WorldWideScience

Sample records for bat tick carios

  1. Experimental infection of the bat tick Carios fonsecai (Acari: Ixodidae with the rabies virus

    Directory of Open Access Journals (Sweden)

    Silvana Regina Favoretto

    2013-12-01

    Full Text Available Introduction This study assessed the viability of the rabies virus in the argasid tick Carios fonsecai following experimental infection. Methods The mouse inoculation test (MIT, fluorescent antibody test (FAT and polymerase chain reaction (PCR were used. The rabies virus was administered to ticks via the intra-coelomic route, and the ticks were sacrificed at different time points. Results The inoculated ticks were negative for rabies according to the MIT. Ticks macerated with rabies virus were positive according to the MIT and FAT. All of the tick lots tested by PCR were positive. Conclusions The rabies virus became unviable shortly after its inoculation into tick bodies. Ticks are not likely to play an important role in the epidemiology of rabies.

  2. The Bat Tick Carios Azteci (Acari: Argasidae) From Belize, With An Endosymbiotic Coxiellaceae

    Science.gov (United States)

    2016-12-01

    forest size on parasite biodiversity : implications for conservation of hosts and parasites. Biodiversity and Conservation 22: 1391–1404. http... Evolution 22: 489–496. http://dx.doi.org/10.1016/j.tree.2007.07.001 Foley, E.H, & Reeves, W.K. 2014. Rickettsia massiliae (Latreille) from the

  3. Borrelia, Rickettsia, and Ehrlichia species in bat ticks, France, 2010.

    Science.gov (United States)

    Socolovschi, Cristina; Kernif, Tahar; Raoult, Didier; Parola, Philippe

    2012-12-01

    Argas vespertilionis, an argasid tick associated with bats and bat habitats in Europe, Africa, and Asia has been reported to bite humans; however, studies investigating the presence of vector-borne pathogens in these ticks are lacking. Using molecular tools, we tested 5 A. vespertilionis ticks collected in 2010 from the floor of a bat-infested attic in southwestern France that had been converted into bedrooms. Rickettsia sp. AvBat, a new genotype of spotted fever group rickettsiae, was detected and cultivated from 3 of the 5 ticks. A new species of the Ehrlichia canis group, Ehrlichia sp. AvBat, was also detected in 3 ticks. Four ticks were infected with Borrelia sp. CPB1, a relapsing fever agent of the Borrelia group that caused fatal borreliosis in a bat in the United Kingdom. Further studies are needed to characterize these new agents and determine if the A. vespertilionis tick is a vector and/or reservoir of these agents.

  4. Ticks infesting bats (Mammalia: Chiroptera) in the Brazilian Pantanal.

    Science.gov (United States)

    Muñoz-Leal, Sebastián; Eriksson, Alan; Santos, Carolina Ferreira; Fischer, Erich; de Almeida, Juliana Cardoso; Luz, Hermes R; Labruna, Marcelo B

    2016-05-01

    Ticks associated with bats have been poorly documented in the Neotropical Zoogeographical Region. In this study, a total of 1028 bats were sampled for tick infestations in the southern portion of the Brazilian Pantanal. A total of 368 ticks, morphologically identified as Ornithodoros hasei (n = 364) and O. mimon (n = 4), were collected from the following bat species: Artibeus planirostris, Platyrrhinus lineatus, Phyllostomus hastatus, Mimon crenulatum and Noctilio albiventris. Morphological identification of O. hasei was confirmed by molecular analysis. Regarding the most abundant bat species, only 40 (6.2%) out of 650 A. planirostris were infested by O. hasei, with a mean intensity of 7.2 ticks per infested bat, or a mean abundance of 0.44 ticks per sampled bat. Noteworthy, one single P. hastatus was infested by 55 O. hasei larvae, in contrast to the 2.5-7.2 range of mean intensity values for the whole study. As a complement to the present study, a total of 8 museum bat specimens (6 Noctilio albiventris and 2 N. leporinus), collected in the northern region of Pantanal, were examined for tick infestations. These bats contained 176 ticks, which were all morphologically identified as O. hasei larvae. Mean intensity of infestation was 22, with a range of 1-46 ticks per infested bat. Our results suggest that A. planirostris might play an important role in the natural life cycle of O. hasei in the Pantanal.

  5. Ticks parasitizing bats (Mammalia: Chiroptera in the Caatinga Biome, Brazil

    Directory of Open Access Journals (Sweden)

    Hermes Ribeiro Luz

    Full Text Available Abstract In this paper, the authors report ticks parasitizing bats from the Serra das Almas Natural Reserve (RPPN located in the municipality of Crateús, state of Ceará, in the semiarid Caatinga biome of northeastern Brazil. The study was carried out during nine nights in the dry season (July 2012 and 10 nights in the rainy season (February 2013. Only bats of the Phyllostomidae and Mormoopidae families were parasitized by ticks. The species Artibeus planirostris and Carolia perspicillata were the most parasitized. A total of 409 larvae were collected and classified into three genera: Antricola (n = 1, Nothoaspis (n = 1 and Ornithodoros (n = 407. Four species were morphologically identified as Nothoaspis amazoniensis, Ornithodoros cavernicolous, Ornithodoros fonsecai, Ornithodoros hasei, and Ornithodoros marinkellei. Ornithodoros hasei was the most common tick associated with bats in the current study. The present study expand the distributional ranges of at least three soft ticks into the Caatinga biome, and highlight an unexpected richness of argasid ticks inhabiting this arid ecosystem.

  6. Ticks parasitizing bats (Mammalia: Chiroptera) in the Caatinga Biome, Brazil.

    Science.gov (United States)

    Luz, Hermes Ribeiro; Muñoz-Leal, Sebastián; Almeida, Juliana Cardoso de; Faccini, João Luiz Horacio; Labruna, Marcelo Bahia

    2016-01-01

    In this paper, the authors report ticks parasitizing bats from the Serra das Almas Natural Reserve (RPPN) located in the municipality of Crateús, state of Ceará, in the semiarid Caatinga biome of northeastern Brazil. The study was carried out during nine nights in the dry season (July 2012) and 10 nights in the rainy season (February 2013). Only bats of the Phyllostomidae and Mormoopidae families were parasitized by ticks. The species Artibeus planirostris and Carolia perspicillata were the most parasitized. A total of 409 larvae were collected and classified into three genera: Antricola (n = 1), Nothoaspis (n = 1) and Ornithodoros (n = 407). Four species were morphologically identified as Nothoaspis amazoniensis, Ornithodoros cavernicolous, Ornithodoros fonsecai, Ornithodoros hasei, and Ornithodoros marinkellei. Ornithodoros hasei was the most common tick associated with bats in the current study. The present study expand the distributional ranges of at least three soft ticks into the Caatinga biome, and highlight an unexpected richness of argasid ticks inhabiting this arid ecosystem.

  7. DNA of Piroplasms of Ruminants and Dogs in Ixodid Bat Ticks.

    Directory of Open Access Journals (Sweden)

    Sándor Hornok

    Full Text Available In this study 308 ticks (Ixodes ariadnae: 26 larvae, 14 nymphs, five females; I. vespertilionis: 89 larvae, 27 nymphs, eight females; I. simplex: 80 larvae, 50 nymphs, nine females have been collected from 200 individuals of 17 bat species in two countries, Hungary and Romania. After DNA extraction these ticks were molecularly analysed for the presence of piroplasm DNA. In Hungary I. ariadnae was most frequently identified from bat species in the family Vespertilionidae, whereas I. vespertilionis was associated with Rhinolophidae. Ixodes ariadnae was not found in Romania. Four, four and one new bat host species of I. ariadnae, I. vespertilionis and I. simplex were identified, respectively. DNA sequences of piroplasms were detected in 20 bat ticks (15 larvae, four nymphs and one female. I. simplex carried piroplasm DNA sequences significantly more frequently than I. vespertilionis. In I. ariadnae only Babesia vesperuginis DNA was detected, whereas in I. vespertilionis sequences of both B. vesperuginis and B. crassa. From I. simplex the DNA of B. canis, Theileria capreoli, T. orientalis and Theileria sp. OT3 were amplified, as well as a shorter sequence of the zoonotic B. venatorum. Bat ticks are not known to infest dogs or ruminants, i.e. typical hosts and reservoirs of piroplasms molecularly identified in I. vespertilionis and I. simplex. Therefore, DNA sequences of piroplasms detected in these bat ticks most likely originated from the blood of their respective bat hosts. This may indicate either that bats are susceptible to a broader range of piroplasms than previously thought, or at least the DNA of piroplasms may pass through the gut barrier of bats during digestion of relevant arthropod vectors. In light of these findings, the role of bats in the epidemiology of piroplasmoses deserves further investigation.

  8. DNA of Piroplasms of Ruminants and Dogs in Ixodid Bat Ticks.

    Science.gov (United States)

    Hornok, Sándor; Szőke, Krisztina; Kováts, Dávid; Estók, Péter; Görföl, Tamás; Boldogh, Sándor A; Takács, Nóra; Kontschán, Jenő; Földvári, Gábor; Barti, Levente; Corduneanu, Alexandra; Sándor, Attila D

    2016-01-01

    In this study 308 ticks (Ixodes ariadnae: 26 larvae, 14 nymphs, five females; I. vespertilionis: 89 larvae, 27 nymphs, eight females; I. simplex: 80 larvae, 50 nymphs, nine females) have been collected from 200 individuals of 17 bat species in two countries, Hungary and Romania. After DNA extraction these ticks were molecularly analysed for the presence of piroplasm DNA. In Hungary I. ariadnae was most frequently identified from bat species in the family Vespertilionidae, whereas I. vespertilionis was associated with Rhinolophidae. Ixodes ariadnae was not found in Romania. Four, four and one new bat host species of I. ariadnae, I. vespertilionis and I. simplex were identified, respectively. DNA sequences of piroplasms were detected in 20 bat ticks (15 larvae, four nymphs and one female). I. simplex carried piroplasm DNA sequences significantly more frequently than I. vespertilionis. In I. ariadnae only Babesia vesperuginis DNA was detected, whereas in I. vespertilionis sequences of both B. vesperuginis and B. crassa. From I. simplex the DNA of B. canis, Theileria capreoli, T. orientalis and Theileria sp. OT3 were amplified, as well as a shorter sequence of the zoonotic B. venatorum. Bat ticks are not known to infest dogs or ruminants, i.e. typical hosts and reservoirs of piroplasms molecularly identified in I. vespertilionis and I. simplex. Therefore, DNA sequences of piroplasms detected in these bat ticks most likely originated from the blood of their respective bat hosts. This may indicate either that bats are susceptible to a broader range of piroplasms than previously thought, or at least the DNA of piroplasms may pass through the gut barrier of bats during digestion of relevant arthropod vectors. In light of these findings, the role of bats in the epidemiology of piroplasmoses deserves further investigation.

  9. Description of a new tick species, Ixodes collaris n. sp. (Acari: Ixodidae), from bats (Chiroptera: Hipposideridae, Rhinolophidae) in Vietnam.

    Science.gov (United States)

    Hornok, Sándor; Görföl, Tamás; Estók, Péter; Tu, Vuong Tan; Kontschán, Jenő

    2016-06-10

    In a recent study on ixodid bat ticks from Eurasia, a high genetic difference was found between Ixodes vespertilionis from Europe and Vietnam. Accordingly, it was proposed that I. vespertilionis is a species complex, with at least one additional, hitherto undescribed species. The aim of the present study was to investigate the morphology of bat ticks from Vietnam and to assess their taxonomic status in comparison with those collected in Europe. Ixodid bat ticks (two females and two nymphs) collected from the pomona leaf-nosed bat (Hipposideros pomona) (Hipposideridae) and intermediate horseshoe bat (Rhinolophus affinis) (Rhinolophidae) in Vietnam showed major morphological differences from European isolates of I. vespertilionis, including the shape of the scutum, the enclosure and shape of porose areas, the presence of a caudo-lateral collar-like ridge ventrally on the basis capituli, polytrich coxae with short setae, and grouped (non-linear) arrangement of anterior pit sensillae in Haller's organ. In this study the female and the nymph of an ixodid bat tick species from Vietnam are described for the first time. The genetic and morphological differences between I. vespertilionis Koch, 1844 and these bat ticks from Vietnam justify the status of the latter as a distinct species, Ixodes collaris Hornok n. sp.

  10. [Taxonomy of the Sokuluk virus (SOKV) (Flaviviridae, Flavivirus, Entebbe bat virus group) isolated from bats (Vespertilio pipistrellus Schreber, 1774), ticks (Argasidae Koch, 1844), and birds in Kyrgyzstan].

    Science.gov (United States)

    L'vov, D K; Al'khovskiĭ, S V; Shchelkanov, M Iu; Shchetinin, A M; Deriabin, P G; Gitel'man, A K; Samokhvalov, E I; Botikov, A G

    2014-01-01

    Complete genome sequencing of the Sokuluk virus (SOKV) isolated in Kyrgyzstan from bats Vespertilio pipistrellus and their obligatory parasites--Argasidae Koch, 1844, ticks was carried out. SOKV was classified as attributed to the Flaviviridae family, Flavivirus genus. The maximum homology (71% for nucleotide and 79% for amino acid sequences) was detected with respect to the Entebbe bat virus (ENTV). ENTV and SOKV form a group joining to the yellow fever virus (YFV) within the limits of the mosquito flavivirus branch. Close relation of SOKV with bat covers and human housings permits to assume SOKV potentially patogenic to human health.

  11. Bat ticks revisited: Ixodes ariadnae sp. nov. and allopatric genotypes of I. vespertilionis in caves of Hungary.

    Science.gov (United States)

    Hornok, Sándor; Kontschán, Jenő; Kováts, Dávid; Kovács, Richárd; Angyal, Dorottya; Görföl, Tamás; Polacsek, Zsolt; Kalmár, Zsuzsa; Mihalca, Andrei D

    2014-04-27

    In Europe two ixodid bat tick species, Ixodes vespertilionis and I. simplex were hitherto known to occur. Bat ticks were collected from cave walls and bats in Hungary. Their morphology and genotypes were compared with microscopy and conventional PCR (followed by sequencing), respectively. A year-round activity of I. vespertilionis was observed. Molecular analysis of the cytochrome oxidase subunit I (COI) gene of twenty ticks from different caves showed that the occurrence of the most common genotype was associated with the caves close to each other. A few specimens of a morphologically different tick variant were also found and their COI analysis revealed only 86-88% sequence homology with I. simplex and I. vespertilionis, respectively. The microenvironment of caves (well separated from each other) appears to support the existence of allopatric I. vespertilionis COI genotypes, most likely related to the distance between caves and to bat migration over-bridging certain caves. The name I. ariadnae sp. nov. is given to the new tick species described here for the first time.

  12. Borrelia, Coxiella, and Rickettsia in Carios capensis (Acari: Argasidae) from a brown pelican (Pelecanus occidentalis) rookery in South Carolina, USA.

    Science.gov (United States)

    Reeves, Will K; Loftis, Amanda D; Sanders, Felicia; Spinks, Mark D; Wills, William; Denison, Amy M; Dasch, Gregory A

    2006-01-01

    Argasid ticks are vectors of viral and bacterial agents of humans and animals. Carios capensis, a tick of seabirds, infests the nests of brown pelicans, Pelecanus occidentalis, and other ground nesting birds along the coast of South Carolina. This tick is associated with pelican nest abandonment and could pose a threat to humans visiting pelican rookeries if visitors are exposed to ticks harboring infectious agents. We collected ticks from a pelican rookery on Deveaux Bank, South Carolina and screened 64 individual ticks, six pools of larvae, and an egg mass for DNA from Bartonella, Borrelia, Coxiella, and Rickettsia by polymerase chain reaction amplification and sequencing. Ticks harbored DNA from "Borrelia lonestari", a novel Coxiella sp., and three species of Rickettsia, including Rickettsia felis and two undescribed Rickettsia spp. DNA from the Coxiella and two undescribed Rickettsia were detected in unfed larvae that emerged in the laboratory, which implies these agents are transmitted vertically by female ticks. We partially characterize the novel Coxiella by molecular means.

  13. Molecular investigations of the bat tick Argas vespertilionis (Ixodida: Argasidae) and Babesia vesperuginis (Apicomplexa: Piroplasmida) reflect "bat connection" between Central Europe and Central Asia.

    Science.gov (United States)

    Hornok, Sándor; Szőke, Krisztina; Görföl, Tamás; Földvári, Gábor; Tu, Vuong Tan; Takács, Nóra; Kontschán, Jenő; Sándor, Attila D; Estók, Péter; Epis, Sara; Boldogh, Sándor; Kováts, Dávid; Wang, Yuanzhi

    2017-05-01

    Argas vespertilionis is a geographically widespread haematophagous ectoparasite species of bats in the Old World, with a suspected role in the transmission of Babesia vesperuginis. The aims of the present study were (1) to molecularly screen A. vespertilionis larvae (collected in Europe, Africa and Asia) for the presence of piroplasms, and (2) to analyze mitochondrial markers of A. vespertilionis larvae from Central Asia (Xinjiang Province, Northwestern China) in a phylogeographical context. Out of the 193 DNA extracts from 321 A. vespertilionis larvae, 12 contained piroplasm DNA (10 from Hungary, two from China). Sequencing showed the exclusive presence of B. vesperuginis, with 100% sequence identity between samples from Hungary and China. In addition, A. vespertilionis cytochrome oxidase c subunit 1 (cox1) and 16S rRNA gene sequences had 99.1-99.2 and 99.5-100% similarities, respectively, between Hungary and China. Accordingly, in the phylogenetic analyses A. vespertilionis from China clustered with haplotypes from Europe, and (with high support) outside the group formed by haplotypes from Southeast Asia. This is the first molecular evidence on the occurrence of B. vesperuginis in Asia. Bat ticks from hosts in Vespertilionidae contained only the DNA of B. vesperuginis (in contrast with what was reported on bat ticks from Rhinolophidae and Miniopteridae). Molecular taxonomic analyses of A. vespertilionis and B. vesperuginis suggest a genetic link of bat parasites between Central Europe and Central Asia, which is epidemiologically relevant in the context of any pathogens associated with bats.

  14. Bats.

    Science.gov (United States)

    Naturescope, 1986

    1986-01-01

    Presents information about bats, including definitions and descriptions of the characteristics of bats. Provides teaching activities such as "Bat and Math,""A Bat Like That,""Bat Party,""Ears in the Dark," and "The Big Bat Mystery." Contains reproducible handouts and quizzes. (TW)

  15. Tick Paralysis

    Science.gov (United States)

    ... Tick Paralysis: Deer tick, dog tick, Rocky Mtn. wood tick, Lone Star tick What is Tick Paralysis? ... Medical Malpractice Center Contact Us Phillip J. Baker, Ph.D., Executive Director, P.O. Box 466, Lyme, ...

  16. Tick bite

    Science.gov (United States)

    ... Images Lyme disease, erythema migrans Lyme disease organism, Borrelia burgdorferi Deer ticks Ticks Tick, deer engorged on the skin Lyme disease - Borrelia burgdorferi organism Tick, deer - adult female Deer and ...

  17. The high genetic variation of viruses of the genus Nairovirus reflects the diversity of their predominant tick hosts

    International Nuclear Information System (INIS)

    Honig, Jessica E.; Osborne, Jane C.; Nichol, Stuart T.

    2004-01-01

    The genus Nairovirus (family Bunyaviridae) contains seven serogroups consisting of 34 predominantly tick-borne viruses, including several associated with severe human and livestock diseases [e.g., Crimean Congo hemorrhagic fever (CCHF) and Nairobi sheep disease (NSD), respectively]. Before this report, no comparative genetic studies or molecular detection assays had been developed for this virus genus. To characterize at least one representative from each of the seven serogroups, reverse transcriptase-polymerase chain reaction (RT-PCR) primers targeting the L polymerase-encoding region of the RNA genome of these viruses were successfully designed based on conserved amino acid motifs present in the predicted catalytic core region. Sequence analysis showed the nairoviruses to be a highly diverse group, exhibiting up to 39.4% and 46.0% nucleotide and amino acid identity differences, respectively. Virus genetic relationships correlated well with serologic groupings and with tick host associations. Hosts of these viruses include both the hard (family Ixodidae) and soft (family Argasidae) ticks. Virus phylogenetic analysis reveals two major monophyletic groups: hard tick and soft tick-vectored viruses. In addition, viruses vectored by Ornithodoros, Carios, and Argas genera ticks also form three separate monophyletic lineages. The striking similarities between tick and nairovirus phylogenies are consistent with possible coevolution of the viruses and their tick hosts. Fossil and phylogenetic data placing the hard tick-soft tick divergence between 120 and 92 million years ago suggest an ancient origin for viruses of the genus Nairovirus

  18. Detection of relapsing fever Borrelia spp., Bartonella spp. and Anaplasmataceae bacteria in argasid ticks in Algeria.

    Directory of Open Access Journals (Sweden)

    Ismail Lafri

    2017-11-01

    Full Text Available Argasid ticks (soft ticks are blood-feeding arthropods that can parasitize rodents, birds, humans, livestock and companion animals. Ticks of the Ornithodoros genus are known to be vectors of relapsing fever borreliosis in humans. In Algeria, little is known about relapsing fever borreliosis and other bacterial pathogens transmitted by argasid ticks.Between May 2013 and October 2015, we investigated the presence of soft ticks in 20 rodent burrows, 10 yellow-legged gull (Larus michahellis nests and animal shelters in six locations in two different bioclimatic zones in Algeria. Six species of argasid ticks were identified morphologically and through 16S rRNA gene sequencing. The presence and prevalence of Borrelia spp., Bartonella spp., Rickettsia spp. and Anaplasmataceae was assessed by qPCR template assays in each specimen. All qPCR-positive samples were confirmed by standard PCR, followed by sequencing the amplified fragments. Two Borrelia species were identified: Borrelia hispanica in Ornithodoros occidentalis in Mostaganem, and Borrelia cf. turicatae in Carios capensis in Algiers. One new Bartonella genotype and one new Anaplasmataceae genotype were also identified in Argas persicus.The present study highlights the presence of relapsing fever borreliosis agents, although this disease is rarely diagnosed in Algeria. Other bacteria of unknown pathogenicity detected in argasid ticks which may bite humans deserve further investigation.

  19. Detection of relapsing fever Borrelia spp., Bartonella spp. and Anaplasmataceae bacteria in argasid ticks in Algeria.

    Science.gov (United States)

    Lafri, Ismail; El Hamzaoui, Basma; Bitam, Idir; Leulmi, Hamza; Lalout, Reda; Mediannikov, Oleg; Chergui, Mohamed; Karakellah, Mohamed; Raoult, Didier; Parola, Philippe

    2017-11-01

    Argasid ticks (soft ticks) are blood-feeding arthropods that can parasitize rodents, birds, humans, livestock and companion animals. Ticks of the Ornithodoros genus are known to be vectors of relapsing fever borreliosis in humans. In Algeria, little is known about relapsing fever borreliosis and other bacterial pathogens transmitted by argasid ticks. Between May 2013 and October 2015, we investigated the presence of soft ticks in 20 rodent burrows, 10 yellow-legged gull (Larus michahellis) nests and animal shelters in six locations in two different bioclimatic zones in Algeria. Six species of argasid ticks were identified morphologically and through 16S rRNA gene sequencing. The presence and prevalence of Borrelia spp., Bartonella spp., Rickettsia spp. and Anaplasmataceae was assessed by qPCR template assays in each specimen. All qPCR-positive samples were confirmed by standard PCR, followed by sequencing the amplified fragments. Two Borrelia species were identified: Borrelia hispanica in Ornithodoros occidentalis in Mostaganem, and Borrelia cf. turicatae in Carios capensis in Algiers. One new Bartonella genotype and one new Anaplasmataceae genotype were also identified in Argas persicus. The present study highlights the presence of relapsing fever borreliosis agents, although this disease is rarely diagnosed in Algeria. Other bacteria of unknown pathogenicity detected in argasid ticks which may bite humans deserve further investigation.

  20. Pesky Ticks

    Centers for Disease Control (CDC) Podcasts

    2013-04-09

    In this podcast for kids, the Kidtastics talk about the dangers of ticks and how to protect yourself from them.  Created: 4/9/2013 by Centers for Disease Control and Prevention (CDC).   Date Released: 4/9/2013.

  1. Bat Bonanza

    Science.gov (United States)

    Phillips, Amanda J.; Scott, Catherine; Matthews, Catherine E.

    2013-01-01

    This article describes a lesson on bats developed for kindergartners, which uses models of bats to teach about their physiology, diet, and habitat. The lesson uses craft sticks, wax paper, and colored construction paper that kindergarten teachers can use to help their students compare the features of 4 different kinds of bats. The use of online…

  2. Breaking Bat

    Science.gov (United States)

    Aguilar, Isaac-Cesar; Kagan, David

    2013-01-01

    The sight of a broken bat in Major League Baseball can produce anything from a humorous dribbler in the infield to a frightening pointed projectile headed for the stands. Bats usually break at the weakest point, typically in the handle. Breaking happens because the wood gets bent beyond the breaking point due to the wave sent down the bat created…

  3. Ticks and tick paralysis: imaging findings on cranial MR

    International Nuclear Information System (INIS)

    Burke, Michael S.; Fordham, Lynn Ansley; Hamrick, Harvey J.

    2005-01-01

    Tick paralysis is an acute, progressive, and potentially fatal muscle paralysis secondary to a toxin secreted by a pregnant tick during a bite. Although tick bites can occur anywhere on the body, ticks are frequently overlooked on the scalp because of overlying hair. Children with acute neurologic symptoms frequently undergo MR scanning that may incidentally reveal the offending tick. Timely identification and removal of the tick leads to rapid recovery from tick paralysis. We report the MRI findings at 1.5 T of tick paralysis with an attached tick. (orig.)

  4. Ticks and tick paralysis: imaging findings on cranial MR

    Energy Technology Data Exchange (ETDEWEB)

    Burke, Michael S.; Fordham, Lynn Ansley [University of North Carolina Chapel Hill, UNC School of Medicine, Department of Radiology, NC (United States); Hamrick, Harvey J. [University of North Carolina Hospitals, Department of Pediatrics, Chapel Hill (United States)

    2005-02-01

    Tick paralysis is an acute, progressive, and potentially fatal muscle paralysis secondary to a toxin secreted by a pregnant tick during a bite. Although tick bites can occur anywhere on the body, ticks are frequently overlooked on the scalp because of overlying hair. Children with acute neurologic symptoms frequently undergo MR scanning that may incidentally reveal the offending tick. Timely identification and removal of the tick leads to rapid recovery from tick paralysis. We report the MRI findings at 1.5 T of tick paralysis with an attached tick. (orig.)

  5. Preventing Ticks on Your Pets

    Science.gov (United States)

    ... Fipronil Pyrethroids (permethrin, etc.) Amitraz Repel Ticks on Dogs A repellent product may prevent the tick from coming into contact with an animal at all or have anti-feeding effects once the tick comes into contact with ...

  6. Bat consumption in Thailand

    Directory of Open Access Journals (Sweden)

    Kanokwan Suwannarong

    2016-01-01

    Full Text Available Background: Human consumption of bats poses an increasing public health threat globally. Communities in which bat guano is mined from caves have extensive exposure to bat excreta, often harvest bats for consumption, and are at risk for bat-borne diseases. Methods: This rapid ethnographic study was conducted in four provinces of Thailand (Ratchaburi, Sakaeo, Nakorn Sawan, and Phitsanulok, where bat guano was mined and sold during the period April–August 2014. The aim of this study was to understand behaviors and risk perceptions associated with bat conservation, exposure to bats and their excreta, and bat consumption. Sixty-seven respondents playing various roles in bat guano mining, packaging, sale, and use as fertilizer participated in the study. Data were collected through interviews and/or focus group discussions. Results: In spite of a bat conservation program dating back to the 1980s, the benefits of conserving bats and the risks associated with bat consumption were not clear and infrequently articulated by study respondents. Discussion: Since bat consumption continues, albeit covertly, the risk of bat-borne diseases remains high. There is an opportunity to reduce the risk of bat-borne diseases in guano-mining communities by strengthening bat conservation efforts and raising awareness of the health risks of bat consumption. Further research is suggested to test behavior change strategies for reducing bat consumption.

  7. Bat consumption in Thailand.

    Science.gov (United States)

    Suwannarong, Kanokwan; Schuler, Sidney

    2016-01-01

    Human consumption of bats poses an increasing public health threat globally. Communities in which bat guano is mined from caves have extensive exposure to bat excreta, often harvest bats for consumption, and are at risk for bat-borne diseases. This rapid ethnographic study was conducted in four provinces of Thailand (Ratchaburi, Sakaeo, Nakorn Sawan, and Phitsanulok), where bat guano was mined and sold during the period April-August 2014. The aim of this study was to understand behaviors and risk perceptions associated with bat conservation, exposure to bats and their excreta, and bat consumption. Sixty-seven respondents playing various roles in bat guano mining, packaging, sale, and use as fertilizer participated in the study. Data were collected through interviews and/or focus group discussions. In spite of a bat conservation program dating back to the 1980s, the benefits of conserving bats and the risks associated with bat consumption were not clear and infrequently articulated by study respondents. Since bat consumption continues, albeit covertly, the risk of bat-borne diseases remains high. There is an opportunity to reduce the risk of bat-borne diseases in guano-mining communities by strengthening bat conservation efforts and raising awareness of the health risks of bat consumption. Further research is suggested to test behavior change strategies for reducing bat consumption.

  8. Rickettsia hoogstraalii sp. nov., isolated from hard- and soft-bodied ticks.

    Science.gov (United States)

    Duh, Darja; Punda-Polic, Volga; Avsic-Zupanc, Tatjana; Bouyer, Donald; Walker, David H; Popov, Vsevolod L; Jelovsek, Mateja; Gracner, Maja; Trilar, Tomi; Bradaric, Nikola; Kurtti, Timothy J; Strus, Jasna

    2010-04-01

    A novel spotted fever group Rickettsia was found in Haemaphysalis sulcata ticks collected from sheep and goats in Croatia in 2006. At the same time, a genetically identical organism was co-isolated with the embryonic cell line CCE3 obtained from the soft tick Carios capensis in Georgia, USA. In this study, further phenotypic and genotypic characteristics of the novel rickettsial strain present in H. sulcata ticks were investigated. Based on the cultivation of bacteria in mosquito and Vero cell cultures, the presence of rickettsiae in tick tissues and cell cultures [confirmed by transmission electron microscopy (TEM)] and the amplification and sequencing of five rickettsial genes, it was demonstrated that the novel Rickettsia strain fulfils the criteria to be classified as a novel species. The name Rickettsia hoogstraalii sp. nov. is proposed for the new strain. Rickettsia hoogstraalii sp. nov., an obligately intracellular bacterium, was grown in Vero cells and arthropod CCE3, ISE6 and C6/36 cell lines. The morphology of the cells of the novel species was typical of SFG rickettsiae. The small coccobacillary appearance of the bacteria was apparent with light microscopy. A Gram-negative bacterial cell wall and a cytoplasmic membrane separated by a narrow periplasmic space were visible by TEM. To date, Rickettsia hoogstraalii sp. nov. has been isolated from two species of ticks, H. sulcata and C. capensis. The novel species appears to be geographically widely distributed, having been detected in Croatia, Spain and Georgia, USA. Although no information is available regarding the possible pathogenicity of the novel species for vertebrate hosts, R. hoogstraalii sp. nov. has a cytopathic effect in Vero, CCE3 and ISE6 cells. Sequence analyses of the 16S rRNA, 17 kDa, gltA, ompA and ompB genes indicated that even though R. hoogstraalii sp. nov. was closely related to Rickettsia felis, it represents a separate species within the spotted fever group. The type strain of R

  9. Maternal care in the soft tick Antricola marginatus.

    Science.gov (United States)

    Labruna, M B; Nava, S; Guzmán-Cornejo, C; Venzal, J M

    2012-08-01

    Among spiders, scorpions, and whip spiders, a common type of maternal care consists of females carrying newly hatched offspring on their body for a few days until they are able to live independently. While this maternal care has been suggested to occur in different argasid tick species, it has been recorded only once, for Antricola marginatus in Cuba; however, this earlier record only superficially mentioned the occurrence of this behavior, with no further details. Here we report the occurrence of maternal care in the argasid tick A. marginatus under natural conditions in a cave at Yucatan, Mexico, where 8 A. marginatus females, while walking on bat guano, had their body entirely covered by a mean number of 305 ± 112 conspecific unfed larvae (range: 105-466). Larvae covered the entire idiosoma of the female tick, where they were motionless or displayed just slight movement. This result substantially expands the number of unique characters that have been found only in Antricola spp. ticks, when compared to the other tick genera. Our findings also indicate that maternal care evolved independently in different taxa of Arachnida, since it has been reported for species of Araneae, Scorpiones, and Amblypygi, and here for an Acari species.

  10. [Protection against tick bites].

    Science.gov (United States)

    Boulanger, N; Lipsker, Dan

    2015-04-01

    There are numerous tick-borne infections, which include viral (TBE), parasitic (babesiosis) and bacterial diseases. Lyme disease (Lyme borreliosis) is the most common tick-borne disease in France. In temperate climates such as in France, ticks bite humans between March and October. Prevention relies on adequate clothing and on repellents. The latter are reviewed in this work. Repellents may be natural, made from eucalyptus, tomato and coconut, or synthetic, among which the most widely used is DEET (N,N,-Diethyl-m-toluamide). Newer, synthetic repellents exist such as IR3535 which, as well as being less toxic, also exhibits greater efficacy against ticks. Some repellents are used on the skin, while others, like permethrin, which is actually an insecticide, may be applied to clothing. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  11. [Tick borne diseases].

    Science.gov (United States)

    Holzer, B R

    2005-11-01

    It is known for many years that tick-borne diseases have worldwide a high economical impact on farming industry and veterinary medicine. But only in the last twenty years the importance of such diseases were notified in human medicine by the medical community and the public with emerging of the tick borne encephalitis virus and the description of Borrelia burgdorferi. It is often forgotten that many other infectious agents as bacteria, virus, Rickettsia or protozoa can be transmitted by ticks. Such diseases are rarely diagnosed in Europe either they are overlooked and misdiagnosed or they are connected with special professional activities. The development of new regions for tourism with different out door activities (adventure trips, trekking, hunting) leads to an exposure to different tick borne diseases, which are often misdiagnosed.

  12. Vaccination against ticks and the control of ticks and tick-borne disease

    International Nuclear Information System (INIS)

    Willadsen, P.

    2005-01-01

    Economic losses due to ticks and tick-borne disease of livestock fall disproportionately on developing countries. Currently, tick control relies mostly on pesticides and parasite-resistant cattle. Release of a commercial recombinant vaccine against Boophilus microplus in Australia in 1994 showed that anti-tick vaccines are a feasible alternative. For vaccines, it is important to understand the efficacy needed for a beneficial outcome. In this, it is relevant that some tick antigens affect multiple tick species; that existing vaccines could be improved by the inclusion of additional tick antigens; and that vaccination against ticks can have an impact on tick-borne disease. Practically, although recombinant vaccine manufacture involves relatively few steps, issues of intellectual property rights (IPR) and requirements for registration of a product may affect economic viability of manufacture. Hence practical vaccines for the developing world will require both successful science and a creative 'business solution' for delivery in a cost-effective way. (author)

  13. Ticks (Ixodidae) and other ectoparasites in Ulu Muda Forest Reserve, Kedah, Malaysia.

    Science.gov (United States)

    Mariana, A; Zuraidawati, Z; Ho, T M; Kulaimi, B Mohd; Saleh, I; Shukor, M N; Shahrul-Anuar, M S

    2008-05-01

    A survey of ticks and other ectoparasites was carried out during a national biodiversity scientific expedition at Ulu Muda Forest Reserve, Kedah, Malaysia from 23-29 March 2003. A total of 161 animals comprising 20 species of birds, 16 species of bats, six species of non-volant small mammals and 12 species of reptiles were examined for ticks and other ectoparasites. From these animals, nine species in five genera of ticks, 10 species in two families of Mesostigmatid mites and five species of chiggers were collected. Three of the ectoparasitic species found, Dermacentor auratus, Ixodes granulatus and Leptotrombidium deliense are of known public health importance. This survey produced the first list of ticks and other ectoparasites in the forest reserve and the third study of ectoparasites in Kedah. Fourteen species of these ectoparasites are new locality records.

  14. Tick Talk: Block Tick Bites and Lyme Disease

    Science.gov (United States)

    ... of tick-borne diseases. Use fine-tipped tweezers. Grab the tick close to the skin and gently ... D. Illustrator: Alan Defibaugh Attention Editors: Reprint our articles and illustrations in your own publication. Our material ...

  15. Developing Anti-tick Vaccines.

    Science.gov (United States)

    Rodríguez-Mallon, Alina

    2016-01-01

    Ticks are responsible for the transmission of viral, bacterial, and protozoal diseases of man and animals and also produce significant economic losses to cattle industry. The use of acaricides constitutes a major component of integrated tick control strategies. However, this is accompanied by the selection of acaricide-resistant ticks and contamination of environment and milk and meat products with drug residues. These issues highlight the need for alternative approaches to control tick infestations and have triggered the search for tick protective antigens for vaccine development. Vaccination as a tick control method has been practiced since the introduction of TickGARD and Gavac that were developed using the midgut glycoprotein Bm86 as antigen. Gavac within integrated tick management systems has proven to reduce the number of acaricidal applications per year that are required to control some strains of R. microplus ticks in different geographical regions. Nevertheless, it has limited or no efficacy against other tick species. These issues have stimulated research for additional tick protective antigens with critical functions in the tick. This chapter presents methodologies for the design and test of molecules as antigens against ticks. Considerations about different methods for the tick control compared to the immunological methods, the desirable characteristics for an anti-tick vaccine and the obstacles encountered for developing this kind of vaccines are discussed. Detailed methodologies for the establishment of a biological model to test new molecules as immunogens against ticks and to perform challenge trials with this model are presented. General considerations in the efficacy calculation for any anti-tick vaccine are also discussed.

  16. Molecular biology of tick acetylcholinesterases.

    Science.gov (United States)

    Temeyer, Kevin Bruce

    2018-01-01

    Ticks vector many pathogens with major health and economic impacts and have developed resistance to most acaricides used for tick control. Organophosphate (OP) acaricides target acetylcholinesterase (AChE) critical to tick central nervous system function. Mutations producing tick AChEs resistant to OPs were characterized; but tick OP-resistance is not fully elucidated, due to remarkable complexity of tick cholinergic systems. Three paralogous tick AChEs exhibiting differences in primary structure and biochemical kinetics are encoded by amplified genes with developmentally regulated expression. Gene silencing data suggest tick AChEs are functional complements in vivo, and transcriptomic and genomic data suggest existence of additional tick AChEs. Cholinergic systems are crucial in neural transmission and are also regulators of vertebrate immune function. Ticks exhibit prolonged intimate host contact, suggesting adaptive functions for tick cholinergic system complexity. AChE was recently reported in tick saliva and a role in manipulation of host immune responses was hypothesized. Physiological roles and genetic control of multiple tick AChEs requires further elucidation and may provide unique opportunities to understand and manipulate cholinergic involvement in biological systems.

  17. Approaches towards tick and tick-borne diseases control

    Directory of Open Access Journals (Sweden)

    Ana Domingos

    2013-04-01

    Full Text Available Ticks are obligate haematophagous ectoparasites of wild and domestic animals as well as humans, considered to be second worldwide to mosquitoes as vectors of human diseases. Tick-borne diseases are responsible worldwide for great economic losses in terms of mortality and morbidity of livestock animals. This review concerns to the different tick and tick-parasites control methods having a major focus on vaccines. Control of tick infestations has been mainly based on the use of acaricides, a control measure with serious drawbacks, as responsible for the contamination of milk and meat products, as a selective factor for acaricide-resistant ticks and as an environmental contaminant. Research on alternatives to the use of acaricides is strongly represented by tick vaccines considered a more cost-effective and environmentally safe strategy. Vaccines based on the Bm86 tick antigen were used in the first commercially available cattle tick vaccines and showed good results in reducing tick numbers, affecting weight and reproductive performance of female ticks which resulted in reduction of cattle tick populations over time and consequently lower reduction of the pathogen agents they carry.

  18. Tick-Borne Relapsing Fever

    Science.gov (United States)

    ... remove an attached tick, use fine tweezers to grab the tick firmly by the head (or as ... 15, 2005) Last Updated: May 1, 2014 This article was contributed by: familydoctor.org editorial staff Categories: ...

  19. Tips to Prevent Tick Bites

    Science.gov (United States)

    Using the right insect repellent and other preventive actions can discourage ticks, mosquitoes, and other biting insects from landing on you. Tips include avoiding tick habitats and minimizing exposed skin.

  20. It's Open Season on Ticks

    Science.gov (United States)

    It’s Open Season on Ticks Protect yourself from tickborne disease this hunting season Ticks feed on the blood of animals (such as rodents, rabbits, deer, and birds), but will bite humans too. Ticks live in grassy or wooded areas, or on the animals themselves. Hunting brings you ...

  1. Cloud Model Bat Algorithm

    OpenAIRE

    Yongquan Zhou; Jian Xie; Liangliang Li; Mingzhi Ma

    2014-01-01

    Bat algorithm (BA) is a novel stochastic global optimization algorithm. Cloud model is an effective tool in transforming between qualitative concepts and their quantitative representation. Based on the bat echolocation mechanism and excellent characteristics of cloud model on uncertainty knowledge representation, a new cloud model bat algorithm (CBA) is proposed. This paper focuses on remodeling echolocation model based on living and preying characteristics of bats, utilizing the transformati...

  2. Tick Talk: Tick-borne Diseases of South Dakota.

    Science.gov (United States)

    Huntington, Mark K; Allison, Jay

    2017-09-01

    In addition to being a nuisance, ticks can carry disease. This article presents a brief review of ticks and associated tick-borne disease relevant to South Dakota and surrounding regions. Tick-borne diseases of special relevance in South Dakota include tularemia, Rocky Mountain spotted fever, and Lyme disease. A number of others may also be encountered in the state as well. Prompt treatment of suspected cases is important to ensure a successful recovery, and tick-avoidance measures can reduce the risks of acquiring them. Most of these conditions are nationally reportable infectious diseases. Copyright© South Dakota State Medical Association.

  3. Pigeon tick bite

    DEFF Research Database (Denmark)

    Rolla, G; Heffler, E; Boita, M

    2018-01-01

    Anaphylaxis is a serious systemic allergic reaction with rapid onset and potentially life-threatening. We report in detail a case of severe nocturnal anaphylaxis due to pigeon tick bite showing the diagnostic value of the extract and the recombinant allergen in the diagnostic procedures (basophil...... reagents. Because of the growing number of pigeons in Middle and Southern Europe cities, some cases of idiopathic anaphylaxis could potentially be caused by A. reflexus in those countries. The identification of pigeon ticks as a trigger of anaphylaxis would greatly improve medical care and advice...

  4. Cloud model bat algorithm.

    Science.gov (United States)

    Zhou, Yongquan; Xie, Jian; Li, Liangliang; Ma, Mingzhi

    2014-01-01

    Bat algorithm (BA) is a novel stochastic global optimization algorithm. Cloud model is an effective tool in transforming between qualitative concepts and their quantitative representation. Based on the bat echolocation mechanism and excellent characteristics of cloud model on uncertainty knowledge representation, a new cloud model bat algorithm (CBA) is proposed. This paper focuses on remodeling echolocation model based on living and preying characteristics of bats, utilizing the transformation theory of cloud model to depict the qualitative concept: "bats approach their prey." Furthermore, Lévy flight mode and population information communication mechanism of bats are introduced to balance the advantage between exploration and exploitation. The simulation results show that the cloud model bat algorithm has good performance on functions optimization.

  5. Cloud Model Bat Algorithm

    Directory of Open Access Journals (Sweden)

    Yongquan Zhou

    2014-01-01

    Full Text Available Bat algorithm (BA is a novel stochastic global optimization algorithm. Cloud model is an effective tool in transforming between qualitative concepts and their quantitative representation. Based on the bat echolocation mechanism and excellent characteristics of cloud model on uncertainty knowledge representation, a new cloud model bat algorithm (CBA is proposed. This paper focuses on remodeling echolocation model based on living and preying characteristics of bats, utilizing the transformation theory of cloud model to depict the qualitative concept: “bats approach their prey.” Furthermore, Lévy flight mode and population information communication mechanism of bats are introduced to balance the advantage between exploration and exploitation. The simulation results show that the cloud model bat algorithm has good performance on functions optimization.

  6. Tick Innate Immunity.

    Czech Academy of Sciences Publication Activity Database

    Kopáček, Petr; Hajdušek, Ondřej; Burešová, Veronika; Daffre, S.

    2010-01-01

    Roč. 708, - (2010), 137-162 ISSN 0065-2598 R&D Projects: GA ČR GAP506/10/2136; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : tick * pathogen transmission * innate immunity Subject RIV: EC - Immunology Impact factor: 1.379, year: 2010

  7. Are ticks venomous animals?

    Czech Academy of Sciences Publication Activity Database

    Cabezas-Cruz, A.; Valdés, James J.

    2014-01-01

    Roč. 11, JUL 2014 (2014), s. 47 ISSN 1742-9994 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : ticks * venom * secreted proteins * toxicoses * pathogens * convergence Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.051, year: 2014

  8. More Trouble from Ticks

    Centers for Disease Control (CDC) Podcasts

    2011-08-18

    Dr. Chris Paddock, a rickettsiologist and infectious disease pathologist discusses a tick-transmitted bacterium, Rickettsia parkeri.  Created: 8/18/2011 by National Center for Emerging Zoonotic and Infectious Diseases (NCEZID).   Date Released: 8/18/2011.

  9. African tick bite fever

    DEFF Research Database (Denmark)

    Johansen, Jakob Aaquist; Thybo, Søren

    2011-01-01

    The incident of spotted fever imported to Denmark is unknown. We present a classic case of African Tick Bite Fever (ATBF) to highlight a disease, which frequently infects wildlife enthusiasts and hunters on vacation in South Africa. ATBF has a good prognosis and is easily treated with doxycyclin...

  10. House bat management

    Science.gov (United States)

    Greenhall, Arthur M.

    1982-01-01

    The soundest long-term solution for the management of bats that enter buildings and cause a nuisance problem or present a public health hazard is by batproofing the structure. Chemical toxicants do not solve house bat problems and may create worse ones. This manual describes batproofing techniques that will provide effective and acceptable alternatives for dealing with house bat problems and hazards. Recent declines in bat populations and greater appreciation of the ecological importance of bats have identified the need for sound management strategies that will encourage bat conservation while protecting human health and solving nuisance problems. One of the best deterrents against house bats is to improve the energy efficiency of the structure since bats may enter holes through which heat is lost. Heat conservation methods used for batproofing will also be eligible for Federal residential energy tax credits. The manual should be useful to homeowners, public health officials, physicians, veterinarians, conservationists, and others interested or concerned about bat interactions with humans.

  11. Tick-borne encephalitis.

    Science.gov (United States)

    Dumpis, U; Crook, D; Oksi, J

    1999-04-01

    Tick-borne encephalitis (TBE) is a zoonotic arbovirus infection endemic to Russia and Eastern and Central Europe. Despite being a common and serious life-threatening disease for which a mass vaccination program was implemented in Austria, there is only limited reference to this disease in the English-language literature. TBE is transmitted to humans usually by the bite of a tick (either Ixodes persulcatus or Ixodes ricinus); occasionally, cases occur following consumption of infected unpasteurized milk. Transmission is seasonal and occurs in spring and summer, particularly in rural areas favored by the vector. TBE is a serious cause of acute central nervous system disease, which may result in death or long-term neurological sequelae. Effective vaccines are available in a few countries. The risk for travelers of acquiring TBE is increasing with the recent rise in tourism to areas of endemicity during spring and summer.

  12. Host specificity in bat ectoparasites: a natural experiment.

    Science.gov (United States)

    Seneviratne, Sampath S; Fernando, H Chandrika; Udagama-Randeniya, Preethi V

    2009-07-15

    We undertook a field study to determine patterns of specialisation of ectoparasites in cave-dwelling bats in Sri Lanka. The hypothesis tested was that strict host specificity (monoxeny) could evolve through the development of differential species preferences through association with the different host groups. Three species of cave-dwelling bats were chosen to represent a wide range of host-parasite associations (monoxeny to polyxeny), and both sympatric and allopatric roosting assemblages. Of the eight caves selected, six caves were "allopatric" roosts where two of each housed only one of the three host species examined: Rousettus leschenaulti (Pteropodidae), Rhinolophus rouxi and Hipposideros speoris (Rhinolophidae). The remaining two caves were "sympatric" roosts and housed all three host species. Thirty bats of each species were examined for ectoparasites in each cave, which resulted in a collection of nycteribiid and streblid flies, an ischnopsyllid bat flea, argasid and ixodid ticks, and mites belonging to three families. The host specificity of bat parasites showed a trend to monoxeny in which 70% of the 30 species reported were monoxenous. Odds ratios derived from chi(2)-tests revealed two levels of host preferences in less-specific parasites (i) the parasite was found on two host species under conditions of both host sympatry and host allopatry, with a preference for a single host in the case of host sympatry and (ii) the preference for a single host was very high, hence under conditions of host sympatry, it was confined to the preferred host only. However, under conditions of host allopatry, it utilized both hosts. There appears to be an increasing prevalence in host preferences of the parasites toward confinement to a single host species. The ecological isolation of the bat hosts and a long history of host-parasite co-existence could have contributed to an overall tendency of bat ectoparasites to become specialists, here reflected in the high percentage

  13. Bat Predation by Spiders

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

  14. Patterns of Abundance and Host Specificity of Bat Ectoparasites in the Central Balkans.

    Science.gov (United States)

    Burazerovic, J; Orlova, M; Obradovic, M; Cirovic, D; Tomanovic, S

    2018-01-10

    Bats are hosts to a number of ectoparasites-acarines (ticks, chiggers, other mites), bat flies, and fleas. Bat ectoparasites might have significant ecological and public health importance as they may be potential vectors of zoonotic agents. It is important to identify their distribution, diversity, and host-parasite associations. Bat ectoparasites in the central Balkans have been largely understudied. The present research was conducted in 45 localities at the territory of Bosnia and Herzegovina, former Yugoslav Republic of Macedonia, Montenegro, and Serbia. In total, 1,143 individuals of 18 species of bats have been examined for the presence and abundance of ectoparasite species during 3 yr of research. In total, 21 ectoparasite species have been identified: three species of ticks, seven species of mites (including one species of chigger), eight species of bat flies, and three species of fleas. In total, 80 host-parasite associations have been identified. The largest number of ectoparasites parasitized primarily only one host species. The highest total number of hosts was identified for ectoparasite species Ixodes vespertilionis Koch, Nycteribia schmidlii Schiner, and Spinturnix myoti Kolenati. The spinturnicid mite Spinturnix psi Kolenati was the most abundant ectoparasite species and together with Penicilidia dufouri Westwood the most widely distributed species of bat ectoparasite, being present at 21 localities in the central Balkans. The presented data include the first systematic records of patterns of prevalence, mean intensity, mean abundance, and host specificity for bat ectoparasites in the central Balkans. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  15. Tick proteins in Borrelia transmission and tick feeding: t(r)ick or treat?

    NARCIS (Netherlands)

    Schuijt, T.J.

    2011-01-01

    The data described in this thesis contribute to the understanding of the role of tick proteins in tick feeding and transmission of Borrelia. Targeting tick proteins that play a crucial role in tick feeding and/or Borrelia transmission are interesting candidates for anti-tick vaccines to prevent Lyme

  16. Bats and SARS

    Centers for Disease Control (CDC) Podcasts

    2006-11-08

    Bats are a natural reservoir for emerging viruses, among them henipaviruses and rabies virus variants. Dr. Nina Marano, Chief, Geographic Medicine and Health Promotion Branch, Division of Global Migration and Quarantine, CDC, explains connection between horseshoe bats and SARS coronavirus transmission.  Created: 11/8/2006 by Emerging Infectious Diseases.   Date Released: 11/17/2006.

  17. A Tick on the Move?

    Centers for Disease Control (CDC) Podcasts

    2016-08-04

    CDC’s tick expert, Dr. Christopher Paddock, discusses ticks found in a new location.  Created: 8/4/2016 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 8/4/2016.

  18. Rhipicephulus sanguineus (Brown Dog Tick)

    African Journals Online (AJOL)

    Leishmania infantimi the etiological agent of visceral leishmaniasis (Coutinho er £11., 2005). The role of R. sangau'ne:is ticks in the transmission of pathogens to humans has been documented (Palmas eraf, 2001 ). Additionally,. R. sanguineus ticks are vectors 01" Rf(fJl'.€H.S'tfl rickerrs:':'. the etiological agent of Rocky.

  19. Bats as bushmeat in Madagascar

    African Journals Online (AJOL)

    Richard K. B. Jenkins and Paul A. Racey

    2008-12-01

    Dec 1, 2008 ... preferred, small insectivorous bats are also eaten. The national hunting season for bats is widely ignored and both unsuitable hunting practices and high offtake represent a serious threat to bat populations in some areas. Bat bushmeat may be an important source of protein for Malagasy people during ...

  20. Transport of Ixodid ticks and tick-borne pathogens by migratory birds.

    Directory of Open Access Journals (Sweden)

    Gunnar eHasle

    2013-09-01

    Full Text Available Birds, particularly passerines, can be parasitized by Ixodid ticks, which may be infected with tick-borne pathogens, like Borrelia spp., Babesia spp., Anaplasma, Rickettsia/Coxiella, and tick-borne encephalitis virus. The prevalence of ticks on birds varies over years, season, locality and different bird species. The prevalence of ticks on different species depends mainly on the degree of feeding on the ground. In Europe, the Turdus spp., especially the blackbird, Turdus merula, appears to be most important for harboring ticks. Birds can easily cross barriers, like fences, mountains, glaciers, desserts and oceans, which would stop mammals, and they can move much faster than the wingless hosts. Birds can potentially transport tick-borne pathogens by transporting infected ticks, by being infected with tick-borne pathogens and transmit the pathogens to the ticks, and possibly act as hosts for transfer of pathogens between ticks through co-feeding. Knowledge of the bird migration routes and of the spatial distribution of tick species and tick-borne pathogens is crucial for understanding the possible impact of birds as spreaders of ticks and tick-borne pathogens. Successful colonization of new tick species or introduction of new tick-borne pathogens will depend on suitable climate, vegetation and hosts. Although it has never been demonstrated that a new tick species, or a new tick pathogen, actually has been established in a new locality after being seeded there by birds, evidence strongly suggests that this could occur.

  1. Serine Protease Inhibitors in Ticks: An Overview of Their Role in Tick Biology and Tick-Borne Pathogen Transmission

    Directory of Open Access Journals (Sweden)

    Adrien A. Blisnick

    2017-05-01

    Full Text Available New tick and tick-borne pathogen control approaches that are both environmentally sustainable and which provide broad protection are urgently needed. Their development, however, will rely on a greater understanding of tick biology, tick-pathogen, and tick-host interactions. The recent advances in new generation technologies to study genomes, transcriptomes, and proteomes has resulted in a plethora of tick biomacromolecular studies. Among these, many enzyme inhibitors have been described, notably serine protease inhibitors (SPIs, whose importance in various tick biological processes is only just beginning to be fully appreciated. Among the multiple active substances secreted during tick feeding, SPIs have been shown to be directly involved in regulation of inflammation, blood clotting, wound healing, vasoconstriction and the modulation of host defense mechanisms. In light of these activities, several SPIs were examined and were experimentally confirmed to facilitate tick pathogen transmission. In addition, to prevent coagulation of the ingested blood meal within the tick alimentary canal, SPIs are also involved in blood digestion and nutrient extraction from the meal. The presence of SPIs in tick hemocytes and their involvement in tick innate immune defenses have also been demonstrated, as well as their implication in hemolymph coagulation and egg development. Considering the involvement of SPIs in multiple crucial aspects of tick-host-pathogen interactions, as well as in various aspects of the tick parasitic lifestyle, these molecules represent highly suitable and attractive targets for the development of effective tick control strategies. Here we review the current knowledge regarding this class of inhibitors in tick biology and tick-borne pathogen transmission, and their potential as targets for future tick control trials.

  2. The bats of Suriname

    NARCIS (Netherlands)

    Husson, A.M.

    1962-01-01

    CONTENTS I. Introduction.................. 3 A. Scope of the present paper............. 3 B. Measurements................ 7 C. Nomenclature................ 8 D. Acknowledgements............... 9 II. General Part.................. 10 A. History of the study of Suriname bats.......... 10 B. Remarks on

  3. Indiana Bat (Towns)

    Data.gov (United States)

    Vermont Center for Geographic Information — This dataset includes towns that contain documented hibernacula or summer range occupied by federally endangered Indiana bats. Survey data used to create this...

  4. Bat Influenza (Flu)

    Science.gov (United States)

    ... genetic information. Reassortment can sometimes lead to the emergence of new flu viruses capable of infecting humans. Yellow-shouldered ... important for public health because bats represent a new animal species that may act as a source of flu ...

  5. Entomopathogenic fungi associated with Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Kalsbeek, Vibeke; Frandsen, F.; Steenberg, Tove

    1995-01-01

    The objective of this study was to demonstrate the occurrence of entomopathogenic fungi on Ixodes ricinus ticks in relation to the tick stage, engorgement and season. Ticks were collected from the vegetation, from small rodents and from deer. All entomopathogenic fungi found belonged to the Hypho......The objective of this study was to demonstrate the occurrence of entomopathogenic fungi on Ixodes ricinus ticks in relation to the tick stage, engorgement and season. Ticks were collected from the vegetation, from small rodents and from deer. All entomopathogenic fungi found belonged....... ricinus population, since females were the most frequently infected stage....

  6. Ultrasonic Bat Deterrent Technology

    Energy Technology Data Exchange (ETDEWEB)

    Kinzie, Kevin; Rominger, Kathryn M.

    2017-12-14

    The project objective was to advance the development and testing of an Near commercial bat-deterrent system with a goal to increase the current GE deterrent system effectiveness to over 50% with broad species applicability. Additionally, the research supported by this program has provided insights into bat behavior and ultrasonic deterrent design that had not previously been explored. Prior research and development had demonstrated the effectiveness of a commercial-grade, air-powered, ultrasonic bat deterrent to be between 30-50% depending upon the species of bat. However, the previous research provided limited insight into the behavioral responses of bats in the presence of ultrasonic deterrent sound fields that could be utilized to improve effectiveness. A unique bat flight room was utilized to observe the behavioral characteristics of bats in the presence of ultrasonic sound fields. Behavioral testing in the bat flight facility demonstrated that ultrasonic sounds similar to those produced by the GE deterrent influenced the activities and behaviors, primarily those associated with foraging, of the species exposed. The study also indicated that continuous and pulsing ultrasonic signals had a similar effect on the bats, and confirmed that as ultrasonic sounds attenuate, their influence on the bats’ activities and behavior decreases. Ground testing at Wolf Ridge Wind, LLC and Shawnee National Forest assessed both continuous and pulsing deterrent signals emitted from the GE deterrent system and further enhanced the behavioral understanding of bats in the presence of the deterrent. With these data and observations, the existing 4-nozzle continuous, or steady, emission ultrasonic system was redesigned to a 6-nozzle system that could emit a pulsing signal covering a larger air space around a turbine. Twelve GE 1.6-100 turbines were outfitted with the deterrent system and a formal three-month field study was performed using daily carcass searches beneath the 12

  7. Learning about Bats and Rabies

    Science.gov (United States)

    ... Rabies Day Rabies and Kids! Rabies Learning about bats and rabies Recommend on Facebook Tweet Share Compartir ... areas where they might contact people and pets. Bats and human rabies in the United States Rabies ...

  8. Bat Rabies Surveillance in Europe

    DEFF Research Database (Denmark)

    Schatz, J.; Fooks, A. R.; McElhinney, L.

    2013-01-01

    Rabies is the oldest known zoonotic disease and was also the first recognized bat associated infection in humans. To date, four different lyssavirus species are the causative agents of rabies in European bats: the European Bat Lyssaviruses type 1 and 2 (EBLV-1, EBLV-2), the recently discovered pu...

  9. Parasites of parasites of bats

    NARCIS (Netherlands)

    Haelewaters, Danny; Pfliegler, Walter P.; Szentiványi, Tamara; Földvári, Mihály; Sándor, Attila D.; Barti, Levente; Camacho, Jasmin J.; Gort, Gerrit; Estók, Péter; Hiller, Thomas; Dick, Carl W.; Pfister, Donald H.

    2017-01-01

    Background: Bat flies (Streblidae and Nycteribiidae) are among the most specialized families of the order Diptera. Members of these two related families have an obligate ectoparasitic lifestyle on bats, and they are known disease vectors for their hosts. However, bat flies have their own

  10. Bat Rabies Surveillance in Europe

    NARCIS (Netherlands)

    Schatz, J.; Fooks, A.R.; McElhinney, L.M.; Horton, D.; Echevarria, J.; Vázquez-Morón, S.; Kooi, E.A.; Rasmussen, T.B.; Müller, T.; Freuling, C.

    2013-01-01

    Rabies is the oldest known zoonotic disease and was also the first recognized bat associated infection in humans. To date, four different lyssavirus species are the causative agents of rabies in European bats: the European Bat Lyssaviruses type 1 and 2 (EBLV-1, EBLV-2), the recently discovered

  11. New Adenovirus in Bats, Germany

    Science.gov (United States)

    Sonntag, Michael; Mühldorfer, Kristin; Speck, Stephanie; Wibbelt, Gudrun

    2009-01-01

    We tested 55 deceased vespertilionid bats of 12 species from southern Germany for virus infections. A new adenovirus was isolated from tissue samples of 2 Pipistrellus pipistrellus bats, which represents the only chiropteran virus isolate found in Europe besides lyssavirus (rabies virus). Evidence was found for adenovirus transmission between bats. PMID:19961700

  12. MetaBAT

    Energy Technology Data Exchange (ETDEWEB)

    2014-04-01

    Assembling individual genomes from shotgun metagenomic sequences derived from complex microbial communities is so far one of the most challenging problems in bioinformatics. As it is impractical to directly assemble full-length genomes, a first step that groups contigs from the same organisms, called metagenome binning, has been developed to provide insights of individual organisms. However, current binning methods perform poorly in the context of large complex community, and as a result they fail to recover many novel genomes. To overcome this limitation, we developed integrated software, called MetaBAT, which automatically forms hundreds of individual genome bins from metagenome contigs. Probabilistic models of abundance and tetranucleotide frequency were trained by extensive empirical studies and integrated to decide the membership of contigs iteratively. To test the performance of MetaBAT, we applied MetaBAT to both synthetic and several large-scale real world metagenome datasets. By using two independent metrics, we demonstrate that in all the data sets tested MetaBAT achieves good sensitivity (16~87%) and very high specificity (56~99%) in forming genome bins. Further analyses of the novel genomes recovered from the human gut microbiome suggest a subset of these genomes are potentially associated with pathological conditions. In conclusion, we believe MetaBAT is a powerful tool

  13. Tick-Borne Pathogens in Ticks Feeding on Migratory Passerines in Western Part of Estonia

    OpenAIRE

    Geller, Julia; Nazarova, Lidia; Katargina, Olga; Leivits, Agu; Järvekülg, Lilian; Golovljova, Irina

    2013-01-01

    During southward migration in the years 2006–2009, 178 migratory passerines of 24 bird species infested with ticks were captured at bird stations in Western Estonia. In total, 249 nymphal ticks were removed and analyzed individually for the presence of Borrelia burgdorferi sensu lato (s.l.), tick-borne encephalitis virus (TBEV), and Anaplasma phagocytophilum. The majority of ticks were collected from Acrocephalus (58%), Turdus (13%), Sylvia (8%), and Parus (6%) bird species. Tick-borne pathog...

  14. Vaccinomics, the new road to tick vaccines.

    Science.gov (United States)

    de la Fuente, José; Merino, Octavio

    2013-12-05

    Ticks are a threat to human and animal health worldwide. Ticks are considered to be second worldwide to mosquitoes as vectors of human diseases, the most important vectors of diseases that affect cattle industry worldwide and important vectors of diseases affecting pets. Tick vaccines are a cost-effective and environmentally friendly alternative to protect against tick-borne diseases through the control of vector infestations and reducing pathogen infection and transmission. These premises stress the need for developing improved tick vaccines in a more efficient way. In this context, development of improved vaccines for tick-borne diseases will be greatly enhanced by vaccinomics approaches starting from the study of tick–host–pathogen molecular interactions and ending in the characterization and validation of vaccine formulations. The discovery of new candidate vaccine antigens for the control of tick infestations and pathogen infection and transmission requires the development of effective screening platforms and algorithms that allow the analysis and validation of data produced by systems biology approaches to tick research. Tick vaccines that affect both tick infestations and pathogen transmission could be used to vaccinate human and animal populations at risk and reservoir species to reduce host exposure to ticks while reducing the number of infected ticks and their vectorial capacity for pathogens that affect human and animal health worldwide.

  15. A study of ticks and tick-borne livestock pathogens in Pakistan

    Science.gov (United States)

    Budachetri, Khemraj; Mukherjee, Nabanita; Williams, Jaclyn; Kausar, Asma; Hassan, Muhammad Jawadul; Adamson, Steven; Dowd, Scot E.; Apanskevich, Dmitry; Arijo, Abdullah; Sindhu, Zia Uddin; Kakar, Muhammad Azam; Khan, Raja Muhammad Dilpazir; Ullah, Shafiq; Sajid, Muhammad Sohail; Ali, Abid; Iqbal, Zafar

    2017-01-01

    Background As obligate blood-feeding arthropods, ticks transmit pathogens to humans and domestic animals more often than other arthropod vectors. Livestock farming plays a vital role in the rural economy of Pakistan, and tick infestation causes serious problems with it. However, research on tick species diversity and tick-borne pathogens has rarely been conducted in Pakistan. In this study, a systematic investigation of the tick species infesting livestock in different ecological regions of Pakistan was conducted to determine the microbiome and pathobiome diversity in the indigenous ticks. Methodology/Principal findings A total of 3,866 tick specimens were morphologically identified as 19 different tick species representing three important hard ticks, Rhipicephalus, Haemaphysalis and Hyalomma, and two soft ticks, Ornithodorus and Argas. The bacterial diversity across these tick species was assessed by bacterial 16S rRNA gene sequencing using a 454-sequencing platform on 10 of the different tick species infesting livestock. The notable genera detected include Ralstonia, Clostridium, Staphylococcus, Rickettsia, Lactococcus, Lactobacillus, Corynebacterium, Enterobacter, and Enterococcus. A survey of Spotted fever group rickettsia from 514 samples from the 13 different tick species generated rickettsial-specific amplicons in 10% (54) of total ticks tested. Only three tick species Rhipicephalus microplus, Hyalomma anatolicum, and H. dromedarii had evidence of infection with “Candidatus Rickettsia amblyommii” a result further verified using a rompB gene-specific quantitative PCR (qPCR) assay. The Hyalomma ticks also tested positive for the piroplasm, Theileria annulata, using a qPCR assay. Conclusions/Significance This study provides information about tick diversity in Pakistan, and pathogenic bacteria in different tick species. Our results showed evidence for Candidatus R. amblyommii infection in Rhipicephalus microplus, H. anatolicum, and H. dromedarii ticks, which

  16. A study of ticks and tick-borne livestock pathogens in Pakistan.

    Directory of Open Access Journals (Sweden)

    Shahid Karim

    2017-06-01

    Full Text Available As obligate blood-feeding arthropods, ticks transmit pathogens to humans and domestic animals more often than other arthropod vectors. Livestock farming plays a vital role in the rural economy of Pakistan, and tick infestation causes serious problems with it. However, research on tick species diversity and tick-borne pathogens has rarely been conducted in Pakistan. In this study, a systematic investigation of the tick species infesting livestock in different ecological regions of Pakistan was conducted to determine the microbiome and pathobiome diversity in the indigenous ticks.A total of 3,866 tick specimens were morphologically identified as 19 different tick species representing three important hard ticks, Rhipicephalus, Haemaphysalis and Hyalomma, and two soft ticks, Ornithodorus and Argas. The bacterial diversity across these tick species was assessed by bacterial 16S rRNA gene sequencing using a 454-sequencing platform on 10 of the different tick species infesting livestock. The notable genera detected include Ralstonia, Clostridium, Staphylococcus, Rickettsia, Lactococcus, Lactobacillus, Corynebacterium, Enterobacter, and Enterococcus. A survey of Spotted fever group rickettsia from 514 samples from the 13 different tick species generated rickettsial-specific amplicons in 10% (54 of total ticks tested. Only three tick species Rhipicephalus microplus, Hyalomma anatolicum, and H. dromedarii had evidence of infection with "Candidatus Rickettsia amblyommii" a result further verified using a rompB gene-specific quantitative PCR (qPCR assay. The Hyalomma ticks also tested positive for the piroplasm, Theileria annulata, using a qPCR assay.This study provides information about tick diversity in Pakistan, and pathogenic bacteria in different tick species. Our results showed evidence for Candidatus R. amblyommii infection in Rhipicephalus microplus, H. anatolicum, and H. dromedarii ticks, which also carried T. annulata.

  17. Do bat gantries and underpasses help bats cross roads safely?

    Directory of Open Access Journals (Sweden)

    Anna Berthinussen

    Full Text Available Major roads can reduce bat abundance and diversity over considerable distances. To mitigate against these effects and comply with environmental law, many European countries install bridges, gantries or underpasses to make roads permeable and safer to cross. However, through lack of appropriate monitoring, there is little evidence to support their effectiveness. Three underpasses and four bat gantries were investigated in northern England. Echolocation call recordings and observations were used to determine the number of bats using underpasses in preference to crossing the road above, and the height at which bats crossed. At gantries, proximity to the gantry and height of crossing bats were measured. Data were compared to those from adjacent, severed commuting routes that had no crossing structure. At one underpass 96% of bats flew through it in preference to crossing the road. This underpass was located on a pre-construction commuting route that allowed bats to pass without changing flight height or direction. At two underpasses attempts to divert bats from their original commuting routes were unsuccessful and bats crossed the road at the height of passing vehicles. Underpasses have the potential to allow bats to cross roads safely if built on pre-construction commuting routes. Bat gantries were ineffective and used by a very small proportion of bats, even up to nine years after construction. Most bats near gantries crossed roads along severed, pre-construction commuting routes at heights that put them in the path of vehicles. Crossing height was strongly correlated with verge height, suggesting that elevated verges may have some value in mitigation, but increased flight height may be at the cost of reduced permeability. Green bridges should be explored as an alternative form of mitigation. Robust monitoring is essential to assess objectively the case for mitigation and to ensure effective mitigation.

  18. Strategies for new and improved vaccines against ticks and tick-borne diseases.

    Science.gov (United States)

    de la Fuente, J; Kopáček, P; Lew-Tabor, A; Maritz-Olivier, C

    2016-12-01

    Ticks infest a variety of animal species and transmit pathogens causing disease in both humans and animals worldwide. Tick-host-pathogen interactions have evolved through dynamic processes that accommodated the genetic traits of the hosts, pathogens transmitted and the vector tick species that mediate their development and survival. New approaches for tick control are dependent on defining molecular interactions between hosts, ticks and pathogens to allow for discovery of key molecules that could be tested in vaccines or new generation therapeutics for intervention of tick-pathogen cycles. Currently, tick vaccines constitute an effective and environmentally sound approach for the control of ticks and the transmission of the associated tick-borne diseases. New candidate protective antigens will most likely be identified by focusing on proteins with relevant biological function in the feeding, reproduction, development, immune response, subversion of host immunity of the tick vector and/or molecules vital for pathogen infection and transmission. This review addresses different approaches and strategies used for the discovery of protective antigens, including focusing on relevant tick biological functions and proteins, reverse genetics, vaccinomics and tick protein evolution and interactomics. New and improved tick vaccines will most likely contain multiple antigens to control tick infestations and pathogen infection and transmission. © 2016 John Wiley & Sons Ltd.

  19. Tick-borne infectious diseases in Australia.

    Science.gov (United States)

    Graves, Stephen R; Stenos, John

    2017-04-17

    Tick bites in Australia can lead to a variety of illnesses in patients. These include infection, allergies, paralysis, autoimmune disease, post-infection fatigue and Australian multisystem disorder. Rickettsial (Rickettsia spp.) infections (Queensland tick typhus, Flinders Island spotted fever and Australian spotted fever) and Q fever (Coxiella burnetii) are the only systemic bacterial infections that are known to be transmitted by tick bites in Australia. Three species of local ticks transmit bacterial infection following a tick bite: the paralysis tick (Ixodes holocyclus) is endemic on the east coast of Australia and causes Queensland tick typhus due to R. australis and Q fever due to C. burnetii; the ornate kangaroo tick (Amblyomma triguttatum) occurs throughout much of northern, central and western Australia and causes Q fever; and the southern reptile tick (Bothriocroton hydrosauri) is found mainly in south-eastern Australia and causes Flinders Island spotted fever due to R. honei. Much about Australian ticks and the medical outcomes following tick bites remains unknown. Further research is required to increase understanding of these areas.

  20. BAT 3-chapter 2

    African Journals Online (AJOL)

    Olatunde Akanni

    on advertisement to take products to the doorsteps of potential consumers. Consequently, local and ... ideation, encoding and presentation of visual information to target audiences in a way that breaks cultural bounds and ... BAT realises the importance of cultural attributes in ads in such a culture sensitive environment like ...

  1. Short communication Prevalence and infestation load of ixodid ticks ...

    African Journals Online (AJOL)

    conducted to identify major tick genera, prevalence and assess tick infestation load on cattle in Dassenech district, ... to identify tick genera and observe cattle infestation load by the ticks and its prevalence in Dassenech district, .... It is found in sub-Saharan Africa and rift valley and as far as. South Africa. This tick is also ...

  2. Tick size and stock returns

    Science.gov (United States)

    Onnela, Jukka-Pekka; Töyli, Juuso; Kaski, Kimmo

    2009-02-01

    Tick size is an important aspect of the micro-structural level organization of financial markets. It is the smallest institutionally allowed price increment, has a direct bearing on the bid-ask spread, influences the strategy of trading order placement in electronic markets, affects the price formation mechanism, and appears to be related to the long-term memory of volatility clustering. In this paper we investigate the impact of tick size on stock returns. We start with a simple simulation to demonstrate how continuous returns become distorted after confining the price to a discrete grid governed by the tick size. We then move on to a novel experimental set-up that combines decimalization pilot programs and cross-listed stocks in New York and Toronto. This allows us to observe a set of stocks traded simultaneously under two different ticks while holding all security-specific characteristics fixed. We then study the normality of the return distributions and carry out fits to the chosen distribution models. Our empirical findings are somewhat mixed and in some cases appear to challenge the simulation results.

  3. Inferring echolocation in ancient bats.

    Science.gov (United States)

    Simmons, Nancy B; Seymour, Kevin L; Habersetzer, Jörg; Gunnell, Gregg F

    2010-08-19

    Laryngeal echolocation, used by most living bats to form images of their surroundings and to detect and capture flying prey, is considered to be a key innovation for the evolutionary success of bats, and palaeontologists have long sought osteological correlates of echolocation that can be used to infer the behaviour of fossil bats. Veselka et al. argued that the most reliable trait indicating echolocation capabilities in bats is an articulation between the stylohyal bone (part of the hyoid apparatus that supports the throat and larynx) and the tympanic bone, which forms the floor of the middle ear. They examined the oldest and most primitive known bat, Onychonycteris finneyi (early Eocene, USA), and argued that it showed evidence of this stylohyal-tympanic articulation, from which they concluded that O. finneyi may have been capable of echolocation. We disagree with their interpretation of key fossil data and instead argue that O. finneyi was probably not an echolocating bat.

  4. Bat flight and zoonotic viruses

    Science.gov (United States)

    O'Shea, Thomas J.; Cryan, Paul M.; Cunningham, Andrew A.; Fooks, Anthony R.; Hayman, David T.S.; Luis, Angela D.; Peel, Alison J.; Plowright, Raina K.; Wood, James L.N.

    2014-01-01

    Bats are sources of high viral diversity and high-profile zoonotic viruses worldwide. Although apparently not pathogenic in their reservoir hosts, some viruses from bats severely affect other mammals, including humans. Examples include severe acute respiratory syndrome coronaviruses, Ebola and Marburg viruses, and Nipah and Hendra viruses. Factors underlying high viral diversity in bats are the subject of speculation. We hypothesize that flight, a factor common to all bats but to no other mammals, provides an intensive selective force for coexistence with viral parasites through a daily cycle that elevates metabolism and body temperature analogous to the febrile response in other mammals. On an evolutionary scale, this host–virus interaction might have resulted in the large diversity of zoonotic viruses in bats, possibly through bat viruses adapting to be more tolerant of the fever response and less virulent to their natural hosts.

  5. Predicting tick presence by environmental risk mapping

    Directory of Open Access Journals (Sweden)

    Arno eSwart

    2014-11-01

    Full Text Available Public health statistics recorded an increasing trend in the incidence of tick bites and erythema migrans in the Netherlands. We investigated whether the disease incidence could be predicted by a spatially explicit categorization model, based on environmental factors and a training set of tick absence-presence data. Presence and absence of Ixodes ricinus were determined by the blanket-dragging method at numerous sites spread over the Netherlands. The probability of tick presence on a 1 km by 1 km square grid was estimated from the field data using a satellite-based methodology. Expert elicitation was conducted to provide a Bayesian prior per landscape type. We applied a linear model to test a correlation between incidence of erythema migrans consultations by general practitioners in the Netherlands and the estimated probability of tick presence. Ticks were present at 252 distinct sampling coordinates and absent at 425. Tick presence was estimated for 54% percent of the total land cover. Our model has predictive power for tick presence in the Netherlands, tick bite incidence per municipality correlated significantly with the average probability of tick presence per grid. The estimated intercept of the linear model was positive and significant. This indicates that a significant fraction of the tick bite consultations could be attributed to the Ixodes ricinus population outside the resident municipality.

  6. The status of BAT detector

    Science.gov (United States)

    Lien, Amy; Markwardt, Craig B.; Krimm, Hans Albert; Barthelmy, Scott D.; Cenko, Bradley

    2018-01-01

    We will present the current status of the Swift/BAT detector. In particular, we will report the updated detector gain calibration, the number of enable detectors, and the global bad time intervals with potential calibration issues. We will also summarize the results of the yearly BAT calibration using the Crab nebula. Finally, we will discuss the effects on the BAT survey, such as the sensitivity, localization, and spectral analysis, due to the changes in detector status.

  7. Bats, cyanide, and gold mining

    Science.gov (United States)

    Clark, Donald R.

    1991-01-01

    Although the boom days of prospectors and gold nuggets are long gone, modern technology enables gold to continue to be extracted from ore. Unfortunately, the extraction method has often been disastrous for bats and other wildlife, an issue I first became aware of in early 1989. Phone calls from Drs. Merlin Tuttle and Elizabeth Pierson, a BCI member and bat researcher from Berkeley, California, alerted me that bats were dying from apparent cyanide poisoning at gold mines in the western United States.

  8. Saliva, Salivary Gland, and Hemolymph Collection from Ixodes scapularis Ticks

    OpenAIRE

    Patton, Toni G.; Dietrich, Gabrielle; Brandt, Kevin; Dolan, Marc C.; Piesman, Joseph; Gilmore, Robert D.

    2012-01-01

    Ticks are found worldwide and afflict humans with many tick-borne illnesses. Ticks are vectors for pathogens that cause Lyme disease and tick-borne relapsing fever (Borrelia spp.), Rocky Mountain Spotted fever (Rickettsia rickettsii), ehrlichiosis (Ehrlichia chaffeensis and E. equi), anaplasmosis (Anaplasma phagocytophilum), encephalitis (tick-borne encephalitis virus), babesiosis (Babesia spp.), Colorado tick fever (Coltivirus), and tularemia (Francisella tularensis) 1-8. To be properly tran...

  9. Ticks on livestock in St. Lucia.

    Science.gov (United States)

    Garris, G I; Scotland, K

    1985-12-01

    Cattle, sheep, goats and horses were examined for ticks. Over 95% of Holstein cross-breeds, 28% of sheep (local mixed breeds) and 18% of goats (local mixed breeds) examined from 18 August to 4 September 1983 were infested with the southern cattle tick, Boophilus microplus Canestrini. About 90 and 17% of the horses examined were infested with the tropical horse tick, Anocentor nitens Neumann, and the tropical bont tick, Amblyomma variegatum Fabricius, respectively. The tropical bont tick was found infesting 10% of cattle in the Gros Islet area of St. Lucia. The tropical bont tick was also found associated with a severe skin disease, dermatophilosis, caused by the bacterium Dermatophilus congolensis, in 54% of the cattle infested by A. variegatum in the Gros Islet and Dauphin areas of St. Lucia.

  10. Entomopathogenic fungi against South American tick species.

    Science.gov (United States)

    Fernandes, Everton Kort Kamp; Bittencourt, Vânia Rita Elias Pinheiro

    2008-12-01

    Ticks are parasites of serious concern for humans, domesticated animals and wild animals. Despite scientific advances, in South America the principal control method for ticks is the use of chemical acaricides. Indiscriminate use of these products causes environmental pollution, food contamination and development of tick resistance to acaricides. In vitro studies and field trials have demonstrated that pathogenic fungal isolates not only cause mortality of many tick species, but also reduce subsequent generations due to effects on their reproductive efficacy. Accordingly, this review presents results of several studies which were conducted in South America. Furthermore, it outlines current information on fungal pathogens of ticks and discusses the need to develop and implement effective strategies for use of entomopathogenic fungi to control ticks in the near future.

  11. Screening of bat faeces for arthropod-borne apicomplexan protozoa: Babesia canis and Besnoitia besnoiti-like sequences from Chiroptera.

    Science.gov (United States)

    Hornok, Sándor; Estók, Péter; Kováts, Dávid; Flaisz, Barbara; Takács, Nóra; Szőke, Krisztina; Krawczyk, Aleksandra; Kontschán, Jenő; Gyuranecz, Miklós; Fedák, András; Farkas, Róbert; Haarsma, Anne-Jifke; Sprong, Hein

    2015-08-28

    Bats are among the most eco-epidemiologically important mammals, owing to their presence in human settlements and animal keeping facilities. Roosting of bats in buildings may bring pathogens of veterinary-medical importance into the environment of domestic animals and humans. In this context bats have long been studied as carriers of various pathogen groups. However, despite their close association with arthropods (both in their food and as their ectoparasites), only a few molecular surveys have been published on their role as carriers of vector-borne protozoa. The aim of the present study was to compensate for this scarcity of information. Altogether 221 (mostly individual) bat faecal samples were collected in Hungary and the Netherlands. The DNA was extracted, and analysed with PCR and sequencing for the presence of arthropod-borne apicomplexan protozoa. Babesia canis canis (with 99-100% homology) was identified in five samples, all from Hungary. Because it was excluded with an Ixodidae-specific PCR that the relevant bats consumed ticks, these sequences derive either from insect carriers of Ba. canis, or from the infection of bats. In one bat faecal sample from the Netherlands a sequence having the highest (99%) homology to Besnoitia besnoiti was amplified. These findings suggest that some aspects of the epidemiology of canine babesiosis are underestimated or unknown, i.e. the potential role of insect-borne mechanical transmission and/or the susceptibility of bats to Ba. canis. In addition, bats need to be added to future studies in the quest for the final host of Be. besnoiti.

  12. Bat biology, genomes, and the Bat1K project

    DEFF Research Database (Denmark)

    Teeling, Emma C; Vernes, Sonja C; Dávalos, Liliana M

    2018-01-01

    Bats are unique among mammals, possessing some of the rarest mammalian adaptations, including true self-powered flight, laryngeal echolocation, exceptional longevity, unique immunity, contracted genomes, and vocal learning. They provide key ecosystem services, pollinating tropical plants, dispers......Bats are unique among mammals, possessing some of the rarest mammalian adaptations, including true self-powered flight, laryngeal echolocation, exceptional longevity, unique immunity, contracted genomes, and vocal learning. They provide key ecosystem services, pollinating tropical plants...... and endangered. Here we announce Bat1K, an initiative to sequence the genomes of all living bat species (n∼1,300) to chromosome-level assembly. The Bat1K genome consortium unites bat biologists (>148 members as of writing), computational scientists, conservation organizations, genome technologists, and any...... interested individuals committed to a better understanding of the genetic and evolutionary mechanisms that underlie the unique adaptations of bats. Our aim is to catalog the unique genetic diversity present in all living bats to better understand the molecular basis of their unique adaptations; uncover...

  13. Social Grooming in Bats: Are Vampire Bats Exceptional?

    Directory of Open Access Journals (Sweden)

    Gerald Carter

    Full Text Available Evidence for long-term cooperative relationships comes from several social birds and mammals. Vampire bats demonstrate cooperative social bonds, and like primates, they maintain these bonds through social grooming. It is unclear, however, to what extent vampires are special among bats in this regard. We compared social grooming rates of common vampire bats Desmodus rotundus and four other group-living bats, Artibeus jamaicensis, Carollia perspicillata, Eidolon helvum and Rousettus aegyptiacus, under the same captive conditions of fixed association and no ectoparasites. We conducted 13 focal sampling sessions for each combination of sex and species, for a total of 1560 presence/absence observations per species. We observed evidence for social grooming in all species, but social grooming rates were on average 14 times higher in vampire bats than in other species. Self-grooming rates did not differ. Vampire bats spent 3.7% of their awake time social grooming (95% CI = 1.5-6.3%, whereas bats of the other species spent 0.1-0.5% of their awake time social grooming. Together with past data, this result supports the hypothesis that the elevated social grooming rate in the vampire bat is an adaptive trait, linked to their social bonding and unique regurgitated food sharing behavior.

  14. Social Grooming in Bats: Are Vampire Bats Exceptional?

    Science.gov (United States)

    Carter, Gerald; Leffer, Lauren

    2015-01-01

    Evidence for long-term cooperative relationships comes from several social birds and mammals. Vampire bats demonstrate cooperative social bonds, and like primates, they maintain these bonds through social grooming. It is unclear, however, to what extent vampires are special among bats in this regard. We compared social grooming rates of common vampire bats Desmodus rotundus and four other group-living bats, Artibeus jamaicensis, Carollia perspicillata, Eidolon helvum and Rousettus aegyptiacus, under the same captive conditions of fixed association and no ectoparasites. We conducted 13 focal sampling sessions for each combination of sex and species, for a total of 1560 presence/absence observations per species. We observed evidence for social grooming in all species, but social grooming rates were on average 14 times higher in vampire bats than in other species. Self-grooming rates did not differ. Vampire bats spent 3.7% of their awake time social grooming (95% CI = 1.5-6.3%), whereas bats of the other species spent 0.1-0.5% of their awake time social grooming. Together with past data, this result supports the hypothesis that the elevated social grooming rate in the vampire bat is an adaptive trait, linked to their social bonding and unique regurgitated food sharing behavior.

  15. Tick-borne pathogens in ticks collected from birds in Taiwan

    Directory of Open Access Journals (Sweden)

    Chi-Chien Kuo

    2017-11-01

    Full Text Available Abstract Background A variety of human diseases transmitted by arthropod vectors, including ticks, are emerging around the globe. Birds are known to be hosts of ticks and can disperse exotic ticks and tick-borne pathogens. In Taiwan, previous studies have focused predominantly on mammals, leaving the role of birds in the maintenance of ticks and dissemination of tick-borne pathogens undetermined. Methods Ticks were collected opportunistically when birds were studied from 1995 to 2013. Furthermore, to improve knowledge on the prevalence and mean load of tick infestation on birds in Taiwan, ticks were thoroughly searched for when birds were mist-netted at seven sites between September 2014 and April 2016 in eastern Taiwan. Ticks were identified based on both morphological and molecular information and were screened for potential tick-borne pathogens, including the genera Anaplasma, Babesia, Borrelia, Ehrlichia and Rickettsia. Finally, a list of hard tick species collected from birds in Taiwan was compiled based on past work and the current study. Results Nineteen ticks (all larvae were recovered from four of the 3096 unique mist-netted bird individuals, yielding a mean load of 0.006 ticks/individual and an overall prevalence of 0.13%. A total of 139 ticks from birds, comprising 48 larvae, 35 nymphs, 55 adults and one individual of unknown life stage, were collected from 1995 to 2016, and 11 species of four genera were identified, including three newly recorded species (Haemaphysalis wellingtoni, Ixodes columnae and Ixodes turdus. A total of eight tick-borne pathogens were detected, with five species (Borrelia turdi, Anaplasma sp. clone BJ01, Ehrlichia sp. BL157-9, Rickettsia helvetica and Rickettsia monacensis not previously isolated in Taiwan. Overall, 16 tick species of five genera have been recorded feeding on birds, including nine species first discovered in this study. Conclusion Our study demonstrates the paucity of information on ticks of

  16. Research on the ecology of ticks and tick-borne pathogens - methodological principles and caveats

    Directory of Open Access Journals (Sweden)

    Agustín eEstrada-Peña

    2013-08-01

    Full Text Available Interest in tick-transmitted pathogens has experienced an upsurge in the past few decades. Routine application of tools for the detection of fragments of foreign DNA in ticks, together with a high degree of interest in the quantification of disease risk for humans, has led to a marked increase in the number of reports on the eco-epidemiology of tick-borne diseases. However, procedural errors continue to accumulate in the scientific literature, resulting in misleading information. For example, unreliable identification of ticks and pathogens, erroneous interpretations of short-term field studies, and the hasty acceptance of some tick species as vectors have led to ambiguities regarding the vector role of these arthropods. In this review, we focus on the ecological features driving the life cycle of ticks and the resulting effects on the eco-epidemiology of tick-transmitted pathogens. We review the factors affecting field collections of ticks, and we describe the biologically and ecologically appropriate procedures for describing tick host-seeking activity and its correlation with environmental traits. We detail the climatic variables that have biological importance on ticks and explain how they should be properly measured and analyzed. We also provide evidence to critically reject the use of some environmental traits that are being increasingly reported as the drivers of the behavior of ticks. With the aim of standardization, we propose unambiguous definitions of the status of hosts and ticks regarding their ability to maintain and spread a given pathogen. We also describe laboratory procedures and standards for evaluating the vectorial status of a tick or the reservoir role of a host. Such harmonization in protocols and terms should provide a coherent framework for the reporting of research findings concerning ticks and tick-borne diseases.

  17. The aural anatomy of bats

    NARCIS (Netherlands)

    Pye, Ade

    1970-01-01

    The fine structure of the ears of 62 species of bats from 13 families has been studied by means of serial sections. The bats were caught alive in Britain, West Indies, Panama, Central and North Africa and were intra-vitally perfused with fixative in order to obtain perfect preservation of the

  18. Metabolomics of the tick-Borrelia interaction during the nymphal tick blood meal.

    Science.gov (United States)

    Hoxmeier, J Charles; Fleshman, Amy C; Broeckling, Corey D; Prenni, Jessica E; Dolan, Marc C; Gage, Kenneth L; Eisen, Lars

    2017-03-13

    The causal agents of Lyme disease in North America, Borrelia burgdorferi and Borrelia mayonii, are transmitted primarily by Ixodes scapularis ticks. Due to their limited metabolic capacity, spirochetes rely on the tick blood meal for nutrients and metabolic intermediates while residing in the tick vector, competing with the tick for nutrients in the blood meal. Metabolomics is an effective methodology to explore dynamics of spirochete survival and multiplication in tick vectors before transmission to a vertebrate host via tick saliva. Using gas chromatography coupled to mass spectrometry, we identified statistically significant differences in the metabolic profile among uninfected I. scapularis nymphal ticks, B. burgdorferi-infected nymphal ticks and B. mayonii-infected nymphal ticks by measuring metabolism every 24 hours over the course of their up to 96 hour blood meals. Specifically, differences in the abundance of purines, amino acids, carbohydrates, and fatty acids during the blood meal among the three groups of nymphal ticks suggest that B. mayonii and B. burgdorferi may have different metabolic capabilities, especially during later stages of nymphal feeding. Understanding mechanisms underlying variable metabolic requirements of different Lyme disease spirochetes within tick vectors could potentially aid development of novel methods to control spirochete transmission.

  19. Tick-proof ceramics. Bo dani ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Shimono, F. (Ishizuka Glass Co. Ltd., Nagoya (Japan))

    1993-07-01

    Ishizuka Glass has developed SiO2-B2O3-R2O(RO) based tick-proof ceramics (trade name; Segrocera) in cooperation with Yamato Chemical Industry, insecticide maker. This article is a report on effectiveness of this ceramics. Ticks living indoors are roughly divided into two kinds, namely ticks living in a house itself and ticks which enter the house by parasitizing on animals and plants, and Segrocera has been developed aiming at the former ticks which, irrespective of its kind, need the temperature of 20-30[degree]C and the moisture of 60% or more as its breeding conditions. The tick-proof effect of Segrocera is as excellent as 90-99% and even after keeping its specimen at 75RH for 12 months, it has shown the ratio of inhibiting ticks' breeding of 98-99%. In comparison with that the effect of other tick-proof agent, pyrethroids-based aerosol is limited up to 24 hours, it is the feature of Segrocera that its life is considerably longer. Safety of Segrocera is also very high. 2 refs., 1 fig., 7 tabs.

  20. Talking to Patients about Preventing Tick Bites

    Centers for Disease Control (CDC) Podcasts

    2012-02-14

    This podcast will help health care providers identify patients who are at increased risk of getting tick bites and provide these patients with tick bite prevention and removal tips.  Created: 2/14/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 2/14/2012.

  1. Tick-borne encephalitis virus, Kyrgyzstan.

    Science.gov (United States)

    Briggs, Benjamin J; Atkinson, Barry; Czechowski, Donna M; Larsen, Peter A; Meeks, Heather N; Carrera, Juan P; Duplechin, Ryan M; Hewson, Roger; Junushov, Asankadyr T; Gavrilova, Olga N; Breininger, Irena; Phillips, Carleton J; Baker, Robert J; Hay, John

    2011-05-01

    Tick-borne encephalitis virus (TBEV) is an emerging pathogen in Europe and Asia. We investigated TBEV in Kyrgyzstan by collecting small mammals and ticks from diverse localities and analyzing them for evidence of TBEV infection. We found TBEV circulating in Kyrgyzstan much farther south and at higher altitudes than previously reported.

  2. Prevalence of ticks infesting grasscutters ( Thryonomys ...

    African Journals Online (AJOL)

    Conclusion and application of results: Farm grasscutters in Côte d'Ivoire do not carry some ticks. But five species were found on wild grasscutters. Ticks and pathogenic agents that they transmit and for which some are responsible for zoonosis, could constitute a major obstacle for the development of grasscutters' farming ...

  3. Tick paralysis: development of a vaccine.

    Science.gov (United States)

    Masina, S; Broady, K W

    1999-04-01

    The paralysis tick of Australia, Ixodes holocyclus, causes a severe toxicosis in domestic animals such as dogs and cats, livestock, and in some cases, humans. It is characterised by a rapidly ascending flaccid paralysis. The causative agent of the toxicosis is a neurotoxin(s) produced in the tick salivary glands. The current treatment for tick paralysis is in the form of a polyclonal dog antiserum. This antiserum treatment is expensive and effective only in the early stages of paralysis. The aim of current research is to develop a recombinant veterinary vaccine based on the tick neurotoxin peptide sequence. A successful vaccine would provide cost-effective, long-term protective immunity against tick-induced paralysis.

  4. A contribution to the development of anti-tick vaccines

    NARCIS (Netherlands)

    Nijhof, A.M.

    2010-01-01

    Ticks and tick-borne diseases seriously affect animal and human health worldwide with the highest economic losses occurring in livestock production in the developing world. The control of ticks and the diseases they transmit depends mainly on chemical tick control using acaricides. The development

  5. Prevention of tick bites: an evaluation of a smartphone app.

    NARCIS (Netherlands)

    Antonise-Kamp, L; Beaujean, D J M A; Crutzen, R; van Steenbergen, J E; Ruwaard, D

    2017-01-01

    Lyme borreliosis (LB) is the most common reported tick-borne infection in Europe, and involves transmission of Borrelia by ticks. As long as a vaccine is not available and effective measures for controlling tick populations are insufficient, LB control is focused on preventive measures to avoid tick

  6. Prevention of tick bites: an evaluation of a smartphone app

    OpenAIRE

    Antonise-Kamp, L.; Beaujean, D. J. M. A.; Crutzen, R.; van Steenbergen, J. E.; Ruwaard, D.

    2017-01-01

    Background Lyme borreliosis (LB) is the most common reported tick-borne infection in Europe, and involves transmission of Borrelia by ticks. As long as a vaccine is not available and effective measures for controlling tick populations are insufficient, LB control is focused on preventive measures to avoid tick bites. To inform citizens about the risk of ticks, motivate them to check for tick bites, and encourage them to remove any attached tick as quickly as possible, a mobile app called ‘Tek...

  7. An attempt of rationalization of tick-borne disease prevention using a multifunctional container for Tick Twister ®

    Directory of Open Access Journals (Sweden)

    Barbara Oczko-Grzesik

    2013-12-01

    Full Text Available Ticks are reservoir and transmission vectors of many bacteria, viruses and parasites, which are pathogenic for humans. Early and correct tick removal is crucial as prevention of tick-borne diseases. The aim of the study is an attempt at rationalization of tick-borne disease prevention using a multifunctional container for Tick Twister®. In practice, it should enable people to use Tick Twister® in all circumstances contributing to the improvement of efficiency in tick-borne diseases prevention, and as a result, to a decrease in their frequency and after effects.

  8. Emerging diseases in Chiroptera: why bats?

    Science.gov (United States)

    Wibbelt, Gudrun; Moore, Marianne S.; Schountz, Tony; Voigt, Christian C.

    2010-01-01

    A conference entitled ‘2nd International Berlin Bat Meeting: Bat Biology and Infectious Diseases’ was held between the 19 and 21 of February 2010 in Berlin, Germany. Researchers from two major disciplines, bat biologists and disease specialists, met for the first time in an interdisciplinary event to share their knowledge about bat-associated diseases. The focus of the meeting was to understand why in particular bats are the hosts of so many of the most virulent diseases globally. During several sessions, key note speakers and participants discussed infectious diseases associated with bats, including viral diseases caused by Henipa-, Filo-, Corona- and Lyssaviruses, the spread of white-nose syndrome in North American bats, bat immunology/immunogenetics, bat parasites, and finally, conservation and human health issues. PMID:20427329

  9. Prevalence of ticks and tick-borne pathogens: Babesia and Borrelia species in ticks infesting cats of Great Britain.

    Science.gov (United States)

    Davies, Saran; Abdullah, Swaid; Helps, Chris; Tasker, Séverine; Newbury, Hannah; Wall, Richard

    2017-09-15

    In a study of tick and tick-borne pathogen prevalence, between May and October 2016, 278 veterinary practices in Great Britain examined 1855 cats. Six-hundred and one cats were found to have attached ticks. The most frequently recorded tick species was Ixodes ricinus (57.1%), followed by Ixodes hexagonus (41.4%) and Ixodes trianguliceps (1.5%). Male cats, 4-6 years of age living in rural areas were most likely to be carrying a tick; hair length and tick treatment history had no significant association with attachment. For cats that were parasitized by ticks in large urban areas, I. hexagonus was the most frequent species recorded. Molecular analysis was possible for 541 individual tick samples, others were too damaged for analysis; Babesia spp., and Borrelia burgdorferi sensu lato were identified in 1.1% (n=6) and 1.8% (n=10) of these, respectively. Babesia spp. included Babesia vulpes sp. nov./Babesia microti-like (n=4) in I. hexagonus and Babesia venatorum (n=2) in I. ricinus. Borrelia burgdorferi s.l. species included Borrelia garinii (n=6) and Borrelia afzelii (n=4). The majority of B. burgorferi s.l. cases were found in I. ricinus, with B. afzelii in one I. hexagonus nymph. No Borrelia or Babesia spp. were present in I. trianguliceps. To determine a true prevalence for ticks on cats, practices that only submitted questionnaires from cats with ticks and practices that submitted fewer than 5 returns per week were removed; amongst those considered to have adhered strictly to the collection protocol, feline tick prevalence amongst cats that had access to the outdoors was 6.6%. These results show that ticks can be found on cats throughout Great Britain, which harbour a range of species of Babesia and B. burgdorferi s.l. and that cats, particularly in green spaces within urban areas, may form an important host for I. hexagonus, a known vector of pathogens. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Aeromechanics of Highly Maneuverable Bats

    National Research Council Canada - National Science Library

    Swartz, S. M; Breuer, K. S

    2008-01-01

    Bats fly with astounding agility, maneuverability and efficiency. Their flight mechanics are completely different from those of insects and birds and characterized by several unique aeromechanical features including: (1...

  11. Delay differential systems for tick population dynamics.

    Science.gov (United States)

    Fan, Guihong; Thieme, Horst R; Zhu, Huaiping

    2015-11-01

    Ticks play a critical role as vectors in the transmission and spread of Lyme disease, an emerging infectious disease which can cause severe illness in humans or animals. To understand the transmission dynamics of Lyme disease and other tick-borne diseases, it is necessary to investigate the population dynamics of ticks. Here, we formulate a system of delay differential equations which models the stage structure of the tick population. Temperature can alter the length of time delays in each developmental stage, and so the time delays can vary geographically (and seasonally which we do not consider). We define the basic reproduction number [Formula: see text] of stage structured tick populations. The tick population is uniformly persistent if [Formula: see text] and dies out if [Formula: see text]. We present sufficient conditions under which the unique positive equilibrium point is globally asymptotically stable. In general, the positive equilibrium can be unstable and the system show oscillatory behavior. These oscillations are primarily due to negative feedback within the tick system, but can be enhanced by the time delays of the different developmental stages.

  12. Is Batting Last an Advantage?

    OpenAIRE

    Theodore L. Turocy

    2003-01-01

    This paper applies the theory of zero-sum stochastic games to assess the validity of baseball's ancient wisdom that batting last confers a strategic advantage. Results from numerical calculation of Markov perfect equilibrium suggest that the team that bats last will have an advantage if in fact the offense has, in some sense, more useful strategic actions available than the defense. An example is provided where the advantage depends on details of the teams playing. Regardless of which team ha...

  13. Human–Bat Interactions in Rural West Africa

    Science.gov (United States)

    Anti, Priscilla; Owusu, Michael; Agbenyega, Olivia; Annan, Augustina; Badu, Ebenezer Kofi; Nkrumah, Evans Ewald; Tschapka, Marco; Oppong, Samuel; Adu-Sarkodie, Yaw

    2015-01-01

    Because some bats host viruses with zoonotic potential, we investigated human–bat interactions in rural Ghana during 2011–2012. Nearly half (46.6%) of respondents regularly visited bat caves; 37.4% had been bitten, scratched, or exposed to bat urine; and 45.6% ate bat meat. Human–bat interactions in rural Ghana are frequent and diverse. PMID:26177344

  14. Human-Bat Interactions in Rural West Africa.

    Science.gov (United States)

    Anti, Priscilla; Owusu, Michael; Agbenyega, Olivia; Annan, Augustina; Badu, Ebenezer Kofi; Nkrumah, Evans Ewald; Tschapka, Marco; Oppong, Samuel; Adu-Sarkodie, Yaw; Drosten, Christian

    2015-08-01

    Because some bats host viruses with zoonotic potential, we investigated human-bat interactions in rural Ghana during 2011-2012. Nearly half (46.6%) of respondents regularly visited bat caves; 37.4% had been bitten, scratched, or exposed to bat urine; and 45.6% ate bat meat. Human-bat interactions in rural Ghana are frequent and diverse.

  15. Bat Hunting and Bat-Human Interactions in Bangladeshi Villages: Implications for Zoonotic Disease Transmission and Bat Conservation.

    Science.gov (United States)

    Openshaw, J J; Hegde, S; Sazzad, H M S; Khan, S U; Hossain, M J; Epstein, J H; Daszak, P; Gurley, E S; Luby, S P

    2017-08-01

    Bats are an important reservoir for emerging zoonotic pathogens. Close human-bat interactions, including the sharing of living spaces and hunting and butchering of bats for food and medicines, may lead to spillover of zoonotic disease into human populations. We used bat exposure and environmental data gathered from 207 Bangladeshi villages to characterize bat exposures and hunting in Bangladesh. Eleven percent of households reported having a bat roost near their homes, 65% reported seeing bats flying over their households at dusk, and 31% reported seeing bats inside their compounds or courtyard areas. Twenty percent of households reported that members had at least daily exposure to bats. Bat hunting occurred in 49% of the villages surveyed and was more likely to occur in households that reported nearby bat roosts (adjusted prevalence ratio [aPR] 2.3, 95% CI 1.1-4.9) and villages located in north-west (aPR 7.5, 95% CI 2.5-23.0) and south-west (aPR 6.8, 95% CI 2.1-21.6) regions. Our results suggest high exposure to bats and widespread hunting throughout Bangladesh. This has implications for both zoonotic disease spillover and bat conservation. © 2016 Blackwell Verlag GmbH.

  16. Prompt Emission Observations of Swift BAT Bursts

    Science.gov (United States)

    Barthelmy, Scott

    2009-01-01

    We review the prompt emission properties of Swift BAT gamma-ray bursts (GRBs). We present the global properties of BAT GRBs based on their spectral and temporal characteristics. The BAT T90 and T50 durations peak at 80 and 20 s, respectively. The peak energy (Epeak) of about 60% of BAT GRBs is very likely to be less than 1.00 keV. We also present the BAT characteristics of GRBs with soft spectra, so called Xray flashes (XRFs). We will compare the BAT GRBs and XRFs parameter distribution to the other missions.

  17. Coendangered hard-ticks: threatened or threatening?

    Directory of Open Access Journals (Sweden)

    Cozma Vasile

    2011-05-01

    Full Text Available Abstract The overwhelming majority of animal conservation projects are focused on vertebrates, despite most of the species on Earth being invertebrates. Estimates state that about half of all named species of invertebrates are parasitic in at least one stage of their development. The dilemma of viewing parasites as biodiversity or pest has been discussed by several authors. However, ticks were omitted. The latest taxonomic synopses of non-fossil Ixodidae consider valid 700 species. Though, how many of them are still extant is almost impossible to tell, as many of them are known only from type specimens in museums and were never collected since their original description. Moreover, many hosts are endangered and as part of conservation efforts of threatened vertebrates, a common practice is the removal of, and treatment for external parasites, with devastating impact on tick populations. There are several known cases when the host became extinct with subsequent coextinction of their ectoparasites. For our synoptic approach we have used the IUCN status of the host in order to evaluate the status of specifically associated hard-ticks. As a result, we propose a number of 63 coendangered and one extinct hard-tick species. On the other side of the coin, the most important issue regarding tick-host associations is vectorial transmission of microbial pathogens (i.e. viruses, bacteria, protozoans. Tick-borne diseases of threatened vertebrates are sometimes fatal to their hosts. Mortality associated with pathogens acquired from ticks has been documented in several cases, mostly after translocations. Are ticks a real threat to their coendangered host and should they be eliminated? Up to date, there are no reliable proofs that ticks listed by us as coendangered are competent vectors for pathogens of endangered animals.

  18. Breeding strategies for tick resistance in tropical cattle: a sustainable approach for tick control

    OpenAIRE

    Shyma, K. P.; Gupta, Jay Prakash; Singh, Veer

    2013-01-01

    About 80 % of world cattle population is under the risk of ticks and tick borne diseases (TTBDs). Losses caused by bovine tick burdens in tropical countries have a tremendous economic impact on production systems. Chemical control of disease has been found to be ineffective and also involving large cost. To reduce our reliance on these chemical products, it is necessary to embark on programs that include habitat management, genetic selection of hosts, and development of a strain capable of in...

  19. ACTUAL TICK-BORNE INFECTIONS IN CRIMEA

    Directory of Open Access Journals (Sweden)

    M. V. Gorovenko

    2016-01-01

    Full Text Available The Crimean Peninsula is located in the Northern part of the Black sea, from the East it is washed by the Sea of Azov, to the South and West by the Black Sea. The unique geographical and climatic conditions facilitate leptospirosis, tularemia, tick-borne encephalitis, Lyme disease, intestinal yersiniosis, pseudotuberculosis, hemorrhagic fever with renal syndrome, Crimean-Congo hemorrhagic fever, Mediterranean fever, Q-fever and other infectious diseases natural foci formation on the territory of Crimea Republic. Tick-borne natural focal infections have the most significance due to favorable epidemiologic conditions especially on the background of high raid ticks attacks on people. A leading role in the epizootology and epidemiology of tick-borne natural-focal infections of the Crimea are playing Ixodidae that occur in different landscape-climatic zones, with the greatest their species diversity is observed in mountain-foothill, forest and forest-steppe regions. There are about 30 species in Ixodidae fauna of the Crimean Peninsula. Ticks species composition identification shows that over 50% of people attacks episodes in the Crimea on recent years is caused by Ixodes ricinus ticks species, the remaining are associated with Haemophisalis punctata, Rhipicephalus sanguineus, Hyalomma marginatum, Dermacentor marginatus and other. Refusal of treatment in medical institutions of the people affected by tick bites, and the possibility of an attack on people subtle phases of mites are lubricates the real picture of the frequency of contacts of the population with ticks and complicates the forecasting of the epidemiological situation. This review summarizes the available information about spreading of tick-borne encephalitis, Lyme disease, Mediterranean and Crimean-Congo haemorrhagic fevers on the territory of Crimea Republic and demonstrates the modern trends and manifestations of epidemic process of these nosological forms. The results

  20. Microbial Invasion vs. Tick Immune Regulation.

    Science.gov (United States)

    Sonenshine, Daniel E; Macaluso, Kevin R

    2017-01-01

    Ticks transmit a greater variety of pathogenic agents that cause disease in humans and animals than any other haematophagous arthropod, including Lyme disease, Rocky Mountain spotted fever, human granulocytic anaplasmosis, babesiosis, tick-borne encephalitis, Crimean Congo haemorhagic fever, and many others (Gulia-Nuss et al., 2016). Although diverse explanations have been proposed to explain their remarkable vectorial capacity, among the most important are their blood feeding habit, their long term off-host survival, the diverse array of bioactive molecules that disrupt the host's natural hemostatic mechanisms, facilitate blood flow, pain inhibitors, and minimize inflammation to prevent immune rejection (Hajdušek et al., 2013). Moreover, the tick's unique intracellular digestive processes allow the midgut to provide a relatively permissive microenvironment for survival of invading microbes. Although tick-host-pathogen interactions have evolved over more than 300 million years (Barker and Murrell, 2008), few microbes have been able to overcome the tick's innate immune system, comprising both humoral and cellular processes that reject them. Similar to most eukaryotes, the signaling pathways that regulate the innate immune response, i.e., the Toll, IMD (Immunodeficiency) and JAK-STAT (Janus Kinase/ Signal Transducers and Activators of Transcription) also occur in ticks (Gulia-Nuss et al., 2016). Recognition of pathogen-associated molecular patterns (PAMPs) on the microbial surface triggers one or the other of these pathways. Consequently, ticks are able to mount an impressive array of humoral and cellular responses to microbial challenge, including anti-microbial peptides (AMPs), e.g., defensins, lysozymes, microplusins, etc., that directly kill, entrap or inhibit the invaders. Equally important are cellular processes, primarily phagocytosis, that capture, ingest, or encapsulate invading microbes, regulated by a primordial system of thioester-containing proteins

  1. Microbial Invasion vs. Tick Immune Regulation

    Directory of Open Access Journals (Sweden)

    Daniel E. Sonenshine

    2017-09-01

    Full Text Available Ticks transmit a greater variety of pathogenic agents that cause disease in humans and animals than any other haematophagous arthropod, including Lyme disease, Rocky Mountain spotted fever, human granulocytic anaplasmosis, babesiosis, tick-borne encephalitis, Crimean Congo haemorhagic fever, and many others (Gulia-Nuss et al., 2016. Although diverse explanations have been proposed to explain their remarkable vectorial capacity, among the most important are their blood feeding habit, their long term off-host survival, the diverse array of bioactive molecules that disrupt the host's natural hemostatic mechanisms, facilitate blood flow, pain inhibitors, and minimize inflammation to prevent immune rejection (Hajdušek et al., 2013. Moreover, the tick's unique intracellular digestive processes allow the midgut to provide a relatively permissive microenvironment for survival of invading microbes. Although tick-host-pathogen interactions have evolved over more than 300 million years (Barker and Murrell, 2008, few microbes have been able to overcome the tick's innate immune system, comprising both humoral and cellular processes that reject them. Similar to most eukaryotes, the signaling pathways that regulate the innate immune response, i.e., the Toll, IMD (Immunodeficiency and JAK-STAT (Janus Kinase/ Signal Transducers and Activators of Transcription also occur in ticks (Gulia-Nuss et al., 2016. Recognition of pathogen-associated molecular patterns (PAMPs on the microbial surface triggers one or the other of these pathways. Consequently, ticks are able to mount an impressive array of humoral and cellular responses to microbial challenge, including anti-microbial peptides (AMPs, e.g., defensins, lysozymes, microplusins, etc., that directly kill, entrap or inhibit the invaders. Equally important are cellular processes, primarily phagocytosis, that capture, ingest, or encapsulate invading microbes, regulated by a primordial system of thioester

  2. Prevalence of tick-borne pathogens in ticks collected from migratory birds in Latvia.

    Science.gov (United States)

    Capligina, Valentina; Salmane, Ineta; Keišs, Oskars; Vilks, Karlis; Japina, Kristine; Baumanis, Viesturs; Ranka, Renate

    2014-02-01

    Migratory birds act as hosts and long-distance vectors for several tick-borne infectious agents. Here, feeding Ixodes ticks were collected from migratory birds during the autumn migration period in Latvia and screened for the presence of epidemiologically important non-viral pathogens. A total of 93 DNA samples of ticks (37 larvae and 56 nymphs) removed from 41 birds (order Passeriformes, 9 species) was tested for Lyme borreliosis spirochaetes, Anaplasma phagocytophilum, Rickettsia spp., and Babesia spp. Borrelia burgdorferi DNA was detected in 18% of the tick samples, and a majority of infected ticks were from thrush (Turdus spp.) birds. Among the infected ticks, Borrelia valaisiana was detected in 41% of cases, Borrelia garinii in 35%, and mixed Bo. valaisiana and Bo. garinii infection in 24%. Anaplasma phagocytophilum DNA was detected in 2% of ticks, R. helvetica in 12%, and Babesia spp. pathogens in 4% of ticks. Among these samples, 3 Babesia species were identified: Ba. divergens, Ba. microti, and Ba. venatorum. Coinfection with different pathogens that included mixed infections with different Borrelia genospecies was found in 20% of nymphal and 3% of larval Ixodes ticks. These results suggest that migratory birds may support the circulation and spread of medically significant zoonoses in Europe. Copyright © 2013 Elsevier GmbH. All rights reserved.

  3. Identification of tick-borne pathogens in ticks feeding on humans in Turkey.

    Directory of Open Access Journals (Sweden)

    Ömer Orkun

    2014-08-01

    Full Text Available The importance of tick-borne diseases is increasing all over the world, including Turkey. The tick-borne disease outbreaks reported in recent years and the abundance of tick species and the existence of suitable habitats increase the importance of studies related to the epidemiology of ticks and tick-borne pathogens in Turkey. The aim of this study was to investigate the presence of and to determine the infection rates of some tick-borne pathogens, including Babesia spp., Borrelia burgdorferi sensu lato and spotted fever group rickettsiae in the ticks removed from humans in different parts of Ankara.A total of 169 ticks belonging to the genus Haemaphysalis, Hyalomma, Ixodes and Rhipicephalus were collected by removing from humans in different parts of Ankara. Ticks were molecularly screened for Babesia spp., Borrelia burgdorferi sensu lato and spotted fever group rickettsiae by PCR and sequencing analysis. We detected 4 Babesia spp.; B. crassa, B. major, B. occultans and B. rossi, one Borrelia spp.; B. burgdorferi sensu stricto and 3 spotted fever group rickettsiae; R. aeschlimannii, R. slovaca and R. hoogstraalii in the tick specimens analyzed. This is the report showing the presence of B. rossi in a region that is out of Africa and in the host species Ha. parva. In addition, B. crassa, for which limited information is available on its distribution and vector species, and B. occultans, for which no conclusive information is available on its presence in Turkey, were identified in Ha. parva and H. marginatum, respectively. Two human pathogenic rickettsia species (R. aeschlimannii and R. slovaca were detected with a high prevalence in ticks. Additionally, B. burgdorferi sensu stricto was detected in unusual tick species (H. marginatum, H. excavatum, Hyalomma spp. (nymph and Ha. parva.This study investigates both the distribution of several tick-borne pathogens affecting humans and animals, and the presence of new tick-borne pathogens in Turkey

  4. Identification of tick-borne pathogens in ticks feeding on humans in Turkey.

    Science.gov (United States)

    Orkun, Ömer; Karaer, Zafer; Çakmak, Ayşe; Nalbantoğlu, Serpil

    2014-08-01

    The importance of tick-borne diseases is increasing all over the world, including Turkey. The tick-borne disease outbreaks reported in recent years and the abundance of tick species and the existence of suitable habitats increase the importance of studies related to the epidemiology of ticks and tick-borne pathogens in Turkey. The aim of this study was to investigate the presence of and to determine the infection rates of some tick-borne pathogens, including Babesia spp., Borrelia burgdorferi sensu lato and spotted fever group rickettsiae in the ticks removed from humans in different parts of Ankara. A total of 169 ticks belonging to the genus Haemaphysalis, Hyalomma, Ixodes and Rhipicephalus were collected by removing from humans in different parts of Ankara. Ticks were molecularly screened for Babesia spp., Borrelia burgdorferi sensu lato and spotted fever group rickettsiae by PCR and sequencing analysis. We detected 4 Babesia spp.; B. crassa, B. major, B. occultans and B. rossi, one Borrelia spp.; B. burgdorferi sensu stricto and 3 spotted fever group rickettsiae; R. aeschlimannii, R. slovaca and R. hoogstraalii in the tick specimens analyzed. This is the report showing the presence of B. rossi in a region that is out of Africa and in the host species Ha. parva. In addition, B. crassa, for which limited information is available on its distribution and vector species, and B. occultans, for which no conclusive information is available on its presence in Turkey, were identified in Ha. parva and H. marginatum, respectively. Two human pathogenic rickettsia species (R. aeschlimannii and R. slovaca) were detected with a high prevalence in ticks. Additionally, B. burgdorferi sensu stricto was detected in unusual tick species (H. marginatum, H. excavatum, Hyalomma spp. (nymph) and Ha. parva). This study investigates both the distribution of several tick-borne pathogens affecting humans and animals, and the presence of new tick-borne pathogens in Turkey. More

  5. BGD: a database of bat genomes.

    Directory of Open Access Journals (Sweden)

    Jianfei Fang

    Full Text Available Bats account for ~20% of mammalian species, and are the only mammals with true powered flight. For the sake of their specialized phenotypic traits, many researches have been devoted to examine the evolution of bats. Until now, some whole genome sequences of bats have been assembled and annotated, however, a uniform resource for the annotated bat genomes is still unavailable. To make the extensive data associated with the bat genomes accessible to the general biological communities, we established a Bat Genome Database (BGD. BGD is an open-access, web-available portal that integrates available data of bat genomes and genes. It hosts data from six bat species, including two megabats and four microbats. Users can query the gene annotations using efficient searching engine, and it offers browsable tracks of bat genomes. Furthermore, an easy-to-use phylogenetic analysis tool was also provided to facilitate online phylogeny study of genes. To the best of our knowledge, BGD is the first database of bat genomes. It will extend our understanding of the bat evolution and be advantageous to the bat sequences analysis. BGD is freely available at: http://donglab.ecnu.edu.cn/databases/BatGenome/.

  6. BGD: a database of bat genomes.

    Science.gov (United States)

    Fang, Jianfei; Wang, Xuan; Mu, Shuo; Zhang, Shuyi; Dong, Dong

    2015-01-01

    Bats account for ~20% of mammalian species, and are the only mammals with true powered flight. For the sake of their specialized phenotypic traits, many researches have been devoted to examine the evolution of bats. Until now, some whole genome sequences of bats have been assembled and annotated, however, a uniform resource for the annotated bat genomes is still unavailable. To make the extensive data associated with the bat genomes accessible to the general biological communities, we established a Bat Genome Database (BGD). BGD is an open-access, web-available portal that integrates available data of bat genomes and genes. It hosts data from six bat species, including two megabats and four microbats. Users can query the gene annotations using efficient searching engine, and it offers browsable tracks of bat genomes. Furthermore, an easy-to-use phylogenetic analysis tool was also provided to facilitate online phylogeny study of genes. To the best of our knowledge, BGD is the first database of bat genomes. It will extend our understanding of the bat evolution and be advantageous to the bat sequences analysis. BGD is freely available at: http://donglab.ecnu.edu.cn/databases/BatGenome/.

  7. The Kinetics of Swinging a Baseball Bat.

    Science.gov (United States)

    Crisco, Joseph J; Osvalds, Nikolas J; Rainbow, Michael J

    2018-04-13

    The purpose of this study was to compute the three-dimensional kinetics required to swing three youth baseball bats of varying moments of inertia (MOI). 306 swings by 22 male players (13-18 yrs.) were analyzed. Inverse dynamics with respect to the batter's hands were computed given the known kinematics and physical properties of the bats. We found that peak force increased with larger bat MOI and was strongly correlated with bat tip speed. In contrast, peak moments were weakly correlated with bat MOI and bat tip speed. Throughout the swing, the force applied to the bat was dominated by a component aligned with the long axis of the bat and directed away from the bat knob, while the moment applied to the bat was minimal until just prior to ball impact. These results indicate that players act to mostly "pull" the bat during their swing until just prior to ball impact, at which point they rapidly increase the moment on the bat. This kinetic analysis provides novel insight into the forces and moments used to swing baseball bats.

  8. Interaction of the tick immune system with transmitted pathogens

    Directory of Open Access Journals (Sweden)

    Ondrej eHajdusek

    2013-07-01

    Full Text Available Ticks are hematophagous arachnids transmitting a wide variety of pathogens including viruses, bacteria, and protozoans to their vertebrate hosts. The tick vector competence has to be intimately linked to the ability of transmitted pathogens to evade tick defense mechanisms encountered on their route through the tick body comprising midgut, hemolymph, salivary glands or ovaries. Tick innate immunity is, like in other invertebrates, based on an orchestrated action of humoral and cellular immune responses. The direct antimicrobial defense in ticks is accomplished by a variety of small molecules such as defensins, lysozymes or by tick-specific antimicrobial compounds such as microplusin/hebraein or 5.3-kDa family proteins. Phagocytosis of the invading microbes by tick hemocytes seems to be mediated by the primordial complement-like system composed of thioester-containing proteins, fibrinogen-related lectins and convertase-like factors. Moreover, an important role in survival of the ingested microbes seems to be played by host proteins and redox balance maintenance in the tick midgut. Here, we summarize recent knowledge about the major components of tick immune system and focus on their interaction with the relevant tick-transmitted pathogens, represented by spirochetes (Borrelia, rickettsiae (Anaplasma, and protozoans (Babesia. Availability of the tick genomic database and feasibility of functional genomics based on RNA interference greatly contribute to the understanding of molecular and cellular interplay at the tick-pathogen interface and may provide new targets for blocking the transmission of tick pathogens.

  9. [Bats and Viruses: complex relationships].

    Science.gov (United States)

    Rodhain, F

    2015-10-01

    With more than 1 200 species, bats and flying foxes (Order Chiroptera) constitute the most important and diverse order of Mammals after Rodents. Many species of bats are insectivorous while others are frugivorous and few of them are hematophagous. Some of these animals fly during the night, others are crepuscular or diurnal. Some fly long distances during seasonal migrations. Many species are colonial cave-dwelling, living in a rather small home range while others are relatively solitary. However, in spite of the importance of bats for terrestrial biotic communities and ecosystem ecology, the diversity in their biology and lifestyles remain poorly known and underappreciated. More than sixty viruses have been detected or isolated in bats; these animals are therefore involved in the natural cycles of many of them. This is the case, for instance, of rabies virus and other Lyssavirus (Family Rhabdoviridae), Nipah and Hendra viruses (Paramyxoviridae), Ebola and Marburg viruses (Filoviridae), SARS-CoV and MERS-CoV (Coronaviridae). For these zoonotic viruses, a number of bat species are considered as important reservoir hosts, efficient disseminators or even directly responsible of the transmission. Some of these bat-borne viruses cause highly pathogenic diseases while others are of potential significance for humans and domestic or wild animals; so, bats are an important risk in human and animal public health. Moreover, some groups of viruses developed through different phylogenetic mechanisms of coevolution between viruses and bats. The fact that most of these viral infections are asymptomatic in bats has been observed since a long time but the mechanisms of the viral persistence are not clearly understood. The various bioecology of the different bat populations allows exchange of virus between migrating and non-migrating conspecific species. For a better understanding of the role of bats in the circulation of these viral zoonoses, epidemiologists must pay attention to

  10. Molecular Ecological Insights into Neotropical Bird-Tick Interactions.

    Science.gov (United States)

    Miller, Matthew J; Esser, Helen J; Loaiza, Jose R; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds' role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually-sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna). Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical-Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically-identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly-discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology and the dynamics of

  11. Molecular Ecological Insights into Neotropical Bird-Tick Interactions.

    Directory of Open Access Journals (Sweden)

    Matthew J Miller

    Full Text Available In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds' role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually-sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna. Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical-Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically-identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly-discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology

  12. Tick control: trapping, biocontrol, host management and other alternative strategies

    Science.gov (United States)

    Ginsberg, Howard S.; Edited by Sonenshine, Daniel E.; Roe, R. Michael

    2014-01-01

    Biology of Ticks is the most comprehensive work on tick biology and tick-borne diseases. This second edition is a multi-authored work, featuring the research and analyses of renowned experts across the globe. Spanning two volumes, the book examines the systematics, biology, structure, ecological adaptations, evolution, genomics and the molecular processes that underpin the growth, development and survival of these important disease-transmitting parasites. Also discussed is the remarkable array of diseases transmitted (or caused) by ticks, as well as modern methods for their control. This book should serve as a modern reference for students, scientists, physicians, veterinarians and other specialists. Volume I covers the biology of the tick and features chapters on tick systematics, tick life cycles, external and internal anatomy, and others dedicated to specific organ systems, specifically, the tick integument, mouthparts and digestive system, salivary glands, waste removal, salivary glands, respiratory system, circulatory system and hemolymph, fat body, the nervous and sensory systems and reproductive systems. Volume II includes chapters on the ecology of non-nidicolous and nidicolous ticks, genetics and genomics (including the genome of the Lyme disease vector Ixodes scapularis) and immunity, including host immune responses to tick feeding and tick-host interactions, as well as the tick's innate immune system that prevents and/or controls microbial infections. Six chapters cover in depth the many diseases caused by the major tick-borne pathogens, including tick-borne protozoa, viruses, rickettsiae of all types, other types of bacteria (e.g., the Lyme disease agent) and diseases related to tick paralytic agents and toxins. The remaining chapters are devoted to tick control using vaccines, acaricides, repellents, biocontrol, and, finally, techniques for breeding ticks in order to develop tick colonies for scientific study.

  13. Molecular Ecological Insights into Neotropical Bird–Tick Interactions

    Science.gov (United States)

    Esser, Helen J.; Loaiza, Jose R.; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds’ role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually–sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna). Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical–Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically–identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly–discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology and the

  14. Bat study in the Kharaa region, Mongolia

    Directory of Open Access Journals (Sweden)

    Ariunbold Jargalsaikhan

    2016-06-01

    Full Text Available Our study objectives were to determine bat species composition and to study the genetic variations and sound characteristics in bats of the Kharaa, Shatan, and Ulgii areas of Mongolia. This study is the first bat survey in this area. Nineteen species were from Mongolia. Six bat species belonged to three genera. We performed mitochondrial DNA sequencing of Myotis bombinus, Myotis gracilis, and Myotis petax to confirm the morphological identification of these species. We also determined the sound frequencies of the six bat species, based on their echolocation calls. The conservation status was determined using World Conservation Union red list categories and criteria. Sixteen bats from three species were ringed during this study and three artificial boxes were placed on trees in the Kharaa River Valley. Other than the northern bat, all species were eastern Palearctic. The northern bat (Eptesicus nilssonii species is widespread in the northern Palearctic region.

  15. The evolution of echolocation in bats.

    Science.gov (United States)

    Jones, Gareth; Teeling, Emma C

    2006-03-01

    Recent molecular phylogenies have changed our perspective on the evolution of echolocation in bats. These phylogenies suggest that certain bats with sophisticated echolocation (e.g. horseshoe bats) share a common ancestry with non-echolocating bats (e.g. Old World fruit bats). One interpretation of these trees presumes that laryngeal echolocation (calls produced in the larynx) probably evolved in the ancestor of all extant bats. Echolocation might have subsequently been lost in Old World fruit bats, only to evolve secondarily (by tongue clicking) in this family. Remarkable acoustic features such as Doppler shift compensation, whispering echolocation and nasal emission of sound each show multiple convergent origins in bats. The extensive adaptive radiation in echolocation call design is shaped largely by ecology, showing how perceptual challenges imposed by the environment can often override phylogenetic constraints.

  16. Tick Bite Alopecia: A Report and Review.

    Science.gov (United States)

    Lynch, Michael C; Milchak, Marissa A; Parnes, Herbert; Ioffreda, Michael D

    2016-11-01

    Tick bites can cause a number of local inflammatory reactions, which are often difficult to differentiate from those induced by other arthropod bites or stings. These include erythematous nodular or pustular lesions, erosive plaques, annular lesions of erythema chronicum migrans, and both scarring and nonscarring inflammatory alopecia. We report a case of nonscarring alopecia in a 21-year-old male who reported a recent history of tick bite to the scalp. The biopsy demonstrated a dense pseudolymphomatous inflammatory infiltrate with numerous eosinophils associated with hair follicle miniaturization and an elevated catagen-telogen count. Signs of external rubbing, including lichen simplex chronicus and the "hamburger sign", were also visualized and are indicative of the associated pruritus. To the authors' knowledge, this is the fifth report of nonscarring tick bite alopecia in the literature and the first in an adult patient. This text will review the classic clinical presentation, histologic findings, and proposed mechanism of tick bite alopecia.

  17. Biological control of cattle fever ticks

    Science.gov (United States)

    Cattle fever ticks (CFT) Rhipicephalus microplus and Rhipicephalus annulatus are invasive livestock pests that are endemic to Mexico and invasive along the Texas – Mexico border. Acaricide resistance, alternate wildlife hosts, and pathogenic landscape forming weeds present challenges for sustainable...

  18. Scouts, forests, and ticks: Impact of landscapes on human-tick contacts.

    Science.gov (United States)

    De Keukeleire, Mathilde; Vanwambeke, Sophie O; Somassè, Elysée; Kabamba, Benoît; Luyasu, Victor; Robert, Annie

    2015-07-01

    Just as with forest workers or people practicing outdoor recreational activities, scouts are at high risk for tick bites and tick-borne infections. The risk of a tick bite is shaped not only by environmental and climatic factors but also by land management. The aim of this study was to assess which environmental conditions favour scout-tick contacts, and thus to better understand how these factors and their interactions influence the two components of risk: hazard (related to vector and host ecology) and exposure of humans to disease vectors. A survey was conducted in the summer of 2009 on the incidence of tick bites in scout camps taking place in southern Belgium. Joint effects of landscape composition and configuration, weather, climate, forest and wildlife management were examined using a multiple gamma regression with a log link. The landscape was characterized by buffers of varying sizes around the camps using a detailed land use map, and accounting for climate and weather variables. Landscape composition and configuration had a significant influence on scout-tick contacts: the risk was high when the camp was surrounded by a low proportion of arable land and situated in a complex and fragmented landscape. The distance to the nearest forest patch, the composition of the forest ecotone as well as weather and climatic factors were all significantly associated with scout-tick contacts. Both hazard- and exposure-related variables significantly contributed to the frequency of scout-tick contact. Our results show that environmental conditions favour scout-tick contacts. For example, we emphasize the impact of accessibility of environments suitable for ticks on the risk of contact. We also highlight the significant effect of both hazard and exposure. Our results are consistent with current knowledge, but further investigations on the effect of forest management, e.g. through its impact on forest structure, on the tick-host-pathogen system, and on humans exposure, is

  19. Small risk of developing symptomatic tick-borne diseases following a tick bite in the Netherlands

    Directory of Open Access Journals (Sweden)

    Hofhuis Agnetha

    2011-02-01

    Full Text Available Abstract Background In The Netherlands, the incidence of Lyme borreliosis is on the rise. Besides its causative agent, Borrelia burgdorferi s.l., other potential pathogens like Rickettsia, Babesia and Ehrlichia species are present in Ixodes ricinus ticks. The risk of disease associated with these microorganisms after tick-bites remains, however, largely unclear. A prospective study was performed to investigate how many persons with tick-bites develop localized or systemic symptoms and whether these are associated with tick-borne microorganisms. Results In total, 297 Ixodes ricinus ticks were collected from 246 study participants who consulted a general practitioner on the island of Ameland for tick bites. Ticks were subjected to PCR to detect DNA of Borrelia burgdorferi s.l., Rickettsia spp., Babesia spp. or Ehrlichia/Anaplasma spp.. Sixteen percent of the collected ticks were positive for Borrelia burgdorferi s.l., 19% for Rickettsia spp., 12% for Ehrlichia/Anaplasma spp. and 10% for Babesia spp.. At least six months after the tick bite, study participants were interviewed on symptoms by means of a standard questionnaire. 14 out of 193 participants (8.3% reported reddening at the bite site and 6 participants (4.1% reported systemic symptoms. No association between symptoms and tick-borne microorganisms was found. Attachment duration ≥24 h was positively associated with reddening at the bite site and systemic symptoms. Using logistic regression techniques, reddening was positively correlated with presence of Borrelia afzelii, and having 'any symptoms' was positively associated with attachment duration. Conclusion The risk of contracting acute Lyme borreliosis, rickettsiosis, babesiosis or ehrlichiosis from a single tick bite was

  20. Prevalence of Tick-Borne Pathogens in Hard Ticks That Attacked Human Hosts in Eastern Siberia

    Directory of Open Access Journals (Sweden)

    Maxim A. Khasnatinov

    2017-12-01

    Full Text Available The aim of this study was to evaluate the risk of tick-borne infections in humans. The prevalence of 4 tick-borne pathogens was studied in the population of Ixodid ticks attacking human hosts in Irkutsk city and neighbouring territories from 2007 to 2017. Methods and Results: In total, 46,357 tick specimens detached from bitten people were analyzed. The antigen of tick-borne encephalitis virus (TBEV was detected in each tick individually by ELISA assay using a commercial kit for the envelope protein E of TBEV. Total RNA and DNA were extracted from ticks using a RiboPrep kit. Reverse transcription was performed using a Reverta-L kit and RNA\\DNA of TBEV; B. burgdorferi sensu lato, A. phagocytophylum and Ehrlichia muris\\E. chaffeensis were detected using a real-time multiplex PCR kit. In total, during 8 years of observations, I. persulcatus caused approximately 86% of bites, Dermacentor sp. 13.95 %, and H. concinna 0.05 %. The most prevalent tick-borne pathogen in I. persulcatus ticks was Lyme disease agent B. burgdorferi sensu lato, which was detected in 12±6.5% of specimens annually. A. phagocytophilum and Ehrlichia sp. were detected in 7.8±2.7% and 4.6±1.5% of specimens, respectively. TBEV was present in 1±0.7% of I. persulcatus. Conclusion: I. persulcatus remains the most important vector of tick-borne diseases to humans in Eastern Siberia. D. nuttalli and D. silvarum are much less aggressive to humans and are less infected with major tick-borne pathogens. H. concinna does not play any significant role as a disease vector. However, a rigorous analysis of TBEV spread in the Dermacentor sp. population is necessary.

  1. 76 FR 8709 - Environmental Impact Statement; Proposed Cattle Fever Tick Control Barrier in South Texas

    Science.gov (United States)

    2011-02-15

    ... ticks (collectively referred to as ``fever ticks'') carry protozoan parasites that cause babesiosis. The...] Environmental Impact Statement; Proposed Cattle Fever Tick Control Barrier in South Texas AGENCY: Animal and... tick control barrier using game fencing to keep cattle fever ticks and southern cattle ticks out of...

  2. Ticks imported to Europe with exotic reptiles.

    Science.gov (United States)

    Mihalca, Andrei Daniel

    2015-09-30

    It is known that traded exotic animals carry with them an immense number of associated symbionts, including parasites. Reptiles are no exception. Most of the imported reptiles originate from tropical countries and their possibility to carry potentially dangerous pathogens is high. According to CITES, Europe is currently the main reptile importer in the world. Despite this, there is no review or analysis available for the risk related to the importation of tick-borne diseases with traded reptile to the EU. The main aim of the manuscript is to provide a review on the available literature on ticks introduced to and exchanged between European countries via the live reptile trade. So far, the published reports of ticks imported on reptiles are limited to few European countries: Italy, Poland, Spain, Netherlands, Belgium, Slovenia and UK. The following species have been reported: Hyalomma aegyptium, Amblyomma dissimile, Amblyomma exornatum, Amblyomma flavomaculatum, Amblyomma fuscolineatum, Amblyomma latum, Amblyomma quadricavum, Amblyomma marmoreum, Amblyomma nuttalli, Amblyomma sparsum, Amblyomma sphenodonti, Amblyomma transversale and Amblyomma varanense. The majority of species are of African origin, followed by American and Asian species. All groups of reptiles (chelonians, snakes, lizards, crocodiles, tuataras) were involved. However, it seems that certain groups (i.e. tortoises of genus Testudo, monitor lizards of genus Varanus, snakes of genus Python) are more important as host for imported ticks, but this may be related to higher levels of international trade. Even fewer are the reports of tick-borne pathogens associated with imported reptile ticks. Despite the diversity of tick species reported on imported reptiles, the situations of truly invasive species are atypical and are limited in natural environments to maximum two cases where H. aegyptium was involved. Otherwise, the risk associated with reptile trade for introduction of invasive tick to Europe is low

  3. Swing Weights of Baseball and Softball Bats

    Science.gov (United States)

    Russell, Dan

    2010-01-01

    Baseball and softball bats are sold according to length in inches and weight in ounces. Much to the consternation of players buying new bats, however, not all bats that weigh the same swing the same. The reason for this has to do with moment of inertia of the bat about a pivot point on the handle, or what the sporting goods industry refers to as…

  4. Risk of Lyme disease development after a tick bite

    Directory of Open Access Journals (Sweden)

    Mladenović Jovan

    2010-01-01

    Full Text Available Background/Aim. Despite numerous research of Lyme disease (LD, there are still many concerns about environmental of infectious agent of LD, as well as its prophylaxis, diagnosis and treatment. The aim of this work was to determine the risk of LD in relation to the way of removing ticks and duration of tick attachment. Methods. In the period from 2000 to 2007 a prospective study was conducted including persons with tick bite referred to the Institute of Epidemiology, Military Medical Academy, and followed for the occurrence of early Lyme disease up to six months after a tick bite. Epidemiological questionnaire was used to collect relevant information about the place and time of tick bites, the way of a removing tick, duration of tick attachment, remnants of a tick left in the skin (parts of the mouth device and the signs of clinical manifestations of LD. Duration of tick attachment was determined on the basis of size of engorged tick and epidemiological data. Removed ticks were determined by the key of Pomerancev. Professional removing of attached tick was considered to be removing of tick with mechanical means by healthcare personnel. Fisher's exact test, Chi squares test and calculation of the relative risk (RR were used for data analysis. Results. Of 3 126 patients with tick bite, clinical manifestations of LD were demonstrated in 19 (0.61%. In the group of subjects (n = 829 in which a tick was not removed professionally there were 17 (2.05% cases with LD, while in the group of respondents (n=2 297 in who a tick was removed professionally there were 2 (0.09% cases with LD after tick bite (RR, 23.55; p < 0.0001. The disease was most frequent in the group of respondents with incompletely and unprofessionally removed ticks (2.46%. In the groups of patients with unprofessionally but completely removed ticks LD occurred in 0.89%, while in the group of subjects with a tick removed by an expert, but incompletely in 0.78% cases. The disease occurred

  5. Cattle tick vaccine researchers join forces in CATVAC

    CSIR Research Space (South Africa)

    Schetters, T

    2016-02-01

    Full Text Available grooming (e.g., with a short halter) for the duration of tick feeding to minimize grooming. Because ticks of the Boophilus group are one-host ticks, larvae will develop to nymphs and subsequently adults on the same animal. Fully engorged ticks that drop off... that the fact that in the natural situation there are usually fewer ticks feeding on the flank than for instance on the neck of the animals is likely due to the fact that cattle groom themselves, and remove ticks from those areas. An experimental trial...

  6. Bats as bushmeat in Madagascar | Jenkins | Madagascar ...

    African Journals Online (AJOL)

    Bats are eaten by people throughout Madagascar and although the larger species like Pteropus rufus, Eidolon dupreanum, Rousettus madagascariensis and Hipposideros commersoni are preferred, small insectivorous bats are also eaten. The national hunting season for bats is widely ignored and both unsuitable

  7. Coccidioides posadasii infection in bats, Brazil.

    Science.gov (United States)

    Cordeiro, Rossana de Aguiar; e Silva, Kylvia Rocha de Castro; Brilhante, Raimunda Sâmia Nogueira; Moura, Francisco Bergson Pinheiro; Duarte, Naylê Francelino Holanda; Marques, Francisca Jakelyne de Farias; Cordeiro, Rebecca de Aguiar; Filho, Renato Evando Moreira; de Araújo, Roberto Wagner Bezerra; Bandeira, Tereza de Jesus Pinheiro Gomes; Rocha, Marcos Fábio Gadelha; Sidrim, José Júlio Costa

    2012-04-01

    To analyze the eco-epidemiologic aspects of Histoplasma capsulatum in Brazil, we tested 83 bats for this fungus. Although H. capsulatum was not isolated, Coccidioides posadasii was recovered from Carollia perspicillata bat lungs. Immunologic studies detected coccidioidal antibodies and antigens in Glossophaga soricina and Desmodus rotundus bats.

  8. Coccidioides posadasii Infection in Bats, Brazil

    OpenAIRE

    Cordeiro, Rossana de Aguiar; Rocha de Castro e Silva, Kylvia; Brilhante, Raimunda Sâmia Nogueira; Moura, Francisco Bergson Pinheiro; Duarte, Naylê Francelino Holanda; Marques, Francisca Jakelyne de Farias; Cordeiro, Rebecca de Aguiar; Filho, Renato Evando Moreira; Bezerra de Araújo, Roberto Wagner; Bandeira, Tereza de Jesus Pinheiro Gomes; Rocha, Marcos Fábio Gadelha; Sidrim, José Júlio Costa

    2012-01-01

    To analyze the eco-epidemiologic aspects of Histoplasma capsulatum in Brazil, we tested 83 bats for this fungus. Although H. capsulatum was not isolated, Coccidioides posadasii was recovered from Carollia perspicillata bat lungs. Immunologic studies detected coccidioidal antibodies and antigens in Glossophaga soricina and Desmodus rotundus bats.

  9. Advances in disease control of tick and tick-borne diseases

    African Journals Online (AJOL)

    by Cowdria ruminatium. These diseases are transmitted by Rhipicephalus appemliculatus, Boopltilus decoloratus and Amblyomma variegatum, respectively which are widespread throughout the country and lack seasonality. The control of ticks and tick-borne diseases (TBD) has been one of the most important emphases of ...

  10. Effects of Climate Change on Ticks and Tick-Borne Diseases in Europe

    Directory of Open Access Journals (Sweden)

    J. S. Gray

    2009-01-01

    Full Text Available Zoonotic tick-borne diseases are an increasing health burden in Europe and there is speculation that this is partly due to climate change affecting vector biology and disease transmission. Data on the vector tick Ixodes ricinus suggest that an extension of its northern and altitude range has been accompanied by an increased prevalence of tick-borne encephalitis. Climate change may also be partly responsible for the change in distribution of Dermacentor reticulatus. Increased winter activity of  I. ricinus is probably due to warmer winters and a retrospective study suggests that hotter summers will change the dynamics and pattern of seasonal activity, resulting in the bulk of the tick population becoming active in the latter part of the year. Climate suitability models predict that eight important tick species are likely to establish more northern permanent populations in a climate-warming scenario. However, the complex ecology and epidemiology of such tick-borne diseases as Lyme borreliosis and tick-borne encephalitis make it difficult to implicate climate change as the main cause of their increasing prevalence. Climate change models are required that take account of the dynamic biological processes involved in vector abundance and pathogen transmission in order to predict future tick-borne disease scenarios.

  11. Tick-Borne Encephalitis Virus in Ticks and Roe Deer, the Netherlands.

    Science.gov (United States)

    Jahfari, Setareh; de Vries, Ankje; Rijks, Jolianne M; Van Gucht, Steven; Vennema, Harry; Sprong, Hein; Rockx, Barry

    2017-06-01

    We report the presence of tick-borne encephalitis virus (TBEV) in the Netherlands. Serologic screening of roe deer found TBEV-neutralizing antibodies with a seroprevalence of 2%, and TBEV RNA was detected in 2 ticks from the same location. Enhanced surveillance and awareness among medical professionals has led to the identification of autochthonous cases.

  12. Tick-Borne Encephalitis Virus in Ticks and Roe Deer, the Netherlands

    NARCIS (Netherlands)

    Jahfari, Setareh; de Vries, Ankje; Rijks, Jolianne M; Van Gucht, Steven; Vennema, Harry; Sprong, Hein; Rockx, Barry

    We report the presence of tick-borne encephalitis virus (TBEV) in the Netherlands. Serologic screening of roe deer found TBEV-neutralizing antibodies with a seroprevalence of 2%, and TBEV RNA was detected in 2 ticks from the same location. Enhanced surveillance and awareness among medical

  13. Tick-Borne Encephalitis Virus in Ticks and Roe Deer, the Netherlands.

    NARCIS (Netherlands)

    Jahfari, Setareh; de Vries, Ankje; Rijks, Jolianne M; Van Gucht, Steven; Vennema, Harry; Sprong, Hein; Rockx, Barry

    We report the presence of tick-borne encephalitis virus (TBEV) in the Netherlands. Serologic screening of roe deer found TBEV-neutralizing antibodies with a seroprevalence of 2%, and TBEV RNA was detected in 2 ticks from the same location. Enhanced surveillance and awareness among medical

  14. Ixodes ricinus tick saliva modulates tick-borne encephalitis virus infection of dendritic cells

    Czech Academy of Sciences Publication Activity Database

    Fialová, Anna; Cimburek, Zdeněk; Iezzi, G.; Kopecký, Jan

    2010-01-01

    Roč. 12, č. 7 (2010), s. 580-585 ISSN 1286-4579 R&D Projects: GA AV ČR IAA600960811 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z50200510 Keywords : Tick-borne encephalitis virus * Dendritic cell * Tick saliva * Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 2.726, year: 2010

  15. Breeding strategies for tick resistance in tropical cattle: a sustainable approach for tick control.

    Science.gov (United States)

    Shyma, K P; Gupta, Jay Prakash; Singh, Veer

    2015-03-01

    About 80 % of world cattle population is under the risk of ticks and tick borne diseases (TTBDs). Losses caused by bovine tick burdens in tropical countries have a tremendous economic impact on production systems. Chemical control of disease has been found to be ineffective and also involving large cost. To reduce our reliance on these chemical products, it is necessary to embark on programs that include habitat management, genetic selection of hosts, and development of a strain capable of inducing host resistance to ticks. Selection for disease resistance provide alternate method for sustainable control of TTBDs. Domestic livestock manifests tick-resistance by skin thickness, coat type, coat color, hair density and skin secretions etc. Zebu cattle have, on average, greater tick resistance than either European cattle or African cattle. Heritability for tick burden in cattle has been shown to range about 0.30, which is sufficient to result in the success of some programs of selection for tick resistance in cattle. To select animals at younger age, to reduce generation interval and to increase genetic gain, marker assisted selection is an important tool. There are also various MHC molecules which are associated with resistance to TTBDs.

  16. Ticks and tick-borne pathogens in wild birds in Greece.

    Science.gov (United States)

    Diakou, Anastasia; Norte, Ana Cláudia; Lopes de Carvalho, Isabel; Núncio, Sofia; Nováková, Markéta; Kautman, Matej; Alivizatos, Haralambos; Kazantzidis, Savas; Sychra, Oldřich; Literák, Ivan

    2016-05-01

    Wild birds are common hosts of ticks and can transport them for long distances, contributing to the spreading of tick-borne pathogens. The information about ticks on birds and tick-borne pathogens in Greece is limited. The present study aimed to evaluate the prevalence and species of ticks infesting wild resident birds (mostly small passerines) in Greece, and to assess Borrelia and Rickettsia infection in the collected ticks. Detection of Borrelia burgdorferi s.l. was performed by nested PCR targeting the flaB gene. Rickettsia spp. were detected by PCR targeting the gltA and ompA genes. Seven (2 %) out of 403 birds examined in northern Greece in 2013 were infested with 15 ticks, identified as Ixodes frontalis, Ixodes acuminatus, Hyalomma marginatum, Hyalomma aegyptium and Hyalomma sp. All ticks were negative for Borrelia spp. while four of them were positive for rickettsiae (Rickettsia aeschlimannii in H. aegyptium and Rickettsia sp. in I. frontalis, H. aegyptium and H. marginatum). Ixodes acuminatus is reported for the first time in Greece and Sylvia borin is reported as a new host record for I. acuminatus.

  17. Reducing tick bite risk in Finland - combining citizen science and GIS for predictive modelling of tick occurrence

    Science.gov (United States)

    Sormunen, Jani; Kulha, Niko; Klemola, Tero

    2017-04-01

    Ticks (Acari: Ixodidae) and tick-borne diseases constitute a growing welfare problem in northern Europe and Russia. Surveys conducted in Russia, Sweden and Norway have revealed a northwards shift in distribution and an increase in tick abundance over the past few decades. In southwestern Finland, surveys have revealed a similar increase in tick abundance, as well as the presence of novel tick-borne pathogens. As avoiding risk areas and removing attached ticks as quickly as possible are the best available methods for preventing tick-borne diseases, accessible and up-to-date data on tick occurrence is essential. However, consistently tracking the nationwide distribution of ticks is impossible using traditional collection methods. Therefore, GIS-based predictive modelling for tick occurrence is required. In May 2015, a national tick collection campaign was launched by the University of Turku tick project, with the objective of mapping the current geographical distribution of the two tick species responsible for tick-borne infections in Finland, Ixodes ricinus and Ixodes persulcatus. During the collection campaign, citizens were asked to send any ticks they found to the University of Turku by letter, along with information on the collection locality. The campaign ended in September 2015 and was a great success, with nearly 7000 letters delivered to the University. These letters contained more than 20 000 individual ticks from all around Finland. The geographic data from the letters was converted into coordinate points after the campaign was concluded. Data from the national tick collection campaign revealed not only a northwards shift in the distribution of I. ricinus, but also novel foci for I. persulcatus in Finland. Strikingly, while they were otherwise found throughout Finland, I. persulcatus were absent from the south-southwestern coast, where I. ricinus is nevertheless abundant. The exact cause for this phenomenon is unclear, as I. persulcatus are found further

  18. Prevention and control strategies for ticks and pathogen transmission.

    Science.gov (United States)

    de La Fuente, J; Kocan, K M; Contreras, M

    2015-04-01

    Ticks and tick-borne pathogens have evolved together, resulting in a complex relationship in which the pathogen's life cycle is perfectly coordinated with the tick's feeding cycle, and the tick can harbour high pathogen levels without affecting its biology. Tick-borne diseases (TBDs) continue to emerge and/or spread, and pose an increasing threatto human and animal health. The disruptive impacts of global change have resulted in ecosystem instability and the future outcomes of management and control programmes for ticks and TBDs are difficult to predict. In particular, the selection of acaricide-resistant ticks has reduced the value of acaricides as a sole means of tick control. Vaccines provide an alternative control method, but the use of tick vaccines has not advanced since the first vaccines were registered in the early 1990s. An understanding of the complex molecular relationship between hosts, ticks and pathogens and the use of systems biology and vaccinomics approaches are needed to discover proteins with the relevant biological function in tick feeding, reproduction, development, immune response, the subversion of host immunity and pathogen transmission, all of which mediate tick and pathogen success. The same approaches will also be required to characterise candidate protective antigens and to validate vaccine formulations. Tick vaccines with a dual effect on tick infestations and pathogen transmission could reduce both tick infestations and their vector capacity for humans, animals and reservoir hosts. The development of integrated tick control strategies, including vaccines and synthetic and botanical acaricides, in combination with managing drug resistance and educating producers, should lead to the sustainable control of ticks and TBDs.

  19. Attachment site selection of ticks on roe deer, Capreolus capreolus.

    Science.gov (United States)

    Kiffner, C; Lödige, C; Alings, M; Vor, T; Rühe, F

    2011-01-01

    The spatio-temporal attachment site patterns of ticks feeding on their hosts can be of significance if co-feeding transmission (i.e. from tick to tick without a systemic infection of the host) of pathogens affects the persistence of a given disease. Using tick infestation data on roe deer, we analysed preferred attachment sites and niche width of Ixodes ticks (larvae, nymphs, males, females) and investigated the degree of inter- and intrastadial aggregation. The different development stages showed rather consistent attachment site patterns and relative narrow feeding site niches. Larvae were mostly found on the head and on the front legs of roe deer, nymphs reached highest densities on the head and highest adult densities were found on the neck of roe deer. The tick stages feeding (larvae, nymphs, females) on roe deer showed high degrees of intrastadial spatial aggregation, whereas males did not. Male ticks showed large feeding site overlap with female ticks. Feeding site overlap between larval-female and larval-nymphal ticks did occur especially during the months May-August on the head and front legs of roe deer and might allow pathogen transmission via co-feeding. Tick density, niche width and niche overlap on roe deer are mainly affected by seasonality, reflecting seasonal activity and abundance patterns of ticks. Since different tick development stages occur spatially and temporally clustered on roe deer, transmission experiments of tick-borne pathogens are urgently needed.

  20. Deorphanization and target validation of cross-tick species conserved novel Amblyomma americanum tick saliva protein.

    Science.gov (United States)

    Mulenga, Albert; Kim, Tae Kwon; Ibelli, Adriana Mércia Guaratini

    2013-05-01

    We previously identified a cross-tick species conserved tick feeding stimuli responsive Amblyomma americanum (Aam) AV422 gene. This study demonstrates that AamAV422 belongs to a novel group of arthropod proteins that is characterized by 14 cysteine amino acid residues: C(23)-X7/9-C(33)-X23/24-C(58)-X8-C(67)-X7-C(75)-X23-C(99)-X15-C(115)-X10-C(126)-X24/25/33-C(150)C(151)-X7-C(159)-X8-C(168)-X23/24-C(192)-X9/10-C(202) predicted to form seven disulfide bonds. We show that AamAV422 protein is a ubiquitously expressed protein that is injected into the host within the first 24h of the tick attaching onto the host as revealed by Western blotting analyses of recombinant (r)AamAV422, tick saliva and dissected tick organ protein extracts using antibodies to 24 and 48 h tick saliva proteins. Native AamAV422 is apparently involved with mediating tick anti-hemostasis and anti-complement functions in that rAamAV422 delayed plasma clotting time in a dose responsive manner by up to ≈ 160 s, prevented platelet aggregation by up to ≈ 16% and caused ≈ 24% reduction in production of terminal complement complexes. Target validation analysis revealed that rAamAV422 is a potential candidate for a cocktail or multivalent tick vaccine preparation in that RNA interference (RNAi)-mediated silencing of AamAV422 mRNA caused a statistically significant (≈ 44%) reduction in tick engorgement weights, which is proxy for amounts of ingested blood. We speculate that AamAV422 is a potential target antigen for development of the highly desired universal tick vaccine in that consistent with high conservation among ticks, antibodies to 24h Ixodes scapularis tick saliva proteins specifically bound rAamAV422. We discuss data in this study in the context of advancing the biology of tick feeding physiology and discovery of potential target antigens for tick vaccine development. Copyright © 2013 Australian Society for Parasitology Inc. Published by Elsevier Ltd. All rights reserved.

  1. Bat Rabies and Other Lyssavirus Infections

    Science.gov (United States)

    Constantine, Denny G.; Blehert, David S.

    2009-01-01

    Bat Rabies and Other Lyssavirus Infections offers readers an overview of the virus variants that cause bat rabies, and geographical patterns in occurrence of this disease. The section Species Susceptibility describes infection rates and trends among bats, humans, and other animals. Disease Ecology considers the biological and environmental dynamics of the disease in various species of bats. Points to Ponder: Interspecies Interactions in Potential Bat Rabies Transmission Settings discusses the narrowing interface of bat colonies and human society and how humans and domestic animals play a role in transmission of bat rabies. Disease Prevention and Control outlines how to limit exposure to rabid bats and other animals. Appendixes include extensive tables of reported infections in bat species and in humans, and a glossary of technical terms is included. The author, Denny G. Constantine, helped define rabies infection in insect-eating bats and has investigated bat rabies ecology for more than half a century. He has authored more than 90 papers during the course of his career and is widely considered to be the world's foremost authority on the disease. Currently, Dr. Constantine is a public health officer emeritus and veterinary epidemiologist for the California Department of Health Services Viral and Rickettsial Disease Laboratory. Milt Friend, first director of the USGS National Wildlife Health Center, wrote the foreword. David Blehert, a USGS microbiologist who is investigating the emergence and causes of bat white-nose syndrome, edited the volume. Bat Rabies is intended for scholars and the general public. Dr. Constantine presents the material in a simple, straightforward manner that serves both audiences. The goal of the author is to increase people's understanding of both bat and disease ecology and also provide a balanced perspective on human risks pertaining to bat rabies.

  2. A perspective on bats (Chiroptera

    Directory of Open Access Journals (Sweden)

    M. Brock Fenton

    2013-03-01

    Full Text Available With over 130 species, bats are the most diverse group of mammals almost everywhere in sub-Saharan Africa. Since 2000, two books (Monadjem et al. 2010; Taylor 2000 have made it much easier to appreciate this reality. Species previously unrecognised are frequent discoveries (e.g. Taylor et al. 2012. Whilst most species are mainly insectivorous, some rely more directly on plants, taking fruit and visiting flowers to obtain nectar and pollen. The combination of mobility, long lifespan and diversity of trophic roles makes bats potentially valuable as indicators of ecosystem health (Cumming & Spiesman 2006. Lack of detailed information, however, makes it easy to overlook bats when focusing on issues of conservation.

  3. A perspective on bats (Chiroptera

    Directory of Open Access Journals (Sweden)

    M. Brock Fenton

    2013-02-01

    Full Text Available With over 130 species, bats are the most diverse group of mammals almost everywhere in sub-Saharan Africa. Since 2000, two books (Monadjem et al. 2010; Taylor 2000 have made it much easier to appreciate this reality. Species previously unrecognised are frequent discoveries (e.g. Taylor et al. 2012. Whilst most species are mainly insectivorous, some rely more directly on plants, taking fruit and visiting flowers to obtain nectar and pollen. The combination of mobility, long lifespan and diversity of trophic roles makes bats potentially valuable as indicators of ecosystem health (Cumming & Spiesman 2006. Lack of detailed information, however, makes it easy to overlook bats when focusing on issues of conservation.

  4. Avian migrants facilitate invasions of neotropical ticks and tick-borne pathogens into the United States.

    Science.gov (United States)

    Cohen, Emily B; Auckland, Lisa D; Marra, Peter P; Hamer, Sarah A

    2015-12-01

    Migratory birds have the potential to transport exotic vectors and pathogens of human and animal health importance across vast distances. We systematically examined birds that recently migrated to the United States from the Neotropics for ticks. We screened both ticks and birds for tick-borne pathogens, including Rickettsia species and Borrelia burgdorferi. Over two spring seasons (2013 and 2014), 3.56% of birds (n = 3,844) representing 42.35% of the species examined (n = 85) were infested by ticks. Ground-foraging birds with reduced fuel stores were most commonly infested. Eight tick species were identified, including seven in the genus Amblyomma, of which only Amblyomma maculatum/Amblyomma triste is known to be established in the United States. Most ticks on birds (67%) were neotropical species with ranges in Central and South America. Additionally, a single Ixodes genus tick was detected. A total of 29% of the ticks (n = 137) and no avian blood samples (n = 100) were positive for infection with Rickettsia species, including Rickettsia parkeri, an emerging cause of spotted fever in humans in the southern United States, a species in the group of Rickettsia monacensis, and uncharacterized species and endosymbionts of unknown pathogenicity. No avian tick or blood samples tested positive for B. burgdorferi, the etiologic agent of Lyme disease. An extrapolation of our findings suggests that anywhere from 4 to 39 million exotic neotropical ticks are transported to the United States annually on migratory songbirds, with uncertain consequences for human and animal health if the current barriers to their establishment and spread are overcome. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  5. Identification of tick-borne encephalitis virus in ticks collected in southeastern Hungary.

    Science.gov (United States)

    Pintér, Réka; Madai, Mónika; Vadkerti, Edit; Németh, Viktória; Oldal, Miklós; Kemenesi, Gábor; Dallos, Bianka; Gyuranecz, Miklós; Kiss, Gábor; Bányai, Krisztián; Jakab, Ferenc

    2013-09-01

    Tick-borne encephalitis virus (TBEV) is an arthropod-borne viral pathogen causing infections in Europe and is responsible for most arbovirus central nervous system infections in Hungary. Assessing the TBEV prevalence in ticks through detection of genomic RNA is a broadly accepted approach to estimate the transmission risk from a tick bite. For this purpose, 2731 ticks were collected from the neighboring area of the town of Dévaványa, located in southeastern Hungary, which is considered a low-risk-transmission area for TBEV. Altogether, 2300 ticks were collected from the vegetation, while 431 were collected from rodents. Samples were pooled and then screened for TBEV with a newly designed semi-nested RT-PCR (RT-snPCR) targeting the NS1 genomic region. PCR results were confirmed by direct sequencing of the second round amplicons. Among the 3 different collected tick species (Ixodes ricinus, Haemaphysalis concinna, Dermacentor marginatus), I. ricinus was the only species that tested positive for TBEV. TBEV-positive ticks were collected from small mammals or from the vegetation. One nymphal pool and 4 larval pools tested positive for TBEV. The only positive nymphal pool was unfed and came from vegetation, while ticks of the 4 positive larval pools were collected from rodents. Minimal TBEV prevalence in ticks was 0.08% for unfed nymphs and 0.78% for feeding larvae. Our results indicate that further long-term investigations on the occurrence of TBEV are needed to better describe the geographic distribution and the prevalence of infected ticks in Hungary. Copyright © 2013 Elsevier GmbH. All rights reserved.

  6. Intensity and directionality of bat echolocation signals

    OpenAIRE

    Jakobsen, Lasse; Brinkl?v, Signe; Surlykke, Annemarie

    2013-01-01

    The paper reviews current knowledge of intensity and directionality of bat echolocation signals. Recent studies have revealed that echolocating bats can be much louder than previously believed. Bats previously dubbed “whispering” can emit calls with source levels up to 110 dB SPL at 10 cm and the louder open space hunting bats have been recorded at above 135 dB SPL. This implies that maximum emitted intensities are generally 30 dB or more above initial estimates. Bats' dynamic control of acou...

  7. How do tiger moths jam bat sonar?

    Science.gov (United States)

    Corcoran, Aaron J; Barber, Jesse R; Hristov, Nickolay I; Conner, William E

    2011-07-15

    The tiger moth Bertholdia trigona is the only animal in nature known to defend itself by jamming the sonar of its predators - bats. In this study we analyzed the three-dimensional flight paths and echolocation behavior of big brown bats (Eptesicus fuscus) attacking B. trigona in a flight room over seven consecutive nights to determine the acoustic mechanism of the sonar-jamming defense. Three mechanisms have been proposed: (1) the phantom echo hypothesis, which states that bats misinterpret moth clicks as echoes; (2) the ranging interference hypothesis, which states that moth clicks degrade the bats' precision in determining target distance; and (3) the masking hypothesis, which states that moth clicks mask the moth echoes entirely, making the moth temporarily invisible. On nights one and two of the experiment, the bats appeared startled by the clicks; however, on nights three through seven, the bats frequently missed their prey by a distance predicted by the ranging interference hypothesis (∼15-20 cm). Three-dimensional simulations show that bats did not avoid phantom targets, and the bats' ability to track clicking prey contradicts the predictions of the masking hypothesis. The moth clicks also forced the bats to reverse their stereotyped pattern of echolocation emissions during attack, even while bats continued pursuit of the moths. This likely further hinders the bats' ability to track prey. These results have implications for the evolution of sonar jamming in tiger moths, and we suggest evolutionary pathways by which sonar jamming may have evolved from other tiger moth defense mechanisms.

  8. BAT-BORNE RABIES IN LATIN AMERICA

    Directory of Open Access Journals (Sweden)

    Luis E. Escobar

    2015-02-01

    Full Text Available The situation of rabies in America is complex: rabies in dogs has decreased dramatically, but bats are increasingly recognized as natural reservoirs of other rabies variants. Here, bat species known to be rabies-positive with different antigenic variants, are summarized in relation to bat conservation status across Latin America. Rabies virus is widespread in Latin American bat species, 22.5%75 of bat species have been confirmed as rabies-positive. Most bat species found rabies positive are classified by the International Union for Conservation of Nature as “Least Concern”. According to diet type, insectivorous bats had the most species known as rabies reservoirs, while in proportion hematophagous bats were the most important. Research at coarse spatial scales must strive to understand rabies ecology; basic information on distribution and population dynamics of many Latin American and Caribbean bat species is needed; and detailed information on effects of landscape change in driving bat-borne rabies outbreaks remains unassessed. Finally, integrated approaches including public health, ecology, and conservation biology are needed to understand and prevent emergent diseases in bats.

  9. Ticks and tick-borne pathogens at the cutaneous interface: host defenses, tick countermeasures, and a suitable environment for pathogen establishment

    Directory of Open Access Journals (Sweden)

    Stephen eWikel

    2013-11-01

    Full Text Available Ticks are unique among hematophagous arthropods by continuous attachment to host skin and blood feeding for days; complexity and diversity of biologically active molecules differentially expressed in saliva of tick species; their ability to modulate the host defenses of pain and itch, hemostasis, inflammation, innate and adaptive immunity, and wound healing; and, the diverse array of infectious agents they transmit. All of these interactions occur at the cutaneous interface in a complex sequence of carefully choreographed host defense responses and tick countermeasures resulting in an environment that facilitates successful blood feeding and establishment of tick-borne infectious agents within the host. Here, we examine diverse patterns of tick attachment to host skin, blood feeding mechanisms, salivary gland transcriptomes, bioactive molecules in tick saliva, timing of pathogen transmission, and host responses to tick bite. Ticks engage and modulate cutaneous and systemic immune defenses involving keratinocytes, natural killer cells, dendritic cells, T cell subpopulations (Th1, Th2, Th17, Treg , B cells, neutrophils, mast cells, basophils, endothelial cells, cytokines, chemokines, complement, and extracellular matrix. A framework is proposed that integrates tick induced changes of skin immune effectors with their ability to respond to tick-borne pathogens. Implications of these changes are addressed. What are the consequences of tick modulation of host cutaneous defenses? Does diversity of salivary gland transcriptomes determine differential modulation of host inflammation and immune defenses and therefore, in part, the clades of pathogens effectively transmitted by different tick species? Do ticks create an immunologically modified cutaneous environment that enhances specific pathogen establishment? Can tick saliva molecules be used to develop vaccines that block pathogen transmission?

  10. Intensity and directionality of bat echolocation signals

    DEFF Research Database (Denmark)

    Jakobsen, Lasse; Brinkløv, Signe; Surlykke, Annemarie

    2013-01-01

    The paper reviews current knowledge of intensity and directionality of bat echolocation signals. Recent studies have revealed that echolocating bats can be much louder than previously believed. Bats previously dubbed "whispering" can emit calls with source levels up to 110 dB SPL at 10 cm...... and the louder open space hunting bats have been recorded at above 135 dB SPL. This implies that maximum emitted intensities are generally 30 dB or more above initial estimates. Bats' dynamic control of acoustic features also includes the intensity and directionality of their sonar calls. Aerial hawking bats...... will increase signal directionality in the field along with intensity thus increasing sonar range. During the last phase of prey pursuit, vespertilionid bats broaden their echolocation beam considerably, probably to counter evasive maneuvers of eared prey. We highlight how multiple call parameters (frequency...

  11. The microbiome of neotropical ticks parasitizing on passerine migratory birds

    OpenAIRE

    Budachetri, Khemraj; Williams, Jaclyn; Mukherjee, Nabanita; Sellers, Michael; Moore, Frank; Karim, Shahid

    2016-01-01

    Seasonal migration of passerine birds between temperate North America and tropical Central and South America is an ecological phenomenon. Migration of birds has been associated with the introduction of ectoparasites like ticks or tick-borne pathogens across the avian migration routes. In this study, the microbial diversity was determined in the ticks and bird DNA samples using 454 pyrosequencing of bacterial 16S rRNA gene. Tick DNA samples showed the dominance of genera Lactococcus, Francisel...

  12. Tick burden on European roe deer (Capreolus capreolus)

    OpenAIRE

    Vor, Torsten; Kiffner, Christian; Hagedorn, Peter; Niedrig, Matthias; R?he, Ferdinand

    2010-01-01

    In our study we assessed the tick burden on roe deer (Capreolus capreolus L.) in relation to age, physical condition, sex, deer density and season. The main objective was to find predictive parameters for tick burden. In September 2007, May, July, and September 2008, and in May and July 2009 we collected ticks on 142 culled roe deer from nine forest departments in Southern Hesse, Germany. To correlate tick burden and deer density we estimated deer density using line transect sampling that acc...

  13. Enhanced passive bat rabies surveillance in indigenous bat species from Germany--a retrospective study.

    Science.gov (United States)

    Schatz, Juliane; Freuling, Conrad Martin; Auer, Ernst; Goharriz, Hooman; Harbusch, Christine; Johnson, Nicholas; Kaipf, Ingrid; Mettenleiter, Thomas Christoph; Mühldorfer, Kristin; Mühle, Ralf-Udo; Ohlendorf, Bernd; Pott-Dörfer, Bärbel; Prüger, Julia; Ali, Hanan Sheikh; Stiefel, Dagmar; Teubner, Jens; Ulrich, Rainer Günter; Wibbelt, Gudrun; Müller, Thomas

    2014-05-01

    In Germany, rabies in bats is a notifiable zoonotic disease, which is caused by European bat lyssaviruses type 1 and 2 (EBLV-1 and 2), and the recently discovered new lyssavirus species Bokeloh bat lyssavirus (BBLV). As the understanding of bat rabies in insectivorous bat species is limited, in addition to routine bat rabies diagnosis, an enhanced passive surveillance study, i.e. the retrospective investigation of dead bats that had not been tested for rabies, was initiated in 1998 to study the distribution, abundance and epidemiology of lyssavirus infections in bats from Germany. A total number of 5478 individuals representing 21 bat species within two families were included in this study. The Noctule bat (Nyctalus noctula) and the Common pipistrelle (Pipistrellus pipistrellus) represented the most specimens submitted. Of all investigated bats, 1.17% tested positive for lyssaviruses using the fluorescent antibody test (FAT). The vast majority of positive cases was identified as EBLV-1, predominately associated with the Serotine bat (Eptesicus serotinus). However, rabies cases in other species, i.e. Nathusius' pipistrelle bat (Pipistrellus nathusii), P. pipistrellus and Brown long-eared bat (Plecotus auritus) were also characterized as EBLV-1. In contrast, EBLV-2 was isolated from three Daubenton's bats (Myotis daubentonii). These three cases contribute significantly to the understanding of EBLV-2 infections in Germany as only one case had been reported prior to this study. This enhanced passive surveillance indicated that besides known reservoir species, further bat species are affected by lyssavirus infections. Given the increasing diversity of lyssaviruses and bats as reservoir host species worldwide, lyssavirus positive specimens, i.e. both bat and virus need to be confirmed by molecular techniques.

  14. Enhanced Passive Bat Rabies Surveillance in Indigenous Bat Species from Germany - A Retrospective Study

    Science.gov (United States)

    Auer, Ernst; Goharriz, Hooman; Harbusch, Christine; Johnson, Nicholas; Kaipf, Ingrid; Mettenleiter, Thomas Christoph; Mühldorfer, Kristin; Mühle, Ralf-Udo; Ohlendorf, Bernd; Pott-Dörfer, Bärbel; Prüger, Julia; Ali, Hanan Sheikh; Stiefel, Dagmar; Teubner, Jens; Ulrich, Rainer Günter; Wibbelt, Gudrun; Müller, Thomas

    2014-01-01

    In Germany, rabies in bats is a notifiable zoonotic disease, which is caused by European bat lyssaviruses type 1 and 2 (EBLV-1 and 2), and the recently discovered new lyssavirus species Bokeloh bat lyssavirus (BBLV). As the understanding of bat rabies in insectivorous bat species is limited, in addition to routine bat rabies diagnosis, an enhanced passive surveillance study, i.e. the retrospective investigation of dead bats that had not been tested for rabies, was initiated in 1998 to study the distribution, abundance and epidemiology of lyssavirus infections in bats from Germany. A total number of 5478 individuals representing 21 bat species within two families were included in this study. The Noctule bat (Nyctalus noctula) and the Common pipistrelle (Pipistrellus pipistrellus) represented the most specimens submitted. Of all investigated bats, 1.17% tested positive for lyssaviruses using the fluorescent antibody test (FAT). The vast majority of positive cases was identified as EBLV-1, predominately associated with the Serotine bat (Eptesicus serotinus). However, rabies cases in other species, i.e. Nathusius' pipistrelle bat (Pipistrellus nathusii), P. pipistrellus and Brown long-eared bat (Plecotus auritus) were also characterized as EBLV-1. In contrast, EBLV-2 was isolated from three Daubenton's bats (Myotis daubentonii). These three cases contribute significantly to the understanding of EBLV-2 infections in Germany as only one case had been reported prior to this study. This enhanced passive surveillance indicated that besides known reservoir species, further bat species are affected by lyssavirus infections. Given the increasing diversity of lyssaviruses and bats as reservoir host species worldwide, lyssavirus positive specimens, i.e. both bat and virus need to be confirmed by molecular techniques. PMID:24784117

  15. Methods of tick removal: A systematic review of the literature

    Directory of Open Access Journals (Sweden)

    Coleman Nikki

    2017-01-01

    Full Text Available Background An increase in tick borne diseases in Australia has seen an interest in appropriate removal of ticks (order Ixodida in order to prevent anaphylaxis, allergy and transmission of tick borne diseases. Aims A systematic review of peer-reviewed literature to determine what method of tick removal should be promoted in terms of preventing future health complications. Methods Thematic synthesis was used in two stages: – tick removal studies conducted on animals and humans were examined and the conclusions from all of these studies were compared, in order to ascertain the best tick removal method in relation to prevention of future medical problems (including tick bite allergy and transmission of infection. Conclusion This systematic review documents the best method of tick removal based on scientific and medical studies between 1985 and 2016. It concludes that the best method is to remove the tick as soon as possible after it is detected, using either fine-tipped tweezers or a reputable commercially produced tick removal tool to pull the tick away from the site of attachment. Some methods of removal, such as applying chemicals like petroleum jelly, alcohol, or nail polish to the tick, have been discredited. Other methods of removal, such as freezing, while promising, have not yet been scientifically validated

  16. Modelling and mapping tick dynamics using volunteered observations

    NARCIS (Netherlands)

    Garcia-Martí, Irene; Zurita-Milla, Raúl; Vliet, van Arnold J.H.; Takken, Willem

    2017-01-01

    Background: Tick populations and tick-borne infections have steadily increased since the mid-1990s posing an ever-increasing risk to public health. Yet, modelling tick dynamics remains challenging because of the lack of data and knowledge on this complex phenomenon. Here we present an approach to

  17. Molecular biology of tick Acetylcholinesterases – a minireview

    Science.gov (United States)

    Ticks are important hematophagous arthropod ectoparasites and like mosquitoes, are vectors for a wide variety of human and animal pathogens. Ticks have significant world-wide health and economic impacts. In the U.S., major impacts include the ability of the blacklegged tick, Ixodes scapularis, to tr...

  18. Genetic parameter estimates for tick resistance in Bonsmara cattle ...

    African Journals Online (AJOL)

    The objectives of the study were to estimate genetic parameters for tick resistance and to evaluate the effect of the level of tick infestation on the estimates of genetic parameters for South African Bonsmara cattle. Field data of repeated tick count records (n = 11 280) on 1 176 animals were collected between 1993 and 2005 ...

  19. Infestation of Royal Python (Python regius) with ticks Amblyomma ...

    African Journals Online (AJOL)

    The Python/Boa Family is found in most part of tropics. It is a highly domesticated pet and can easily be handled (Cansdale 1962). Snakes are commonly infected by ticks more importantly the hand bodied ticks (Fowler, 1986).However, under captive condition, ticks usually exert a lot of burden on their hosts being carriers of ...

  20. Survey of Hard Ticks (Ixodidae) Infesting Camels ( Camelus ...

    African Journals Online (AJOL)

    To determine the prevalence and abundance of hard ticks infesting camels, 414 nomadic one - humped camels in Kano State, northwestern Nigeria were selected by random sampling and examined for the presence of ticks on their bodies between January and December 2007. Three species of ticks, Amblyomma ...

  1. Ixodidae ticks in the megapolis of Kyiv, Ukraine

    Science.gov (United States)

    The Ixodidae include the most common tick species encountered in Europe. The ticks transmit a variety of bacterial and protozoan agents of medical and veterinary significance. The aim of the current work was to investigate distribution of Ixodes ricinus and Dermacentor reticulatus ticks in Kyiv, the...

  2. Molecular ecological insights into neotropical bird-tick interactions

    NARCIS (Netherlands)

    Miller, Matthew J.; Esser, Helen J.; Loaiza, Jose R.; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In

  3. Ticks associated with domestic dogs and cats in Florida, USA

    Science.gov (United States)

    Voluntary collections of ticks from domestic dogs and cats by veterinary practitioners across Florida were conducted over a 10 month period. Of the 1,337 ticks submitted, five species of ixodid ticks were identified and included Rhipicephalus sanguineus, Amblyomma americanum, A. maculatum, Dermacen...

  4. An analysis of batting backlift techniques among coached and ...

    African Journals Online (AJOL)

    One of the first principles of cricket batsmanship for batting coaches is to teach junior cricketers to play using a straight bat. This requires the bat to be lifted directly towards the stumps with the bat face facing downwards. No study has yet examined whether there are differences in the batting back lift techniques (BTT) of ...

  5. Bat Biology, Genomes, and the Bat1K Project: To Generate Chromosome-Level Genomes for All Living Bat Species.

    Science.gov (United States)

    Teeling, Emma C; Vernes, Sonja C; Dávalos, Liliana M; Ray, David A; Gilbert, M Thomas P; Myers, Eugene

    2018-02-15

    Bats are unique among mammals, possessing some of the rarest mammalian adaptations, including true self-powered flight, laryngeal echolocation, exceptional longevity, unique immunity, contracted genomes, and vocal learning. They provide key ecosystem services, pollinating tropical plants, dispersing seeds, and controlling insect pest populations, thus driving healthy ecosystems. They account for more than 20% of all living mammalian diversity, and their crown-group evolutionary history dates back to the Eocene. Despite their great numbers and diversity, many species are threatened and endangered. Here we announce Bat1K, an initiative to sequence the genomes of all living bat species (n∼1,300) to chromosome-level assembly. The Bat1K genome consortium unites bat biologists (>148 members as of writing), computational scientists, conservation organizations, genome technologists, and any interested individuals committed to a better understanding of the genetic and evolutionary mechanisms that underlie the unique adaptations of bats. Our aim is to catalog the unique genetic diversity present in all living bats to better understand the molecular basis of their unique adaptations; uncover their evolutionary history; link genotype with phenotype; and ultimately better understand, promote, and conserve bats. Here we review the unique adaptations of bats and highlight how chromosome-level genome assemblies can uncover the molecular basis of these traits. We present a novel sequencing and assembly strategy and review the striking societal and scientific benefits that will result from the Bat1K initiative.

  6. Bat Flight and Zoonotic Viruses

    Centers for Disease Control (CDC) Podcasts

    2014-05-30

    Reginald Tucker reads an abridged version of the EID perspective Bat Flight and Zoonotic Viruses.  Created: 5/30/2014 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 6/2/2014.

  7. Henipavirus RNA in African bats.

    Directory of Open Access Journals (Sweden)

    Jan Felix Drexler

    Full Text Available BACKGROUND: Henipaviruses (Hendra and Nipah virus are highly pathogenic members of the family Paramyxoviridae. Fruit-eating bats of the Pteropus genus have been suggested as their natural reservoir. Human Henipavirus infections have been reported in a region extending from Australia via Malaysia into Bangladesh, compatible with the geographic range of Pteropus. These bats do not occur in continental Africa, but a whole range of other fruit bats is encountered. One of the most abundant is Eidolon helvum, the African Straw-coloured fruit bat. METHODOLOGY/PRINCIPAL FINDINGS: Feces from E. helvum roosting in an urban setting in Kumasi/Ghana were tested for Henipavirus RNA. Sequences of three novel viruses in phylogenetic relationship to known Henipaviruses were detected. Virus RNA concentrations in feces were low. CONCLUSIONS/SIGNIFICANCE: The finding of novel putative Henipaviruses outside Australia and Asia contributes a significant extension of the region of potential endemicity of one of the most pathogenic virus genera known in humans.

  8. A Review of Methods for Detecting Tick-Borne Encephalitis Virus Infection in Tick, Animal, and Human Specimens

    Czech Academy of Sciences Publication Activity Database

    Ergunay, K.; Tkachev, S.; Kozlova, I.; Růžek, Daniel

    2016-01-01

    Roč. 16, č. 1 (2016), s. 4-12 ISSN 1530-3667 R&D Projects: GA ČR GAP502/11/2116 Institutional support: RVO:60077344 Keywords : tick-borne encephalitis * serology * PCR * tick(s) * rodents Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.045, year: 2016

  9. Bartonellae are Prevalent and Diverse in Costa Rican Bats and Bat Flies.

    Science.gov (United States)

    Judson, S D; Frank, H K; Hadly, E A

    2015-12-01

    Species in the bacterial genus, Bartonella, can cause disease in both humans and animals. Previous reports of Bartonella in bats and ectoparasitic bat flies suggest that bats could serve as mammalian hosts and bat flies as arthropod vectors. We compared the prevalence and genetic similarity of bartonellae in individual Costa Rican bats and their bat flies using molecular and sequencing methods targeting the citrate synthase gene (gltA). Bartonellae were more prevalent in bat flies than in bats, and genetic variants were sometimes, but not always, shared between bats and their bat flies. The detected bartonellae genetic variants were diverse, and some were similar to species known to cause disease in humans and other mammals. The high prevalence and sharing of bartonellae in bat flies and bats support a role for bat flies as a potential vector for Bartonella, while the genetic diversity and similarity to known species suggest that bartonellae could spill over into humans and animals sharing the landscape. © 2015 Blackwell Verlag GmbH.

  10. Detection of tick-borne pathogens in roe deer (Capreolus capreolus), in questing ticks (Ixodes ricinus), and in ticks infesting roe deer in southern Germany.

    Science.gov (United States)

    Overzier, Evelyn; Pfister, Kurt; Herb, Ingrid; Mahling, Monia; Böck, Georg; Silaghi, Cornelia

    2013-06-01

    The hard tick Ixodes ricinus is the most common tick in Central Europe and plays an important role as a vector of several pathogens. In the complex life cycles of these pathogens, the role of wild animals as natural reservoirs has been discussed. The aims of this study were to investigate the role of roe deer (Capreolus capreolus) as a potential reservoir host for Babesia spp., Anaplasma phagocytophilum, and Rickettsia spp. Therefore, we explored the differences in the infection rates of roe deer and engorged and questing ticks with these pathogens from a single forest site with special attention to coinfection. Blood, spleen, and skin samples of a total of 95 roe deer individuals were screened by molecular methods for these pathogens from September 2010 to January 2012 in the 'Angelberger Forst' (Bavaria, Germany). Moreover, 331 engorged ticks from 44 roe deer individuals and 199 host-seeking ticks from the same area were screened. Altogether, the following prevalence rates and a high diversity of species were detected for the respective pathogens in individual animals and ticks: (i) Babesia spp.: roe deer, 89.5%; engorged ticks, 7.3%; questing ticks: adults, 2.5%, nymphs, 3.3%. Sequencing revealed B. venatorum, B. capreoli, and B. microti. (ii) A. phagocytophilum: roe deer 98.9%; engorged ticks, 86.1%; questing ticks: adults, 8.9%, nymphs, 0.8%. (iii) Rickettsia spp.: roe deer, 0%; engorged ticks, 16.6%; questing ticks: adults, 13.9%, nymphs, 17.5%. Sequencing revealed R. helvetica. Furthermore, several coinfections were detected in both roe deer and ticks. The high prevalence rates of B. capreoli and A. phagocytophilum in roe deer support their role as reservoir hosts for these pathogens, but no evidence for a role of roe deer in the life cycle of R. helvetica could be provided. Copyright © 2013 Elsevier GmbH. All rights reserved.

  11. Survey of ticks (Acari: Ixodidae) and tick-borne pathogens in North Dakota.

    Science.gov (United States)

    Russart, Nathan M; Dougherty, Michael W; Vaughan, Jefferson A

    2014-09-01

    Ticks were sampled at nine locations throughout North Dakota during early summer of 2010, using flagging techniques and small mammals trapping. In total, 1,762 ticks were collected from eight of the nine locations. The dominant species were Dermacentor variabilis (Say) (82%), found throughout the state, and Ixodes scapularis Say (17%), found in northeastern counties. A few nymphal and adult I. scapularis tested positive for Borrelia burgdorferi (3%) and Anaplasma phagocytophilum (8%). This is the first report of I. scapularis and associated pathogens occurring in North Dakota and provides evidence for continued westward expansion of this important vector tick species in the United States.

  12. Integrated tick and tick-borne disease control trials in crossbred dairy cattle in Malawi

    DEFF Research Database (Denmark)

    Tjørnehøj, Kirsten; Whiteland, A. P.; Mfitilodze, M. W.

    1996-01-01

    , but there were no incidents of tick-borne disease in the immunised group. In a second trial, which tested a strategic dipping regimen, 107 animals were dipped 9 times over a 6 month period. Despite heavy challenge by B. bovis and moderate challenge by B. bigemina and Anaplasma spp, demonstrated serologically......, there was only a single clinical case of babesiosis. The observations provide encouragement for the introduction of integrated tick and tick-borne disease control programmes in improved cattle in ECF endemic areas....

  13. Ultraviolet vision may be widespread in bats

    Science.gov (United States)

    Gorresen, P. Marcos; Cryan, Paul; Dalton, David C.; Wolf, Sandy; Bonaccorso, Frank

    2015-01-01

    Insectivorous bats are well known for their abilities to find and pursue flying insect prey at close range using echolocation, but they also rely heavily on vision. For example, at night bats use vision to orient across landscapes, avoid large obstacles, and locate roosts. Although lacking sharp visual acuity, the eyes of bats evolved to function at very low levels of illumination. Recent evidence based on genetics, immunohistochemistry, and laboratory behavioral trials indicated that many bats can see ultraviolet light (UV), at least at illumination levels similar to or brighter than those before twilight. Despite this growing evidence for potentially widespread UV vision in bats, the prevalence of UV vision among bats remains unknown and has not been studied outside of the laboratory. We used a Y-maze to test whether wild-caught bats could see reflected UV light and whether such UV vision functions at the dim lighting conditions typically experienced by night-flying bats. Seven insectivorous species of bats, representing five genera and three families, showed a statistically significant ‘escape-toward-the-light’ behavior when placed in the Y-maze. Our results provide compelling evidence of widespread dim-light UV vision in bats.

  14. Bat rabies--a Gordian knot?

    Science.gov (United States)

    Freuling, Conrad; Vos, Ad; Johnson, Nicholas; Fooks, Anthony R; Müller, Thomas

    2009-01-01

    Although classical rabies is one of the earliest identified and best studied infectious diseases, there is still limited knowledge about lyssaviruses and their major natural hosts, bats. Focussing on bat rabies in Europe caused by European bat lyssaviruses 1 (EBLV-1) and 2, for instance the association of EBLV-1 to Eptesicus bats and EBLV-2 to Myotis daubentonii and M. dasycneme together with an apparent clustering of cases is one question still to be answered. Furthermore, the question whether EBLVs are less virulent or bats less susceptible is the key to the understanding of the disease. Accumulating evidence from experimental studies and field observations, however, has resulted in contradicting hypotheses. Serological surveys, using tools developed for classical rabies, are often used for bat rabies surveillance. However, such surveys are hampered by the lack of validated methods applicable for bat sera. Bats seem to play a prominent role as reservoir for viral pathogens and the unique biology of bats especially the immune response may contribute to this. Considering all known aspects, bat rabies seems to form a yet unsolvable entanglement, reminiscent of the ancient tale of the Gordian knot. In this manuscript we will not be able to untangle this knot, but we hope to offer some suggestions of where to start.

  15. Ticks, ivermectin, and experimental Chagas disease

    Directory of Open Access Journals (Sweden)

    João Carlos Pinto Dias

    2005-12-01

    Full Text Available Following an infestation of dogticks in kennels housing dogs used for long-term studies of the pathogenesis of Chagas disease, we examined the effect of ivermectin treatment on the dogs, ticks, trypanosome parasites, and also on triatomine vectors of Chagas disease. Ivermectin treatment was highly effective in eliminating the ticks, but showed no apparent effect on the dogs nor on their trypanosome infection. Triatominae fed on the dogs soon after ivermectin treatment showed high mortality, but this effect quickly declined for bugs fed at successive intervals after treatment. In conclusion, although ivermectin treatment may have a transient effect on peridomestic populations of Triatominae, it is not the treatment of choice for this situation. The study also showed that although the dogticks could become infected with Trypanosoma cruzi, this only occurred when feeding on dogs in the acute phase of infection, and there was no evidence of subsequent parasite development in the ticks.

  16. Bats in Agroecosytems around California's Central Coast

    Science.gov (United States)

    Wayne, A.

    2014-12-01

    Bats in agroecosystems around California's Central Coast: A full quarter of California's land area is farmland. Crops account for 32.5 billion of California's GDP. Insect control is a big problem for farmers, and California bats eat only insects, saving farmers an estimated 3 to $53 billion a year. As farmers maximize crop yield, they use more pesticides, herbicides, and fertilizers, which contaminate runoff streams that bats drink from. Also, pesticide use kills bats' sole food source: insects. My research objective was to find out how farm management practices and landscape complexity affect bat diversity and activity, and to see which one affects bat activity more. We monitored 18 sites, including conventional, organic, and low and high-complexity landscapes. We noted more bat activity at sites with high complexity landscapes and organic practices than at sites with either low-complexity landscapes or conventional farming practices. I captured and processed bats and recorded data. I also classified insects collected from light traps. I learned how to handle bats and measure forearm length and weight, as well as how to indentify their gender. I took hair clippings and fecal samples, which yield data about the bats' diet. Their diet, in turn, gives us data about which pests they eat and therefore help control. I also learned about bats' echolocation: they have a special muscle over their ears that closes when they echolocate so that they don't burst their own eardrum. Also, some insects have evolved a special call that will disrupt bats echolocation so bats can't track it.

  17. The tick (Acari: Ixodidae) fauna of Herald's Beacon Islet, Australia.

    Science.gov (United States)

    Kwak, Mackenzie L; Mintram, Kate

    2017-01-01

    A rare opportunity to travel to Herald's Beacon Islet with permission from the Australian government to collect ticks allowed for a survey of the tick fauna of the island to be undertaken for the first time. The avian fauna of the island, which serve as hosts, was also recorded and includes one new species record for the island. The seabird soft tick Ornithodoros capensis Neumann and the seabird hard tick Amblyomma loculosum Neumann were found to be present on the island. Images of the ticks present on the island are presented along with morphological characters for their identification.

  18. Leg structure explains host site preference in bat flies (Diptera: Streblidae) parasitizing neotropical bats (Chiroptera: Phyllostomidae).

    Science.gov (United States)

    Hiller, Thomas; Honner, Benjamin; Page, Rachel A; Tschapka, Marco

    2018-03-22

    Bat flies (Streblidae) are diverse, obligate blood-feeding insects and probably the most conspicuous ectoparasites of bats. They show preferences for specific body regions on their host bat, which are reflected in behavioural characteristics. In this study, we corroborate the categorization of bat flies into three ecomorphological groups, focusing only on differences in hind leg morphology. As no detailed phylogeny of bat flies is available, it remains uncertain whether these morphological differences reflect the evolutionary history of bat flies or show convergent adaptations for the host habitat type. We show that the division of the host bat into three distinct habitats contributes to the avoidance of interspecific competition of bat fly species. Finally, we found evidence for density-dependent competition between species belonging to the same ecomorphological group.

  19. Removing a tick: proper technique in children

    Directory of Open Access Journals (Sweden)

    Susana Rueda Pérez

    2012-06-01

    Full Text Available There is medical consensus on the need to remove the tick within 24 hours the mite parasites to the human host, to avoid possible complications. The preferred way is by gently traction the mite, aided by forceps without twisting or chokes with toxic agents, because of the possibility that the mite excretes bacteria mixed with substances. The average time of extraction is estimated between one or three minutes. In children parasitized by ticks this amount of time can be excessive when it’s necessary restraint without the consent of the minor. Using this technique we reduce the time to seconds and the damage caused to the skin is minimal.

  20. Ticks, Borrelia Burgdorferi and Lyme Disease

    Directory of Open Access Journals (Sweden)

    Işın Sinem Bağcı

    2016-09-01

    Full Text Available Lyme disease, which is caused by spirochete Borrelia burgdorferi sensu lato, is a tick-transmitted, multisystem infectious disease. It occurs in stages, with different clinical manifestations at each stage. Erythema migrans is the most frequent manifestation which occurs at the site of the tick bite. Borrelial lymphocytoma and acrodermatitis chronica atrophicans are late-stage cutaneous manifestations. Extracutaneous signs of infection most often involve the musculoskeletal, cardiovascular, and nervous systems. Serologic assays remain the mainstay of diagnosis. All stages of the disease are curable with appropriate antibiotic therapy.

  1. Status of tick distribution in Bangladesh, India and Pakistan.

    Science.gov (United States)

    Ghosh, Srikant; Bansal, Gyan Chand; Gupta, Suresh Chandra; Ray, Debdatta; Khan, Muhammad Qasim; Irshad, Hamid; Shahiduzzaman, Md; Seitzer, Ulrike; Ahmed, Jabbar S

    2007-09-01

    On a global basis, ticks transmit a greater variety of pathogenic microorganisms, protozoa, rickettsiae, spirochaets, and viruses than any other arthropods and are among the most important vectors of diseases affecting livestock, humans, and companion animals. Ticks and tick-borne diseases (TTBDs) affect 80% of the world cattle population and are widely distributed throughout the world, particularly in tropical and subtropical countries including India, Pakistan, and Bangladesh. Ticks and tick-transmitted infections have coevolved with various wild animal hosts, which constitute the reservoir hosts for ticks and tick-borne pathogens of livestock, pets, and humans. In this region, the livestock sector is suffering from a number of disease problems caused by bacteria, viruses, fungi, and parasites. Among the parasitological problems, the damage caused by TTBDs is considered very high, and the control of TTBDs has been given priority.

  2. Bartonella species in bats (Chiroptera) and bat flies (Nycteribiidae) from Nigeria, West Africa.

    Science.gov (United States)

    Kamani, Joshua; Baneth, Gad; Mitchell, Mark; Mumcuoglu, Kosta Y; Gutiérrez, Ricardo; Harrus, Shimon

    2014-09-01

    Previous and ongoing studies have incriminated bats as reservoirs of several emerging and re-emerging zoonoses. Most of these studies, however, have focused on viral agents and neglected important bacterial pathogens. To date, there has been no report investigating the prevalence of Bartonella spp. in bats and bat flies from Nigeria, despite the fact that bats are used as food and for cultural ritual purposes by some ethnic groups in Nigeria. To elucidate the role of bats as reservoirs of bartonellae, we screened by molecular methods 148 bats and 34 bat flies, Diptera:Hippoboscoidea:Nycteribiidae (Cyclopodia greeffi) from Nigeria for Bartonella spp. Overall, Bartonella spp. DNA was detected in 76 out of 148 (51.4%) bat blood samples tested and 10 out of 24 (41.7%) bat flies tested by qPCR targeting the 16S-23S internal transcribed spacer (ITS) locus. Bartonella was isolated from 23 of 148 (15.5%) bat blood samples, and the isolates were genetically characterized. Prevalence of Bartonella spp. culture-positive samples ranged from 0% to 45.5% among five bat species. Micropterus spp. bats had a significantly higher relative risk of 3.45 for being culture positive compared to Eidolon helvum, Epomophorus spp., Rhinolophus spp., and Chaerephon nigeriae. Bartonella spp. detected in this study fall into three distinct clusters along with other Bartonella spp. isolated from bats and bat flies from Kenya and Ghana, respectively. The isolation of Bartonella spp. in 10.0-45.5% of four out of five bat species screened in this study indicates a widespread infection in bat population in Nigeria. Further investigation is warranted to determine the role of these bacteria as a cause of human and animal diseases in Nigeria.

  3. Detection of tick-borne encephalitis virus in I. ricinus ticks collected from autumn migratory birds in Latvia.

    Science.gov (United States)

    Kazarina, Alisa; Japiņa, Kristīne; Keišs, Oskars; Salmane, Ineta; Bandere, Dace; Capligina, Valentina; Ranka, Renāte

    2015-03-01

    Birds have a potential of spreading ticks via bird migration routes. In this study, we screened 170 ticks removed during autumn 2010 from 55 birds belonging to 10 species for the presence of tick-borne encephalitis virus (TBEV). In total, TBEV RNA was detected in 14% of I. ricinus tick samples obtained from different birds species. The results of this study indicate the possible role of migrating birds in the dispersal of TBEV-infected ticks along the southward migration route. Copyright © 2014 Elsevier GmbH. All rights reserved.

  4. How the bat got its buzz

    DEFF Research Database (Denmark)

    Ratcliffe, John M; Elemans, Coen P H; Jakobsen, Lasse

    2013-01-01

    Since the discovery of echolocation in bats, the final phase of an attack on a flying insect, the 'terminal buzz', has proved enigmatic. During the buzz, bats increase information update rates by producing vocalizations up to 220 times s(-1). The buzz's ubiquity in hawking and trawling bats implies...... its importance for hunting success. Superfast muscles, previously unknown in mammals, are responsible for the extreme vocalization rate. Some bats produce a second phase-buzz II-defined by a large drop in the fundamental frequency (F(0)) of their calls. By doing so, bats broaden their acoustic field...... tension. Furthermore, we propose that buzz II represents a countermeasure against the evasive flight of eared prey in the evolutionary arms-race that saw the independent evolution of bat-detecting ears in various groups of night-flying insects....

  5. Presence of European bat lyssavirus RNas in apparently healthy Rousettus aegyptiacus bats

    NARCIS (Netherlands)

    Wellenberg, G.J.; Audry, L.; Ronsholt, L.; Poel, van der W.H.M.; Bruschke, C.J.M.; Bourhy, H.

    2002-01-01

    Apparently healthy Rousettus aegyptiacus bats were randomly chosen from a Dutch colony naturally infected with European bat lyssavirus subgenotype 1a (EBL1a). These bats were euthanised three months after the first evidence of an EBL1a infection in the colony. EBL1a genomic and antigenomic RNAs of

  6. A review of fire effects on bats and bat habitat in the eastern oak region

    Science.gov (United States)

    Roger W. Perry

    2012-01-01

    Fire is increasingly being used in oak forests to promote oak regeneration, improve wildlife habitat, and reduce hazardous fuel loads. Although recent research has begun to shed light on the relationships among fire, bats, and bat habitat, these interactions are not yet fully understood. Fire may affect bats directly through heat and smoke during the burning process or...

  7. A review of fire effects on bats and bat habitat in the eastern oaks region

    Science.gov (United States)

    Roger W. Perry

    2012-01-01

    Fire is increasingly being used in oak forests to promote oak regeneration, improve wildlife habitat, and reduce hazardous fuel loads. Although recent research has begun to shed light on the relationships among fire, bats, and bat habitat, these interactions are not yet fully understood. Fire may affect bats directly through heat and smoke during the burning process or...

  8. Detection of European bat lyssavirus type 2 in Danish Daubenton’s bats

    DEFF Research Database (Denmark)

    Rasmussen, Thomas Bruun; Chriél, Mariann; Baagøe, Hans J.

    European bat lyssavirus (EBLV) is considered to be endemic in the Danish bat populations, but limited information exists about the types of EBLV strains currently in circulation. EBLV type 1 (EBLV-1) is seen as the predominant type in the Serotine bats (Eptesicus serotinus) with the latest case...

  9. Bat rabies surveillance in France: first report of unusual mortality among serotine bats.

    Science.gov (United States)

    Picard-Meyer, Evelyne; Servat, Alexandre; Wasniewski, Marine; Gaillard, Matthieu; Borel, Christophe; Cliquet, Florence

    2017-12-13

    Rabies is a fatal viral encephalitic disease that is caused by lyssaviruses which can affect all mammals, including human and bats. In Europe, bat rabies cases are attributed to five different lyssavirus species, the majority of rabid bats being attributed to European bat 1 lyssavirus (EBLV-1), circulating mainly in serotine bats (Eptesicus serotinus). In France, rabies in bats is under surveillance since 1989, with 77 positive cases reported between 1989 and 2016. In the frame of the bat rabies surveillance, an unusual mortality of serotine bats was reported in 2009 in a village in North-East France. Six juvenile bats from an E. serotinus maternity colony counting ~200 individuals were found to be infected with EBLV-1. The active surveillance of the colony by capture sessions of bats from July to September 2009 showed a high detection rate of neutralising EBLV-1 antibodies (≈ 50%) in the colony. Moreover, one out of 111 animals tested was found to shed viable virus in saliva, while lyssavirus RNA was detected by RT-PCR for five individuals. This study demonstrated that the lyssavirus infection in the serotine maternity colony was followed by a high rate of bat rabies immunity after circulation of the virus in the colony. The ratio of seropositive bats is probably indicative of an efficient virus transmission coupled to a rapid circulation of EBLV-1 in the colony.

  10. Tick-borne pathogens in ticks feeding on migratory passerines in Western part of Estonia.

    Science.gov (United States)

    Geller, Julia; Nazarova, Lidia; Katargina, Olga; Leivits, Agu; Järvekülg, Lilian; Golovljova, Irina

    2013-07-01

    During southward migration in the years 2006-2009, 178 migratory passerines of 24 bird species infested with ticks were captured at bird stations in Western Estonia. In total, 249 nymphal ticks were removed and analyzed individually for the presence of Borrelia burgdorferi sensu lato (s.l.), tick-borne encephalitis virus (TBEV), and Anaplasma phagocytophilum. The majority of ticks were collected from Acrocephalus (58%), Turdus (13%), Sylvia (8%), and Parus (6%) bird species. Tick-borne pathogens were detected in nymphs removed from Acrocephalus, Turdus, and Parus bird species. TBEV of the European subtype was detected in 1 I. ricinus nymph removed from A. palustris. B. burgdorferi s.l. DNA was found in 11 ticks (4.4%) collected from Turdus and Parus species. Bird-associated B. garinii and B. valaisiana were detected in I. ricinus nymphs removed from T. merula. Rodent-associated B. afzelii was detected in 3 I. ricinus nymphs from 2 P. major birds. One of the B. afzelii-positive nymphs was infected with a mix of 2 B. afzelii strains, whereas 1 of these strains was also detected in another nymph feeding on the same great tit. The sharing of the same B. afzelii strain by 2 nymphs indicates a possible transmission of B. afzelii by co-feeding on a bird. A. phagocytophilum DNA was detected in 1 I. ricinus nymph feeding on a T. iliacus. The results of the study confirm the possible role of migratory birds in the dispersal of ticks infected with tick-borne pathogens along the southward migration route via Estonia.

  11. Partial Characterization of Tick-Borne Encephalitis Virus Isolates from Ticks of Southern Ukraine.

    Science.gov (United States)

    Yurchenko, Oksana O; Dubina, Dmytro O; Vynograd, Nataliya O; Gonzalez, Jean-Paul

    2017-08-01

    Tick-borne encephalitis (TBE) is the most common tick-borne viral infection in Eurasia; thousands of human cases are annually reported from several European countries. Several tick species are vectors of the tick-borne encephalitis virus (TBEV), while TBE appears to be spreading from the Eurasian continent westward to Europe. Fifteen study sites were chosen from five territories of southern Ukraine, including Odessa, Mykolaiv, Kherson Oblast, the Autonomous Republic of Crimea, and Sevastopol. Tick collection was performed in spring season of three consecutive years (1988-1990) using either flagging technique or direct collection of specimens feeding on cattle. A total of 15,243 tick imagoes and nymphs were collected from nine species, including Dermacentor marginatus, D. reticulatus, Haemaphysalis parva, H. punctata, Hyalomma marginatum, Ixodes ricinus, Rhipicephalus bursa, R. rossicus, and R. sanguineus, pooled in 282 monospecific samples. Supernatant of grinded pool was used for inoculation to suckling mice for virus isolation. Eight TBEV isolates were identified from ticks among six study sites. Ticks showed a minimum infection rate from 0.11% to 0.81%. Phylogenetic analysis of the envelope (E) protein gene of seven isolates, assigned all to the European subtype (TBEV-Eu) showing a maximum identity of 97.17% to the "Pan" TBEV-Eu reference strain. Compared to 104 TBEV-Eu isolates they clustered within the same clade as the Pan reference strain and distinguished from other TBEV-Eu isolates. Amino acid sequence analysis of the South Ukrainian TBEV-Eu isolates revealed the presence of four amino acid substitutions 67 (N), 266 (R), 306 (V), and 407 (R), in the ectodomains II and III and in the stem-anchor region of the E protein gene. This study confirmed TBEV-Eu subtype distribution in the southern region of Ukraine, which eventually overlaps with TBEV-FE (Far Eastern subtype) and TBEV-Sib (Siberian subtype) domains, showing the heterogeneity of TBEV circulating in

  12. Convergences in the diversification of bats

    OpenAIRE

    M. Brock FENTON

    2010-01-01

    Twenty-five characters or suites of characters from bats are considered in light of changes in bat classification. The characters include some associated with flower-visiting (two), echolocation (12), roosting (six), reproduction (two) and three are of unknown adaptive function. In both the 1998 and 2006 classifications of bats into suborders (Megachiroptera and Microchiroptera versus Yinpterochiroptera and Yangochiroptera, respectively), some convergences between suborders are the same (e.g....

  13. Behavior of bats at wind turbines.

    Science.gov (United States)

    Cryan, Paul M; Gorresen, P Marcos; Hein, Cris D; Schirmacher, Michael R; Diehl, Robert H; Huso, Manuela M; Hayman, David T S; Fricker, Paul D; Bonaccorso, Frank J; Johnson, Douglas H; Heist, Kevin; Dalton, David C

    2014-10-21

    Wind turbines are causing unprecedented numbers of bat fatalities. Many fatalities involve tree-roosting bats, but reasons for this higher susceptibility remain unknown. To better understand behaviors associated with risk, we monitored bats at three experimentally manipulated wind turbines in Indiana, United States, from July 29 to October 1, 2012, using thermal cameras and other methods. We observed bats on 993 occasions and saw many behaviors, including close approaches, flight loops and dives, hovering, and chases. Most bats altered course toward turbines during observation. Based on these new observations, we tested the hypotheses that wind speed and blade rotation speed influenced the way that bats interacted with turbines. We found that bats were detected more frequently at lower wind speeds and typically approached turbines on the leeward (downwind) side. The proportion of leeward approaches increased with wind speed when blades were prevented from turning, yet decreased when blades could turn. Bats were observed more frequently at turbines on moonlit nights. Taken together, these observations suggest that bats may orient toward turbines by sensing air currents and using vision, and that air turbulence caused by fast-moving blades creates conditions that are less attractive to bats passing in close proximity. Tree bats may respond to streams of air flowing downwind from trees at night while searching for roosts, conspecifics, and nocturnal insect prey that could accumulate in such flows. Fatalities of tree bats at turbines may be the consequence of behaviors that evolved to provide selective advantages when elicited by tall trees, but are now maladaptive when elicited by wind turbines.

  14. Green roofs provide habitat for urban bats

    Directory of Open Access Journals (Sweden)

    K.L. Parkins

    2015-07-01

    Full Text Available Understanding bat use of human-altered habitat is critical for developing effective conservation plans for this ecologically important taxon. Green roofs, building rooftops covered in growing medium and vegetation, are increasingly important conservation tools that make use of underutilized space to provide breeding and foraging grounds for urban wildlife. Green roofs are especially important in highly urbanized areas such as New York City (NYC, which has more rooftops (34% than green space (13%. To date, no studies have examined the extent to which North American bats utilize urban green roofs. To investigate the role of green roofs in supporting urban bats, we monitored bat activity using ultrasonic recorders on four green and four conventional roofs located in highly developed areas of NYC, which were paired to control for location, height, and local variability in surrounding habitat and species diversity. We then identified bat vocalizations on these recordings to the species level. We documented the presence of five of nine possible bat species over both roof types: Lasiurus borealis, L. cinereus, L. noctivagans, P. subflavus,andE. fuscus. Of the bat calls that could be identified to the species level, 66% were from L. borealis. Overall levels of bat activity were higher over green roofs than over conventional roofs. This study provides evidence that, in addition to well documented ecosystem benefits, urban green roofs contribute to urban habitat availability for several North American bat species.

  15. Bat flight: aerodynamics, kinematics and flight morphology.

    Science.gov (United States)

    Hedenström, Anders; Johansson, L Christoffer

    2015-03-01

    Bats evolved the ability of powered flight more than 50 million years ago. The modern bat is an efficient flyer and recent research on bat flight has revealed many intriguing facts. By using particle image velocimetry to visualize wake vortices, both the magnitude and time-history of aerodynamic forces can be estimated. At most speeds the downstroke generates both lift and thrust, whereas the function of the upstroke changes with forward flight speed. At hovering and slow speed bats use a leading edge vortex to enhance the lift beyond that allowed by steady aerodynamics and an inverted wing during the upstroke to further aid weight support. The bat wing and its skeleton exhibit many features and control mechanisms that are presumed to improve flight performance. Whereas bats appear aerodynamically less efficient than birds when it comes to cruising flight, they have the edge over birds when it comes to manoeuvring. There is a direct relationship between kinematics and the aerodynamic performance, but there is still a lack of knowledge about how (and if) the bat controls the movements and shape (planform and camber) of the wing. Considering the relatively few bat species whose aerodynamic tracks have been characterized, there is scope for new discoveries and a need to study species representing more extreme positions in the bat morphospace. © 2015. Published by The Company of Biologists Ltd.

  16. Wind power and bats : Ontario guideline

    Energy Technology Data Exchange (ETDEWEB)

    McGuiness, F. [Ontario Ministry of Natural Resources, Peterborough, ON (Canada). Renewable Energy Resources; Stewart, J. [Ontario Ministry of Natural Resources, Toronto, ON (Canada). Wildlife Section

    2008-07-01

    None of the 8 species of bats in Ontario are considered as species at risk. However, all bats in Ontario are protected under the Fish and Wildlife Conservation Act. The Ontario Ministry of Natural Resources (MNR) is responsible for identifying significant wildlife habitat for bats, including hibernacula and maternity roosts. The MNR's role in wind development includes environmental assessments (EA) and surveys. The MNR bat guideline includes a summary of Ontario species, a literature review of research related to wind turbines and bats, and a review of methods for assessing and monitoring bats. Guideline development includes a bat working group responsible for obtaining data on risk factors and monitoring requirements. The MNR has determined that site selection is critical for minimizing potential impacts. Wind farm proponents can use MNR data, information, and maps for their site selection process. Information requirements include bat species data; habitat data; and meteorological data. The presence of risk factors results in a sensitivity rating. The MNR is also developing a site sensitivity mapping project in order to assist proponents in making siting decisions. All proposed sites are required to conduct pre-construction site surveys. Acoustic detectors and radar are used to determine bat activity at the site. Monitoring and mitigation strategies include selective wind turbine shutdown during key periods or weather conditions. tabs., figs.

  17. Bat habitat research. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    Keller, B.L.; Bosworth, W.R.; Doering, R.W.

    1993-12-31

    This progress report describes activities over the current reporting period to characterize the habitats of bats on the INEL. Research tasks are entitled Monitoring bat habitation of caves on the INEL to determine species present, numbers, and seasons of use; Monitor bat use of man-made ponds at the INEL to determine species present and rates of use of these waters; If the Big Lost River is flowing on the INEL and/or if the Big Lost River sinks contain water, determine species present, numbers and seasons of use; Determine the habitat requirement of Townsend`s big-eared bats, including the microclimate of caves containing Townsend`s big-eared bats as compared to other caves that do not contain bats; Determine and describe an economical and efficient bat census technique to be used periodically by INEL scientists to determine the status of bats on the INEL; and Provide a suggestive management and protective plan for bat species on the INEL that might, in the future, be added to the endangered and sensitive list;

  18. Molecular Detection of Tick-Borne Pathogens in Humans with Tick Bites and Erythema Migrans, in the Netherlands.

    Directory of Open Access Journals (Sweden)

    Setareh Jahfari

    2016-10-01

    Full Text Available Tick-borne diseases are the most prevalent vector-borne diseases in Europe. Knowledge on the incidence and clinical presentation of other tick-borne diseases than Lyme borreliosis and tick-borne encephalitis is minimal, despite the high human exposure to these pathogens through tick bites. Using molecular detection techniques, the frequency of tick-borne infections after exposure through tick bites was estimated.Ticks, blood samples and questionnaires on health status were collected from patients that visited their general practitioner with a tick bite or erythema migrans in 2007 and 2008. The presence of several tick-borne pathogens in 314 ticks and 626 blood samples of this cohort were analyzed using PCR-based methods. Using multivariate logistic regression, associations were explored between pathogens detected in blood and self-reported symptoms at enrolment and during a three-month follow-up period.Half of the ticks removed from humans tested positive for Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, Candidatus Neoehrlichia mikurensis, Rickettsia helvetica, Rickettsia monacensis, Borrelia miyamotoi and several Babesia species. Among 92 Borrelia burgdorferi s. l. positive ticks, 33% carried another pathogen from a different genus. In blood of sixteen out of 626 persons with tick bites or erythema migrans, DNA was detected from Candidatus Neoehrlichia mikurensis (n = 7, Anaplasma phagocytophilum (n = 5, Babesia divergens (n = 3, Borrelia miyamotoi (n = 1 and Borrelia burgdorferi s. l. (n = 1. None of these sixteen individuals reported any overt symptoms that would indicate a corresponding illness during the three-month follow-up period. No associations were found between the presence of pathogen DNA in blood and; self-reported symptoms, with pathogen DNA in the corresponding ticks (n = 8, reported tick attachment duration, tick engorgement, or antibiotic treatment at enrolment.Based on molecular detection techniques, the

  19. Molecular Detection of Tick-Borne Pathogens in Humans with Tick Bites and Erythema Migrans, in the Netherlands.

    Science.gov (United States)

    Jahfari, Setareh; Hofhuis, Agnetha; Fonville, Manoj; van der Giessen, Joke; van Pelt, Wilfrid; Sprong, Hein

    2016-10-01

    Tick-borne diseases are the most prevalent vector-borne diseases in Europe. Knowledge on the incidence and clinical presentation of other tick-borne diseases than Lyme borreliosis and tick-borne encephalitis is minimal, despite the high human exposure to these pathogens through tick bites. Using molecular detection techniques, the frequency of tick-borne infections after exposure through tick bites was estimated. Ticks, blood samples and questionnaires on health status were collected from patients that visited their general practitioner with a tick bite or erythema migrans in 2007 and 2008. The presence of several tick-borne pathogens in 314 ticks and 626 blood samples of this cohort were analyzed using PCR-based methods. Using multivariate logistic regression, associations were explored between pathogens detected in blood and self-reported symptoms at enrolment and during a three-month follow-up period. Half of the ticks removed from humans tested positive for Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, Candidatus Neoehrlichia mikurensis, Rickettsia helvetica, Rickettsia monacensis, Borrelia miyamotoi and several Babesia species. Among 92 Borrelia burgdorferi s. l. positive ticks, 33% carried another pathogen from a different genus. In blood of sixteen out of 626 persons with tick bites or erythema migrans, DNA was detected from Candidatus Neoehrlichia mikurensis (n = 7), Anaplasma phagocytophilum (n = 5), Babesia divergens (n = 3), Borrelia miyamotoi (n = 1) and Borrelia burgdorferi s. l. (n = 1). None of these sixteen individuals reported any overt symptoms that would indicate a corresponding illness during the three-month follow-up period. No associations were found between the presence of pathogen DNA in blood and; self-reported symptoms, with pathogen DNA in the corresponding ticks (n = 8), reported tick attachment duration, tick engorgement, or antibiotic treatment at enrolment. Based on molecular detection techniques, the probability of

  20. Modulation of host immunity by tick saliva

    Czech Academy of Sciences Publication Activity Database

    Kotál, Jan; Langhansová, H.; Lieskovská, J.; Andersen, J. F.; Francischetti, I.M.B.; Chavakis, T.; Kopecký, J.; Pedra, J. H. F.; Kotsyfakis, Michalis; Chmelař, J.

    2015-01-01

    Roč. 128, OCT 14 2015 (2015), s. 58-68 ISSN 1874-3919 R&D Projects: GA ČR GAP502/12/2409 Institutional support: RVO:60077344 Keywords : Adaptive immunity * Innate immunity * Saliva * Salivary glands * Tick Subject RIV: EB - Gene tics ; Molecular Biology Impact factor: 3.867, year: 2015

  1. Ixodid ticks parasitizing wild carnivores in Romania

    Czech Academy of Sciences Publication Activity Database

    D'Amico, G.; Dumitrache, M.O.; Matei, I.A.; Ionică, A.M.; Gherman, C.M.; Sándor, A.D.; Modrý, David; Mihalca, A. D.

    2017-01-01

    Roč. 71, č. 2 (2017), s. 139-149 ISSN 0168-8162 Institutional support: RVO:60077344 Keywords : Dermacentor spp. * Haemaphysalis spp. * Ixodes spp. * Rhipicephalus spp. * wildlife * tick-host associations Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.760, year: 2016

  2. A perspective on bats (Chiroptera)

    OpenAIRE

    M. Brock Fenton

    2013-01-01

    With over 130 species, bats are the most diverse group of mammals almost everywhere in sub-Saharan Africa. Since 2000, two books (Monadjem et al. 2010; Taylor 2000) have made it much easier to appreciate this reality. Species previously unrecognised are frequent discoveries (e.g. Taylor et al. 2012). Whilst most species are mainly insectivorous, some rely more directly on plants, taking fruit and visiting flowers to obtain nectar and pollen. The combination of mobility, long lifespan and dive...

  3. Second case of European bat lyssavirus type 2 detected in a Daubenton's bat in Finland.

    Science.gov (United States)

    Nokireki, Tiina; Sironen, Tarja; Smura, Teemu; Karkamo, Veera; Sihvonen, Liisa; Gadd, Tuija

    2017-09-25

    European bat lyssavirus type 2 (EBLV-2) was detected in Finland in a Daubenton's bat (Myotis daubentonii) found in the municipality of Inkoo (60°02'45″N, 024°00'20″E). The bat showed neurological signs and was later found dead. The laboratory analysis revealed the presence of lyssavirus, and the virus was characterized as EBLV-2. This isolation of EBLV-2 was the second time that the virus has been detected in a Daubenton's bat in Finland. This provides additional proof that EBLV-2 is endemic in the Finnish Daubenton's bat population.

  4. Ticks (Acari: Ixodidae) of the state of Amazonas, Brazil.

    Science.gov (United States)

    Gianizella, Sergio L; Martins, Thiago F; Onofrio, Valeria C; Aguiar, Nair O; Gravena, Waleska; do Nascimento, Carlos A R; Neto, Laérzio C; Faria, Diogo L; Lima, Natália A S; Solorio, Monica R; Maranhão, Louise; Lima, Ivan J; Cobra, Iury V D; Santos, Tamily; Lopes, Gerson P; Ramalho, Emiliano E; Luz, Hermes R; Labruna, Marcelo B

    2018-02-01

    The tick fauna of Brazil is currently composed by 72 species. The state of Amazonas is the largest of Brazil, with an area of ≈ 19% of the Brazilian land. Besides its vast geographic area, only 19 tick species have been reported for Amazonas. Herein, lots containing ticks from the state of Amazonas were examined in three major tick collections from Brazil. A total of 5933 tick specimens were examined and recorded, comprising 2693 males, 1247 females, 1509 nymphs, and 484 larvae. These ticks were identified into the following 22 species: Amblyomma cajennense sensu lato, Amblyomma calcaratum, Amblyomma coelebs, Amblyomma dissimile, Amblyomma dubitatum, Amblyomma geayi, Amblyomma goeldii, Amblyomma humerale, Amblyomma latepunctatun, Amblyomma longirostre, Amblyomma naponense, Amblyomma oblongoguttatum, Amblyomma ovale, Amblyomma rotundatum, Amblyomma scalpturatum, Amblyomma varium, Dermacentor nitens, Haemaphysalis juxtakochi, Ixodes cf. Ixodes fuscipes, Ixodes luciae, Rhipicephalus microplus, Rhipicephalus sanguineus sensu lato. Ticks were collected from 17 (27.4%) out of the 62 municipalities that currently compose the state of Amazonas. The following four species are reported for the first time in the state of Amazonas: A. coelebs, A. dubitatum, H. juxtakochi, and Ixodes cf. I. fuscipes. The only tick species previously reported for Amazonas and not found in the present study is Amblyomma parvum. This study provides a great expansion of geographical and host records of ticks for the state of Amazonas, which is now considered to have a tick fauna composed by 23 species. It is noteworthy that we report 1391 Amblyomma nymphs that were identified to 13 different species.

  5. Tick burden on European roe deer (Capreolus capreolus).

    Science.gov (United States)

    Vor, Torsten; Kiffner, Christian; Hagedorn, Peter; Niedrig, Matthias; Rühe, Ferdinand

    2010-08-01

    In our study we assessed the tick burden on roe deer (Capreolus capreolus L.) in relation to age, physical condition, sex, deer density and season. The main objective was to find predictive parameters for tick burden. In September 2007, May, July, and September 2008, and in May and July 2009 we collected ticks on 142 culled roe deer from nine forest departments in Southern Hesse, Germany. To correlate tick burden and deer density we estimated deer density using line transect sampling that accounts for different detectability in March 2008 and 2009, respectively. We collected more than 8,600 ticks from roe deer heads and necks, 92.6% of which were Ixodes spp., 7.4% Dermacentor spp. Among Ixodes, 3.3% were larvae, 50.5% nymphs, 34.8% females and 11.4% males, with significant seasonal deviation. Total tick infestation was high, with considerable individual variation (from 0 to 270 ticks/deer). Adult tick burden was positively correlated with roe deer body indices (body mass, age, hind foot length). Significantly more nymphs were found on deer from forest departments with high roe deer density indices, indicating a positive correlation with deer abundance. Overall, tick burden was highly variable. Seasonality and large scale spatial characteristics appeared to be the most important factors affecting tick burden on roe deer.

  6. Cattle and rainfall affect tick abundance in central Kenya.

    Science.gov (United States)

    Keesing, Felicia; Ostfeld, Richard S; Young, Truman P; Allan, Brian F

    2018-03-01

    East Africa is a global hot spot for the diversity of ixodid ticks. As ectoparasites and as vectors of pathogens, ticks negatively affect the well-being of humans, livestock and wildlife. To prevent tick infestations, livestock owners and managers typically treat livestock with acaricides that kill ticks when they attempt to feed on livestock hosts. Because of the costs of preventing and mitigating tick parasitism, predicting where and when ticks will be abundant is an important challenge in this region. We used a 7-year monthly record of tick abundance on large experimental plots to assess the effects of rainfall, wildlife and cattle on larvae, nymphs and adults of two common tick species, Rhipicephalus pulchellus and Rhipicephalus praetextatus. Nymphal and adult ticks were more abundant when there had been high cumulative rainfall in the prior months. They were less abundant when cattle were present than when only large wild mammals were. Larval abundance was not affected by the presence of cattle, and larvae did not appear to be sensitive to rainfall in prior months, though they were less abundant in our surveys when rainfall was high in the sampling month. The challenges of managing ticks in this region are being exacerbated rapidly by changes in rainfall patterns wrought by climate change, and by overall increases in livestock, making efforts to predict the impacts of these drivers all the more pressing.

  7. A comparison of bats and rodents as reservoirs of zoonotic viruses: are bats special?

    Science.gov (United States)

    Luis, Angela D.; Hayman, David T. S.; O'Shea, Thomas J.; Cryan, Paul M.; Gilbert, Amy T.; Pulliam, Juliet R. C.; Mills, James N.; Timonin, Mary E.; Willis, Craig K. R.; Cunningham, Andrew A.; Fooks, Anthony R.; Rupprecht, Charles E.; Wood, James L. N.; Webb, Colleen T.

    2013-01-01

    Bats are the natural reservoirs of a number of high-impact viral zoonoses. We present a quantitative analysis to address the hypothesis that bats are unique in their propensity to host zoonotic viruses based on a comparison with rodents, another important host order. We found that bats indeed host more zoonotic viruses per species than rodents, and we identified life-history and ecological factors that promote zoonotic viral richness. More zoonotic viruses are hosted by species whose distributions overlap with a greater number of other species in the same taxonomic order (sympatry). Specifically in bats, there was evidence for increased zoonotic viral richness in species with smaller litters (one young), greater longevity and more litters per year. Furthermore, our results point to a new hypothesis to explain in part why bats host more zoonotic viruses per species: the stronger effect of sympatry in bats and more viruses shared between bat species suggests that interspecific transmission is more prevalent among bats than among rodents. Although bats host more zoonotic viruses per species, the total number of zoonotic viruses identified in bats (61) was lower than in rodents (68), a result of there being approximately twice the number of rodent species as bat species. Therefore, rodents should still be a serious concern as reservoirs of emerging viruses. These findings shed light on disease emergence and perpetuation mechanisms and may help lead to a predictive framework for identifying future emerging infectious virus reservoirs. PMID:23378666

  8. A comparison of bats and rodents as reservoirs of zoonotic viruses: are bats special?

    Science.gov (United States)

    Luis, Angela D.; Hayman, David T.S.; O'Shea, Thomas J.; Cryan, Paul M.; Gilbert, Amy T.; Pulliam, Juliet R.C.; Mills, James N.; Timonin, Mary E.; Willis, Craig K.R.; Cunningham, Andrew A.; Fooks, Anthony R.; Rupprecht, Charles E.; Wood, James L.N.; Webb, Colleen T.

    2013-01-01

    Bats are the natural reservoirs of a number of high-impact viral zoonoses. We present a quantitative analysis to address the hypothesis that bats are unique in their propensity to host zoonotic viruses based on a comparison with rodents, another important host order. We found that bats indeed host more zoonotic viruses per species than rodents, and we identified life-history and ecological factors that promote zoonotic viral richness. More zoonotic viruses are hosted by species whose distributions overlap with a greater number of other species in the same taxonomic order (sympatry). Specifically in bats, there was evidence for increased zoonotic viral richness in species with smaller litters (one young), greater longevity and more litters per year. Furthermore, our results point to a new hypothesis to explain in part why bats host more zoonotic viruses per species: the stronger effect of sympatry in bats and more viruses shared between bat species suggests that interspecific transmission is more prevalent among bats than among rodents. Although bats host more zoonotic viruses per species, the total number of zoonotic viruses identified in bats (61) was lower than in rodents (68), a result of there being approximately twice the number of rodent species as bat species. Therefore, rodents should still be a serious concern as reservoirs of emerging viruses. These findings shed light on disease emergence and perpetuation mechanisms and may help lead to a predictive framework for identifying future emerging infectious virus reservoirs.

  9. Sound localization by echolocating bats

    Science.gov (United States)

    Aytekin, Murat

    Echolocating bats emit ultrasonic vocalizations and listen to echoes reflected back from objects in the path of the sound beam to build a spatial representation of their surroundings. Important to understanding the representation of space through echolocation are detailed studies of the cues used for localization, the sonar emission patterns and how this information is assembled. This thesis includes three studies, one on the directional properties of the sonar receiver, one on the directional properties of the sonar transmitter, and a model that demonstrates the role of action in building a representation of auditory space. The general importance of this work to a broader understanding of spatial localization is discussed. Investigations of the directional properties of the sonar receiver reveal that interaural level difference and monaural spectral notch cues are both dependent on sound source azimuth and elevation. This redundancy allows flexibility that an echolocating bat may need when coping with complex computational demands for sound localization. Using a novel method to measure bat sonar emission patterns from freely behaving bats, I show that the sonar beam shape varies between vocalizations. Consequently, the auditory system of a bat may need to adapt its computations to accurately localize objects using changing acoustic inputs. Extra-auditory signals that carry information about pinna position and beam shape are required for auditory localization of sound sources. The auditory system must learn associations between extra-auditory signals and acoustic spatial cues. Furthermore, the auditory system must adapt to changes in acoustic input that occur with changes in pinna position and vocalization parameters. These demands on the nervous system suggest that sound localization is achieved through the interaction of behavioral control and acoustic inputs. A sensorimotor model demonstrates how an organism can learn space through auditory-motor contingencies

  10. Molecular detection and characterization of tick-borne pathogens in dogs and ticks from Nigeria.

    Directory of Open Access Journals (Sweden)

    Joshua Kamani

    Full Text Available BACKGROUND: Only limited information is currently available on the prevalence of vector borne and zoonotic pathogens in dogs and ticks in Nigeria. The aim of this study was to use molecular techniques to detect and characterize vector borne pathogens in dogs and ticks from Nigeria. METHODOLOGY/PRINCIPAL FINDINGS: Blood samples and ticks (Rhipicephalus sanguineus, Rhipicephalus turanicus and Heamaphysalis leachi collected from 181 dogs from Nigeria were molecularly screened for human and animal vector-borne pathogens by PCR and sequencing. DNA of Hepatozoon canis (41.4%, Ehrlichia canis (12.7%, Rickettsia spp. (8.8%, Babesia rossi (6.6%, Anaplasma platys (6.6%, Babesia vogeli (0.6% and Theileria sp. (0.6% was detected in the blood samples. DNA of E. canis (23.7%, H. canis (21.1%, Rickettsia spp. (10.5%, Candidatus Neoehrlichia mikurensis (5.3% and A. platys (1.9% was detected in 258 ticks collected from 42 of the 181 dogs. Co- infections with two pathogens were present in 37% of the dogs examined and one dog was co-infected with 3 pathogens. DNA of Rickettsia conorii israelensis was detected in one dog and Rhipicephalus sanguineus tick. DNA of another human pathogen, Candidatus N. mikurensis was detected in Rhipicephalus sanguineus and Heamaphysalis leachi ticks, and is the first description of Candidatus N. mikurensis in Africa. The Theileria sp. DNA detected in a local dog in this study had 98% sequence identity to Theileria ovis from sheep. CONCLUSIONS/SIGNIFICANCE: The results of this study indicate that human and animal pathogens are abundant in dogs and their ticks in Nigeria and portray the potential high risk of human exposure to infection with these agents.

  11. Climate change, biodiversity, ticks and tick-borne diseases: The butterfly effect.

    Science.gov (United States)

    Dantas-Torres, Filipe

    2015-12-01

    We have killed wild animals for obtaining food and decimated forests for many reasons. Nowadays, we are burning fossil fuels as never before and even exploring petroleum in deep waters. The impact of these activities on our planet is now visible to the naked eye and the debate on climate change is warming up in scientific meetings and becoming a priority on the agenda of both scientists and policy decision makers. On the occasion of the Impact of Environmental Changes on Infectious Diseases (IECID) meeting, held in the 2015 in Sitges, Spain, I was invited to give a keynote talk on climate change, biodiversity, ticks and tick-borne diseases. The aim of the present article is to logically extend my rationale presented on the occasion of the IECID meeting. This article is not intended to be an exhaustive review, but an essay on climate change, biodiversity, ticks and tick-borne diseases. It may be anticipated that warmer winters and extended autumn and spring seasons will continue to drive the expansion of the distribution of some tick species (e.g., Ixodes ricinus) to northern latitudes and to higher altitudes. Nonetheless, further studies are advocated to improve our understanding of the complex interactions between landscape, climate, host communities (biodiversity), tick demography, pathogen diversity, human demography, human behaviour, economics, and politics, also considering all ecological processes (e.g., trophic cascades) and other possible interacting effects (e.g., mutual effects of increased greenhouse gas emissions and increased deforestation rates). The multitude of variables and interacting factors involved, and their complexity and dynamism, make tick-borne transmission systems beyond (current) human comprehension. That is, perhaps, the main reason for our inability to precisely predict new epidemics of vector-borne diseases in general.

  12. Phylogeographic Characterization of Tick-Borne Encephalitis Virus from Patients, Rodents and Ticks in Slovenia

    Science.gov (United States)

    Fajs, Luka; Durmiši, Emina; Knap, Nataša; Strle, Franc; Avšič-Županc, Tatjana

    2012-01-01

    Tick-borne encephalitis virus (TBEV) is the most important arboviral agent causing infections of the central nervous system in central Europe. Previous studies have shown that TBEV exhibits pronounced genetic variability, which is often correlated to the geographical origin of TBEV. Genetic variability of TBEV has previously been studied predominantly in rodents and ticks, while information about the variability in patients is scarce. In order to understand the molecular relationships of TBEV between natural hosts, vectors and humans, as well as correlation between phylogenetic and geographical clustering, sequences of TBEV E and NS5 protein genes, were obtained by direct sequencing of RT-PCR products from TBE-confirmed patients as well as from rodents and ticks collected from TBE-endemic regions in Slovenia. A total of 27 partial E protein gene sequences representing 15 human, 4 rodent and 8 tick samples and 30 partial NS5 protein gene sequences representing 17 human, 5 rodent and 8 tick samples were obtained. The complete genome sequence of TBEV strain Ljubljana I was simultaneously obtained. Phylogenetic analysis of the E and NS5 protein gene sequences revealed a high degree of TBEV variability in patients, ticks and rodents. Furthermore, an evident correlation between geographical and phylogenetic clustering was shown that was independent of the TBEV host. Moreover, we show the presence of a possible recombination event in the TBEV genome obtained from a patient sample, which was supported with multiple recombination event detection methods. This is the first study that simultaneously analyzed the genetic relationships of directly sequenced TBEV samples from patients, ticks and rodents and provides the largest set of patient-derived TBEV sequences up to date. In addition, we have confirmed the geographical clustering of TBEV sequences in Slovenia and have provided evidence of a possible recombination event in the TBEV genome, obtained from a patient. PMID

  13. Phylogeographic characterization of tick-borne encephalitis virus from patients, rodents and ticks in Slovenia.

    Directory of Open Access Journals (Sweden)

    Luka Fajs

    Full Text Available Tick-borne encephalitis virus (TBEV is the most important arboviral agent causing infections of the central nervous system in central Europe. Previous studies have shown that TBEV exhibits pronounced genetic variability, which is often correlated to the geographical origin of TBEV. Genetic variability of TBEV has previously been studied predominantly in rodents and ticks, while information about the variability in patients is scarce. In order to understand the molecular relationships of TBEV between natural hosts, vectors and humans, as well as correlation between phylogenetic and geographical clustering, sequences of TBEV E and NS5 protein genes, were obtained by direct sequencing of RT-PCR products from TBE-confirmed patients as well as from rodents and ticks collected from TBE-endemic regions in Slovenia. A total of 27 partial E protein gene sequences representing 15 human, 4 rodent and 8 tick samples and 30 partial NS5 protein gene sequences representing 17 human, 5 rodent and 8 tick samples were obtained. The complete genome sequence of TBEV strain Ljubljana I was simultaneously obtained. Phylogenetic analysis of the E and NS5 protein gene sequences revealed a high degree of TBEV variability in patients, ticks and rodents. Furthermore, an evident correlation between geographical and phylogenetic clustering was shown that was independent of the TBEV host. Moreover, we show the presence of a possible recombination event in the TBEV genome obtained from a patient sample, which was supported with multiple recombination event detection methods. This is the first study that simultaneously analyzed the genetic relationships of directly sequenced TBEV samples from patients, ticks and rodents and provides the largest set of patient-derived TBEV sequences up to date. In addition, we have confirmed the geographical clustering of TBEV sequences in Slovenia and have provided evidence of a possible recombination event in the TBEV genome, obtained from a

  14. Climate change, biodiversity, ticks and tick-borne diseases: The butterfly effect

    Directory of Open Access Journals (Sweden)

    Filipe Dantas-Torres

    2015-12-01

    Full Text Available We have killed wild animals for obtaining food and decimated forests for many reasons. Nowadays, we are burning fossil fuels as never before and even exploring petroleum in deep waters. The impact of these activities on our planet is now visible to the naked eye and the debate on climate change is warming up in scientific meetings and becoming a priority on the agenda of both scientists and policy decision makers. On the occasion of the Impact of Environmental Changes on Infectious Diseases (IECID meeting, held in the 2015 in Sitges, Spain, I was invited to give a keynote talk on climate change, biodiversity, ticks and tick-borne diseases. The aim of the present article is to logically extend my rationale presented on the occasion of the IECID meeting. This article is not intended to be an exhaustive review, but an essay on climate change, biodiversity, ticks and tick-borne diseases. It may be anticipated that warmer winters and extended autumn and spring seasons will continue to drive the expansion of the distribution of some tick species (e.g., Ixodes ricinus to northern latitudes and to higher altitudes. Nonetheless, further studies are advocated to improve our understanding of the complex interactions between landscape, climate, host communities (biodiversity, tick demography, pathogen diversity, human demography, human behaviour, economics, and politics, also considering all ecological processes (e.g., trophic cascades and other possible interacting effects (e.g., mutual effects of increased greenhouse gas emissions and increased deforestation rates. The multitude of variables and interacting factors involved, and their complexity and dynamism, make tick-borne transmission systems beyond (current human comprehension. That is, perhaps, the main reason for our inability to precisely predict new epidemics of vector-borne diseases in general.

  15. A survey of tick-borne pathogens in dogs and their ticks in the Pantanal biome, Brazil.

    Science.gov (United States)

    Melo, A L T; Witter, R; Martins, T F; Pacheco, T A; Alves, A S; Chitarra, C S; Dutra, V; Nakazato, L; Pacheco, R C; Labruna, M B; Aguiar, D M

    2016-03-01

    Tick and blood samples collected from domestic dogs in the Brazilian Pantanal were tested by molecular methods for the presence of tick-borne protozoa and bacteria. Among 320 sampled dogs, 3.13% were infected by Babesia vogeli (Piroplasmida: Babesiidae), 8.75% by Hepatozoon canis (Eucoccidiorida: Hepatozoidae), 7.19% by Anaplasma platys (Rickettsiales: Anaplasmataceae), and 0.94% by an unclassified Anaplasma sp. In three tick species collected from dogs, the following tick-borne agents were detected: (a) B. vogeli, An. platys and Ehrlichia canis (Rickettsiales: Anaplasmataceae), infecting Rhipicephalus sanguineus sensu lato (Ixodida: Ixodidae) ticks; (b) H. canis, an unclassified Anaplasma sp. and Rickettsia amblyommii (Rickettsiales: Rickettsiaceae), infecting Amblyomma cajennense sensu lato (Ixodida: Ixodidae) ticks, and (c) Rickettsia sp. strain Atlantic rainforest, an emerging human pathogen, infecting Amblyomma ovale ticks. Molecular analysis, based on a mitochondrial gene, revealed that the Am. cajennense s.l. ticks of the present study corresponded to Amblyomma sculptum, a member of the Am. cajennense species complex, and that Rh. sanguineus s.l. belonged to the tropical lineage. Whereas dogs are exposed to a number of tick-borne bacterial and protozoan agents in the Pantanal biome, humans are potentially exposed to infection by spotted fever group rickettsiae (e.g. R. amblyommii and Rickettsia sp. strain Atlantic rainforest) because both Am. sculptum and Am. ovale are among the most important human-biting ticks in Brazil. © 2015 The Royal Entomological Society.

  16. Seasonal Activity of Ticks and their Importance in Tick-Borne Infectious Diseases in West Azerbaijan, Iran

    Directory of Open Access Journals (Sweden)

    Sh Salari Lak

    2008-12-01

    Full Text Available "nBackground: West Azerbaijan is considered as a main region for domestic animal breeding. Due to importance of herd as a main host and ticks as a vector of relapsing fever and CCHF, a comprehensive study was undertaken in the region."nMethods: Outdoor, indoor collection as well as ticks stick to the animals' body were collected and identified. The study was conducted during the whole seasons in 2004-2005."nResults: During four seasons a total of 2728 ticks of two families (Ixodidae and Argasidae were collected compris­ing 7 genera of 5 hard ticks and two genera of soft ticks including Haemaphysalis, Hyalomma, Rhipicepha­lus, Boophilus and Dermacentor. The soft ticks were Ornithodoros and Argas. These 7 genera included 18 species. The main species were Haemaphysalis inermis, H. punctata, H. sulcata, H. numidiana, H. concinna, Hyalomma mar­gi­natum, Hy. anatolicum, Hy. detritum, Hy. dromedarii, Hy. asiaticum, Hy. schulzei, H. aegyptium, Rhipicephalus bursa, R. sangiuneus, Dermacentor marginatus, Boophilus annulatus, Ornithodoros lahorensis, and Argas persicus. Fre­quency of ticks during different seasons was different. A pyrethroid insecticide, cypermethrin, which is widely used for tick control was tested against soft ticks. The test method was based on WHO recommendation. At the LD50 level A. persicus needs more concentration than O. lahorensis."nConclusion: Ornithodoros and Argas are the more prevalent soft ticks in the region. Distribution and prevalence of hard ticks was varied in different seasons. Results of this study will provide a clue for vectors of tick-borne diseases in the region for local authorities for implementation of tick control.

  17. Seasonal Activity of Ticks and their Importance in Tick-Borne Infectious Diseases in West Azerbaijan, Iran

    Directory of Open Access Journals (Sweden)

    Sh Salari Lak

    2008-12-01

    Full Text Available Background: West Azerbaijan is considered as a main region for domestic animal breeding. Due to importance of herd as a main host and ticks as a vector of relapsing fever and CCHF, a comprehensive study was undertaken in the region.Methods: Outdoor, indoor collection as well as ticks stick to the animals' body were collected and identified. The study was conducted during the whole seasons in 2004-2005.Results: During four seasons a total of 2728 ticks of two families (Ixodidae and Argasidae were collected compris­ing 7 genera of 5 hard ticks and two genera of soft ticks including Haemaphysalis, Hyalomma, Rhipicepha­lus, Boophilus and Dermacentor. The soft ticks were Ornithodoros and Argas. These 7 genera included 18 species. The main species were Haemaphysalis inermis, H. punctata, H. sulcata, H. numidiana, H. concinna, Hyalomma mar­gi­natum, Hy. anatolicum, Hy. detritum, Hy. dromedarii, Hy. asiaticum, Hy. schulzei, H. aegyptium, Rhipicephalus bursa, R. sangiuneus, Dermacentor marginatus, Boophilus annulatus, Ornithodoros lahorensis, and Argas persicus. Fre­quency of ticks during different seasons was different. A pyrethroid insecticide, cypermethrin, which is widely used for tick control was tested against soft ticks. The test method was based on WHO recommendation. At the LD50 level A. persicus needs more concentration than O. lahorensis.Conclusion: Ornithodoros and Argas are the more prevalent soft ticks in the region. Distribution and prevalence of hard ticks was varied in different seasons. Results of this study will provide a clue for vectors of tick-borne diseases in the region for local authorities for implementation of tick control.

  18. Confirmation of Tick Bite by Detection of Antibody to Ixodes Calreticulin Salivary Protein▿

    OpenAIRE

    Alarcon-Chaidez, Francisco; Ryan, Raymond; Wikel, Stephen; Dardick, Kenneth; Lawler, Caroline; Foppa, Ivo M.; Tomas, Patricio; Cushman, Alexis; Hsieh, Ann; Spielman, Andrew; Bouchard, Keith R.; Dias, Filiciano; Aslanzadeh, Jaber; Krause, Peter J.

    2006-01-01

    Ticks introduce a variety of pharmacologically active molecules into their host during attachment and feeding in order to obtain a blood meal. People who are repeatedly exposed to ticks may develop an immune response to tick salivary proteins. Despite this response, people usually are unaware of having been bitten, especially if they are not repeatedly exposed to ticks. In order to develop a laboratory marker of tick exposure that would be useful in understanding the epidemiology of tick-born...

  19. Ecological dynamics of emerging bat virus spillover

    Science.gov (United States)

    Plowright, Raina K.; Eby, Peggy; Hudson, Peter J.; Smith, Ina L.; Westcott, David; Bryden, Wayne L.; Middleton, Deborah; Reid, Peter A.; McFarlane, Rosemary A.; Martin, Gerardo; Tabor, Gary M.; Skerratt, Lee F.; Anderson, Dale L.; Crameri, Gary; Quammen, David; Jordan, David; Freeman, Paul; Wang, Lin-Fa; Epstein, Jonathan H.; Marsh, Glenn A.; Kung, Nina Y.; McCallum, Hamish

    2015-01-01

    Viruses that originate in bats may be the most notorious emerging zoonoses that spill over from wildlife into domestic animals and humans. Understanding how these infections filter through ecological systems to cause disease in humans is of profound importance to public health. Transmission of viruses from bats to humans requires a hierarchy of enabling conditions that connect the distribution of reservoir hosts, viral infection within these hosts, and exposure and susceptibility of recipient hosts. For many emerging bat viruses, spillover also requires viral shedding from bats, and survival of the virus in the environment. Focusing on Hendra virus, but also addressing Nipah virus, Ebola virus, Marburg virus and coronaviruses, we delineate this cross-species spillover dynamic from the within-host processes that drive virus excretion to land-use changes that increase interaction among species. We describe how land-use changes may affect co-occurrence and contact between bats and recipient hosts. Two hypotheses may explain temporal and spatial pulses of virus shedding in bat populations: episodic shedding from persistently infected bats or transient epidemics that occur as virus is transmitted among bat populations. Management of livestock also may affect the probability of exposure and disease. Interventions to decrease the probability of virus spillover can be implemented at multiple levels from targeting the reservoir host to managing recipient host exposure and susceptibility. PMID:25392474

  20. Schizamniogenesis in the rusty bat, Pipistrellus rusticus

    African Journals Online (AJOL)

    Schizamniogenesis in the rusty bat,. Pipistrellus rusticus. M. van der Merwe. Mammal Research Institute, University of Pretoria, Pretoria,. 0002 Republic of South Africa. Received 20 September 1993; accepled 3 May 1994. Rusty bats are seasonally mono estrous, carrying a single foetus in each of the two uterine horns.

  1. Dengue Virus in Bats from Southeastern Mexico

    Science.gov (United States)

    Sotomayor-Bonilla, Jesús; Chaves, Andrea; Rico-Chávez, Oscar; Rostal, Melinda K.; Ojeda-Flores, Rafael; Salas-Rojas, Mónica; Aguilar-Setien, Álvaro; Ibáñez-Bernal, Sergio; Barbachano-Guerrero, Arturo; Gutiérrez-Espeleta, Gustavo; Aguilar-Faisal, J. Leopoldo; Aguirre, A. Alonso; Daszak, Peter; Suzán, Gerardo

    2014-01-01

    To identify the relationship between landscape use and dengue virus (DENV) occurrence in bats, we investigated the presence of DENV from anthropogenically changed and unaltered landscapes in two Biosphere Reserves: Calakmul (Campeche) and Montes Azules (Chiapas) in southern Mexico. Spleen samples of 146 bats, belonging to 16 species, were tested for four DENV serotypes with standard reverse transcriptase polymerase chain reaction (RT-PCR) protocols. Six bats (4.1%) tested positive for DENV-2: four bats in Calakmul (two Glossophaga soricina, one Artibeus jamaicensis, and one A. lituratus) and two bats in Montes Azules (both A. lituratus). No effect of anthropogenic disturbance on the occurrence of DENV was detected; however, all three RT-PCR–positive bat species are considered abundant species in the Neotropics and well-adapted to disturbed habitats. To our knowledge, this study is the first study conducted in southeastern Mexico to identify DENV-2 in bats by a widely accepted RT-PCR protocol. The role that bats play on DENV's ecology remains undetermined. PMID:24752688

  2. Intensity and directionality of bat echolocation signals

    Directory of Open Access Journals (Sweden)

    Lasse eJakobsen

    2013-04-01

    Full Text Available The paper reviews current knowledge of intensity and directionality of bat echolocation signals. Recent studies have revealed that echolocating bats can be much louder than previously believed. Bats previously dubbed whispering can emit calls with source levels up to 110 dB SPL at 10 cm and the louder open space hunting bats have been recorded at above 135 dB SPL. This implies that maximum emitted intensities are generally 30 dB or more above initial estimates. Bats’ dynamic control of acoustic features also includes the intensity and directionality of their sonar calls. Aerial hawking bats will increase signal directionality in the field along with intensity thus increasing sonar range. During the last phase of prey pursuit, vespertilionid bats broaden their echolocation beam considerably, probably to counter evasive manoeuvres of eared prey. We highlight how multiple call parameters (frequency, duration, intensity and directionality of echolocation signals in unison define the search volume probed by bats and in turn how bats perceive their surroundings. Small changes to individual parameters can, in combination, drastically change the bat’s perception, facilitating successful navigation and food acquisition across a vast range of ecological niches. To better understand the function of echolocation in the natural habitat it is critical to determine multiple acoustic features of the echolocation calls. The combined (interactive effects, not only of frequency and time parameters, but also of intensity and directionality, define the bat’s view of its acoustic scene.

  3. Vision Quest seeks answer to bat mortality

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2006-01-15

    Two research programs investigating bat mortalities at Vision Quest Windelectric's 68 MW Summerview Wind Farm in southern Alberta were reviewed. Field teams discovered 532 bat carcasses during the first year of routine post-construction monitoring at the wind farm. The problem appeared to be confined to the fall migration, with over 90 per cent of mortalities found during the fall. Most collisions occurred on low-wind speed nights. Thermal imaging has shown that the bats collided with moving blades. However, very little is known about the migratory patterns that bring them into contact with the wind farms. Vision Quest has provided funding for a study to examine the echolocation abilities of bats during migration, the influence of weather conditions, the wind speed of bats, and whether or not there is anything about the turbines that attracts them. Preliminary studies have suggested that machines that were on low wind shutdown had fewer collisions. It was anticipated that a comparison between activity levels at Summerview with other wind farms or sites will provide clues about the high levels of collision. In addition to the study, the United States based EcoSystems Technology will track bat behaviour during the fall migration using radar. Alberta Fish and Wildlife is currently developing a set of guidelines for siting and monitoring wind projects and has asked the Alberta Bat Action Team to develop a set of monitoring protocols to help in predicting the risk to bats prior to the construction of wind farms.

  4. A study of wood baseball bat breakage

    Science.gov (United States)

    Patrick Drane; James Sherwood; Renzo Colosimo; David Kretschmann

    2012-01-01

    Over the span of three months in 2008, 2232 baseball bats broke while being used during Major League Baseball (MLB) games; of which 756 were classified as Multi Piece Failures (MPFs). This rate of failure motivated Major League Baseball to explore options for potential changes in the bat regulations to reduce the rate. After a study of the information that could be...

  5. Roost characteristics of hoary bats in Arkansas

    Science.gov (United States)

    Roger W. Perry; Ronald E. Thill

    2007-01-01

    We radiotracked nine hoary bats (Lasiurus cinereus) and characterized 12 roosts during late spring and early summer in the Ouachita Mountains of central Arkansas. Hoary bats generally roosted on the easterly sides of tree canopies in the foliage of white oaks (Quercus alba), post oaks (Q. stellata) and shortleaf pines (Pinus...

  6. Vampire Bat Rabies: Ecology, Epidemiology and Control

    Science.gov (United States)

    Johnson, Nicholas; Aréchiga-Ceballos, Nidia; Aguilar-Setien, Alvaro

    2014-01-01

    Extensive surveillance in bat populations in response to recent emerging diseases has revealed that this group of mammals acts as a reservoir for a large range of viruses. However, the oldest known association between a zoonotic virus and a bat is that between rabies virus and the vampire bat. Vampire bats are only found in Latin America and their unique method of obtaining nutrition, blood-feeding or haematophagy, has only evolved in the New World. The adaptations that enable blood-feeding also make the vampire bat highly effective at transmitting rabies virus. Whether the virus was present in pre-Columbian America or was introduced is much disputed, however, the introduction of Old World livestock and associated landscape modification, which continues to the present day, has enabled vampire bat populations to increase. This in turn has provided the conditions for rabies re-emergence to threaten both livestock and human populations as vampire bats target large mammals. This review considers the ecology of the vampire bat that make it such an efficient vector for rabies, the current status of vampire-transmitted rabies and the future prospects for spread by this virus and its control. PMID:24784570

  7. Effects of acoustic deterrents on foraging bats

    Science.gov (United States)

    Joshua B. Johnson; W. Mark Ford; Jane L. Rodrigue; John W. Edwards

    2012-01-01

    Significant bat mortality events associated with wind energy expansion, particularly in the Appalachians, have highlighted the need for development of possible mitigation practices to reduce or prevent strike mortality. Other than increasing turbine cut-in speed, acoustic deterrents probably hold the greatest promise for reducing bat mortality. However, acoustic...

  8. Use of the forest canopy by bats.

    Science.gov (United States)

    L. Wunder; A.B. Carey

    1994-01-01

    Of the 15 species of bats in the Pacific Northwest, 11 are known to make regular use of the forest canopy for roosting, foraging, and reproduction. This paper reviews roosting requirements, foraging, and the importance of landscape-scale factors to canopy using species in the Northwest. Many northwest bats use several different types of tree roosts. Common roosting...

  9. Tick microbiome and pathogen acquisition altered by host blood meal.

    Science.gov (United States)

    Swei, Andrea; Kwan, Jessica Y

    2017-03-01

    Lyme disease, a zoonotic disease, is the most prevalent vector-borne disease in the Northern Hemisphere. Diversity of the vector (tick) microbiome can impact pathogen transmission, yet the biotic and abiotic factors that drive microbiome diversity are largely unresolved, especially under natural, field conditions. We describe the microbiome of Ixodes pacificus ticks, the vector for Lyme disease in the western United States, and show a strong impact of host blood meal identity on tick microbiome species richness and composition. Western fence lizards, a host that is refractory to the Lyme disease pathogen, significantly reduces microbiome diversity in ticks relative to ticks that feed on a mammalian reservoir host. Host blood meal-driven reduction of tick microbiome diversity may have lifelong repercussions on I. pacificus vector competency and ultimately disease dynamics.

  10. Biology, treatment, and control of flea and tick infestations.

    Science.gov (United States)

    Blagburn, Byron L; Dryden, Michael W

    2009-11-01

    Flea and tick infestations are common and elimination can be expensive and time consuming. Many advances in control of fleas can be directly linked to improved knowledge of the intricacies of flea host associations, reproduction, and survival in the premises. Understanding tick biology and ecology is far more difficult than with fleas, because North America can have up to 9 different tick species infesting cats and dogs compared to 1 primary flea species. Effective tick control is more difficult to achieve than effective flea control, because of the abundance of potential alternative hosts in the tick life cycle. Many effective host-targeted tick control agents exist, several of which also possess activity against adult or immature fleas and other parasites.

  11. Rickettsia Species in Ticks Removed from Humans in Istanbul, Turkey

    Science.gov (United States)

    Gargili, Aysen; Palomar, Ana M.; Midilli, Kenan; Portillo, Aránzazu; Kar, Sırrı

    2012-01-01

    Abstract A total of 167 ticks collected from humans in Istanbul (Turkey) in 2006 were screened for Rickettsia species, and nested PCRs targeting gltA and ompA rickettsial fragment genes were carried out. Rickettsia monacensis (51), R. aeschlimannii (8), R. conorii subsp. conorii (3), R. helvetica (2), R. raoultii (1), R. africae (1), R. felis (1), and other Rickettsia spp. (2), were detected. To our knowledge, these Rickettsia species (except R. conorii) had never been reported in ticks removed from humans in Turkey. The presence of R. africae also had not been previously described, either in Hyalomma ticks or in any European tick species. In addition, R. aeschlimannii and R. felis had not been found associated with Rhipicephalus bursa specimens. The presence of human pathogenic Rickettsia in ticks removed from humans provides information about the risk of tick-borne rickettsioses in Turkey. PMID:22925016

  12. Poxviruses in Bats … so What?

    Directory of Open Access Journals (Sweden)

    Kate S. Baker

    2014-04-01

    Full Text Available Poxviruses are important pathogens of man and numerous domestic and wild animal species. Cross species (including zoonotic poxvirus infections can have drastic consequences for the recipient host. Bats are a diverse order of mammals known to carry lethal viral zoonoses such as Rabies, Hendra, Nipah, and SARS. Consequent targeted research is revealing bats to be infected with a rich diversity of novel viruses. Poxviruses were recently identified in bats and the settings in which they were found were dramatically different. Here, we review the natural history of poxviruses in bats and highlight the relationship of the viruses to each other and their context in the Poxviridae family. In addition to considering the zoonotic potential of these viruses, we reflect on the broader implications of these findings. Specifically, the potential to explore and exploit this newfound relationship to study coevolution and cross species transmission together with fundamental aspects of poxvirus host tropism as well as bat virology and immunology.

  13. Swift Burst Alert Telescope (BAT) Instrument Response

    International Nuclear Information System (INIS)

    Parsons, A.; Barthelmy, S.; Cummings, J.; Gehrels, N.; Hullinger, D.; Krimm, H.; Markwardt, C.; Tueller, J.; Fenimore, E.; Palmer, D.; Sato, G.; Takahashi, T.; Nakazawa, K.; Okada, Y.; Takahashi, H.; Suzuki, M.; Tashiro, M.

    2004-01-01

    The Burst Alert Telescope (BAT), a large coded aperture instrument with a wide field-of-view (FOV), provides the gamma-ray burst triggers and locations for the Swift Gamma-Ray Burst Explorer. In addition to providing this imaging information, BAT will perform a 15 keV - 150 keV all-sky hard x-ray survey based on the serendipitous pointings resulting from the study of gamma-ray bursts, and will also monitor the sky for transient hard x-ray sources. For BAT to provide spectral and photometric information for the gamma-ray bursts, the transient sources and the all-sky survey, the BAT instrument response must be determined to an increasingly greater accuracy. This paper describes the spectral models and the ground calibration experiments used to determine the BAT response to an accuracy suitable for gamma-ray burst studies

  14. Ticks and spotted fever group rickettsiae of southeastern Virginia.

    Science.gov (United States)

    Nadolny, Robyn M; Wright, Chelsea L; Sonenshine, Daniel E; Hynes, Wayne L; Gaff, Holly D

    2014-02-01

    The incidence of tick-borne rickettsial disease in the southeastern United States has been rising steadily through the past decade, and the range expansions of tick species and tick-borne infectious agents, new and old, has resulted in an unprecedented mix of vectors and pathogens. The results of an ongoing 4-year surveillance project describe the relative abundance of questing tick populations in southeastern Virginia. Since 2009, more than 66,000 questing ticks of 7 species have been collected from vegetation in a variety of habitats, with Amblyomma americanum constituting over 95% of ticks collected. Other species represented included Ixodes scapularis, Dermacentor variabilis, Amblyomma maculatum, Ixodes affinis, Haemaphysalis leporispalustris, and Ixodes brunneus. We found that 26.9-54.9% of A. americanum ticks tested were positive for Rickettsia amblyommii, a non-pathogenic symbiont of this tick species. We also found no evidence of R. rickettsii in D. variabilis ticks, although they did show low infection rates of R. montanensis (1.5-2.0%). Rickettsia parkeri and Candidatus R. andeanae were found in 41.8-55.7% and 0-1.5% A. maculatum ticks, respectively. The rate of R. parkeri in A. maculatum ticks is among the highest in the literature and has increased in the 2 years since R. parkeri and A. maculatum were first reported in southeastern Virginia. We conclude that tick populations in southeastern Virginia have recently undergone dramatic changes in species and abundance and that these populations support a variety of rickettsial agents with the potential for increased risk to human health. Copyright © 2013 Elsevier GmbH. All rights reserved.

  15. Tick-borne encephalitis virus infection in humans

    OpenAIRE

    Hrnjaković-Cvjetković Ivana; Cvjetković Dejan; Patić Aleksandra; Radovanov Jelena; Kovačević Gordana; Milošević Vesna

    2016-01-01

    Introduction. Tick-borne meningoencephalitis virus is a flavivirus that causes the most important vector-borne central nervous system infection in many countries of Europe and Asia. There are three subtypes of tick-borne encephalitis virus: European, Siberian and the Far-Eastern subtype. Transmission. In endemic areas, the virus remains in transmissive cycles between Ixodes ticks and small rodents. Clinical picture. In most cases (70−98%) infection goes asy...

  16. Vampire bats exhibit evolutionary reduction of bitter taste receptor genes common to other bats

    Science.gov (United States)

    Hong, Wei; Zhao, Huabin

    2014-01-01

    The bitter taste serves as an important natural defence against the ingestion of poisonous foods and is thus believed to be indispensable in animals. However, vampire bats are obligate blood feeders that show a reduced behavioural response towards bitter-tasting compounds. To test whether bitter taste receptor genes (T2Rs) have been relaxed from selective constraint in vampire bats, we sampled all three vampire bat species and 11 non-vampire bats, and sequenced nine one-to-one orthologous T2Rs that are assumed to be functionally conserved in all bats. We generated 85 T2R sequences and found that vampire bats have a significantly greater percentage of pseudogenes than other bats. These results strongly suggest a relaxation of selective constraint and a reduction of bitter taste function in vampire bats. We also found that vampire bats retain many intact T2Rs, and that the taste signalling pathway gene Calhm1 remains complete and intact with strong functional constraint. These results suggest the presence of some bitter taste function in vampire bats, although it is not likely to play a major role in food selection. Together, our study suggests that the evolutionary reduction of bitter taste function in animals is more pervasive than previously believed, and highlights the importance of extra-oral functions of taste receptor genes. PMID:24966321

  17. The microbiome of neotropical ticks parasitizing on passerine migratory birds.

    Science.gov (United States)

    Budachetri, Khemraj; Williams, Jaclyn; Mukherjee, Nabanita; Sellers, Michael; Moore, Frank; Karim, Shahid

    2017-01-01

    Seasonal migration of passerine birds between temperate North America and tropical Central and South America is an ecological phenomenon. Migration of birds has been associated with the introduction of ectoparasites like ticks or tick-borne pathogens across the avian migration routes. In this study, the microbial diversity was determined in the ticks and bird DNA samples using 454 pyrosequencing of bacterial 16S rRNA gene. Tick DNA samples showed the dominance of genera Lactococcus, Francisella, Raoultella, Wolbachia and Rickettsia across all the ticks, but birds DNA did not share common microbial diversity with ticks. Furthermore, "Candidatus Rickettsia amblyommii" infection in the 91 ticks collected off the songbirds was also quantified by qPCR assay. Interestingly, "Candidatus R. amblyommii" was tested positive in 24 ticks (26% infection), and infection varied from as low as three copies to thousands of copies, but bird blood samples showed no amplification. Our results provide evidence that songbirds serve as transport carrier for immature ticks, and less likely to be a reservoir for "Candidatus R. amblyommii". Copyright © 2016 Elsevier GmbH. All rights reserved.

  18. Modelling tick abundance using machine learning techniques and satellite imagery

    DEFF Research Database (Denmark)

    Kjær, Lene Jung; Korslund, L.; Kjelland, V.

    satellite images to run Boosted Regression Tree machine learning algorithms to predict overall distribution (presence/absence of ticks) and relative tick abundance of nymphs and larvae in southern Scandinavia. For nymphs, the predicted abundance had a positive correlation with observed abundance...... the predicted distribution of larvae was mostly even throughout Denmark, it was primarily around the coastlines in Norway and Sweden. Abundance was fairly low overall except in some fragmented patches corresponding to forested habitats in the region. Machine learning techniques allow us to predict for larger...... the collected ticks for pathogens and using the same machine learning techniques to develop prevalence maps of the ScandTick region....

  19. Pet ownership increases human risk of encountering ticks.

    Science.gov (United States)

    Jones, E H; Hinckley, A F; Hook, S A; Meek, J I; Backenson, B; Kugeler, K J; Feldman, K A

    2018-02-01

    We examined whether pet ownership increased the risk for tick encounters and tickborne disease among residents of three Lyme disease-endemic states as a nested cohort within a randomized controlled trial. Information about pet ownership, use of tick control for pets, property characteristics, tick encounters and human tickborne disease were captured through surveys, and associations were assessed using univariate and multivariable analyses. Pet-owning households had 1.83 times the risk (95% CI = 1.53, 2.20) of finding ticks crawling on and 1.49 times the risk (95% CI = 1.20, 1.84) of finding ticks attached to household members compared to households without pets. This large evaluation of pet ownership, human tick encounters and tickborne diseases shows that pet owners, whether of cats or dogs, are at increased risk of encountering ticks and suggests that pet owners are at an increased risk of developing tickborne disease. Pet owners should be made aware of this risk and be reminded to conduct daily tick checks of all household members, including the pets, and to consult their veterinarian regarding effective tick control products. © 2017 Blackwell Verlag GmbH.

  20. Persistent Ehrlichia ewingii Infection in Dogs after Natural Tick Infestation

    OpenAIRE

    Starkey, L.A.; Barrett, A.W.; Beall, M.J.; Chandrashekar, R.; Thatcher, B.; Tyrrell, P.; Little, S.E.

    2015-01-01

    Background Ehrlichia ewingii, which causes disease in dogs and people, is the most common Ehrlichia spp. infecting dogs in the United States, but little is known about how long E.?ewingii infection persists in dogs. Hypothesis/Objectives To evaluate the persistence of natural infection with E.?ewingii in dogs. Animals Four Class A Beagles; no previous exposure to ticks or tick?borne infectious agents. Methods Dogs were exposed to ticks by weekly walks through tick habitat in north central Okl...

  1. Understanding human - bat interactions in NSW, Australia: improving risk communication for prevention of Australian bat lyssavirus.

    Science.gov (United States)

    Quinn, Emma K; Massey, Peter D; Cox-Witton, Keren; Paterson, Beverley J; Eastwood, Keith; Durrheim, David N

    2014-07-02

    Australian bat lyssavirus (ABLV) infects a number of flying fox and insectivorous bats species in Australia. Human infection with ABLV is inevitably fatal unless prior vaccination and/or post-exposure treatment (PET) is given. Despite ongoing public health messaging about the risks associated with bat contact, surveillance data have revealed a four-fold increase in the number of people receiving PET for bat exposure in NSW between 2007 and 2011. Our study aimed to better understand these human - bat interactions in order to identify additional risk communication messages that could lower the risk of potential ABLV exposure. All people aged 18 years or over whom received PET for non-occupation related potential ABLV exposure in the Hunter New England Local Health District of Australia between July 2011 and July 2013 were considered eligible for the study. Eligible participants were invited to a telephone interview to explore the circumstances of their bat contact. Interviews were then transcribed and thematically analysed by two independent investigators. Of 21 eligible participants that were able to be contacted, 16 consented and participated in a telephone interview. Participants reported bats as being widespread in their environment but reported a general lack of awareness about ABLV, particularly the risk of disease from bat scratches. Participants who attempted to 'rescue' bats did so because of a deep concern for the bat's welfare. Participants reported a change in risk perception after the exposure event and provided suggestions for public health messages that could be used to raise awareness about ABLV. Reframing the current risk messages to account for the genuine concern of people for bat welfare may enhance the communication. The potential risk to the person and possible harm to the bat from an attempted 'rescue' should be promoted, along with contact details for animal rescue groups. The potential risk of ABLV from bat scratches merits greater emphasis.

  2. Biological and ecological aspects of hard ticks

    Directory of Open Access Journals (Sweden)

    Diana Nayibe Polanco Echeverry

    2016-01-01

    Full Text Available Hard ticks are blood-sucking ectoparasites of Ixodidae family. These mites have been always considered disrupting agents of livestock systems, where they are recognized as the cause of economic and production losses. However, their ecological role is important for the dynamic equilibrium of the production systems bovine meat or milk. Knowing their biolog y and ecolog y can shed light on the sanitary decisions made in relation to these organisms. This review article presents issues related to classification, characteristics, and life cycle of hard ticks and relations vector-parasite-host. In addition, it addresses the control of ectoparasites on conventional livestock systems and the implica-tions that these models of intervention might have on agro-ecosystem.

  3. Extension of Ixodes ricinus ticks and agents of tick-borne diseases to mountain areas in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Danielová, V.; Rudenko, Natalia; Daniel, M.; Holubová, J.; Materna, J.; Golovchenko, Maryna; Schwarzová, L.

    2006-01-01

    Roč. 296, Suppl. 1 (2006), s. 48-53 ISSN 1438-4221. [International Potsdam Symposium on Tick-borne Diseases /8./. Potsdam, 10.03.2005-12.03.2005] Grant - others:WHO/EC(CZ) cCASHh-EVK2-2000-0070 Institutional research plan: CEZ:AV0Z60220518 Keywords : ticks * tick-borne pathogens * mountain areas Subject RIV: EE - Microbiology , Virology Impact factor: 2.760, year: 2006

  4. Deer tick masquerading as pigmented conjunctival lesion

    Directory of Open Access Journals (Sweden)

    Robin K. Kuriakose

    2017-04-01

    Conclusions and importance: Despite the low risk for Lyme disease, which is endemic to the Adirondack region where the patient was affected, doxycycline was prescribed for prophylaxis. In any case of suspected tick penetration to the ocular surface, immediate ophthalmologic consultation and prompt removal via the method mentioned above is recommended, as well as attention paid to the Infectious Diseases Society of America guidelines regarding prophylaxis.

  5. Ticks and Tickborne Diseases Affecting Military Personnel

    Science.gov (United States)

    1989-09-01

    vitamin C, garlic , sulfur powder, panty hose, and others have been reported to me as "great tick repellents." While these efforts may possibly...tickborne diseases in the U.S.) are usually successfully treated with antibiotics in their initial stages; 2 31 therefore, early diagnosis is imperative. For...convulsions, coma, and death (Burgdorfer, 1975). Although treatable with broad spectrum antibiotics , about 5% of cases reported in the U.S. are fatal

  6. Changing distributions of ticks: causes and consequences.

    Science.gov (United States)

    Léger, Elsa; Vourc'h, Gwenaël; Vial, Laurence; Chevillon, Christine; McCoy, Karen D

    2013-02-01

    Today, we are witnessing changes in the spatial distribution and abundance of many species, including ticks and their associated pathogens. Evidence that these changes are primarily due to climate change, habitat modifications, and the globalisation of human activities are accumulating. Changes in the distribution of ticks and their invasion into new regions can have numerous consequences including modifications in their ecological characteristics and those of endemic species, impacts on the dynamics of local host populations and the emergence of human and livestock disease. Here, we review the principal causes for distributional shifts in tick populations and their consequences in terms of the ecological attributes of the species in question (i.e. phenotypic and genetic responses), pathogen transmission and disease epidemiology. We also describe different methodological approaches currently used to assess and predict such changes and their consequences. We finish with a discussion of new research avenues to develop in order to improve our understanding of these host-vector-pathogen interactions in the context of a changing world.

  7. Tick (Amblyomma chabaudi) infestation of endemic tortoises in southwest Madagascar and investigation of tick-borne pathogens.

    Science.gov (United States)

    Ehlers, Julian; Ganzhorn, Jörg U; Silaghi, Cornelia; Krüger, Andreas; Pothmann, Daniela; Ratovonamana, R Yedidya; Veit, Alexandra; Keller, Christian; Poppert, Sven

    2016-03-01

    Little is known about the role of endemic ticks as vectors for bacterial and protozoan pathogens for animals and humans in Madagascar and their interaction in anthropogenic habitats where humans, their livestock and native Malagasy species (vectors and hosts) come into more frequent contact than in natural forest ecosystems. The aims of the study were (1) to test whether habitat degradation is associated with increased infestation of tortoises by ticks and (2) to investigate whether ticks carried Babesia, Borrelia or Rickettsia species that might be pathogenic for humans and livestock. We studied hard ticks of two endemic Malagasy tortoises, Astrochelys radiata and Pyxis arachnoides in March and April 2013 in southwest Madagascar. Two tortoise habitats were compared, the National Park of Tsimanampetsotsa and the adjacent degraded pasture and agricultural land at the end of the wet season. Ticks were screened for protozoan and bacterial pathogens via PCR on DNA isolated from ticks using genus-specific primers. Only one out of 42 A. radiata collected from both habitats had ticks. The low prevalence did not allow further analyses of the effect of habitat degradation. Forty-two P. arachnoides were found in the anthropogenic habitat and 36 individuals in the national park. Tick infestation rates of P. arachnoides differed significantly between the two study sites. Tortoises inside the park had lower tick prevalence than outside (8 of 36 (22%) versus 32 of 42 individuals (76%)) and infected animals tended to have fewer ticks inside than outside the park. All ticks collected in both habitats were adults of the ixodid tick Amblyomma chabaudi, which is supposed to be a host-specific tick of P. arachnoides. Screening for Borrelia sp. and Babesia sp. was negative in all ticks. But all A. chabaudi ticks were infected with Rickettsia africae, known to cause spotted fever in humans. Thus, habitat degradation seems to be linked to higher infestation of tortoises with ticks with

  8. Range Expansion of Tick Disease Vectors in North America: Implications for Spread of Tick-Borne Disease

    Directory of Open Access Journals (Sweden)

    Daniel E. Sonenshine

    2018-03-01

    Full Text Available Ticks are the major vectors of most disease-causing agents to humans, companion animals and wildlife. Moreover, ticks transmit a greater variety of pathogenic agents than any other blood-feeding arthropod. Ticks have been expanding their geographic ranges in recent decades largely due to climate change. Furthermore, tick populations in many areas of their past and even newly established localities have increased in abundance. These dynamic changes present new and increasing severe public health threats to humans, livestock and companion animals in areas where they were previously unknown or were considered to be of minor importance. Here in this review, the geographic status of four representative tick species are discussed in relation to these public health concerns, namely, the American dog tick, Dermacentor variabilis, the lone star tick, Amblyomma americanum, the Gulf Coast Tick, Amblyomma maculatum and the black-legged tick, Ixodes scapularis. Both biotic and abiotic factors that may influence future range expansion and successful colony formation in new habitats are discussed.

  9. Bat-mouse bone marrow chimera: a novel animal model for dissecting the uniqueness of the bat immune system.

    Science.gov (United States)

    Yong, Kylie Su Mei; Ng, Justin Han Jia; Her, Zhisheng; Hey, Ying Ying; Tan, Sue Yee; Tan, Wilson Wei Sheng; Irac, Sergio Erdal; Liu, Min; Chan, Xue Ying; Gunawan, Merry; Foo, Randy Jee Hiang; Low, Dolyce Hong Wen; Mendenhall, Ian Hewitt; Chionh, Yok Teng; Dutertre, Charles-Antoine; Chen, Qingfeng; Wang, Lin-Fa

    2018-03-16

    Bats are an important animal model with long lifespans, low incidences of tumorigenesis and an ability to asymptomatically harbour pathogens. Currently, in vivo studies of bats are hampered due to their low reproduction rates. To overcome this, we transplanted bat cells from bone marrow (BM) and spleen into an immunodeficient mouse strain NOD-scid IL-2R -/- (NSG), and have successfully established stable, long-term reconstitution of bat immune cells in mice (bat-mice). Immune functionality of our bat-mouse model was demonstrated through generation of antigen-specific antibody response by bat cells following immunization. Post-engraftment of total bat BM cells and splenocytes, bat immune cells survived, expanded and repopulated the mouse without any observable clinical abnormalities. Utilizing bat's remarkable immunological functions, this novel model has a potential to be transformed into a powerful platform for basic and translational research.

  10. Bats of the Savannah River Site and vicinity.

    Energy Technology Data Exchange (ETDEWEB)

    M.A. Menzel; J.M. Menzel; J.C. Kilgo; W.M. Ford; T.C. Carter; J.W. Edwards

    2003-10-01

    The U.S. Department of Energy's Savannah River Site supports a diverse bat community. Nine species occur there regularly, including the eastern pipistrelle (Pipistrellus subflavus), southeastern myotis (Myotis austroriparius), evening bat (Nycticeius humeralis), Rafinesque's big-eared bat (Corynorhinus rafinesquii), silver-haired bat (Lasionycteris noctivagans), eastern red bat (Lasiurus borealis), Seminole bat (L. seminolus), hoary bat (L. cinereus), and big brown bat (Eptesicus fuscus). There are extralimital capture records for two additional species: little brown bat (M. lucifigus) and northern yellow bat (Lasiurus intermedius). Acoustical sampling has documented the presence of Brazilian free-tailed bats (Tadarida brasiliensis), but none has been captured. Among those species common to the Site, the southeastern myotis and Rafinesque's big-eared bat are listed in South Carolina as threatened and endangered, respectively. The presence of those two species, and a growing concern for the conservation of forest-dwelling bats, led to extensive and focused research on the Savannah River Site between 1996 and 2002. Summarizing this and other bat research, we provide species accounts that discuss morphology and distribution, roosting and foraging behaviors, home range characteristics, habitat relations, and reproductive biology. We also present information on conservation needs and rabies issues; and, finally, identification keys that may be useful wherever the bat species we describe are found.

  11. Seasonal Dynamics and Distribution of Ticks in Rwanda: Implications for Tick Control Strategy in Rwanda

    OpenAIRE

    Edward Mutandwa; Nshimiyimana Juvenal

    2010-01-01

    The broad objective of this study was to examine the dynamics and seasonal distribution of tick species in Rwanda in three agro-ecological zones namely high altitude (Gishwati), the mid altitude (Huye) and the lower altitude zones (Nyagatare). Ten cows per zone were identified and used for collecting ticks m onthly on a period covering the short dry season and long rainy season from December 2002 to June 2003. These animals were not treated and remained on pasture land. The results revealed t...

  12. Convergent evolution of anti-bat sounds.

    Science.gov (United States)

    Corcoran, Aaron J; Hristov, Nickolay I

    2014-09-01

    Bats and their insect prey rely on acoustic sensing in predator prey encounters--echolocation in bats, tympanic hearing in moths. Some insects also emit sounds for bat defense. Here, we describe a previously unknown sound-producing organ in Geometrid moths--a prothoracic tymbal in the orange beggar moth (Eubaphe unicolor) that generates bursts of ultrasonic clicks in response to tactile stimulation and playback of a bat echolocation attack sequence. Using scanning electron microscopy and high-speed videography, we demonstrate that E. unicolor and phylogenetically distant tiger moths have evolved serially homologous thoracic tymbal organs with fundamentally similar functional morphology, a striking example of convergent evolution. We compared E. unicolor clicks to that of five sympatric tiger moths and found that 9 of 13 E. unicolor clicking parameters were within the range of sympatric tiger moths. Remaining differences may result from the small size of the E. unicolor tymbal. Four of the five sympatric clicking tiger moth species were unpalatable to bats (0-20% eaten), whereas E. unicolor was palatable to bats (86% eaten). Based on these results, we hypothesize that E. unicolor evolved tymbal organs that mimic the sounds produced by toxic tiger moths when attacked by echolocating bats.

  13. Bat echolocation calls: adaptation and convergent evolution.

    Science.gov (United States)

    Jones, Gareth; Holderied, Marc W

    2007-04-07

    Bat echolocation calls provide remarkable examples of 'good design' through evolution by natural selection. Theory developed from acoustics and sonar engineering permits a strong predictive basis for understanding echolocation performance. Call features, such as frequency, bandwidth, duration and pulse interval are all related to ecological niche. Recent technological breakthroughs have aided our understanding of adaptive aspects of call design in free-living bats. Stereo videogrammetry, laser scanning of habitat features and acoustic flight path tracking permit reconstruction of the flight paths of echolocating bats relative to obstacles and prey in nature. These methods show that echolocation calls are among the most intense airborne vocalizations produced by animals. Acoustic tracking has clarified how and why bats vary call structure in relation to flight speed. Bats using broadband echolocation calls adjust call design in a range-dependent manner so that nearby obstacles are localized accurately. Recent phylogenetic analyses based on gene sequences show that particular types of echolocation signals have evolved independently in several lineages of bats. Call design is often influenced more by perceptual challenges imposed by the environment than by phylogeny, and provides excellent examples of convergent evolution. Now that whole genome sequences of bats are imminent, understanding the functional genomics of echolocation will become a major challenge.

  14. Bat echolocation calls: adaptation and convergent evolution

    Science.gov (United States)

    Jones, Gareth; Holderied, Marc W

    2007-01-01

    Bat echolocation calls provide remarkable examples of ‘good design’ through evolution by natural selection. Theory developed from acoustics and sonar engineering permits a strong predictive basis for understanding echolocation performance. Call features, such as frequency, bandwidth, duration and pulse interval are all related to ecological niche. Recent technological breakthroughs have aided our understanding of adaptive aspects of call design in free-living bats. Stereo videogrammetry, laser scanning of habitat features and acoustic flight path tracking permit reconstruction of the flight paths of echolocating bats relative to obstacles and prey in nature. These methods show that echolocation calls are among the most intense airborne vocalizations produced by animals. Acoustic tracking has clarified how and why bats vary call structure in relation to flight speed. Bats using broadband echolocation calls adjust call design in a range-dependent manner so that nearby obstacles are localized accurately. Recent phylogenetic analyses based on gene sequences show that particular types of echolocation signals have evolved independently in several lineages of bats. Call design is often influenced more by perceptual challenges imposed by the environment than by phylogeny, and provides excellent examples of convergent evolution. Now that whole genome sequences of bats are imminent, understanding the functional genomics of echolocation will become a major challenge. PMID:17251105

  15. Bat echolocation calls: Orientation to communication

    Science.gov (United States)

    Fenton, M. Brock

    2004-05-01

    Bats hunting flying insects adjust the design of their echolocation calls according to the situation in which they forage and stage in an attack. Changes in call design across attack sequences alert other bats within earshot to the presence of prey, demonstrating a continuum in roles for biosonar signals between orientation and communication. Many aerial-feeding bats change the design of their echolocation calls in the presence of echolocating conspecifics. Bats may change frequency parameters, durations, and/or intensities of their calls. While a variety of free-tailed bats (Molossidae Otomops martiensseni, Tadarida teniotis, Molossus molossus) consistently change their echolocation calls when more than one bat is flying in an area, at least one sheath-tailed bat (Emballonuridae Taphozous perforatus) does not. Changes in echolocation calls may maximize jamming avoidance and/or enhance the communicative function of the calls. The data for molossids support the hypothesis that when hunting some species fly in formation. Here, variation in individual call design could provide positional information and reduce the chances of mid-air collisions.

  16. Immunization of Cattle with Tick Salivary Gland Extracts

    Directory of Open Access Journals (Sweden)

    Ali Nikpay

    2016-01-01

    Full Text Available Background: Rhipicephalus (Boophilus annulatus tick is one of the most important ectoparasite of cattle. Re­cently, several laboratories in the world have been concentrated on immunizing cattle against tick using various types of tissue extracts of ticks. The aim of this study was to evaluate the effect of immunization of cattle with tick salivary gland extract on biological parameters of ticks and humoral immune responses of cattle.Methods: Fourteen more dominant protein bands identified as immunogenic by Western-blot analysis were eluted from polyacrylamide gel. Test and control groups were injected three times with eluted proteins and sterile PBS (pH= 7.2 respectively with equivalent amount of adjuvant. After four weeks a tick challenge was performed. Fi­nally, biological parameters of collected engorged female ticks were recorded and humoral immune responses to immunization measured by ELISA.Results: The results indicated immunization of cattle resulted in reduction in mean tick counts, attachment, en­gorgement weights, feeding index, egg mass weight, hatchability and fertility index (respectively 63.1%, 62.6%, 30.2%, 36.4%, 40%, 78.7% and 13.3% and increased duration of feeding, pre-oviposition and incubation period of eggs (respectively 8.6%, 45 and 31.34%. All changes were statistically significant (P< 0.05. Results showed an increase in antibody production of test group from the first week after immunization. The antibody level was boosted following tick infestation.Conclusion: This investigation indicates that immunization of cattle with these antigens could induce a protective immune response against Rh. (B. annulatus tick that would be expected to provide a safe non-chemical means of tick control.

  17. Beta attenuation transmission system (BATS)

    International Nuclear Information System (INIS)

    Hagan, R.C.; Fullbright, H.J.

    1977-01-01

    The beta attenuation transmission system (BATS) is an automated radiation gauge designed for quantitative measurement of component thickness in explosive detonators. The BATS was designed and built by Group M-1, the Nondestructive Testing Group, of the Los Alamos Scientific Laboratory to measure the areal thickness, in mg/cm 2 , of a cylinder of high explosive (HE) enclosed within a plastic holder. The problem is to determine the density of the HE. A 90 Sr source is collimated by a 0.25 x 1.59-mm slit, and the transmitted beta-particle flux is detected by a plastic scintillator, coupled to a photomultiplier tube. The detonator is transported through the radiation beam by a leadscrew, ballnut, stepping-motor combination. Continuous analog position data are available, derived from the output from a linear-actuated potentiometer attached to the scanner. A linear electrometer amplifies the detected signal, which is then integrated for a preselected time, to obtain the desired statistical accuracy. A microprocessor (μP) is used to control the scanner position and to make the data readings at the assigned positions. The data are stored, and, at the completion of the scan, are processed into the desired format. The final answer is displayed to the operator or output to a peripheral device for permanent record. The characteristics of the radiation source, the collimator, the signal detection and conditioning, and the final results are described in detail. The scanner and the microprocessor control system are briefly outlined

  18. Ecological Factors Associated with European Bat Lyssavirus Seroprevalence in Spanish Bats

    Science.gov (United States)

    Serra-Cobo, Jordi; López-Roig, Marc; Seguí, Magdalena; Sánchez, Luisa Pilar; Nadal, Jacint; Borrás, Miquel; Lavenir, Rachel; Bourhy, Hervé

    2013-01-01

    Bats have been proposed as major reservoirs for diverse emerging infectious viral diseases, with rabies being the best known in Europe. However, studies exploring the ecological interaction between lyssaviruses and their natural hosts are scarce. This study completes our active surveillance work on Spanish bat colonies that began in 1992. Herein, we analyzed ecological factors that might affect the infection dynamics observed in those colonies. Between 2001 and 2011, we collected and tested 2,393 blood samples and 45 dead bats from 25 localities and 20 bat species. The results for dead confirmed the presence of EBLV-1 RNA in six species analyzed (for the first time in Myotis capaccinii). Samples positive for European bat lyssavirus-1 (EBLV-1)–neutralizing antibodies were detected in 68% of the localities sampled and in 13 bat species, seven of which were found for the first time (even in Myotis daubentonii, a species to date always linked to EBLV-2). EBLV-1 seroprevalence (20.7%) ranged between 11.1 and 40.2% among bat species and seasonal variation was observed, with significantly higher antibody prevalence in summer (July). EBLV-1 seroprevalence was significantly associated with colony size and species richness. Higher seroprevalence percentages were found in large multispecific colonies, suggesting that intra- and interspecific contacts are major risk factors for EBLV-1 transmission in bat colonies. Although bat-roosting behavior strongly determines EBLV-1 variability, we also found some evidence that bat phylogeny might be involved in bat-species seroprevalence. The results of this study highlight the importance of life history and roost ecology in understanding EBLV-1–prevalence patterns in bat colonies and also provide useful information for public health officials. PMID:23700480

  19. Rabies virus infection in Eptesicus fuscus bats born in captivity (naïve bats.

    Directory of Open Access Journals (Sweden)

    April D Davis

    Full Text Available The study of rabies virus infection in bats can be challenging due to quarantine requirements, husbandry concerns, genetic differences among animals, and lack of medical history. To date, all rabies virus (RABV studies in bats have been performed in wild caught animals. Determining the RABV exposure history of a wild caught bat based on the presence or absence of viral neutralizing antibodies (VNA may be misleading. Previous studies have demonstrated that the presence of VNA following natural or experimental inoculation is often ephemeral. With this knowledge, it is difficult to determine if a seronegative, wild caught bat has been previously exposed to RABV. The influence of prior rabies exposure in healthy, wild caught bats is unknown. To investigate the pathogenesis of RABV infection in bats born in captivity (naïve bats, naïve bats were inoculated intramuscularly with one of two Eptesicus fuscus rabies virus variants, EfV1 or EfV2. To determine the host response to a heterologous RABV, a separate group of naïve bats were inoculated with a Lasionycteris noctivagans RABV (LnV1. Six months following the first inoculation, all bats were challenged with EfV2. Our results indicate that naïve bats may have some level of innate resistance to intramuscular RABV inoculation. Additionally, naïve bats inoculated with the LnV demonstrated the lowest clinical infection rate of all groups. However, primary inoculation with EfV1 or LnV did not appear to be protective against a challenge with the more pathogenic EfV2.

  20. Navigation: Bat orientation using Earth's magnetic field

    DEFF Research Database (Denmark)

    Holland, Richard A.; Thorup, Kasper; Vonhof, Maarten J.

    2006-01-01

    Bats famously orientate at night by echolocation 1 , but this works over only a short range, and little is known about how they navigate over longer distances 2 . Here we show that the homing behaviour of Eptesicus fuscus, known as the big brown bat, can be altered by artificially shifting...... the Earth's magnetic field, indicating that these bats rely on a magnetic compass to return to their home roost. This finding adds to the impressive array of sensory abilities possessed by this animal for navigation in the dark....

  1. Lagos bat virus transmission in an Eidolon helvum bat colony, Ghana.

    Science.gov (United States)

    Freuling, Conrad M; Binger, Tabea; Beer, Martin; Adu-Sarkodie, Yaw; Schatz, Juliane; Fischer, Melina; Hanke, Dennis; Hoffmann, Bernd; Höper, Dirk; Mettenleiter, Thomas C; Oppong, Samual K; Drosten, Christian; Müller, Thomas

    2015-12-02

    A brain sample of a straw-coloured fruit bat (Eidolon helvum) from Ghana without evident signs of disease tested positive by generic Lyssavirus RT-PCR and direct antigen staining. Sequence analysis confirmed the presence of a Lagos bat virus belonging to phylogenetic lineage A. Virus neutralization tests using the isolate with sera from the same group of bats yielded neutralizing antibodies in 74% of 567 animals. No cross-neutralization was observed against a different Lagos bat virus (lineage B). Copyright © 2015 Elsevier B.V. All rights reserved.

  2. Strategic control of ticks with synthetic pyrethroids in Theileria parva ...

    African Journals Online (AJOL)

    The effect of tick control by strategic dipping in synthetic pyrethroids on growth and survival rates of calves in Eastern Tanzania where Theileria parva and other tick borne infections (babesiosis, anaplasmosis and ehrlichiosis) are endemic was measured. One day to five months old Tanganyika short horn zebu (Bos indicus) ...

  3. The application of lambda-cyhalothrin in tick control.

    Science.gov (United States)

    Jurisic, Aleksandar D; Petrovic, Aleksandra P; Rajkovic, Dragana V; Nicin, Slobodan Dj

    2010-09-01

    In recent years, in urban areas of Novi Sad, unique ecological conditions, specific floristic and faunistic composition and poor habits of citizens in sense of public health, facilitate the development and maintenance of ticks. Regarding the importance of ticks as vectors of severe human and animal diseases, complex and detailed studies are conducted with an aim to find the most efficient methods for tick control. Two tick species, Ixodes ricinus and Dermacentor marginatus, were identified during a 3-year period on the territory of Municipality of Novi Sad. During 2006, the efficacy of the pyrethroid lambda-cyhalothrin in tick control varied from 60.7 to 100%. The highest efficacy recorded in 2007 was 92.3%. The efficacy of lambda-cyhalothrin in 2008 varied from 39.1 to 100%. Lambda-cyhalothrin showed high efficacy in tick control at localities which were improved before the application (mowed, litter removed, abundance control and euthanasia of abandoned cats and dogs). The results of this research indicate that lambda-cyhalothrin has a toxic effect on ticks and could be used as efficient acaricide for tick control, although its efficacy depends on formulation, terrain features and methods of application.

  4. Relative abundance of hard tick on reared cattle (Family: Bovidae ...

    African Journals Online (AJOL)

    A survey was carried out among cattle reared in Idah LGA of Kogi State, for tick infestations for a period of four months (May – August, 2009). A total of 294 cattle were sampled, 181 were infested with three species of hard ticks (Family: Ixodidae), comprising of Amblyomma variegatum, Boophilus decoloratus, and ...

  5. Effects of Vegetation Microclimate on Larval Cattle Fever Tick Survival

    Science.gov (United States)

    Cattle Fever Ticks (CFT), Rhipicephalus annulatus and R. microplus, have been a threat to the livestock industry for many years. These ticks are vectors of cattle fever, a disease produced by the hemoparasite Babesia bovis and B. bigemina. Laboratory research on CFT larval survival has shown that co...

  6. Tick-borne encephalitis: Pathogenesis and clinical implications

    Czech Academy of Sciences Publication Activity Database

    Růžek, Daniel; Dobler, G.; Mantke, O. D.

    2010-01-01

    Roč. 8, č. 4 (2010), s. 223-232 ISSN 1477-8939 R&D Projects: GA ČR GPP302/10/P438; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Tick-borne encephalitis * Tick-borne encephalitis virus * Pathogenesis * Clinical data Subject RIV: EE - Microbiology, Virology

  7. Tick resistance to diazinon: a case report | Samuel | Nigerian ...

    African Journals Online (AJOL)

    A case of a heavy tick infestation of dogs in a private kennel that resisted treatment with diazinon is reported. Application is by the conventional acaricidal tick dips and subsequent acaricidal spraying of the premises on three consecutive occasions which yielded no result. However a change of drug from diazinon to ...

  8. Effects of anti-tick vaccines, recombinant serine protease inhibitors ...

    African Journals Online (AJOL)

    A preliminary trial of a cocktail of recombinant RAS-1-2 and RIM 36 antigens was conducted in Uganda to assess the effects of ant-tick vaccines against Rhipicephalus appendiculatus tick feeding on Zebu cattle under both experimental and natural conditions. Under experimental conditions, over a period of 28 days, the ...

  9. Equine tick-borne infections in the Netherlands

    NARCIS (Netherlands)

    Butler, C.M.

    2012-01-01

    This thesis focuses on the emergence and establishment of equine tick-borne infections in the Netherlands, with particular attention to their diagnosis, clinical relevance and treatment. Four tick-borne agents (Borrelia burgdorferi, Theileria equi, Babesia caballi and Anaplasma phagocytophilum)

  10. Diversity and distribution of ticks from domestic ruminants in Lebanon.

    Science.gov (United States)

    Dabaja, Mayssaa Fawaz; Tempesta, Maria; Bayan, Ali; Vesco, Gesualdo; Vesco, Gesualdo; Greco, Grazia; Torina, Alessandra; Blanda, Valeria; La Russa, Francesco; Scimeca, Salvatore; Ezzedine, Mohamad; Mortada, Hussein; Raoult, Didier; Fournier, Pierre Edouard; Mortada, Mohamad

    2017-06-30

    Ticks (Acari: Ixodidae) are ectoparasites infesting livestock in every geographic area in the world and they are vectors of several viral, bacterial, and protozoan pathogens to animals and humans worldwide. A deep knowledge of the geographical distribution of these arthropods would have a key role in the control of tick-borne diseases. Few data are available about tick presence in domestic ruminants in Lebanon. The study aimed at providing an analysis of tick presence and distribution in Lebanon. Ticks were collected from cattle, sheep, and goats farms distributed in 6 Lebanese provinces between June and September 2014. A total of 272 adult hard ticks were randomly collected from domestic ruminants (cattle, sheep, and goats) located at 37 Lebanese farms, distributed among 30 villages. Ticks belonged to 4 Ixodidae genera: Rhipicephalus (72.4%), Haemaphysalis (11.4%), Dermacentor (8.1%), and Hyalomma (8.1%). They included the following species: Rhipicephalus annulatus (50.7%), Rhipicephalus turanicus (18.8%), Hyalomma anatolicum (8.1%), Haemaphylasis punctata (11.4%), Dermacentor marginatus (8.1%), Rhipicephalus sanguineus (2.5%), and Rhipicephalus bursa (0.4%). Rhipicephalus turanicus and H. anatolicum were found on cattle, sheep, and goats, R. annulatus on cattle and sheep, R. sanguineus, D. marginatus and Hea. punctata on sheep and goats, while R. bursa was collected only on sheep. Tick species involved in pathogen transmission were found and some of the identi ed species were recorded in Lebanon for the rst time.

  11. Dual control of ticks and tsetse flies using deltamethrin through ...

    African Journals Online (AJOL)

    Mo

    The baseline survey was carried out in three parishes to establish the initial tsetse density, tick burdens, level of tick control and prevalence of trypanosomosis and TBDs in cattle. Initially, samples were taken from 200 head of cattle and were ear tagged for future monitoring. Stained blood smears were examined for TBDs.

  12. Electromagnetic radiation and behavioural response of ticks: an experimental test.

    Science.gov (United States)

    Vargová, Blažena; Majláth, Igor; Kurimský, Juraj; Cimbala, Roman; Kosterec, Michal; Tryjanowski, Piotr; Jankowiak, Łukasz; Raši, Tomáš; Majláthová, Viktória

    2018-05-01

    Factors associated with the increased usage of electronic devices, wireless technologies and mobile phones nowadays are present in increasing amounts in our environment. All living organisms are constantly affected by electromagnetic radiation which causes serious environmental pollution. The distribution and density of ticks in natural habitats is influenced by a complex of abiotic and biotic factors. Exposure to radio-frequency electromagnetic field (RF-EMF) constitutes a potential cause altering the presence and distribution of ticks in the environment. Our main objective was to determine the affinity of Dermacentor reticulatus ticks towards RF-EMF exposure. Originally designed and constructed radiation-shielded tube (RST) test was used to test the affinity of ticks under controlled laboratory conditions. All test were performed in an electromagnetic compatibility laboratory in an anechoic chamber. Ticks were irradiated using a Double-Ridged Waveguide Horn Antenna to RF-EMF at 900 and 5000 MHz, 0 MHz was used as control. The RF-EMF exposure to 900 MHz induced a higher concentration of ticks on irradiated arm of RST as opposed to the RF-EMF at 5000 MHz, which caused an escape of ticks to the shielded arm. This study represents the first experimental evidence of RF-EMF preference in D. reticulatus. The projection of obtained results to the natural environment could help assess the risk of tick borne diseases and could be a tool of preventive medicine.

  13. Quantifying the availability of vertebrate hosts to ticks

    NARCIS (Netherlands)

    Hofmeester, Tim R.; Marcus Rowcliffe, J.; Jansen, Patrick A.

    2017-01-01

    The availability of vertebrate hosts is a major determinant of the occurrence of ticks and tick-borne zoonoses in natural and anthropogenic ecosystems and thus drives disease risk for wildlife, livestock, and humans. However, it remains challenging to quantify the availability of vertebrate hosts in

  14. Beware of Ticks (A Minute of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    2015-05-14

    Lyme disease is transmitted by the bite of blacklegged ticks and affects up to 300,000 Americans each year. This podcast discusses ways to prevent tick bites.  Created: 5/14/2015 by MMWR.   Date Released: 5/14/2015.

  15. Characterization of ferritin 2 for the control of tick infestations

    Czech Academy of Sciences Publication Activity Database

    Hajdušek, Ondřej; Almazán, C.; Loosová, Gabriela; Villar, M.; Canales, M.; Grubhoffer, L.; Kopáček, Petr; de la Fuente, J.

    2010-01-01

    Roč. 28, č. 17 (2010), s. 2993-2998 ISSN 0264-410X R&D Projects: GA AV ČR IAA600960910; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : tick ferritin 2 * tick-protective vaccine Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.572, year: 2010

  16. Participatory impact assessment of ticks on cattle milk production in ...

    African Journals Online (AJOL)

    rain and bush burning practice by the abba gada period mentioned. They further said that there ... which as they believe used to reduce tick infestation while they were practicing earlier. There was “Diima ... Figure 1: Relationships between tick burden and climate change in five Abba Gada leadership's periods (Each Abba ...

  17. Some Factors Affecting the Sustainability of Tick and Tick-Borne ...

    African Journals Online (AJOL)

    implications for development of acaricide resistance in ticks. In some cases, acaricides are mixed with the bare hand, thus posing serious health hazards to the users. Table 1. The types of acaricides currently in use in the countr. Formulation. Chemical group. Single. Organophosphate. Formamidine. Synthetic pyrethroids.

  18. How ticks get under your skin: insertion mechanics of the feeding apparatus of Ixodes ricinus ticks

    Science.gov (United States)

    Richter, Dania; Matuschka, Franz-Rainer; Spielman, Andrew; Mahadevan, L.

    2013-01-01

    The tick Ixodes ricinus uses its mouthparts to penetrate the skin of its host and to remain attached for about a week, during which time Lyme disease spirochaetes may pass from the tick to the host. To understand how the tick achieves both tasks, penetration and attachment, with the same set of implements, we recorded the insertion events by cinematography, interpreted the mouthparts’ function by scanning electron microscopy and identified their points of articulation by confocal microscopy. Our structural dynamic observations suggest that the process of insertion and attachment occurs via a ratchet-like mechanism with two distinct stages. Initially, the two telescoping chelicerae pierce the skin and, by moving alternately, generate a toehold. Subsequently, a breaststroke-like motion, effected by simultaneous flexure and retraction of both chelicerae, pulls in the barbed hypostome. This combination of a flexible, dynamic mechanical ratchet and a static holdfast thus allows the tick to solve the problem of how to penetrate skin and also remain stuck for long periods of time. PMID:24174106

  19. Tick-Pathogen Interactions and Vector Competence: Identification of Molecular Drivers for Tick-Borne Diseases

    Czech Academy of Sciences Publication Activity Database

    de la Fuente, J.; Antunes, S.; Bonnet, S.; Cabezas Cruz, Alejandro; Domingos, A.G.; Estrada-Peňa, A.; Johnson, N.; Kocan, K.M.; Mansfield, K. L.; Nijhof, A.M.; Papa, A.; Rudenko, Natalia; Villar, M.; Alberdi, P.; Torina, A.; Ayllón, N.; Vancová, Marie; Golovchenko, Maryna; Grubhoffer, Libor; Caracappa, S.; Fooks, A. R.; Gortazar, C.; Rego, Ryan O. M.

    2017-01-01

    Roč. 7, APR 7 (2017), č. článku 114. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : tick * Anaplasma * flavivirus * Babesia * Borrelia * Microbiome * immunology * vaccine Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.300, year: 2016

  20. ANTIDotE: anti-tick vaccines to prevent tick-borne diseases in Europe

    NARCIS (Netherlands)

    Sprong, Hein; Trentelman, Jos; Seemann, Ingar; Grubhoffer, Libor; Rego, Ryan O. M.; Hajdušek, Ondřej; Kopáček, Petr; Šíma, Radek; Nijhof, Ard M.; Anguita, Juan; Winter, Peter; Rotter, Bjorn; Havlíková, Sabina; Klempa, Boris; Schetters, Theo P.; Hovius, Joppe W. R.

    2014-01-01

    Ixodes ricinus transmits bacterial, protozoal and viral pathogens, causing disease and forming an increasing health concern in Europe. ANTIDotE is an European Commission funded consortium of seven institutes, which aims to identify and characterize tick proteins involved in feeding and pathogen

  1. Strategies for new and improved vaccines against ticks and tick-borne diseases

    Czech Academy of Sciences Publication Activity Database

    de la Fuente, J.; Kopáček, Petr; Lew-Tabor, A.; Maritz-Olivier, C.

    2016-01-01

    Roč. 38, č. 12 (2016), s. 754-769 ISSN 0141-9838 R&D Projects: GA ČR GA13-11043S EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : interactomics * reverse genetics * systems biology * tick * vaccine * vaccinology Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.493, year: 2016

  2. ANTIDotE: anti-tick vaccines to prevent tick-borne diseases in Europe

    Czech Academy of Sciences Publication Activity Database

    Sprong, H.; Trentelman, J.; Seemann, I.; Grubhoffer, Libor; Rego, Ryan O. M.; Hajdušek, Ondřej; Kopáček, Petr; Šíma, Radek; Nijhof, A.M.; Anguita, J.; Winter, P.; Rotter, B.; Havlíková, S.; Klempa, B.; Schetters, T.P.; Hovius, J.W.R.

    2014-01-01

    Roč. 7, FEB 2014 (2014), s. 77 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Ixodes ricinus * vaccine * Lyme borreliosis * tick-borne encephalitis * babesiosis * public health Subject RIV: EC - Immunology Impact factor: 3.430, year: 2014

  3. Identification and Characterization of Ixodes scapularis Antigens That Elicit Tick Immunity Using Yeast Surface Display

    NARCIS (Netherlands)

    Schuijt, T.J.; Narasimhan, S.; Daffre, S.; Deponte, K.; Hovius, J.W.R.; van 't Veer, C.; van der Poll, T.; Bakhtiari, K.; Meijers, J.C.M.; Boder, E.T.; van Dam, A.P.; Fikrig, E.

    2011-01-01

    Repeated exposure of rabbits and other animals to ticks results in acquired resistance or immunity to subsequent tick bites and is partially elicited by antibodies directed against tick antigens. In this study we demonstrate the utility of a yeast surface display approach to identify tick salivary

  4. No evidence of African swine fever virus replication in hard ticks

    NARCIS (Netherlands)

    de Carvalho Ferreira, Helena C; Tudela Zúquete, Sara; Wijnveld, Michiel; Weesendorp, Eefke; Jongejan, Frans; Stegeman, Arjan; Loeffen, Willie L A

    African swine fever (ASF) is caused by African swine fever virus (ASFV), a tick-borne DNA virus. Soft ticks of the genus Ornithodoros are the only biological vectors of ASFV recognized so far. Although other hard ticks have been tested for vector competence, two commonly found tick species in

  5. Identifying Environmental and Human Factors Associated With Tick Bites using Volunteered Reports and Frequent Pattern Mining

    NARCIS (Netherlands)

    Garcia-Martí, Irene; Zurita-Milla, Raul; Swart, Arno; Wijngaard, van den Kees C.; Vliet, van Arnold J.H.; Bennema, Sita; Harms, Margriet

    2017-01-01

    Tick populations and tick-borne diseases like Lyme borreliosis have been steadily increasing since the mid-1990s. Realizing the threat that ticks pose to public health, two Dutch citizen science projects have collected tick bite reports since 2006. This unique volunteered geographical dataset,

  6. Prevalence of ticks on local and crossbred cattle in and around ...

    African Journals Online (AJOL)

    Identify the favorable predilection sites of ticks and to measure the tick burden within breeds, different age groups and ... Study period, tick collection and identification methods. Ticks were collected from half body .... reported in many parts of Ethiopia, such as in Rift Valley Solomon Gebre et al., (2001), Hararghe Gulilat Asrat ...

  7. Site 300 Bat Monitoring Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Drennan, Joe [Garcia and Associates, San Francisco, CA (United States); Tortosa, Justin [Garcia and Associates, San Francisco, CA (United States)

    2016-07-18

    From June 15 to 18, 2015, GANDA biologist Graham Neale assisted in programming and fieldtesting of the bat monitoring equipment. The equipment was deployed in the field on a meteorological (MET) tower within Site 300 on June 18, 2015.

  8. Bat echolocation calls facilitate social communication.

    Science.gov (United States)

    Knörnschild, Mirjam; Jung, Kirsten; Nagy, Martina; Metz, Markus; Kalko, Elisabeth

    2012-12-07

    Bat echolocation is primarily used for orientation and foraging but also holds great potential for social communication. The communicative function of echolocation calls is still largely unstudied, especially in the wild. Eavesdropping on vocal signatures encoding social information in echolocation calls has not, to our knowledge, been studied in free-living bats so far. We analysed echolocation calls of the polygynous bat Saccopteryx bilineata and found pronounced vocal signatures encoding sex and individual identity. We showed experimentally that free-living males discriminate approaching male and female conspecifics solely based on their echolocation calls. Males always produced aggressive vocalizations when hearing male echolocation calls and courtship vocalizations when hearing female echolocation calls; hence, they responded with complex social vocalizations in the appropriate social context. Our study demonstrates that social information encoded in bat echolocation calls plays a crucial and hitherto underestimated role for eavesdropping conspecifics and thus facilitates social communication in a highly mobile nocturnal mammal.

  9. Somatosensory Substrates of Flight Control in Bats

    Directory of Open Access Journals (Sweden)

    Kara L. Marshall

    2015-05-01

    Full Text Available Flight maneuvers require rapid sensory integration to generate adaptive motor output. Bats achieve remarkable agility with modified forelimbs that serve as airfoils while retaining capacity for object manipulation. Wing sensory inputs provide behaviorally relevant information to guide flight; however, components of wing sensory-motor circuits have not been analyzed. Here, we elucidate the organization of wing innervation in an insectivore, the big brown bat, Eptesicus fuscus. We demonstrate that wing sensory innervation differs from other vertebrate forelimbs, revealing a peripheral basis for the atypical topographic organization reported for bat somatosensory nuclei. Furthermore, the wing is innervated by an unusual complement of sensory neurons poised to report airflow and touch. Finally, we report that cortical neurons encode tactile and airflow inputs with sparse activity patterns. Together, our findings identify neural substrates of somatosensation in the bat wing and imply that evolutionary pressures giving rise to mammalian flight led to unusual sensorimotor projections.

  10. White-Nose Syndrome of bats

    Science.gov (United States)

    Jessie A. Glaeser; Martin J. Pfeiffer; Daniel L. Lindner

    2016-01-01

    Devastating. Catastrophic. Unprecedented. This is how white-nose syndrome of bats (WNS) is characterized. It is one of the deadliest wildlife diseases ever observed and could have significant impacts on outdoor recreation, agriculture and wildlife management.

  11. Immunological control of ticks and tick-borne diseases that impact cattle health and production in Mexico

    Science.gov (United States)

    The cattle industry is one of the most important agroeconomic activities in Mexico. The national herd is estimated to include approximately 33.5 million head of cattle. Ticks and tick-borne diseases are principal factors with a negative impact on cattle health and production in Mexico. The most econ...

  12. Variable spikes in tick-borne encephalitis incidence in 2006 independent of variable tick abundance but related to weather

    Czech Academy of Sciences Publication Activity Database

    Randolph, S. E.; Asokliene, L.; Avsic-Zupanc, T.; Bormane, A.; Burri, C.; Gern, L.; Golovljova, I.; Hubálek, Zdeněk; Knap, N.; Kondrusik, M.; Kupca, A.; Pejčoch, Milan; Vasilenko, V.; Žygutiene, M.

    2008-01-01

    Roč. 1, č. 44 (2008), s. 1-18 ISSN 1756-3305 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : tick-borne encephalitis * epidemiology * weather conditions * ixodid ticks * outdoor activity * mushroom harvest * berry harvest Subject RIV: FN - Epidemiology , Contagious Diseases ; Clinical Immunology

  13. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris

    Science.gov (United States)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  14. Prevalence of tick-borne pathogens in questing Ixodes ricinus ticks in urban and suburban areas of Switzerland

    Directory of Open Access Journals (Sweden)

    Corinne P. Oechslin

    2017-11-01

    Full Text Available Abstract Background Throughout Europe, Ixodes ricinus transmits numerous pathogens. Its widespread distribution is not limited to rural but also includes urbanized areas. To date, comprehensive data on pathogen carrier rates of I. ricinus ticks in urban areas of Switzerland is lacking. Results Ixodes ricinus ticks sampled at 18 (sub- urban collection sites throughout Switzerland showed carrier rates of 0% for tick-borne encephalitis virus, 18.0% for Borrelia burgdorferi (sensu lato, 2.5% for Borrelia miyamotoi, 13.5% for Rickettsia spp., 1.4% for Anaplasma phagocytophilum, 6.2% for "Candidatus Neoehrlichia mikurensis", and 0.8% for Babesia venatorum (Babesia sp., EU1. Site-specific prevalence at collection sites with n > 45 ticks (n = 9 significantly differed for B. burgdorferi (s.l., Rickettsia spp., and "Ca. N. mikurensis", but were not related to the habitat type. Three hundred fifty eight out of 1078 I. ricinus ticks (33.2% tested positive for at least one pathogen. Thereof, about 20% (71/358 were carrying two or three different potentially disease-causing agents. Using next generation sequencing, we could detect true pathogens, tick symbionts and organisms of environmental or human origin in ten selected samples. Conclusions Our data document the presence of pathogens in the (sub- urban I. ricinus tick population in Switzerland, with carrier rates as high as those in rural regions. Carriage of multiple pathogens was repeatedly observed, demonstrating the risk of acquiring multiple infections as a consequence of a tick bite.

  15. Ticks and Tick-Borne Pathogens of the Caribbean: Current Understanding and Future Directions for More Comprehensive Surveillance

    Czech Academy of Sciences Publication Activity Database

    Gondard, M.; Cabezas Cruz, Alejandro; Charles, R. A.; Vayssier-Taussat, M.; Albina, E.; Moutailler, S.

    2017-01-01

    Roč. 7, NOV 29 (2017), č. článku 490. ISSN 2235-2988 Institutional support: RVO:60077344 Keywords : tick-borne pathogens * ticks * Caribbean * epidemiology * newhigh-throughput technologies * surveillance Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.300, year: 2016

  16. Bat distribution size or shape as determinant of viral richness in african bats.

    Directory of Open Access Journals (Sweden)

    Gaël D Maganga

    Full Text Available The rising incidence of emerging infectious diseases (EID is mostly linked to biodiversity loss, changes in habitat use and increasing habitat fragmentation. Bats are linked to a growing number of EID but few studies have explored the factors of viral richness in bats. These may have implications for role of bats as potential reservoirs. We investigated the determinants of viral richness in 15 species of African bats (8 Pteropodidae and 7 microchiroptera in Central and West Africa for which we provide new information on virus infection and bat phylogeny. We performed the first comparative analysis testing the correlation of the fragmented geographical distribution (defined as the perimeter to area ratio with viral richness in bats. Because of their potential effect, sampling effort, host body weight, ecological and behavioural traits such as roosting behaviour, migration and geographical range, were included into the analysis as variables. The results showed that the geographical distribution size, shape and host body weight have significant effects on viral richness in bats. Viral richness was higher in large-bodied bats which had larger and more fragmented distribution areas. Accumulation of viruses may be related to the historical expansion and contraction of bat species distribution range, with potentially strong effects of distribution edges on virus transmission. Two potential explanations may explain these results. A positive distribution edge effect on the abundance or distribution of some bat species could have facilitated host switches. Alternatively, parasitism could play a direct role in shaping the distribution range of hosts through host local extinction by virulent parasites. This study highlights the importance of considering the fragmentation of bat species geographical distribution in order to understand their role in the circulation of viruses in Africa.

  17. Bat guilds, a concept to classify the highly diverse foraging and echolocation behaviors of microchiropteran bats

    Science.gov (United States)

    Denzinger, Annette; Schnitzler, Hans-Ulrich

    2013-01-01

    Throughout evolution the foraging and echolocation behaviors as well as the motor systems of bats have been adapted to the tasks they have to perform while searching and acquiring food. When bats exploit the same class of environmental resources in a similar way, they perform comparable tasks and thus share similar adaptations independent of their phylogeny. Species with similar adaptations are assigned to guilds or functional groups. Habitat type and foraging mode mainly determine the foraging tasks and thus the adaptations of bats. Therefore, we use habitat type and foraging mode to define seven guilds. The habitat types open, edge and narrow space are defined according to the bats' echolocation behavior in relation to the distance between bat and background or food item and background. Bats foraging in the aerial, trawling, flutter detecting, or active gleaning mode use only echolocation to acquire their food. When foraging in the passive gleaning mode bats do not use echolocation but rely on sensory cues from the food item to find it. Bat communities often comprise large numbers of species with a high diversity in foraging areas, foraging modes, and diets. The assignment of species living under similar constraints into guilds identifies patterns of community structure and helps to understand the factors that underlie the organization of highly diverse bat communities. Bat species from different guilds do not compete for food as they differ in their foraging behavior and in the environmental resources they use. However, sympatric living species belonging to the same guild often exploit the same class of resources. To avoid competition they should differ in their niche dimensions. The fine grain structure of bat communities below the rather coarse classification into guilds is determined by mechanisms that result in niche partitioning. PMID:23840190

  18. Bat guilds, a concept to classify the highly diverse foraging and echolocation behaviors of microchiropteran bats.

    Science.gov (United States)

    Denzinger, Annette; Schnitzler, Hans-Ulrich

    2013-01-01

    Throughout evolution the foraging and echolocation behaviors as well as the motor systems of bats have been adapted to the tasks they have to perform while searching and acquiring food. When bats exploit the same class of environmental resources in a similar way, they perform comparable tasks and thus share similar adaptations independent of their phylogeny. Species with similar adaptations are assigned to guilds or functional groups. Habitat type and foraging mode mainly determine the foraging tasks and thus the adaptations of bats. Therefore, we use habitat type and foraging mode to define seven guilds. The habitat types open, edge and narrow space are defined according to the bats' echolocation behavior in relation to the distance between bat and background or food item and background. Bats foraging in the aerial, trawling, flutter detecting, or active gleaning mode use only echolocation to acquire their food. When foraging in the passive gleaning mode bats do not use echolocation but rely on sensory cues from the food item to find it. Bat communities often comprise large numbers of species with a high diversity in foraging areas, foraging modes, and diets. The assignment of species living under similar constraints into guilds identifies patterns of community structure and helps to understand the factors that underlie the organization of highly diverse bat communities. Bat species from different guilds do not compete for food as they differ in their foraging behavior and in the environmental resources they use. However, sympatric living species belonging to the same guild often exploit the same class of resources. To avoid competition they should differ in their niche dimensions. The fine grain structure of bat communities below the rather coarse classification into guilds is determined by mechanisms that result in niche partitioning.

  19. Bat echolocation calls: adaptation and convergent evolution

    OpenAIRE

    Jones, Gareth; Holderied, Marc W

    2007-01-01

    Bat echolocation calls provide remarkable examples of ‘good design’ through evolution by natural selection. Theory developed from acoustics and sonar engineering permits a strong predictive basis for understanding echolocation performance. Call features, such as frequency, bandwidth, duration and pulse interval are all related to ecological niche. Recent technological breakthroughs have aided our understanding of adaptive aspects of call design in free-living bats. Stereo videogrammetry, lase...

  20. Warm-up with weighted bat and adjustment of upper limb muscle activity in bat swinging under movement correction conditions.

    Science.gov (United States)

    Ohta, Yoichi; Ishii, Yasumitsu; Ikudome, Sachi; Nakamoto, Hiroki

    2014-02-01

    The effects of weighted bat warm-up on adjustment of upper limb muscle activity were investigated during baseball bat swinging under dynamic conditions that require a spatial and temporal adjustment of the swinging to hit a moving target. Seven male college baseball players participated in this study. Using a batting simulator, the task was to swing the standard bat coincident with the arrival timing and position of a moving target after three warm-up swings using a standard or weighted bat. There was no significant effect of weighted bat warm-up on muscle activity before impact associated with temporal or spatial movement corrections. However, lower inhibition of the extensor carpi ulnaris muscle activity was observed in a velocity-changed condition in the weighted bat warm-up, as compared to a standard bat warm-up. It is suggested that weighted bat warm-up decreases the adjustment ability associated with inhibition of muscle activation under movement correction conditions.

  1. Ticks threatening lineage of Anatolian wild sheep (Ovis gmelinii anatolica) and determination of their tick-borne pathogens.

    Science.gov (United States)

    Orkun, Ömer; Emir, Hasan; Karaer, Zafer

    2016-09-15

    We aimed to determine the ticks of the Anatolian wild sheep and to define their tick-borne pathogens while molecularly studying their relationships with those of the domestic sheep. Furthermore, another aim of this study is to investigate tick paralysis resulting in the death of the Anatolian wild sheep. Ticks and blood samples were collected from the wild sheep whilst tick samples were also collected from hares, guinea fowls, chickens, and a turkey living in the Anatolian wild sheep breeding area. While PCR amplification was carried out for the detection of Babesia spp., Theileria spp. and Anaplasma spp. in blood samples, CCHF virus was screened in the tick samples in addition to the above-mentioned pathogens. Theileria spp. was detected in blood samples of 45 wild sheep. A total of 3494 ticks were collected from 52 Anatolian wild sheep, 5 hares, 5 guinea fowls, 2 chickens, and 1 turkey whereas 98 ticks were collected from the ground. B. ovis and T. ovis were detected in tick pools (Rh. bursa and H. excavatum) that were collected from the wild sheep. The paralysis was diagnosed in both of the hind legs of the newborn lambs infested with a great number of ticks. We also report that the tick species (H. excavatum and Rh. bursa) are determined to cause tick paralysis and tick toxicosis, which are associated with mortality especially in lambs. T. ovis and B. ovis were detected and studied for the first time in Anatolian wild sheep and in their ticks. The results of phylogenetic analyses showed that T. ovis and B. ovis isolates are genetically very close to the isolates that were previously obtained from the domestic small ruminants. We show that the Anatolian wild sheep can play the role of a reservoir for T. ovis. The presence of the CCHF virus has also been clearly shown and it has been observed that this virus, which is very pathogenic for humans, is anywise circulating in the region. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Biological correlates of extinction risk in bats.

    Science.gov (United States)

    Jones, Kate E; Purvis, Andy; Gittleman, John L

    2003-04-01

    We investigated patterns and processes of extinction and threat in bats using a multivariate phylogenetic comparative approach. Of nearly 1,000 species worldwide, 239 are considered threatened by the International Union for Conservation of Nature and Natural Resources (IUCN) and 12 are extinct. Small geographic ranges and low wing aspect ratios are independently found to predict extinction risk in bats, which explains 48% of the total variance in IUCN assessments of threat. The pattern and correlates of extinction risk in the two bat suborders are significantly different. A higher proportion (4%) of megachiropteran species have gone extinct in the last 500 years than microchiropteran bats (0.3%), and a higher proportion is currently at risk of extinction (Megachiroptera: 34%; Microchiroptera: 22%). While correlates of microchiropteran extinction risk are the same as in the order as a whole, megachiropteran extinction is correlated more with reproductive rate and less with wing morphology. Bat extinction risk is not randomly distributed phylogenetically: closely related species have more similar levels of threat than would be expected if extinction risk were random. Given the unbalanced nature of the evolutionary diversification of bats, it is probable that the amount of phylogenetic diversity lost if currently threatened taxa disappear may be greater than in other clades with numerically more threatened species.

  3. Convergences in the diversification of bats

    Directory of Open Access Journals (Sweden)

    M. Brock FENTON

    2010-08-01

    Full Text Available Twenty-five characters or suites of characters from bats are considered in light of changes in bat classification. The characters include some associated with flower-visiting (two, echolocation (12, roosting (six, reproduction (two and three are of unknown adaptive function. In both the 1998 and 2006 classifications of bats into suborders (Megachiroptera and Microchiroptera versus Yinpterochiroptera and Yangochiroptera, respectively, some convergences between suborders are the same (e.g., foliage roosting, tent building, but others associated with echolocation differ substantially. In the 1998 phylogeny convergences associated with echolocation (high duty cycle echolocation, nasal emission of echolocation calls occurred among the Microchiroptera. In the 2006 phylogeny, they occur between Yinpterochiroptera and Yangochiroptera. While some traits apparently arose independently in two suborders (e.g., foliage-roosting, tent building, low intensity echolocation calls, noseleafs, nasal emission of echolocation calls, high duty cycle echolocation behaviour, others appear to have been ancestral (roosting in narrow spaces, laryngeal echolocation, stylohyal-tympanic contact, oral emission of echolocation calls, and small litter size. A narrow profile through the chest is typical of bats reflecting the thoracic skeleton. This feature suggests that the ancestors of bats spent the day in small crevices. Features associated with laryngeal echolocation appear to be ancestral, suggesting that echolocation evolved early in bats but was subsequently lost in one yinpterochiropteran lineage [Current Zoology 56 (4: 454–468, 2010].

  4. Heavy metal contamination in bats in Britain

    International Nuclear Information System (INIS)

    Walker, L.A.; Simpson, V.R.; Rockett, L.; Wienburg, C.L.; Shore, R.F.

    2007-01-01

    Toxic metals are bioaccumulated by insectivorous mammals but few studies (none from Britain) have quantified residues in bats. We measured renal mercury (Hg), lead (Pb) and cadmium (Cd) concentrations in bats from south-west England to determine how they varied with species, sex, age, and over time, and if they were likely to cause adverse effects. Residues were generally highest in whiskered bats (Myotis mystacinus). Compared with other species, pipistrelle (Pipistrellus spp) and Natterer's bats (Myotis nattereri) had significantly lower kidney Hg and Pb concentrations, respectively. Renal Hg increased over time in pipistrelles but the contributory sources are unknown. Kidney Pb did not decrease over time despite concurrent declines in atmospheric Pb. Overall, median renal metal concentrations were similar to those in bats from mainland Europe and 6- to 10-fold below those associated with clinical effect, although 5% of pipistrelles had kidney Pb residues diagnostic of acute lead poisoning. - Heavy metal contamination has been quantified in bats from Britain for the first time and indicates increased accumulation of Hg and no reduction in Pb

  5. The communicative potential of bat echolocation pulses.

    Science.gov (United States)

    Jones, Gareth; Siemers, Björn M

    2011-05-01

    Ecological constraints often shape the echolocation pulses emitted by bat species. Consequently some (but not all) bats emit species-specific echolocation pulses. Because echolocation pulses are often intense and emitted at high rates, they are potential targets for eavesdropping by other bats. Echolocation pulses can also vary within species according to sex, body size, age, social group and geographic location. Whether these features can be recognised by other bats can only be determined reliably by playback experiments, which have shown that echolocation pulses do provide sufficient information for the identification of sex and individual in one species. Playbacks also show that bats can locate conspecifics and heterospecifics at foraging and roost sites by eavesdropping on echolocation pulses. Guilds of echolocating bat species often partition their use of pulse frequencies. Ecology, allometric scaling and phylogeny play roles here, but are not sufficient to explain this partitioning. Evidence is accumulating to support the hypothesis that frequency partitioning evolved to facilitate intraspecific communication. Acoustic character displacement occurs in at least one instance. Future research can relate genetic population structure to regional variation in echolocation pulse features and elucidate those acoustic features that most contribute to discrimination of individuals.

  6. Hawkmoths produce anti-bat ultrasound

    Science.gov (United States)

    Barber, Jesse R.; Kawahara, Akito Y.

    2013-01-01

    Bats and moths have been engaged in aerial warfare for nearly 65 Myr. This arms race has produced a suite of counter-adaptations in moths, including bat-detecting ears. One set of defensive strategies involves the active production of sound; tiger moths' ultrasonic replies to bat attack have been shown to startle bats, warn the predators of bad taste and jam their biosonar. Here, we report that hawkmoths in the Choerocampina produce entirely ultrasonic sounds in response to tactile stimulation and the playback of biosonar attack sequences. Males do so by grating modified scraper scales on the outer surface of the genital valves against the inner margin of the last abdominal tergum. Preliminary data indicate that females also produce ultrasound to touch and playback of echolocation attack, but they do so with an entirely different mechanism. The anti-bat function of these sounds is unknown but might include startling, cross-family acoustic mimicry, warning of unprofitability or physical defence and/or jamming of echolocation. Hawkmoths present a novel and tractable system to study both the function and evolution of anti-bat defences. PMID:23825084

  7. The occurrence of Ixodes ricinus ticks and important tick-borne pathogens in areas with high tick-borne encephalitis prevalence in different altitudinal levels of the Czech Republic. Part I. Ixodes ricinus ticks and tick-borne encephalitis virus

    Czech Academy of Sciences Publication Activity Database

    Daniel, M.; Danielová, V.; Kříž, B.; Růžek, Daniel; Fialová, A.; Malý, M.; Materna, J.; Pejčoch, M.; Erhart, Jan

    2016-01-01

    Roč. 65, č. 2 (2016), s. 118-128 ISSN 1210-7913 Institutional support: RVO:60077344 Keywords : Ixodes ricinus * tick-borne encephalitis virus * occurence * altitude * region * season Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.500, year: 2016

  8. Fibrinogen-related proteins in ixodid ticks

    Czech Academy of Sciences Publication Activity Database

    Štěrba, J.; Dupejová, J.; Fišer, M.; Vancová, Marie; Grubhoffer, Libor

    2011-01-01

    Roč. 4, - (2011), e127 ISSN 1756-3305 R&D Projects: GA MŠk(CZ) LC06009; GA AV ČR KJB600960906; GA ČR GA206/09/1782 Institutional research plan: CEZ:AV0Z60220518 Keywords : AMERICAN DOG TICK * INNATE IMMUNITY * DORIN-M * RHIPICEPHALUS-APPENDICULATUS * MOLECULAR CHARACTERIZATION * DERMACENTOR-VARIABILIS * ORNITHODOROS-MOUBATA * LECTINS * HEMOLYMPH * BINDING Subject RIV: EE - Microbiology, Virology Impact factor: 2.937, year: 2011 http://www.parasitesandvectors.com/content/pdf/1756-3305-4-127.pdf

  9. Ecological factors characterizing the prevalence of bacterial tick-borne pathogens in Ixodes ricinus ticks in pastures and woodlands.

    Science.gov (United States)

    Halos, Lénaïg; Bord, Séverine; Cotté, Violaine; Gasqui, Patrick; Abrial, David; Barnouin, Jacques; Boulouis, Henri-Jean; Vayssier-Taussat, Muriel; Vourc'h, Gwenaël

    2010-07-01

    Ecological changes are recognized as an important driver behind the emergence of infectious diseases. The prevalence of infection in ticks depends upon ecological factors that are rarely taken into account simultaneously. Our objective was to investigate the influences of forest fragmentation, vegetation, adult tick hosts, and habitat on the infection prevalence of three tick-borne bacteria, Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, and Rickettsia sp. of the spotted fever group, in questing Ixodes ricinus ticks, taking into account tick characteristics. Samples of questing nymphs and adults were taken from 61 pastures and neighboring woodlands in central France. The ticks were tested by PCR of pools of nymphs and individual adults. The individual infection prevalence was modeled using multivariate regression. The highest infection prevalences were found in adult females collected in woodland sites for B. burgdorferi sensu lato and A. phagocytophilum (16.1% and 10.7%, respectively) and in pasture sites for Rickettsia sp. (8.7%). The infection prevalence in nymphs was lower than 6%. B. burgdorferi sensu lato was more prevalent in woodlands than in pastures. Forest fragmentation favored B. burgdorferi sensu lato and A. phagocytophilum prevalence in woodlands, and in pastures, the B. burgdorferi sensu lato prevalence was favored by shrubby vegetation. Both results are probably because large amounts of edges or shrubs increase the abundance of small vertebrates as reservoir hosts. The Rickettsia sp. prevalence was maximal on pasture with medium forest fragmentation. Female ticks were more infected by B. burgdorferi sensu lato than males and nymphs in woodland sites, which suggests an interaction between the ticks and the bacteria. This study confirms the complexity of the tick-borne pathogen ecology. The findings support the importance of small vertebrates as reservoir hosts and make a case for further studies in Europe on the link between the

  10. Tick-Borne Transmission of Murine Gammaherpesvirus 68

    Directory of Open Access Journals (Sweden)

    Valeria Hajnická

    2017-10-01

    Full Text Available Herpesviruses are a large group of DNA viruses infecting mainly vertebrates. Murine gammaherpesvirus 68 (MHV68 is often used as a model in studies of the pathogenesis of clinically important human gammaherpesviruses such as Epstein-Barr virus and Kaposi's sarcoma-associated herpesvirus. This rodent virus appears to be geographically widespread; however, its natural transmission cycle is unknown. Following detection of MHV68 in field-collected ticks, including isolation of the virus from tick salivary glands and ovaries, we investigated whether MHV68 is a tick-borne virus. Uninfected Ixodes ricinus ticks were shown to acquire the virus by feeding on experimentally infected laboratory mice. The virus survived tick molting, and the molted ticks transmitted the virus to uninfected laboratory mice on which they subsequently fed. MHV68 was isolated from the tick salivary glands, consistent with transmission via tick saliva. The virus survived in ticks without loss of infectivity for at least 120 days, and subsequently was transmitted vertically from one tick generation to the next, surviving more than 500 days. Furthermore, the F1 generation (derived from F0 infected females transmitted MHV68 to uninfected mice on which they fed, with MHV68 M3 gene transcripts detected in blood, lung, and spleen tissue of mice on which F1 nymphs and F1 adults engorged. These experimental data fulfill the transmission criteria that define an arthropod-borne virus (arbovirus, the largest biological group of viruses. Currently, African swine fever virus (ASFV is the only DNA virus recognized as an arbovirus. Like ASFV, MHV68 showed evidence of pathogenesis in ticks. Previous studies have reported MHV68 in free-living ticks and in mammals commonly infested with I. ricinus, and neutralizing antibodies to MHV68 have been detected in large mammals (e.g., deer including humans. Further studies are needed to determine if these reports are the result of tick-borne transmission

  11. Indiana bats, northern long-eared bats, and prescribed fire in the Appalachians: challenges and considerations.

    Science.gov (United States)

    Susan Loeb; Joy O' Keefe

    2014-01-01

    The Indiana bat (Myotis sodalist) is an endangered species and the northern long-eared bat (M. septentrionalis) has been proposed for listing as endangered. Both species are found throughout the Appalachians, and they commonly inhabit fire-dependent ecosystems such as pine and pine-oak forests. Due to their legal status, prescribed burns in areas where these species...

  12. Novel Cryptosporidium bat genotypes III and IV in bats from the USA and Czech Republic.

    Science.gov (United States)

    Kváč, Martin; Hořická, Anna; Sak, Bohumil; Prediger, Jitka; Salát, Jiří; Širmarová, Jana; Bartonička, Tomáš; Clark, Mark; Chelladurai, Jeba Rose Jennifer Jesudoss; Gillam, Erin; McEvoy, John

    2015-10-01

    Bats from the families Rhinolophidae (n = 90) and Vespertilionidae (n = 191) in the USA and Czech Republic were screened for the presence of Cryptosporidium by microscopic and molecular analysis of faecal samples collected from rectum of dissected animals and from the ground beneath roosting sites. Cryptosporidium oocysts were not detected in any of the 281 faecal specimens examined using the aniline-carbol-methyl violet staining method. Nested PCR amplification, sequencing and phylogenetic analysis of the small ribosomal subunit rRNA and actin genes were used to identify isolates and infer evolutionary relationships. Cryptosporidium parvum was identified in a western small-footed bat (Myotis ciliolabrum) from the USA and a common pipistrelle bats (Pipistrellus pipistrellus) from the Czech Republic. Two novel genotypes were identified and named Cryptosporidium bat genotype III and IV. Bat genotype III was found in two big brown bats (Eptesicus fuscus) from the USA. Bat genotype IV was detected in two common pipistrelle bats from the Czech Republic.

  13. Keeping bats cool in the winter: hibernating bats and their exposure to 'hot' incandescent lamplight

    NARCIS (Netherlands)

    Haarsma, A.J.; Hullu, de E.

    2012-01-01

    In order to monitor bat population trends, an annual census is performed of all known underground hibernacula in Europe. During these censuses, bats are sometimes found to show signs of arousal, presumably from non-tactile stimuli caused by the observer, e.g. air currents, sound, light or an

  14. Bat distribution size or shape as determinant of viral richness in African bats

    Czech Academy of Sciences Publication Activity Database

    Maganga, G. D.; Bourgarel, M.; Vallo, Peter; Dallo, T. D.; Ngoagouni, C.; Drexler, J. F.; Drosten, C.; Nakouné, E. R.; Leroy, E. M.; Morand, S.

    2014-01-01

    Roč. 9, č. 6 (2014), e100172 E-ISSN 1932-6203 Institutional support: RVO:68081766 Keywords : cytochrome-b gene * fruit bats * Rousettus aegyptiacus * Eidolon helvum * species richness * Marburg virus * molecular phylogeny * infectious diseases * geographical range * neotropical bats Subject RIV: EG - Zoology Impact factor: 3.234, year: 2014

  15. BAT Exosomes: Metabolic Crosstalk with Other Organs and Biomarkers for BAT Activity.

    Science.gov (United States)

    Goody, Deborah; Pfeifer, Alexander

    2018-04-10

    In the last decade, exosomes have gained interest as a new type of intercellular communication between cells and tissues. Exosomes are circulating, cell-derived lipid vesicles smaller than 200 nm that contain proteins and nucleic acids, including microRNAs (miRNAs), and are able to modify cellular targets. Exosomal miRNAs function as signalling molecules that regulate the transcription of their target genes and can cause phenotypic transformation of recipient cells. Recent studies have shown that brown fat secretes exosomes as a form of communication with other metabolic organs such as the liver. Moreover, it has been shown that levels of miRNAs in BAT-derived exosomes change after BAT activation in vitro and in vivo. Thus, BAT-derived exosomes can be used as potential biomarkers of BAT activity. Here, we review the present knowledge about BAT-derived exosomes and their role in metabolism.

  16. Proteomics Approach to the Study of Cattle Tick Adaptation to White Tailed Deer

    Directory of Open Access Journals (Sweden)

    Marina Popara

    2013-01-01

    Full Text Available Cattle ticks, Rhipicephalus (Boophilus microplus, are a serious threat to animal health and production. Some ticks feed on a single host species while others such as R. microplus infest multiple hosts. White tailed deer (WTD play a role in the maintenance and expansion of cattle tick populations. However, cattle ticks fed on WTD show lower weight and reproductive performance when compared to ticks fed on cattle, suggesting the existence of host factors that affect tick feeding and reproduction. To elucidate these factors, a proteomics approach was used to characterize tick and host proteins in R. microplus ticks fed on cattle and WTD. The results showed that R. microplus ticks fed on cattle have overrepresented tick proteins involved in blood digestion and reproduction when compared to ticks fed on WTD, while host proteins were differentially represented in ticks fed on cattle or WTD. Although a direct connection cannot be made between differentially represented tick and host proteins, these results suggested that differentially represented host proteins together with other host factors could be associated with higher R. microplus tick feeding and reproduction observed in ticks fed on cattle.

  17. Ticks on humans in the Pantanal wetlands, Brazil.

    Science.gov (United States)

    Ramos, Vanessa N; Osava, Carolina F; Piovezan, Ubiratan; Szabó, Matias P J

    2014-09-01

    Information on ticks biting humans in Brazil is very restricted. In fact, many times when human tick-borne diseases are diagnosed, the involved vector tick is not identified, although this may be clinically helpful. Pantanal is one of the world's largest floodplains, has an exuberant wildlife, and is place of extensive cattle ranching, ecotourism, and fishing. We herein report tick species found on humans in a 13-month survey in a region with both cattle and wildlife handling in the Brazilian Pantanal. From February 2012 to February 2013, a total of 280 ticks was collected from humans (n=22), 121 of which were attached. Amblyomma cajennense sensu lato nymphs were the main tick species and stage found attached to humans (n=93) especially during the dry months (winter). In the wet season (summer), Amblyomma parvum adults were the main ticks found attached to humans (n=19) followed by A. cajennense s.l. adults (n=9). Only one unattached nymph of A. parvum was collected in this study. These results reinforce that A. cajennense s.l. nymphs are an important parasite of humans (and vectors) in Brazil and draw also attention to A. parvum adults as frequent human parasites as well. Copyright © 2014 Elsevier GmbH. All rights reserved.

  18. Bat guilds, a concept to classify the highly diverse foraging and echolocation behaviors of microchiropteran bats

    Directory of Open Access Journals (Sweden)

    Annette eDenzinger

    2013-07-01

    Full Text Available Throughout evolution the foraging and echolocation behaviors as well as the motor systems of bats have been adapted to the tasks they have to perform while searching and acquiring food. When bats exploit the same class of environmental resources in a similar way, they perform comparable tasks and thus share similar adaptations independent of their phylogeny. Species with similar adaptations are assigned to guilds or functional groups. Habitat type and foraging mode mainly determine the foraging tasks and thus the adaptations of bats. Therefore we use habitat type and foraging mode to define seven guilds. The habitat types open, edge and narrow space are defined according to the bats’ echolocation behavior in relation to the distance between bat and background or food item and background. Bats foraging in the aerial, trawling, flutter detecting, or active gleaning mode use only echolocation to acquire their food. When foraging in the passive gleaning mode bats do not use echolocation but rely on sensory cues from the food item to find it. Bat communities often comprise large numbers of species with a high diversity in foraging areas, foraging modes, and diets. The assignment of species living under similar constraints into guilds identifies pattern of community structure and helps to understand the factors that underlie the organization of highly diverse bat communities. Bat species from different guilds do not compete for food as they differ in their foraging behavior and in the environmental resources they use. However, sympatric living species belonging to the same guild often exploit the same class of resources. To avoid competition they should differ in their niche dimensions. The fine grain structure of bat communities below the rather coarse classification into guilds is determined by mechanisms that result in niche partitioning.

  19. Tick Haller’s Organ, a New Paradigm for Arthropod Olfaction: How Ticks Differ from Insects

    Directory of Open Access Journals (Sweden)

    Ann L. Carr

    2017-07-01

    Full Text Available Ticks are the vector of many human and animal diseases; and host detection is critical to this process. Ticks have a unique sensory structure located exclusively on the 1st pairs of legs; the fore-tarsal Haller’s organ, not found in any other animals, presumed to function like the insect antennae in chemosensation but morphologically very different. The mechanism of tick chemoreception is unknown. Utilizing next-generation sequencing and comparative transcriptomics between the 1st and 4th legs (the latter without the Haller’s organ, we characterized 1st leg specific and putative Haller’s organ specific transcripts from adult American dog ticks, Dermacentor variabilis. The analysis suggested that the Haller’s organ is involved in olfaction, not gustation. No known odorant binding proteins like those found in insects, chemosensory lipocalins or typical insect olfactory mechanisms were identified; with the transcriptomic data only supporting a possible olfactory G-protein coupled receptor (GPCR signal cascade unique to the Haller’s organ. Each component of the olfactory GPCR signal cascade was identified and characterized. The expression of GPCR, Gαo and β-arrestin transcripts identified exclusively in the 1st leg transcriptome, and putatively Haller’s organ specific, were examined in unfed and blood-fed adult female and male D. variabilis. Blood feeding to repletion in adult females down-regulated the expression of all three chemosensory transcripts in females but not in males; consistent with differences in post-feeding tick behavior between sexes and an expected reduced chemosensory function in females as they leave the host. Data are presented for the first time of the potential hormonal regulation of tick chemosensation; behavioral assays confirmed the role of the Haller’s organ in N,N-diethyl-meta-toluamide (DEET repellency but showed no role for the Haller’s organ in host attachment. Further research is needed to understand

  20. The physics of bat echolocation: Signal processing techniques

    Science.gov (United States)

    Denny, Mark

    2004-12-01

    The physical principles and signal processing techniques underlying bat echolocation are investigated. It is shown, by calculation and simulation, how the measured echolocation performance of bats can be achieved.

  1. Prevention of tick bites: an evaluation of a smartphone app.

    Science.gov (United States)

    Antonise-Kamp, L; Beaujean, D J M A; Crutzen, R; van Steenbergen, J E; Ruwaard, D

    2017-12-04

    Lyme borreliosis (LB) is the most common reported tick-borne infection in Europe, and involves transmission of Borrelia by ticks. As long as a vaccine is not available and effective measures for controlling tick populations are insufficient, LB control is focused on preventive measures to avoid tick bites. To inform citizens about the risk of ticks, motivate them to check for tick bites, and encourage them to remove any attached tick as quickly as possible, a mobile app called 'Tekenbeet' (Dutch for 'tick bite') was developed and released. The aim of this study was to evaluate the usage and user satisfaction of the 'Tekenbeet' app and to investigate whether it affects users' knowledge, perceived severity, perceived susceptibility, self-efficacy, response efficacy, current behavior and intention to comply with preventive measures. Usage of the app was evaluated with data obtained from Google Analytics. A survey among the Dutch general adult population with two data collection periods evaluated the usage, user satisfaction and its influence on abovementioned outcomes. Data obtained from Google Analytics showed the app was downloaded almost 40,000 in the 20 months following the launch. The 'tick radar' and 'tick diary' screens were viewed most often. In addition, a total of 554 respondents completed an online survey. The mean user satisfaction score was 7.44 (on a scale of 1-10) and 90.9% of respondents would recommend the app to others. On average, survey respondents who downloaded the app (n = 243) recorded significantly more often higher knowledge scores (OR 3.37; 95% CI 2.02-5.09) and had a higher intention to comply with preventive measures (OR 2.47; 95% CI 1.22-5.85) compared to respondents who did not download the app (n = 311). The 'Tekenbeet' app is a frequently used and well-appreciated educational tool to increase public knowledge of ticks and tick bites. It also helps to improve the user's intention to apply preventive measures. The use of

  2. New Borrelia species detected in ixodid ticks in Oromia, Ethiopia.

    Science.gov (United States)

    Kumsa, Bersissa; Socolovschi, Cristina; Raoult, Didier; Parola, Philippe

    2015-04-01

    Little is known about Borrelia species transmitted by hard ticks in Ethiopia. The present study was conducted from November 2011 through March 2014 to address the occurrence and molecular identity of these bacteria in ixodid ticks infesting domestic animals in Oromia, Ethiopia. A total of 767 ixodid ticks collected from domestic animals were screened for Borrelia DNA by quantitative (q) real-time PCR followed by standard PCR and sequencing to identify the species. Overall, 3.8% (29/767) of the tested ticks were positive for Borrelia DNA, including 8/119 (6.7%) Amblyomma cohaerens, 1/42 (2.4%) Am. gemma, 3/53 (5.7%) Am. variegatum, 5/22 (22.7%) Amblyomma larvae, 3/60 (5%) Amblyomma nymphs, 2/139 (1.4%) Rhipicephalus (Boophilus) decoloratus, 2/31 (6.4%) Rh. decoloratus nymphs, and 5/118 (4.2%) Rh. pulchellus using 16S genus-specific qPCR. The prevalence of Borrelia DNA was significantly higher in genus Amblyomma (20/298, 6.7%) than in the genus Rhipicephalus (9/417, 2.1%) ticks (P=0.001). Sequencing of PCR products from the flaB and 16S rRNA genes of Borrelia spp. from Amblyomma ticks showed the presence of a new species between the relapsing fever and Lyme disease groups. However, Borrelia sp. detected in Rhipicephalus ticks clustered with B. theileri/B. lonestari. The human pathogenicity of the Borrelia sp. detected in Amblyomma ticks from Ethiopia has not yet been investigated, whereas the Borrelia sp. detected in Rhipicephalus ticks in our study is the causative agent of bovine borreliosis in cattle and may have veterinary importance in different parts of Ethiopia. Furthermore, the detection of previously unrecognized Borrelia species in Amblyomma and Rhipicephalus ticks in Ethiopia generates additional questions concerning the bacterial fauna in hard ticks and will prompt researchers to perform detailed studies for better understanding of ixodid ticks associated bacteria. Copyright © 2015 Elsevier GmbH. All rights reserved.

  3. Candidatus Neoehrlichia mikurensis in Ticks from Migrating Birds in Sweden.

    Science.gov (United States)

    Labbé Sandelin, Lisa; Tolf, Conny; Larsson, Sara; Wilhelmsson, Peter; Salaneck, Erik; Jaenson, Thomas G T; Lindgren, Per-Eric; Olsen, Björn; Waldenström, Jonas

    2015-01-01

    Candidatus Neoehrlichia mikurensis (CNM; family Anaplasmataceae) was recently recognized as a potential tick-borne human pathogen. The presence of CNM in mammals, in host-seeking Ixodes ticks and in ticks attached to mammals and birds has been reported recently. We investigated the presence of CNM in ornithophagous ticks from migrating birds. A total of 1,150 ticks (582 nymphs, 548 larvae, 18 undetermined ticks and two adult females) collected from 5,365 birds captured in south-eastern Sweden was screened for CNM by molecular methods. The birds represented 65 different species, of which 35 species were infested with one or more ticks. Based on a combination of morphological and molecular species identification, the majority of the ticks were identified as Ixodes ricinus. Samples were initially screened by real-time PCR targeting the CNM 16S rRNA gene, and confirmed by a second real-time PCR targeting the groEL gene. For positive samples, a 1260 base pair fragment of the 16S rRNA gene was sequenced. Based upon bacterial gene sequence identification, 2.1% (24/1150) of the analysed samples were CNM-positive. Twenty-two out of 24 CNM-positive ticks were molecularly identified as I. ricinus nymphs, and the remaining two were identified as I. ricinus based on morphology. The overall CNM prevalence in I. ricinus nymphs was 4.2%. None of the 548 tested larvae was positive. CNM-positive ticks were collected from 10 different bird species. The highest CNM-prevalences were recorded in nymphs collected from common redpoll (Carduelis flammea, 3/7), thrush nightingale (Luscinia luscinia, 2/29) and dunnock (Prunella modularis, 1/17). The 16S rRNA sequences obtained in this study were all identical to each other and to three previously reported European strains, two of which were obtained from humans. It is concluded that ornithophagous ticks may be infected with CNM and that birds most likely can disperse CNM-infected ticks over large geographical areas.

  4. Candidatus Neoehrlichia mikurensis in Ticks from Migrating Birds in Sweden.

    Directory of Open Access Journals (Sweden)

    Lisa Labbé Sandelin

    Full Text Available Candidatus Neoehrlichia mikurensis (CNM; family Anaplasmataceae was recently recognized as a potential tick-borne human pathogen. The presence of CNM in mammals, in host-seeking Ixodes ticks and in ticks attached to mammals and birds has been reported recently. We investigated the presence of CNM in ornithophagous ticks from migrating birds. A total of 1,150 ticks (582 nymphs, 548 larvae, 18 undetermined ticks and two adult females collected from 5,365 birds captured in south-eastern Sweden was screened for CNM by molecular methods. The birds represented 65 different species, of which 35 species were infested with one or more ticks. Based on a combination of morphological and molecular species identification, the majority of the ticks were identified as Ixodes ricinus. Samples were initially screened by real-time PCR targeting the CNM 16S rRNA gene, and confirmed by a second real-time PCR targeting the groEL gene. For positive samples, a 1260 base pair fragment of the 16S rRNA gene was sequenced. Based upon bacterial gene sequence identification, 2.1% (24/1150 of the analysed samples were CNM-positive. Twenty-two out of 24 CNM-positive ticks were molecularly identified as I. ricinus nymphs, and the remaining two were identified as I. ricinus based on morphology. The overall CNM prevalence in I. ricinus nymphs was 4.2%. None of the 548 tested larvae was positive. CNM-positive ticks were collected from 10 different bird species. The highest CNM-prevalences were recorded in nymphs collected from common redpoll (Carduelis flammea, 3/7, thrush nightingale (Luscinia luscinia, 2/29 and dunnock (Prunella modularis, 1/17. The 16S rRNA sequences obtained in this study were all identical to each other and to three previously reported European strains, two of which were obtained from humans. It is concluded that ornithophagous ticks may be infected with CNM and that birds most likely can disperse CNM-infected ticks over large geographical areas.

  5. Preventing tick attachment to dogs using essential oils.

    Science.gov (United States)

    Goode, Penelope; Ellse, Lauren; Wall, Richard

    2018-03-27

    Preventing tick bites using repellents could make a valuable contribution to an integrated tick management programme for dogs. Here, the ability of a range of essential oils or active ingredients of commercially available repellents, to abolish the orientation and taxis of the tick Ixodes ricinus towards sebum extracted from dog hair was examined in laboratory bioassays. Substantial differences between oils were observed, but turmeric oil was both able to prevent a climbing response by ticks and had a longer residual activity than other oils. A blanket-drag field assay was then used to compare the attachment of ticks to blankets impregnated with one of: turmeric oil, DEET (positive control), orange-oil or excipient only (negative controls). In total, 899 ticks were counted, with an average of 23.3 (SD ± 21.3) ticks per blanket drag for excipient-only (n = 16), 26.9 (SD ± 28.6) for orange oil (n = 16), 2.6 (SD ± 2.0) for turmeric oil (n = 16) and 3.4 (SD ± 3.7) for DEET (n = 16). Finally, in a participatory in vivo trial, tick acquisition by 15 untreated control dogs was compared with 24 dogs sprayed with turmeric-oil and 16 dogs sprayed with orange oil (both 2.5% v/v diluted in water with a 1% coco glucoside excipient) before each walk in known tick infested areas. The percentage of dogs with ticks attached to the legs or belly of dogs sprayed with turmeric oil suspension (15% ± 19.4%) was significantly lower than that of ticks attached to the same areas of dogs sprayed with orange oil suspension (85% ± 19.4%) and unsprayed dogs (73% ± 26.2%) (P < 0.05). The data indicate that turmeric-oil may form a valuable component of a tick management programme for domestic dogs. Copyright © 2018 Elsevier GmbH. All rights reserved.

  6. Morphology-induced information transfer in bat sonar

    OpenAIRE

    Reijniers, Jonas; Vanderelst, Dieter; Peremans, Herbert

    2010-01-01

    Abstract: It has been argued that an important part of understanding bat echolocation comes down to understanding the morphology of the bat sound processing apparatus. In this Letter we present a method based on information theory that allows us to assess target localization performance of bat sonar, without a priori knowledge on the position, size, or shape of the reflecting target. We demonstrate this method using simulated directivity patterns of the frequency-modulated bat Micronycteris m...

  7. Identification of Novel Betaherpesviruses in Iberian Bats Reveals Parallel Evolution

    OpenAIRE

    Pozo, Francisco; Juste, Javier; Vázquez-Morón, Sonia; Anar-López, Carolina; Ibáñez, Carlos; Garin, Inazio; Aihartza, Joxerra; Casas, Inmaculada; Tenorio, Antonio; Echevarría, Juan E.

    2016-01-01

    A thorough search for bat herpesviruses was carried out in oropharyngeal samples taken from most of the bat species present in the Iberian Peninsula from the Vespertilionidae, Miniopteridae, Molossidae and Rhinolophidae families, in addition to a colony of captive fruit bats from the Pteropodidae family. By using two degenerate consensus PCR methods targeting two conserved genes, distinct and previously unrecognized bat-hosted herpesviruses were identified for the most of the tested species. ...

  8. Tentative novel lyssavirus in a bat in Finland.

    Science.gov (United States)

    Nokireki, T; Tammiranta, N; Kokkonen, U-M; Kantala, T; Gadd, T

    2018-02-15

    A tentative novel member of the genus Lyssavirus, designated as Kotalahti bat lyssavirus, was detected in a Brandt's bat (Myotis brandtii) in Finland. Based on phylogenetic analysis, the virus differs from other known lyssaviruses, being closely related to Khujand virus, Aravan virus, Bokeloh bat lyssavirus and European bat lyssavirus 2. © 2018 The Authors. Transboundary and Emerging Diseases Published by Blackwell Verlag GmbH.

  9. Antioxidant Defenses in the Brains of Bats during Hibernation.

    Science.gov (United States)

    Yin, Qiuyuan; Ge, Hanxiao; Liao, Chen-Chong; Liu, Di; Zhang, Shuyi; Pan, Yi-Hsuan

    2016-01-01

    Hibernation is a strategy used by some mammals to survive a cold winter. Small hibernating mammals, such as squirrels and hamsters, use species- and tissue-specific antioxidant defenses to cope with oxidative insults during hibernation. Little is known about antioxidant responses and their regulatory mechanisms in hibernating bats. We found that the total level of reactive oxygen species (ROS) and reactive nitrogen species (RNS) in the brain of each of the two distantly related hibernating bats M. ricketti and R. ferrumequinum at arousal was lower than that at torpid or active state. We also found that the levels of malondialdehyde (product of lipid peroxidation) of the two hibernating species of bats were significantly lower than those of non-hibernating bats R. leschenaultia and C. sphinx. This observation suggests that bats maintain a basal level of ROS/RNS that does no harm to the brain during hibernation. Results of Western blotting showed that hibernating bats expressed higher amounts of antioxidant proteins than non-hibernating bats and that M. ricketti bats upregulated the expression of some enzymes to overcome oxidative stresses, such as superoxide dismutase, glutathione reductase, and catalase. In contrast, R. ferrumequinum bats maintained a relatively high level of superoxide dismutase 2, glutathione reductase, and thioredoxin-2 throughout the three different states of hibernation cycles. The levels of glutathione (GSH) were higher in M. ricketti bats than in R. ferrumequinum bats and were significantly elevated in R. ferrumequinum bats after torpor. These data suggest that M. ricketti bats use mainly antioxidant enzymes and R. ferrumequinum bats rely on both enzymes and low molecular weight antioxidants (e.g., glutathione) to avoid oxidative stresses during arousal. Furthermore, Nrf2 and FOXOs play major roles in the regulation of antioxidant defenses in the brains of bats during hibernation. Our study revealed strategies used by bats against oxidative

  10. Ticks (Acari: Ixodidae) infesting some small mammals from Northern Turkey with new tick-host associations and locality records.

    Science.gov (United States)

    Keskin, Adem; Selçuk, Ahmet Yesari; Kefelioğlu, Haluk

    2017-12-01

    Ticks are obligate ectoparasites of a vast range of terrestrial vertebrates which may play an important role in the transmission of many zoonotic pathogens to humans and animals. In the current study, we performed an investigation on ticks infesting some small mammals captured from Samsun and Tokat provinces, Northern Turkey. One hundred forty-five mammalian samples belonging to four species, namely Cricetulus migratorius (n = 1), Apodemus flavicollis (n = 17), Crocidura suaveolens (n = 102) and Sorex volnuchini (n = 25), were examined for the presence of tick infestations. A total of 273 (74 larvae, 194 nymphs, 5 females) hard ticks were collected from 88 mammalian samples. Ticks were identified as Ixodes laguri (1 nymph), I. redikorzevi (22 larvae, 186 nymphs, 5 females), I. ricinus (52 larvae, 4 nymphs) and Rhipicephalus turanicus (3 nymphs). Here, we also provided new tick mammalian host associations for Turkey. In addition, I. laguri and I. redikorzevi ticks were recorded for the first time in Samsun province of Turkey.

  11. Surveillance of Ixodes ricinus ticks (Acari: Ixodidae) in Iceland.

    Science.gov (United States)

    Alfredsson, Matthias; Olafsson, Erling; Eydal, Matthias; Unnsteinsdottir, Ester Rut; Hansford, Kayleigh; Wint, William; Alexander, Neil; Medlock, Jolyon M

    2017-10-10

    Ixodes ricinus is a three-host tick, a principal vector of Borrelia burgdorferi (s.l.) and one of the main vectors of tick-borne encephalitis (TBE) virus. Iceland is located in the North Atlantic Ocean with subpolar oceanic climate. During the past 3-4 decades, average temperature has increased, supporting more favourable conditions for ticks. Reports of I. ricinus have increased in recent years. If these ticks were able to establish in a changing climate, Iceland may face new threats posed by tick-borne diseases. Active field surveillance by tick flagging was conducted at 111 sites around Iceland from August 2015 to September 2016. Longworth mammal traps were used to trap Apodemus sylvaticus in southwestern and southern Iceland. Surveillance on tick importation by migratory birds was conducted in southeastern Iceland, using bird nets and a Heligoland trap. Vulpes lagopus carcasses from all regions of the country were inspected for ticks. In addition, existing and new passive surveillance data from two institutes have been merged and are presented. Continental probability of presence models were produced. Boosted Regression Trees spatial modelling methods and its predictions were assessed against reported presence. By field sampling 26 questing I. ricinus ticks (7 males, 3 females and 16 nymphs) were collected from vegetation from three locations in southern and southeastern Iceland. Four ticks were found on migratory birds at their arrival in May 2016. A total of 52 A. sylvaticus were live-trapped but no ticks were found nor on 315 V. lagopus carcasses. Passive surveillance data collected since 1976, reports further 214 I. ricinus ticks from 202 records, with an increase of submissions in recent years. The continental probability of presence model correctly predicts approximately 75% of the recorded presences, but fails to predict a fairly specific category of recorded presence in areas where the records are probably opportunistic and not likely to lead to

  12. Efficacy of orally administered powdered aloe juice (Aloe ferox against ticks on cattle and ticks and fleas on dogs

    Directory of Open Access Journals (Sweden)

    J.J. Fourie

    2005-06-01

    Full Text Available The efficacy of orally administered powdered aloe juice (Aloe ferox was evaluated against ticks on cattle and against ticks and fleas on dogs. Twelve calves were each infested over a 25-day period with approximately 4000 larvae of Rhipicephalus (Boophilus decoloratus and allocated to 3 groups of 4 calves each. Three days after the last larval infestation and daily for 22 days thereafter, the calves in 1 group were fed 5 mg / kg body weight and those in another 25 mg / kg body weight of powdered aloe juice incorporated in game maintenance pellets, while the animals in the 3rd group received only pellets. Detached female ticks were collected daily and counted and the weights and the fertility of groups of 50 engorged female ticks collected from the animals were ascertained. The powdered aloe juice in the game maintenance pellets had no effect on the tick burdens of the calves or on the fertility of the ticks. Six dogs, in each of 2 groups, were treated daily for 15 consecutive days, commencing on Day -5 before the 1st tick infestation, with either 0.39 g or 0.74 g of powdered aloe juice, administered orally in gelatin capsules, while a 3rd group of 6 dogs served as untreated controls. All the dogs were challenged with Haemaphysalis leachi on Days 0 and +7, and with Ctenocephalides felis on Days+1and +8, and efficacy assessments were made 1 day after flea and 2 days after tick challenge, respectively. Treatment was not effective against ticks or fleas on the dogs.

  13. Multiple mortality events in bats: a global review

    Science.gov (United States)

    O'Shea, Thomas J.; Cryan, Paul; Hayman, David TH; Plowright, Raina K.; Streicker, Daniel G.

    2016-01-01

    Despite conservation concerns for many species of bats, factors causing mortality in bats have not been reviewed since 1970. Here, we review and qualitatively describe trends in the occurrence and apparent causes of multiple mortality events (MMEs) in bats around the world.

  14. Bats roosting in public buildings: A preliminary assessment from ...

    African Journals Online (AJOL)

    Madagascar has many synanthropic bat species but relatively little is known about how people interact with them. A preliminary assessment on the presence of bats in buildings and their interactions with people was conducted in the eastern town of Moramanga. Fifty of the 156 buildings were reported to contain active bat ...

  15. Roost temperature and fidelity of Wahlberg's epauletted fruit bat ...

    African Journals Online (AJOL)

    Generally,Wahlberg's epauletted fruit bat (Epomophorus wahlbergi) roost in trees or under the eaves of buildings. This study investigated the roosting dynamics of E. wahlbergi in the urban environment of Pietermaritzburg, South Africa. To determine roost fidelity bats were radiotracked to daytime roosts. Bats were found to ...

  16. Schizamniogenesis in the rusty bat, Pipistrellus rusticus | van der ...

    African Journals Online (AJOL)

    Rusty bats are seasonally monoestrous, carrying a single foetus in each of the two uterine horns. Implantation is superficial with amniogenesis initiated very early during embryogenesis. Contrary to most other bat species where the amnion is formed by folding, it is formed by cavitation in the rusty bat.

  17. Food resource partitioning inb syntopic nectarivorous bats on Puerto Rico

    Science.gov (United States)

    We analyzed stable isotopes (δ13C, δ15N) to estimate the importance of plants and insects to the diet of two nectar-feeding bats on Puerto Rico, the brown flower bat (Erophylla bombifrons) and the Greater Antillean long-tongued bat (Monophyllus redmani). Concentrations of stable ...

  18. Ovarian activity and early embryonic development in the rusty bat ...

    African Journals Online (AJOL)

    The reproductive pattern of the female rusty bat, Pipistrellus rusticus, was investigated by means of a histological examination of the ovarian follicles as well as early embryonic development. Bats were collected from two localities in Limpopo Province. Female rusty bats are seasonal monestrous breeders, initiating ...

  19. Large roads reduce bat activity across multiple species.

    Science.gov (United States)

    Kitzes, Justin; Merenlender, Adina

    2014-01-01

    Although the negative impacts of roads on many terrestrial vertebrate and bird populations are well documented, there have been few studies of the road ecology of bats. To examine the effects of large roads on bat populations, we used acoustic recorders to survey bat activity along ten 300 m transects bordering three large highways in northern California, applying a newly developed statistical classifier to identify recorded calls to the species level. Nightly counts of bat passes were analyzed with generalized linear mixed models to determine the relationship between bat activity and distance from a road. Total bat activity recorded at points adjacent to roads was found to be approximately one-half the level observed at 300 m. Statistically significant road effects were also found for the Brazilian free-tailed bat (Tadarida brasiliensis), big brown bat (Eptesicus fuscus), hoary bat (Lasiurus cinereus), and silver-haired bat (Lasionycteris noctivagans). The road effect was found to be temperature dependent, with hot days both increasing total activity at night and reducing the difference between activity levels near and far from roads. These results suggest that the environmental impacts of road construction may include degradation of bat habitat and that mitigation activities for this habitat loss may be necessary to protect bat populations.

  20. Monitoring bat activity at the Dutch EEZ in 2014

    NARCIS (Netherlands)

    Lagerveld, S.; Jonge Poerink, B.; Vries, de P.

    2015-01-01

    IMARES conducted studies in 2012 and 2013 to monitor offshore bat activity with passive acoustic ultrasonic recorders. In the follow-up project reported here, more data on the offshore occurrence of bats was collected in 2014. Using the same methodology as in 2012 and 2013, bat activity was

  1. Resource selection by Indiana bats during the maternity season

    Science.gov (United States)

    Kathryn M. Womack; Sybill K. Amelon; Frank R. Thompson

    2013-01-01

    Little information exists on resource selection by foraging Indiana bats (Myotis sodalis) during the maternity season. Existing studies are based on modest sample sizes because of the rarity of this endangered species and the difficulty of radio-tracking bats. Our objectives were to determine resource selection by foraging Indiana bats during the maternity season and...

  2. Personal Reflections My Tryst with the Bats of Madurai -86 ...

    Indian Academy of Sciences (India)

    Space Memory in Bats: Most animals have space memory in that they return to the same place after the day or night ... The other species of insectivorous bats ofMadurai, nine in all, do have roost memory but not space ... cally, the auditory region of the brain of insectivorous bats are disproportionately large compared to the.

  3. Sialomes and Mialomes: A Systems-Biology View of Tick Tissues and Tick-Host Interactions

    Czech Academy of Sciences Publication Activity Database

    Chmelař, J.; Kotál, Jan; Karim, S.; Kopáček, Petr; Francischetti, I.M.B.; Pedra, J. H. F.; Kotsyfakis, Michalis

    2016-01-01

    Roč. 32, č. 3 (2016), s. 242-254 ISSN 1471-4922 R&D Projects: GA ČR GAP502/12/2409; GA ČR GA13-11043S EU Projects: European Commission(XE) 268177 Institutional support: RVO:60077344 Keywords : next- gene ration sequencing * sialomes * systems biology * tick-borne pathogens Subject RIV: EB - Gene tics ; Molecular Biology Impact factor: 6.333, year: 2016

  4. Tick iron and heme metabolism – New target for an anti-tick intervention

    Czech Academy of Sciences Publication Activity Database

    Hajdušek, Ondřej; Šíma, Radek; Perner, Jan; Loosová, Gabriela; Harcubová, Adéla; Kopáček, Petr

    2016-01-01

    Roč. 7, č. 4 (2016), s. 565-572 ISSN 1877-959X R&D Projects: GA ČR GA13-11043S; GA ČR GP13-27630P; GA ČR GP13-12816P EU Projects: European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : tick * iron * heme * RNAi * vaccine Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.230, year: 2016

  5. [Hematophagous bats as reservoirs of rabies].

    Science.gov (United States)

    Scheffer, Karin Corrêa; Iamamoto, Keila; Asano, Karen Miyuki; Mori, Enio; Estevez Garcia, Andrea Isabel; Achkar, Samira M; Fahl, Williande Oliveira

    2014-04-01

    Rabies continues to be a challenge for public health authorities and a constraint to the livestock industry in Latin America. Wild and domestic canines and vampire bats are the main transmitter species and reservoirs of the disease. Currently, variations observed in the epidemiological profile of rabies, where the species of hematophagous bat Desmodus rotundus constitutes the main transmitting species. Over the years, knowledge has accumulated about the ecology, biology and behavior of this species and the natural history of rabies, which should lead to continuous development of methods of population control of d. Rotundus as well as prevention and diagnostic tools for rabies. Ecological relationships of this species with other hematophagous and non-hematophagous bats is unknown, and there is much room for improvement in reporting systems and surveillance, as well as creating greater awareness among the farming community. Understanding the impact of human-induced environmental changes on the rabies virus in bats should be cause for further investigation. This will require a combination of field studies with mathematical models and new diagnostic tools. This review aims to present the most relevant issues on the role of hematophagous bats as reservoirs and transmitters of the rabies virus.

  6. Sexually selected infanticide in a polygynous bat.

    Directory of Open Access Journals (Sweden)

    Mirjam Knörnschild

    Full Text Available BACKGROUND: Adult individuals of many species kill unrelated conspecific infants for several adaptive reasons ranging from predation or resource competition to the prevention of misdirected parental care. Moreover, infanticide can increase the reproductive success of the aggressor by killing the offspring of competitors and thereafter mating with the victimized females. This sexually selected infanticide predominantly occurs in polygynous species, with convincing evidence for primates, carnivores, equids, and rodents. Evidence for bats was predicted but lacking. METHODOLOGY/PRINCIPAL FINDINGS: Here we report the first case, to our knowledge, of sexually selected infanticide in a bat, the polygynous white-throated round-eared bat, Lophostoma silvicolum. Behavioral studies in a free-living population revealed that an adult male repeatedly attacked and injured the pups of two females belonging to his harem, ultimately causing the death of one pup. The infanticidal male subsequently mated with the mother of the victimized pup and this copulation occurred earlier than any other in his harem. CONCLUSIONS/SIGNIFICANCE: Our findings indicate that sexually selected infanticide is more widespread than previously thought, adding bats as a new taxon performing this strategy. Future work on other bats, especially polygynous species in the tropics, has great potential to investigate the selective pressures influencing the evolution of sexually selected infanticide and to study how infanticide impacts reproductive strategies and social structures of different species.

  7. The hearing gene Prestin reunites echolocating bats

    Science.gov (United States)

    Li, Gang; Wang, Jinhong; Rossiter, Stephen J.; Jones, Gareth; Cotton, James A.; Zhang, Shuyi

    2008-01-01

    The remarkable high-frequency sensitivity and selectivity of the mammalian auditory system has been attributed to the evolution of mechanical amplification, in which sound waves are amplified by outer hair cells in the cochlea. This process is driven by the recently discovered protein prestin, encoded by the gene Prestin. Echolocating bats use ultrasound for orientation and hunting and possess the highest frequency hearing of all mammals. To test for the involvement of Prestin in the evolution of bat echolocation, we sequenced the coding region in echolocating and nonecholocating species. The resulting putative gene tree showed strong support for a monophyletic assemblage of echolocating species, conflicting with the species phylogeny in which echolocators are paraphyletic. We reject the possibilities that this conflict arises from either gene duplication and loss or relaxed selection in nonecholocating fruit bats. Instead, we hypothesize that the putative gene tree reflects convergence at stretches of functional importance. Convergence is supported by the recovery of the species tree from alignments of hydrophobic transmembrane domains, and the putative gene tree from the intra- and extracellular domains. We also found evidence that Prestin has undergone Darwinian selection associated with the evolution of specialized constant-frequency echolocation, which is characterized by sharp auditory tuning. Our study of a hearing gene in bats strongly implicates Prestin in the evolution of echolocation, and suggests independent evolution of high-frequency hearing in bats. These results highlight the potential problems of extracting phylogenetic signals from functional genes that may be prone to convergence. PMID:18776049

  8. Harmonic-hopping in Wallacea's bats.

    Science.gov (United States)

    Kingston, Tigga; Rossiter, Stephen J

    2004-06-10

    Evolutionary divergence between species is facilitated by ecological shifts, and divergence is particularly rapid when such shifts also promote assortative mating. Horseshoe bats are a diverse Old World family (Rhinolophidae) that have undergone a rapid radiation in the past 5 million years. These insectivorous bats use a predominantly pure-tone echolocation call matched to an auditory fovea (an over-representation of the pure-tone frequency in the cochlea and inferior colliculus) to detect the minute changes in echo amplitude and frequency generated when an insect flutters its wings. The emitted signal is the accentuated second harmonic of a series in which the fundamental and remaining harmonics are filtered out. Here we show that three distinct, sympatric size morphs of the large-eared horseshoe bat (Rhinolophus philippinensis) echolocate at different harmonics of the same fundamental frequency. These morphs have undergone recent genetic divergence, and this process has occurred in parallel more than once. We suggest that switching harmonics creates a discontinuity in the bats' perception of available prey that can initiate disruptive selection. Moreover, because call frequency in horseshoe bats has a dual function in resource acquisition and communication, ecological selection on frequency might lead to assortative mating and ultimately reproductive isolation and speciation, regardless of external barriers to gene flow.

  9. Prevalence of Anaplasma marginale in different tick species from Ngorongoro Crater, Tanzania.

    Science.gov (United States)

    Fyumagwa, Robert D; Simmler, Pascale; Meli, Marina L; Hoare, Richard; Hofmann-Lehmann, Regina; Lutz, Hans

    2009-04-06

    In 2001, Ngorongoro Crater was infested with high density of ticks on grassland, livestock and wildlife which was also associated with high mortality. Adult ticks were collected, identified, processed for nucleic acids extraction and a molecular analysis was performed to determine the range of tick species harboring Anaplasma marginale. The real-time PCR was used in the amplification of rickettsia DNA in tick pools (n=527) from 11 identified tick species. Six tick species were detected with A. marginale DNA including Amblyomma gemma, Rhipicephalus appendiculatus, R. compositus, R.decoloratus, R. praetextatus and R. pulchellus. The detection rate in each tick species was 3%, 0.7%, 2%, 13%, 1.8%, and 6.2%, respectively. Five of the positive tick species excluding R.decoloratus have previously not been described to transmit A. marginale. High diversity of tick species detected with A. marginale in Ngorongoro Crater is likely to increase a risk to susceptible animals of contracting the infection.

  10. Genetic characterization of tick-borne flaviviruses: new insights into evolution, pathogenetic determinants and taxonomy.

    Science.gov (United States)

    Grard, Gilda; Moureau, Grégory; Charrel, Rémi N; Lemasson, Jean-Jacques; Gonzalez, Jean-Paul; Gallian, Pierre; Gritsun, Tamara S; Holmes, Edward C; Gould, Ernest A; de Lamballerie, Xavier

    2007-04-25

    Here, we analyze the complete coding sequences of all recognized tick-borne flavivirus species, including Gadgets Gully, Royal Farm and Karshi virus, seabird-associated flaviviruses, Kadam virus and previously uncharacterized isolates of Kyasanur Forest disease virus and Omsk hemorrhagic fever virus. Significant taxonomic improvements are proposed, e.g. the identification of three major groups (mammalian, seabird and Kadam tick-borne flavivirus groups), the creation of a new species (Karshi virus) and the assignment of Tick-borne encephalitis and Louping ill viruses to a unique species (Tick-borne encephalitis virus) including four viral types (i.e. Western Tick-borne encephalitis virus, Eastern Tick-borne encephalitis virus, Turkish sheep Tick-borne encephalitis virus and Louping ill Tick-borne encephalitis virus). The analyses also suggest a complex relationship between viruses infecting birds and those infecting mammals. Ticks that feed on both categories of vertebrates may constitute the evolutionary bridge between the three distinct identified lineages.

  11. Long-term survival of an urban fruit bat seropositive for Ebola and Lagos bat viruses.

    Directory of Open Access Journals (Sweden)

    David T S Hayman

    2010-08-01

    Full Text Available Ebolaviruses (EBOV (family Filoviridae cause viral hemorrhagic fevers in humans and non-human primates when they spill over from their wildlife reservoir hosts with case fatality rates of up to 90%. Fruit bats may act as reservoirs of the Filoviridae. The migratory fruit bat, Eidolon helvum, is common across sub-Saharan Africa and lives in large colonies, often situated in cities. We screened sera from 262 E. helvum using indirect fluorescent tests for antibodies against EBOV subtype Zaire. We detected a seropositive bat from Accra, Ghana, and confirmed this using western blot analysis. The bat was also seropositive for Lagos bat virus, a Lyssavirus, by virus neutralization test. The bat was fitted with a radio transmitter and was last detected in Accra 13 months after release post-sampling, demonstrating long-term survival. Antibodies to filoviruses have not been previously demonstrated in E. helvum. Radio-telemetry data demonstrates long-term survival of an individual bat following exposure to viruses of families that can be highly pathogenic to other mammal species. Because E. helvum typically lives in large urban colonies and is a source of bushmeat in some regions, further studies should determine if this species forms a reservoir for EBOV from which spillover infections into the human population may occur.

  12. Bats and zoonotic viruses: can we confidently link bats with emerging deadly viruses?

    Science.gov (United States)

    Moratelli, Ricardo; Calisher, Charles H

    2015-01-01

    An increasingly asked question is 'can we confidently link bats with emerging viruses?'. No, or not yet, is the qualified answer based on the evidence available. Although more than 200 viruses - some of them deadly zoonotic viruses - have been isolated from or otherwise detected in bats, the supposed connections between bats, bat viruses and human diseases have been raised more on speculation than on evidence supporting their direct or indirect roles in the epidemiology of diseases (except for rabies). However, we are convinced that the evidence points in that direction and that at some point it will be proved that bats are competent hosts for at least a few zoonotic viruses. In this review, we cover aspects of bat biology, ecology and evolution that might be relevant in medical investigations and we provide a historical synthesis of some disease outbreaks causally linked to bats. We provide evolutionary-based hypotheses to tentatively explain the viral transmission route through mammalian intermediate hosts and to explain the geographic concentration of most outbreaks, but both are no more than speculations that still require formal assessment. PMID:25742261

  13. Vaccination with BM86, subolesin and akirin protective antigens for the control of tick infestations in white tailed deer and red deer

    OpenAIRE

    Carreón, Diana; Pérez de Lastra, José Manuel; Pérez de Lastra, José Manuel; Canales, Mario; Ruiz Fons, Francisco; Boadella, Mariana; Moreno-Cid, Juan A.; Villar, Margarita; Gortázar, Christian; Reglero, Manuel; Fuente, José de la

    2012-01-01

    Red deer (Cervus elaphus) and white-tailed deer (Odocoileus virginianus) are hosts for different tick species and tick-borne pathogens and play a role in tick dispersal and maintenance in some regions. These factors stress the importance of controlling tick infestations in deer and several methods such as culling and acaricide treatment have been used. Tick vaccines are a cost-effective alternative for tick control that reduced cattle tick infestations and tick-borne pathogens prevalence whil...

  14. Increasing evidence that bats actively forage at wind turbines.

    Science.gov (United States)

    Foo, Cecily F; Bennett, Victoria J; Hale, Amanda M; Korstian, Jennifer M; Schildt, Alison J; Williams, Dean A

    2017-01-01

    Although the ultimate causes of high bat fatalities at wind farms are not well understood, several lines of evidence suggest that bats are attracted to wind turbines. One hypothesis is that bats would be attracted to turbines as a foraging resource if the insects that bats prey upon are commonly present on and around the turbine towers. To investigate the role that foraging activity may play in bat fatalities, we conducted a series of surveys at a wind farm in the southern Great Plains of the US from 2011-2016. From acoustic monitoring we recorded foraging activity, including feeding buzzes indicative of prey capture, in the immediate vicinity of turbine towers from all six bat species known to be present at this site. From insect surveys we found Lepidoptera, Coleoptera, and Orthoptera in consistently high proportions over several years suggesting that food resources for bats were consistently available at wind turbines. We used DNA barcoding techniques to assess bat diet composition of (1) stomach contents from 47 eastern red bat ( Lasiurus borealis ) and 24 hoary bat ( Lasiurus cinereus ) carcasses collected in fatality searches, and (2) fecal pellets from 23 eastern red bats that were found on turbine towers, transformers, and tower doors. We found that the majority of the eastern red bat and hoary bat stomachs, the two bat species most commonly found in fatality searches at this site, were full or partially full, indicating that the bats were likely killed while foraging. Although Lepidoptera and Orthoptera dominated the diets of these two bat species, both consumed a range of prey items with individual bats having from one to six insect species in their stomachs at the time of death. The prey items identified from eastern red bat fecal pellets showed similar results. A comparison of the turbine insect community to the diet analysis results revealed that the most abundant insects at wind turbines, including terrestrial insects such as crickets and several

  15. [EFFECT OF PYRETHROIDS ON TAIGA TICKS (IXODES PERSULCATUS IXODIDAE)].

    Science.gov (United States)

    Germant, O M; Shashina, N I

    2016-01-01

    Nonspecific prevention of infections, the agents of which are transmitted by Ixodes ticks, is aimed at stopping the suction of the ticks to humans and is substantially based one the use of acaricides. The most interesting group of compounds to be used to individually protect humans is pyrethroids that cause different nerve conduction disturbances in the ticks, which result in their paralysis and death more significantly rapidly than the compounds from other chemical groups. The effect of 8 pyrethroids was investigated when the taiga ticks were in contact with the tissue treated with the compounds. The relationship of the chemical structure of pyrethroids with their acaricidal activity was analyzed from motor activity values and knockdown time. The test pyreithroids, in order of decreasing acaricidal activity, are imiprothrin cyphenothrin, cyfluthrin, alpha-cyperamethrin, zeta-cyperimethrin fenothrin, flumethrin.

  16. Efficacy of afoxolaner against Dermacentor variabilis ticks in dogs.

    Science.gov (United States)

    Mitchell, Elizabeth B; Dorr, Paul; Everett, William R; Chester, Theodore S; Larsen, Diane

    2014-04-02

    Efficacy of afoxolaner, a novel isoxazoline insecticide/acaricide, against Dermacentor variabilis ticks was confirmed in two laboratory studies. Each study utilized a controlled, randomized block design. One day prior to treatment, beagle dogs were infested with 50 unfed adult ticks. Repeat infestations were performed weekly for four weeks. The number of live ticks remaining on each dog was determined 48 h after treatment and after each subsequent infestation. A single oral treatment with a dose approaching the minimum effective dose of afoxolaner (2.5mg/kg) eliminated the pre-existing infestations by D. variabilis ticks and controlled weekly re-infestations with 99.7-100% efficacy up to Day 23 and >97% efficacy at Day 30. Copyright © 2014 The Authors. Published by Elsevier B.V. All rights reserved.

  17. Cattle tick vaccine researchers join forces in CATVAC

    Czech Academy of Sciences Publication Activity Database

    Schetters, T.P.; Bishop, R.; Crampton, M.; Kopáček, Petr; Lew-Tabor, A.; Maritz-Olivier, C.; Miller, R.; Mosqueda, J.; Patarroyo, J.; Rodriguez-Valle, M.; Scoles, G.A.; de la Fuente, J.

    2016-01-01

    Roč. 9, FEB 24 (2016), s. 105 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : CATVAC * vaccine * cattle * tick * Rhipicephalus microplus Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.080, year: 2016

  18. Cattle tick vaccine researchers join forces in CATVAC

    Science.gov (United States)

    A meeting sponsored by the Bill & Melinda Gates Foundation was held at the Avanti Hotel, Mohammedia, Morocco, July 14–15, 2015. The meeting resulted in the formation of the Cattle Tick Vaccine Consortium (CATVAC)....

  19. Risk of Disease from Mosquito and Tick Bites

    Science.gov (United States)

    Insect repellents help reduce the risk of mosquito and tick bites, which can transmit diseases including West Nile Virus, malaria, encephalitis, yellow fever, dengue fever, chikungunya virus, Lyme disease, Rocky Mountain spotted fever, and ehrlichiosis.

  20. Kanyawara Virus: A Novel Rhabdovirus Infecting Newly Discovered Nycteribiid Bat Flies Infesting Previously Unknown Pteropodid Bats in Uganda.

    Science.gov (United States)

    Goldberg, Tony L; Bennett, Andrew J; Kityo, Robert; Kuhn, Jens H; Chapman, Colin A

    2017-07-13

    Bats are natural reservoir hosts of highly virulent pathogens such as Marburg virus, Nipah virus, and SARS coronavirus. However, little is known about the role of bat ectoparasites in transmitting and maintaining such viruses. The intricate relationship between bats and their ectoparasites suggests that ectoparasites might serve as viral vectors, but evidence to date is scant. Bat flies, in particular, are highly specialized obligate hematophagous ectoparasites that incidentally bite humans. Using next-generation sequencing, we discovered a novel ledantevirus (mononegaviral family Rhabdoviridae, genus Ledantevirus) in nycteribiid bat flies infesting pteropodid bats in western Uganda. Mitochondrial DNA analyses revealed that both the bat flies and their bat hosts belong to putative new species. The coding-complete genome of the new virus, named Kanyawara virus (KYAV), is only distantly related to that of its closest known relative, Mount Elgon bat virus, and was found at high titers in bat flies but not in blood or on mucosal surfaces of host bats. Viral genome analysis indicates unusually low CpG dinucleotide depletion in KYAV compared to other ledanteviruses and rhabdovirus groups, with KYAV displaying values similar to rhabdoviruses of arthropods. Our findings highlight the possibility of a yet-to-be-discovered diversity of potentially pathogenic viruses in bat ectoparasites.

  1. Deciphering the bat virome catalog to better understand the ecological diversity of bat viruses and the bat origin of emerging infectious diseases.

    Science.gov (United States)

    Wu, Zhiqiang; Yang, Li; Ren, Xianwen; He, Guimei; Zhang, Junpeng; Yang, Jian; Qian, Zhaohui; Dong, Jie; Sun, Lilian; Zhu, Yafang; Du, Jiang; Yang, Fan; Zhang, Shuyi; Jin, Qi

    2016-03-01

    Studies have demonstrated that ~60%-80% of emerging infectious diseases (EIDs) in humans originated from wild life. Bats are natural reservoirs of a large variety of viruses, including many important zoonotic viruses that cause severe diseases in humans and domestic animals. However, the understanding of the viral population and the ecological diversity residing in bat populations is unclear, which complicates the determination of the origins of certain EIDs. Here, using bats as a typical wildlife reservoir model, virome analysis was conducted based on pharyngeal and anal swab samples of 4440 bat individuals of 40 major bat species throughout China. The purpose of this study was to survey the ecological and biological diversities of viruses residing in these bat species, to investigate the presence of potential bat-borne zoonotic viruses and to evaluate the impacts of these viruses on public health. The data obtained in this study revealed an overview of the viral community present in these bat samples. Many novel bat viruses were reported for the first time and some bat viruses closely related to known human or animal pathogens were identified. This genetic evidence provides new clues in the search for the origin or evolution pattern of certain viruses, such as coronaviruses and noroviruses. These data offer meaningful ecological information for predicting and tracing wildlife-originated EIDs.

  2. Bats Increase the Number of Cultivable Airborne Fungi in the "Nietoperek" Bat Reserve in Western Poland.

    Science.gov (United States)

    Kokurewicz, Tomasz; Ogórek, Rafał; Pusz, Wojciech; Matkowski, Krzysztof

    2016-07-01

    The "Nietoperek" bat reserve located in Western Poland is one of the largest bat hibernation sites in the European Union with nearly 38,000 bats from 12 species. Nietoperek is part of a built underground fortification system from WWII. The aims of the study were (1) to determine the fungal species composition and changes during hibernation season in relation to bat number and microclimatic conditions and (2) evaluate the potential threat of fungi for bat assemblages and humans visiting the complex. Airborne fungi were collected in the beginning, middle and end of hibernation period (9 November 2013 and 17 January and 15 March 2014) in 12 study sites, one outside and 11 inside the complex. Ambient temperature (T a) and relative humidity (RH) were measured by the use of data loggers, and species composition of bats was recorded from the study sites. The collision method (Air Ideal 3P) sampler was used to detect 34 species of airborne fungi including Pseudogymnoascus destructans (Pd). The density of airborne fungi isolated from the outdoor air samples varied from 102 to 242 CFU/1 m(3) of air and from 12 to 1198 CFU in the underground air samples. There was a positive relationship between number of bats and the concentration of fungi. The concentration of airborne fungi increased with the increase of bats number. Analysis of other possible ways of spore transport to the underground indicated that the number of bats was the primary factor determining the number of fungal spores in that hibernation site. Microclimatic conditions where Pd was found (median 8.7 °C, min-max 6.1-9.9 °C and 100 %, min-max 77.5-100.0 %) were preferred by hibernating Myotis myotis and Myotis daubentonii; therefore, these species are most probably especially prone to infection by this fungi species. The spores of fungi found in the underground can be pathogenic for humans and animals, especially for immunocompromised persons, even though their concentrations did not exceed limits and

  3. Acoustic mirrors as sensory traps for bats.

    Science.gov (United States)

    Greif, Stefan; Zsebők, Sándor; Schmieder, Daniela; Siemers, Björn M

    2017-09-08

    Sensory traps pose a considerable and often fatal risk for animals, leading them to misinterpret their environment. Bats predominantly rely on their echolocation system to forage, orientate, and navigate. We found that bats can mistake smooth, vertical surfaces as clear flight paths, repeatedly colliding with them, likely as a result of their acoustic mirror properties. The probability of collision is influenced by the number of echolocation calls and by the amount of time spent in front of the surface. The echolocation call analysis corroborates that bats perceive smooth, vertical surfaces as open flyways. Reporting on occurrences with different species in the wild, we argue that it is necessary to more closely monitor potentially dangerous locations with acoustic mirror properties (such as glass fronts) to assess the true frequency of fatalities around these sensory traps. Copyright © 2017 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.

  4. The amazing bats: Friends, enemies or allies?

    Directory of Open Access Journals (Sweden)

    Salim Mattar V

    2017-09-01

    Full Text Available Bats are a group of extraordinarily specialized vertebrates and are the only mammals capable of flying; their nocturnal habits have stigmatized them to such an extent that in the Hollywood film productions Count Dracula of the Carpathian Mountains was considered the first vampire man; even before Batman himself. In ecosystems, bats are actors with leading roles, 70% of them are insectivores, pollinators, or frugivorous and contribute to the regeneration of forests by disseminating seeds. Some are even fish hunters. Although their large population is mostly distributed in the tropics, they are cosmopolitan and are also found in the Northern Hemisphere. The population of these bats has been displaced in the South American tropics, due to, among many factors, illegal mining, pesticide spraying, indiscriminate deforestation to provide pasture for cattle, and the invasion of their habitats by humans (1.

  5. Does Host Complement Kill Borrelia burgdorferi within Ticks?

    OpenAIRE

    Rathinavelu, Sivaprakash; Broadwater, Anne; de Silva, Aravinda M.

    2003-01-01

    The Lyme disease spirochete, Borrelia burgdorferi, inhabits the gut lumen of the tick vector. At this location the spirochete is exposed to host blood when a tick feeds. We report here on studies that were done with normal and complement-deficient (C3-knockout) mice to determine if the host complement system killed spirochetes within the vector. We found that spirochete numbers within feeding nymphs were not influenced by complement, most likely because host complement was inactivated within ...

  6. Cell lines from the soft tick Ornithodoros moubata

    Czech Academy of Sciences Publication Activity Database

    Bell-Sakyi, L.; Růžek, Daniel; Gould, E. A.

    2009-01-01

    Roč. 49, č. 3 (2009), s. 209-219 ISSN 0168-8162 R&D Projects: GA ČR GA524/08/1509; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ornithodoros moubata * soft tick * tick-borne encephalitis Subject RIV: EE - Microbiology, Virology Impact factor: 1.391, year: 2009

  7. Climate change and Ixodes tick-borne diseases of humans.

    Science.gov (United States)

    Ostfeld, Richard S; Brunner, Jesse L

    2015-04-05

    The evidence that climate warming is changing the distribution of Ixodes ticks and the pathogens they transmit is reviewed and evaluated. The primary approaches are either phenomenological, which typically assume that climate alone limits current and future distributions, or mechanistic, asking which tick-demographic parameters are affected by specific abiotic conditions. Both approaches have promise but are severely limited when applied separately. For instance, phenomenological approaches (e.g. climate envelope models) often select abiotic variables arbitrarily and produce results that can be hard to interpret biologically. On the other hand, although laboratory studies demonstrate strict temperature and humidity thresholds for tick survival, these limits rarely apply to field situations. Similarly, no studies address the influence of abiotic conditions on more than a few life stages, transitions or demographic processes, preventing comprehensive assessments. Nevertheless, despite their divergent approaches, both mechanistic and phenomenological models suggest dramatic range expansions of Ixodes ticks and tick-borne disease as the climate warms. The predicted distributions, however, vary strongly with the models' assumptions, which are rarely tested against reasonable alternatives. These inconsistencies, limited data about key tick-demographic and climatic processes and only limited incorporation of non-climatic processes have weakened the application of this rich area of research to public health policy or actions. We urge further investigation of the influence of climate on vertebrate hosts and tick-borne pathogen dynamics. In addition, testing model assumptions and mechanisms in a range of natural contexts and comparing their relative importance as competing models in a rigorous statistical framework will significantly advance our understanding of how climate change will alter the distribution, dynamics and risk of tick-borne disease.

  8. Amblyomma americanum tick calreticulin binds C1q but does not inhibit activation of the classical complement cascade

    OpenAIRE

    Kim, Tae Kwon; Ibelli, Adriana Mércia Guaratini; Mulenga, Albert

    2015-01-01

    In this study we characterized Amblyomma americanum (Aam) tick calreticulin (CRT) homolog in tick feeding physiology. In nature, different tick species can be found feeding on the same animal host. This suggests that different tick species found feeding on the same host can modulate the same host anti-tick defense pathways to successfully feed. From this perspective it’s plausible that different tick species can utilize universally conserved proteins such as CRT to regulate and facilitate fee...

  9. Molecular evolution of bat color vision genes.

    Science.gov (United States)

    Wang, Daryi; Oakley, Todd; Mower, Jeffrey; Shimmin, Lawrence C; Yim, Sokchea; Honeycutt, Rodney L; Tsao, Hsienshao; Li, Wen-Hsiung

    2004-02-01

    The two suborders of bats, Megachiroptera (megabats) and Microchiroptera (microbats), use different sensory modalities for perceiving their environment. Megabats are crepuscular and rely on a well-developed eyes and visual pathway, whereas microbats occupy a nocturnal niche and use acoustic orientation or echolocation more than vision as the major means of perceiving their environment. In view of the differences associated with their sensory systems, we decided to investigate the function and evolution of color vision (opsin genes) in these two suborders of bats. The middle/long wavelength (M/L) and short wavelength (S) opsin genes were sequenced from two frugivorous species of megabats, Haplonycteris fischeri and Pteropus dasymallus formosus, and one insectivorous species of microbat, Myotis velifer. Contrary to the situation in primates, where many nocturnal species have lost the functional S opsin gene, both crepuscular and strictly nocturnal species of bats that we examined have functional M/L and S opsin genes. Surprisingly, the S opsin in these bats may be sensitive to UV light, which is relatively more abundant at dawn and at dusk. The M/L opsin in these bats appears to be the L type, which is sensitive to red and may be helpful for identifying fruits among leaves or for other purposes. Most interestingly, H. fischeri has a recent duplication of the M/L opsin gene, representing to date the only known case of opsin gene duplication in non-primate mammals. Some of these observations are unexpected and may provide insights into the effect of nocturnal life on the evolution of opsin genes in mammals and the evolution of the life history traits of bats in general.

  10. Adaptive vocal behavior drives perception by echolocation in bats

    DEFF Research Database (Denmark)

    Moss, Cynthia F; Chiu, Chen; Surlykke, Annemarie

    2011-01-01

    Echolocation operates through adaptive sensorimotor systems that collectively enable the bat to localize and track sonar objects as it flies. The features of sonar signals used by a bat to probe its surroundings determine the information available to its acoustic imaging system. In turn, the bat......'s perception of a complex scene guides its active adjustments in the features of subsequent sonar vocalizations. Here, we propose that the bat's active vocal-motor behaviors play directly into its representation of a dynamic auditory scene....

  11. A tiny tick can cause a big health problem

    Directory of Open Access Journals (Sweden)

    Manuel John

    2017-01-01

    Full Text Available Ticks are tiny crawling bugs in the spider family that feed by sucking blood from animals. They are second only to mosquitoes as vectors of human disease, both infectious and toxic. Infected ticks spread over a hundred diseases, some of which are fatal if undetected. They spread the spirochete (which multiplies in the insect's gut with a subsequent bite to the next host. We describe the only reported cases of peri ocular tick bite from India that presented to us within a span of 3 days and its management. Due suspicion and magnification of the lesions revealed the ticks which otherwise masqueraded as small skin tags/moles on gross examination. The ticks were firmly latched on to the skin and careful removal prevented incarceration of the mouth parts. Rickettsial diseases that were believed to have disappeared from India are reemerging and their presence has recently been documented in at least 11 states in the country. Among vector borne diseases, the most common, Lyme disease, also known as the great mimicker, can present with rheumatoid arthritis, fibromyalgia, depression, attention deficit hyperactivity disorder, multiple sclerosis, chronic fatigue syndrome, cardiac manifestations, encephalitis, and mental illness, to name some of the many associations. Common ocular symptoms and signs include conjunctivitis, keratitis, uveitis, and retinitis. Early detection and treatment of tick borne diseases is important to prevent multi system complications that can develop later in life.

  12. Economic importance of ticks and their effective control strategies

    Directory of Open Access Journals (Sweden)

    Haranahalli Vasanthachar Manjunathachar

    2014-09-01

    Full Text Available Role of livestock in improvement of a country ’s economy is inevitable. Livestock contributes a lion ’s share in agricultural sector of developing countries. Several developing countries have adopted the use of exotic germplasm to improve the productivity of their native breeds, which has brought down the disease resistance. Among various problems hindering the growth and productivity of livestock, parasite related problem plays a major role. Tick and tick borne diseases are prevalent in 80% of the cattle population around the globe. They cause various worries to the farmers by transmitting major disease causing pathogens and jeopardize animal health leading to poor production. Ticks transmit various pathogenic agents like virus, bacteria, protozoa and other parasites as well. Many of them are dangerous for the livestock health and some are also zoonotic hence, need to be checked at the initial stages. Control of ticks is the major concern in the present situation as the use of anti-parasitic drugs has led to the current trend of resistance development. Search for an effective alternative method has begun; vaccination will be a better alternative and promising tool for protecting livestock from the tick infestations and thereby tick borne diseases.

  13. An Immunosuppressant Peptide from the Hard Tick Amblyomma variegatum

    Directory of Open Access Journals (Sweden)

    Yufeng Tian

    2016-05-01

    Full Text Available Ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1–2 weeks to obtain blood meals. Thus, they must secrete many immunosuppressant factors to combat the hosts’ immune system. In the present work, we investigated an immunosuppressant peptide of the hard tick Amblyomma variegatum. This peptide, named amregulin, is composed of 40 residues with an amino acid sequence of HLHMHGNGATQVFKPRLVLKCPNAAQLIQPGKLQRQLLLQ. A cDNA of the precursor peptide was obtained from the National Center for Biotechnology Information (NCBI, Bethesda, MD, USA. In rat splenocytes, amregulin exerts significant anti-inflammatory effects by inhibiting the secretion of inflammatory factors in vitro, such as tumor necrosis factor-alpha (TNF-α, interleukin-1 (IL-1, interleukin-8 (IL-8 and interferon-gamma (IFN-γ. In rat splenocytes, treated with amregulin, compared to lipopolysaccharide (LPS alone, the inhibition of the above inflammatory factors was significant at all tested concentrations (2, 4 and 8 µg/mL. Amregulin shows strong free radical scavenging and antioxidant activities (5, 10 and 20 µg/mL in vitro. Amregulin also significantly inhibits adjuvant-induced paw inflammation in mouse models in vivo. This peptide may facilitate the ticks’ successful blood feeding and may lead to host immunotolerance of the tick. These findings have important implications for the understanding of tick-host interactions and the co-evolution between ticks and the viruses that they bear.

  14. Transstadial transmission of Borrelia turcica in Hyalomma aegyptium ticks.

    Science.gov (United States)

    Kalmár, Zsuzsa; Cozma, Vasile; Sprong, Hein; Jahfari, Setareh; D'Amico, Gianluca; Mărcuțan, Daniel I; Ionică, Angela M; Magdaş, Cristian; Modrý, David; Mihalca, Andrei D

    2015-01-01

    Borrelia turcica comprises the third major group of arthropod-transmitted borreliae and is phylogenetically divergent from other Borrelia groups. The novel group of Borrelia was initially isolated from Hyalomma aegyptium ticks in Turkey and it was recently found in blood and multiple organs of tortoises exported from Jordan to Japan. However, the ecology of these spirochetes and their development in ticks or the vertebrate hosts were not investigated in detail; our aims were to isolate the pathogen and to evaluate the possibility of transstadial transmission of Borrelia turcica by H. aegyptium ticks. Ticks were collected from Testudo graeca tortoises during the summer of 2013 from southeastern Romania. Engorged nymphs were successfully molted to the adult stage. Alive B. turcica was isolated from molted ticks by using Barbour-Stoenner-Kelly (BSK) II medium. Four pure cultures of spirochetes were obtained and analyzed by PCR and sequencing. Sequence analysis of glpQ, gyrB and flaB revealed 98%-100% similarities with B. turcica. H. aegyptium ticks collected from T. graeca tortoises were able to pass the infection with B. turcica via transstadial route, suggesting its vectorial capacity.

  15. Immune responses against recombinant tick antigen, Bm95, for the control of Rhipicephalus (Boophilus) microplus ticks in cattle.

    Science.gov (United States)

    Kumar, Amit; Garg, Rajat; Yadav, C L; Vatsya, Stuti; Kumar, R R; Sugumar, Parthasarthy; Chandran, Dev; Mangamoorib, Lakshmi Narasu; Bedarkar, S N

    2009-10-28

    Immune responses against Bm95 recombinant cattle tick antigen and its protective efficacy for control of Rhipicephalus (Boophilus) microplus ticks were determined in experimental crossbred cow calves. Anti-Bm95 antibody titers, as assessed by indirect ELISA, in immunized calves ranged from 196.1+/-13.7 on day 0 to 7979.9+/-312.5 on day 110 post-primary immunization. The rise in antibody titer was statistically significant (pticks, mean percentage of dead ticks, and decrease in engorgement weight were recorded in immunized animals. Also, there were significant differences (pcontrol calves. The percent reduction in number of adult females in vaccinated calves, reduction in mean weight of egg masses, percent reduction in mean weight and reduction in fertility of engorged females collected from vaccinated calves were determined and the efficacy of Bm95 recombinant cattle tick antigen was 81.27%.

  16. Sonar bat for visually impaired people

    OpenAIRE

    Pedrero Rodríguez, Mauro

    2013-01-01

    Visually impaired people have many difficulties when traveling because it is impossible for them to detect obstacles that stand in their way. Bats instead of using the sight to detect these obstacles use a method based on ultrasounds, as their sense of hearing is much more developed than that of sight. The aim of the project is to design and build a device based on the method used by the bats to detect obstacles and transmit this information to people with vision problems to improve the...

  17. Saccharomyces cerevisiae Bat1 and Bat2 aminotransferases have functionally diverged from the ancestral-like Kluyveromyces lactis orthologous enzyme.

    Directory of Open Access Journals (Sweden)

    Maritrini Colón

    Full Text Available BACKGROUND: Gene duplication is a key evolutionary mechanism providing material for the generation of genes with new or modified functions. The fate of duplicated gene copies has been amply discussed and several models have been put forward to account for duplicate conservation. The specialization model considers that duplication of a bifunctional ancestral gene could result in the preservation of both copies through subfunctionalization, resulting in the distribution of the two ancestral functions between the gene duplicates. Here we investigate whether the presumed bifunctional character displayed by the single branched chain amino acid aminotransferase present in K. lactis has been distributed in the two paralogous genes present in S. cerevisiae, and whether this conservation has impacted S. cerevisiae metabolism. PRINCIPAL FINDINGS: Our results show that the KlBat1 orthologous BCAT is a bifunctional enzyme, which participates in the biosynthesis and catabolism of branched chain aminoacids (BCAAs. This dual role has been distributed in S. cerevisiae Bat1 and Bat2 paralogous proteins, supporting the specialization model posed to explain the evolution of gene duplications. BAT1 is highly expressed under biosynthetic conditions, while BAT2 expression is highest under catabolic conditions. Bat1 and Bat2 differential relocalization has favored their physiological function, since biosynthetic precursors are generated in the mitochondria (Bat1, while catabolic substrates are accumulated in the cytosol (Bat2. Under respiratory conditions, in the presence of ammonium and BCAAs the batbat2Δ double mutant shows impaired growth, indicating that Bat1 and Bat2 could play redundant roles. In K. lactis wild type growth is independent of BCAA degradation, since a Klbat1Δ mutant grows under this condition. CONCLUSIONS: Our study shows that BAT1 and BAT2 differential expression and subcellular relocalization has resulted in the distribution of the

  18. Saccharomyces cerevisiae Bat1 and Bat2 Aminotransferases Have Functionally Diverged from the Ancestral-Like Kluyveromyces lactis Orthologous Enzyme

    Science.gov (United States)

    Colón, Maritrini; Hernández, Fabiola; López, Karla; Quezada, Héctor; González, James; López, Geovani; Aranda, Cristina; González, Alicia

    2011-01-01

    Background Gene duplication is a key evolutionary mechanism providing material for the generation of genes with new or modified functions. The fate of duplicated gene copies has been amply discussed and several models have been put forward to account for duplicate conservation. The specialization model considers that duplication of a bifunctional ancestral gene could result in the preservation of both copies through subfunctionalization, resulting in the distribution of the two ancestral functions between the gene duplicates. Here we investigate whether the presumed bifunctional character displayed by the single branched chain amino acid aminotransferase present in K. lactis has been distributed in the two paralogous genes present in S. cerevisiae, and whether this conservation has impacted S. cerevisiae metabolism. Principal Findings Our results show that the KlBat1 orthologous BCAT is a bifunctional enzyme, which participates in the biosynthesis and catabolism of branched chain aminoacids (BCAAs). This dual role has been distributed in S. cerevisiae Bat1 and Bat2 paralogous proteins, supporting the specialization model posed to explain the evolution of gene duplications. BAT1 is highly expressed under biosynthetic conditions, while BAT2 expression is highest under catabolic conditions. Bat1 and Bat2 differential relocalization has favored their physiological function, since biosynthetic precursors are generated in the mitochondria (Bat1), while catabolic substrates are accumulated in the cytosol (Bat2). Under respiratory conditions, in the presence of ammonium and BCAAs the batbat2Δ double mutant shows impaired growth, indicating that Bat1 and Bat2 could play redundant roles. In K. lactis wild type growth is independent of BCAA degradation, since a Klbat1Δ mutant grows under this condition. Conclusions Our study shows that BAT1 and BAT2 differential expression and subcellular relocalization has resulted in the distribution of the biosynthetic and catabolic

  19. Prevalence of tick-borne encephalitis virus in Ixodes ricinus ticks in northern Europe with particular reference to Southern Sweden

    Science.gov (United States)

    2014-01-01

    Background In northern Europe, the tick-borne encephalitis virus (TBEV) of the European subtype is usually transmitted to humans by the common tick Ixodes ricinus. The aims of the present study are (i) to obtain up-to-date information on the TBEV prevalence in host-seeking I. ricinus in southern and central Sweden; (ii) to compile and review all relevant published records on the prevalence of TBEV in ticks in northern Europe; and (iii) to analyse and try to explain how the TBE virus can be maintained in natural foci despite an apparently low TBEV infection prevalence in the vector population. Methods To estimate the mean minimum infection rate (MIR) of TBEV in I. ricinus in northern Europe (i.e. Denmark, Norway, Sweden and Finland) we reviewed all published TBEV prevalence data for host-seeking I. ricinus collected during 1958–2011. Moreover, we collected 2,074 nymphs and 906 adults of I. ricinus from 29 localities in Sweden during 2008. These ticks were screened for TBEV by RT-PCR. Results The MIR for TBEV in nymphal and adult I. ricinus was 0.28% for northern Europe and 0.23% for southern Sweden. The infection prevalence of TBEV was significantly lower in nymphs (0.10%) than in adult ticks (0.55%). At a well-known TBEV-endemic locality, Torö island south-east of Stockholm, the TBEV prevalence (MIR) was 0.51% in nymphs and 4.48% in adults of I. ricinus. Conclusions If the ratio of nymphs to adult ticks in the TBEV-analysed sample differs from that in the I. ricinus population in the field, the MIR obtained will not necessarily reflect the TBEV prevalence in the field. The relatively low TBEV prevalence in the potential vector population recorded in most studies may partly be due to: (i) inclusion of uninfected ticks from the ‘uninfected areas’ surrounding the TBEV endemic foci; (ii) inclusion of an unrepresentative, too large proportion of immature ticks, compared to adult ticks, in the analysed tick pools; and (iii) shortcomings in the laboratory

  20. Education to Action: Improving Public Perception of Bats

    Directory of Open Access Journals (Sweden)

    Eric Hoffmaster

    2016-01-01

    Full Text Available Public perception of bats has historically been largely negative with bats often portrayed as carriers of disease. Bats are commonly associated with vampire lore and thus elicit largely fearful reactions despite the fact that they are a vital and valuable part of the ecosystem. Bats provide a variety of essential services from pest control to plant pollination. Despite the benefits of bats to the environment and the economy, bats are suffering at the hands of humans. They are victims of turbines, human encroachment, pesticides, and, most recently, white nose syndrome. Because of their critical importance to the environment, humans should do what they can to help protect bats. We propose that humans will be more likely to do so if their perceptions and attitudes toward bats can be significantly improved. In a preliminary study we found some support for the idea that people can be educated about bats through bat oriented events and exhibits, and that this greater knowledge can inspire humans to act to save bats.

  1. [Trematodes (Trematoda) of bats (Chiroptera) from the Middle Volga Region].

    Science.gov (United States)

    Kirillov, A A; Kirillova, N Iu; Vekhnik, V P

    2012-01-01

    The data on species diversity of trematodes from bats collected in the Middle Volga Region are summarized. According to original and literary data, 20 trematode species were recorded in bats of the region examined. Plagiorchis elegans, Lecithodendrium skrjabini, L. rysavyi, Prosthodendrium hurkovaae, and Pycnoporus megacotyle are specified for the bat fauna of Russia for the first time. For 11 species of parasites, new hosts are recorded. The analysis of bat helminthes demonstrated that the fauna of trematodes of the northern bat (12 species of trematodes), of the pond, and of the Brandt's bats is the most diverse, constituting more than 10 parasite species per bat species. The largest number of final hosts in the Middle Volga Region is characteristic of Plagiorchis koreanus and Prosthodendrium chilostomum; the latter species were revealed in 8 and 7 bat species, respectively. Trematodes of bats possess a high degree of host specificity. 17 species parasitize exclusively in bats out of 20 parasite species registered for the order Chiroptera. Only 3 species (Plagiorchis elegans, P. vespertilionis, and Prosthodendrium chilostomum) show wide degree of specificity, being found in other animals. Taxonomic position, the circle of hosts, collecting sites, and brief data in biology and geographical distribution for each helminth species are specified. Morphological descriptions and original figures for all the trematode species revealed in bats of the Middle Volga Region are given.

  2. Novel Bartonella Species in Insectivorous Bats, Northern China.

    Directory of Open Access Journals (Sweden)

    Hui-Ju Han

    Full Text Available Bartonella species are emerging human pathogens. Bats are known to carry diverse Bartonella species, some of which are capable of infecting humans. However, as the second largest mammalian group by a number of species, the role of bats as the reservoirs of Bartonella species is not fully explored, in term of their species diversity and worldwide distribution. China, especially Northern China, harbors a number of endemic insectivorous bat species; however, to our knowledge, there are not yet studies about Bartonella in bats in China. The aim of the study was to investigate the prevalence and genetic diversity of Bartonella species in bats in Northern China. Bartonella species were detected by PCR amplification of gltA gene in 25.2% (27/107 bats in Mengyin County, Shandong Province of China, including 1/3 Rhinolophus ferrumequinum, 2/10 Rhinolophus pusillus, 9/16 Myotis fimbriatus, 1/5 Myotis ricketti, 14/58 Myotis pequinius. Phylogenetic analysis showed that Bartonella species detected in bats in this study clustered into ten groups, and some might be novel Bartonella species. An association between Bartonella species and bat species was demonstrated and co-infection with different Bartonella species in a single bat was also observed. Our findings expanded our knowledge on the genetic diversity of Bartonella in bats, and shed light on the ecology of bat-borne Bartonella species.

  3. Nonecholocating fruit bats produce biosonar clicks with their wings.

    Science.gov (United States)

    Boonman, Arjan; Bumrungsri, Sara; Yovel, Yossi

    2014-12-15

    Because evolution mostly acts over millions of years, the intermediate steps leading to a functional sensory system remain enigmatic. Accordingly, there is an ongoing debate regarding the evolution of bat echolocation. In search of the origin of bat echolocation, we studied how Old World fruit bats, which have always been classified as nonecholocating, orient in complete darkness. We found that two of these nonecholocating species used click-like sounds to detect and discriminate objects in complete darkness. However, we discovered that this click-based echo sensing is rudimentary and does not allow these bats to estimate distance accurately as all other echolocating bats can. Moreover, unlike all other echolocating bats, which generate pulses using the larynx or the tongue, these bats generated clicks with their wings. We provide evidence suggesting that all Old World fruit bats can click with their wings. Although this click-based echo sensing used by Old World fruit bats may not represent the ancestral form of current (laryngeal) bat echolocation, we argue that clicking fruit bats could be considered behavioral fossils, opening a window to study the evolution of echolocation. Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. A bony connection signals laryngeal echolocation in bats.

    Science.gov (United States)

    Veselka, Nina; McErlain, David D; Holdsworth, David W; Eger, Judith L; Chhem, Rethy K; Mason, Matthew J; Brain, Kirsty L; Faure, Paul A; Fenton, M Brock

    2010-02-18

    Echolocation is an active form of orientation in which animals emit sounds and then listen to reflected echoes of those sounds to form images of their surroundings in their brains. Although echolocation is usually associated with bats, it is not characteristic of all bats. Most echolocating bats produce signals in the larynx, but within one family of mainly non-echolocating species (Pteropodidae), a few species use echolocation sounds produced by tongue clicks. Here we demonstrate, using data obtained from micro-computed tomography scans of 26 species (n = 35 fluid-preserved bats), that proximal articulation of the stylohyal bone (part of the mammalian hyoid apparatus) with the tympanic bone always distinguishes laryngeally echolocating bats from all other bats (that is, non-echolocating pteropodids and those that echolocate with tongue clicks). In laryngeally echolocating bats, the proximal end of the stylohyal bone directly articulates with the tympanic bone and is often fused with it. Previous research on the morphology of the stylohyal bone in the oldest known fossil bat (Onychonycteris finneyi) suggested that it did not echolocate, but our findings suggest that O. finneyi may have used laryngeal echolocation because its stylohyal bones may have articulated with its tympanic bones. The present findings reopen basic questions about the timing and the origin of flight and echolocation in the early evolution of bats. Our data also provide an independent anatomical character by which to distinguish laryngeally echolocating bats from other bats.

  5. Assessing the impacts of wind energy development on bats

    Energy Technology Data Exchange (ETDEWEB)

    Arnett, E.B. [Bat Conservation International, Austin, TX (United States)

    2008-07-01

    Research conducted by the Bats and Wind Energy Cooperative in West Virginia was presented. Bats are key pollinators, seed dispersers, and insect predators. Bats also help to protect crops and play an important role in helping to reduce pesticide use. However, bats reproduce slowly and are susceptible to mortality factors. In 2003, between 1398 and 4031 bats were killed at the Mountaineer Wind Energy Facility in West Virginia. Possible explanations why bats are killed by wind turbines include the fact that wind farms form a linear corridor. Acoustics, echolocation failure, and electromagnetic-disorientation may also play a role in bat mortalities. Unifying patterns of bat fatalities at wind facilities include the fact that fatalities are heavily skewed toward migratory bats. Peak turbine collision fatalities occur in mid-summer. Bat fatalities are highest during periods of low wind speed and seem to be related to climate variables associated with the passage of weather fronts. Studies have also shown that the changing cut-in speeds of turbines may also reduce bat fatalities. It was concluded that pre-construction assessments should be conducted to determine high risk areas. tabs., figs.

  6. Echolocating bats cry out loud to detect their prey

    DEFF Research Database (Denmark)

    Surlykke, Annemarie; Kalko, Elisabeth K V

    2008-01-01

    Echolocating bats have successfully exploited a broad range of habitats and prey. Much research has demonstrated how time-frequency structure of echolocation calls of different species is adapted to acoustic constraints of habitats and foraging behaviors. However, the intensity of bat calls has...... been largely neglected although intensity is a key factor determining echolocation range and interactions with other bats and prey. Differences in detection range, in turn, are thought to constitute a mechanism promoting resource partitioning among bats, which might be particularly important...... for the species-rich bat assemblages in the tropics. Here we present data on emitted intensities for 11 species from 5 families of insectivorous bats from Panamá hunting in open or background cluttered space or over water. We recorded all bats in their natural habitat in the field using a multi-microphone array...

  7. BAT2 GRB Catalog - Prompt Emission Properties of Swift GRBs

    International Nuclear Information System (INIS)

    Sakamoto, T.; Barthelmy, S.; Gehrels, N.; Parsons, A.; Tueller, J.; Baumgartner, W.; Cummings, J.; Fenimore, E.; Palmer, D.; Krimm, H.; Markwardt, C.; Sato, G.; Stamatikos, M.; Ukwatta, T.

    2010-01-01

    We present the second Swift Burst Alert Telescope (BAT) catalog of gamma-ray bursts (GRBs), which contains 476 bursts detected by the BAT between 2004 December 19 and 2009 December 21. This catalog presents burst trigger time, location, 90% error radius, duration, fluence, peak flux, time-averaged spectral parameters and time-resolved spectral parameters measured by the BAT. The BAT T 90 duration peaks at 70 s. We confirm that the spectra of the BAT short-duration GRBs are generally harder than those of the long-duration GRBs. The observed durations of the BAT high redshift GRBs are not systematically longer than those of the moderate redshift GRBs. Furthermore, the observed spectra of the BAT high redshift GRBs are similar to or harder than the moderate redshift GRBs.

  8. The distribution of the bats of South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Menzel, Jennifer M. [USDA Forest Service, Parsons, WV (United States); Menzel, Michael A. [West Virginia Univ., Morgantown, WV (United States); Ford, W. Mark [USDA Forest Service, Parsons, WV (United States); Edwards, John W. [West Virginia Univ., Morgantown, WV (United States); Sheffield, Steven R. [George Mason Univ., Fairfax, VA (United States); Kilgo, John C. [USDA Forest Service, New Ellenton, SC (United States); Bunch, Mary S. [South Carolina Dept. of Natural Resources, Pendleton, SC (United States)

    2003-03-01

    Menzel. J.M., M.A. Menzel, W.M. Ford, J.W. Edwards, S.R. Sheffield, J.C. Kilgo, and M.S. Bunch. 2003. The distribution of the bats of South Carolina. Southeastern Nat. 2(1): 121-152. There is a paucity of information available about the distribution of bats in the southeastern United States. We synthesized records from museums, bat captures, and bats submitted for rabies testing to provide a more accurate and useful distribution for natural resource managers and those planning to research bats in South Carolina. Distributional information, including maps, collection localities within counties, and literature references, for all 14 species of bats that occur in South Carolina, has never been synthesized. To provide better information on the state's bat fauna, we have updated distributions for all species that occur in South Carolina.

  9. Cave- and Crevice-Dwelling Bats on USACE Projects: Townsend's Big-Eared Bat (Corynorhinus townsendii)

    National Research Council Canada - National Science Library

    Mitchell, Wilma

    2002-01-01

    ..." (Dickerson, Martin, and Allen 1999; Kasul, Martin, and Allen 2000). This technical note provides information on selected bat species that have the potential to occur on Corps projects in the eastern United States and be impacted by Corps activities...

  10. Anaplasma phagocytophilum and Anaplasma marginale Elicit Different Gene Expression Responses in Cultured Tick Cells

    Directory of Open Access Journals (Sweden)

    Zorica Zivkovic

    2009-01-01

    Full Text Available The genus Anaplasma (Rickettsiales: Anaplasmataceae includes obligate tick-transmitted intracellular organisms, Anaplasma phagocytophilum and Anaplasma marginale that multiply in both vertebrate and tick host cells. Recently, we showed that A. marginale affects the expression of tick genes that are involved in tick survival and pathogen infection and multiplication. However, the gene expression profile in A. phagocytophilum-infected tick cells is currently poorly characterized. The objectives of this study were to characterize tick gene expression profile in Ixodes scapularis ticks and cultured ISE6 cells in response to infection with A. phagocypthilum and to compare tick gene expression responses in A. phagocytophilum- and A. marginale-infected tick cells by microarray and real-time RT-PCR analyses. The results of these studies demonstrated modulation of tick gene expression by A. phagocytophilum and provided evidence of different gene expression responses in tick cells infected with A. phagocytophilum and A. marginale. These differences in Anaplasma-tick interactions may reflect differences in pathogen life cycle in the tick cells.

  11. Tick infestation on roe deer in relation to geographic and remotely sensed climatic variables in a tick-borne encephalitis endemic area.

    Science.gov (United States)

    Carpi, G; Cagnacci, F; Neteler, M; Rizzoli, A

    2008-10-01

    Roe deer Capreolus capreolus are among the most important feeding hosts for the sheep tick Ixodes ricinus, thus contributing to the occurrence of tick-borne diseases in Europe. Tick-borne encephalitis (TBE), which is transmitted by co-feeding of larvae and nymphs on rodents, requires precise climatic conditions to occur. We used roe deer as sentinels for potential circulation of TBE virus in Northern Italy, by examining the association between tick infestation, occurrence of TBE human cases, geographical and climatic parameters. Tick infestation on roe deer, and particularly frequency of co-feeding, was clearly associated with the geographic location and the autumnal cooling rate. Consistently, TBE occurrence in humans was geographically related to co-feeding tick abundance. The surveillance of tick infestation on roe deer, combined with remotely sensed climatic data, could therefore be used as an inexpensive early risk assessment tool of favourable conditions for TBE emergence and persistence in humans.

  12. Molecular identification of tick-borne pathogens in ticks collected from dogs and small ruminants from Greece.

    Science.gov (United States)

    Chaligiannis, Ιlias; Fernández de Mera, Isabel G; Papa, Anna; Sotiraki, Smaragda; de la Fuente, José

    2018-03-07

    Ticks are vectors for a variety of human and animal pathogens (bacteria, protozoa and viruses). In order to investigate the pathogens carried by ticks in Greece, a total of 179 adult ticks (114 female and 65 male) were collected from domestic animals (sheep, goats and dogs) from 14 prefectures of six regions of Greece. Among them, 40 were Dermacentor marginatus, 25 Haemaphysalis parva, 22 H. sulcata, one H. punctata, 13 Ixodes gibbosus, 77 Rhipicephalus sanguineus s.l. and one R. bursa. All ticks were tested for the presence of DNA of Anaplasma spp., Babesia spp., Coxiella burnetii, Rickettsia spp. and Theileria spp. The collected ticks were examined by PCR and reverse line blot (RLB) assay. A prevalence of 20.1% for Anaplasma spp., 15.6% for Babesia spp. (identifying B. bigemina, B. divergens, B. ovis and B. crassa), 17.9% for C. burnetii, 15.1% for Rickettsia spp., and 21.2% for Theileria spp. (identifying T. annulata, T. buffeli/orientalis, T. ovis and T. lestoquardi) was found. The results of this study demonstrate the variety of tick-borne pathogens of animal and human importance circulating in Greece, and that awareness is needed to minimize the risk of infection, especially among farmers and pet owners.

  13. Pathogenesis of bat rabies in a natural reservoir: Comparative susceptibility of the straw-colored fruit bat (Eidolon helvum) to three strains of Lagos bat virus.

    Science.gov (United States)

    Suu-Ire, Richard; Begeman, Lineke; Banyard, Ashley C; Breed, Andrew C; Drosten, Christian; Eggerbauer, Elisa; Freuling, Conrad M; Gibson, Louise; Goharriz, Hooman; Horton, Daniel L; Jennings, Daisy; Kuzmin, Ivan V; Marston, Denise; Ntiamoa-Baidu, Yaa; Riesle Sbarbaro, Silke; Selden, David; Wise, Emma L; Kuiken, Thijs; Fooks, Anthony R; Müller, Thomas; Wood, James L N; Cunningham, Andrew A

    2018-03-01

    Rabies is a fatal neurologic disease caused by lyssavirus infection. People are infected through contact with infected animals. The relative increase of human rabies acquired from bats calls for a better understanding of lyssavirus infections in their natural hosts. So far, there is no experimental model that mimics natural lyssavirus infection in the reservoir bat species. Lagos bat virus is a lyssavirus that is endemic in straw-colored fruit bats (Eidolon helvum) in Africa. Here we compared the susceptibility of these bats to three strains of Lagos bat virus (from Senegal, Nigeria, and Ghana) by intracranial inoculation. To allow comparison between strains, we ensured the same titer of virus was inoculated in the same location of the brain of each bat. All bats (n = 3 per strain) were infected, and developed neurological signs, and fatal meningoencephalitis with lyssavirus antigen expression in neurons. There were three main differences among the groups. First, time to death was substantially shorter in the Senegal and Ghana groups (4 to 6 days) than in the Nigeria group (8 days). Second, each virus strain produced a distinct clinical syndrome. Third, the spread of virus to peripheral tissues, tested by hemi-nested reverse transcriptase PCR, was frequent (3 of 3 bats) and widespread (8 to 10 tissues positive of 11 tissues examined) in the Ghana group, was frequent and less widespread in the Senegal group (3/3 bats, 3 to 6 tissues positive), and was rare and restricted in the Nigeria group (1/3 bats, 2 tissues positive). Centrifugal spread of virus from brain to tissue of excretion in the oral cavity is required to enable lyssavirus transmission. Therefore, the Senegal and Ghana strains seem most suitable for further pathogenesis, and for transmission, studies in the straw-colored fruit bat.

  14. Human betacoronavirus 2c EMC/2012-related viruses in bats, Ghana and Europe.

    Science.gov (United States)

    Annan, Augustina; Baldwin, Heather J; Corman, Victor Max; Klose, Stefan M; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K V; Lina, Peter H C; Godlevska, Elena V; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix

    2013-03-01

    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats.

  15. Human Betacoronavirus 2c EMC/2012–related Viruses in Bats, Ghana and Europe

    Science.gov (United States)

    Annan, Augustina; Baldwin, Heather J.; Corman, Victor Max; Klose, Stefan M.; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K.V.; Lina, Peter H.C.; Godlevska, Elena V.; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian

    2013-01-01

    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats. PMID:23622767

  16. Skin and fur bacterial diversity and community structure on American southwestern bats: effects of habitat, geography and bat traits.

    Science.gov (United States)

    Winter, Ara S; Hathaway, Jennifer J M; Kimble, Jason C; Buecher, Debbie C; Valdez, Ernest W; Porras-Alfaro, Andrea; Young, Jesse M; Read, Kaitlyn J H; Northup, Diana E

    2017-01-01

    Microorganisms that reside on and in mammals, such as bats, have the potential to influence their host's health and to provide defenses against invading pathogens. However, we have little understanding of the skin and fur bacterial microbiota on bats, or factors that influence the structure of these communities. The southwestern United States offers excellent sites for the study of external bat bacterial microbiota due to the diversity of bat species, the variety of abiotic and biotic factors that may govern bat bacterial microbiota communities, and the lack of the newly emergent fungal disease in bats, white-nose syndrome (WNS), in the southwest. To test these variables, we used 16S rRNA gene 454 pyrosequencing from swabs of external skin and fur surfaces from 163 bats from 13 species sampled from southeastern New Mexico to northwestern Arizona. Community similarity patterns, random forest models, and generalized linear mixed-effects models show that factors such as location (e.g., cave-caught versus surface-netted) and ecoregion are major contributors to the structure of bacterial communities on bats. Bats caught in caves had a distinct microbial community compared to those that were netted on the surface. Our results provide a first insight into the distribution of skin and fur bat bacteria in the WNS-free environment of New Mexico and Arizona. More importantly, it provides a baseline of bat external microbiota that can be explored for potential natural defenses against pathogens.

  17. Bat Accelerated Regions Identify a Bat Forelimb Specific Enhancer in the HoxD Locus.

    Directory of Open Access Journals (Sweden)

    Betty M Booker

    2016-03-01

    Full Text Available The molecular events leading to the development of the bat wing remain largely unknown, and are thought to be caused, in part, by changes in gene expression during limb development. These expression changes could be instigated by variations in gene regulatory enhancers. Here, we used a comparative genomics approach to identify regions that evolved rapidly in the bat ancestor, but are highly conserved in other vertebrates. We discovered 166 bat accelerated regions (BARs that overlap H3K27ac and p300 ChIP-seq peaks in developing mouse limbs. Using a mouse enhancer assay, we show that five Myotis lucifugus BARs drive gene expression in the developing mouse limb, with the majority showing differential enhancer activity compared to the mouse orthologous BAR sequences. These include BAR116, which is located telomeric to the HoxD cluster and had robust forelimb expression for the M. lucifugus sequence and no activity for the mouse sequence at embryonic day 12.5. Developing limb expression analysis of Hoxd10-Hoxd13 in Miniopterus natalensis bats showed a high-forelimb weak-hindlimb expression for Hoxd10-Hoxd11, similar to the expression trend observed for M. lucifugus BAR116 in mice, suggesting that it could be involved in the regulation of the bat HoxD complex. Combined, our results highlight novel regulatory regions that could be instrumental for the morphological differences leading to the development of the bat wing.

  18. Echolocation The Strange Ways of Bats

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 5. Echolocation The Strange Ways of Bats. G Marimuthu. General Article Volume 1 Issue 5 May 1996 pp 40-48. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/001/05/0040-0048. Author Affiliations.

  19. Analysis of bat wings for morphing

    Science.gov (United States)

    Leylek, Emily A.; Manzo, Justin E.; Garcia, Ephrahim

    2008-03-01

    The morphing of wings from three different bat species is studied using an extension of the Weissinger method. To understand how camber affects performance factors such as lift and lift to drag ratio, XFOIL is used to study thin (3% thickness to chord ratio) airfoils at a low Reynolds number of 100,000. The maximum camber of 9% yielded the largest lift coefficient, and a mid-range camber of 7% yielded the largest lift to drag ratio. Correlations between bat wing morphology and flight characteristics are covered, and the three bat wing planforms chosen represent various combinations of morphological components and different flight modes. The wings are studied using the extended Weissinger method in an "unmorphed" configuration using a thin, symmetric airfoil across the span of the wing through angles of attack of 0°-15°. The wings are then run in the Weissinger method at angles of attack of -2° to 12° in a "morphed" configuration modeled after bat wings seen in flight, where the camber of the airfoils comprising the wings is varied along the span and a twist distribution along the span is introduced. The morphed wing configurations increase the lift coefficient over 1000% from the unmorphed configuration and increase the lift to drag ratio over 175%. The results of the three different species correlate well with their flight in nature.

  20. Economic dispatch using chaotic bat algorithm

    International Nuclear Information System (INIS)

    Adarsh, B.R.; Raghunathan, T.; Jayabarathi, T.; Yang, Xin-She

    2016-01-01

    This paper presents the application of a new metaheuristic optimization algorithm, the chaotic bat algorithm for solving the economic dispatch problem involving a number of equality and inequality constraints such as power balance, prohibited operating zones and ramp rate limits. Transmission losses and multiple fuel options are also considered for some problems. The chaotic bat algorithm, a variant of the basic bat algorithm, is obtained by incorporating chaotic sequences to enhance its performance. Five different example problems comprising 6, 13, 20, 40 and 160 generating units are solved to demonstrate the effectiveness of the algorithm. The algorithm requires little tuning by the user, and the results obtained show that it either outperforms or compares favorably with several existing techniques reported in literature. - Highlights: • The chaotic bat algorithm, a new metaheuristic optimization algorithm has been used. • The problem solved – the economic dispatch problem – is nonlinear, discontinuous. • It has number of equality and inequality constraints. • The algorithm has been demonstrated to be applicable on high dimensional problems.

  1. Echolocation The Strange Ways of Bats

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 5. Echolocation The Strange Ways of Bats. G Marimuthu. General Article Volume 1 Issue 5 May 1996 pp 40-48. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/05/0040-0048. Author Affiliations.

  2. The distribution of bats in The Netherlands

    NARCIS (Netherlands)

    Braaksma, S.

    1970-01-01

    The Research Institute for Nature Management (R.I.N.) has compiled all available information on the distribution of bats in the Netherlands up till 1968. The data were derived from literature and museum specimens, as well as from numerous unpublished observations. Around 1960 much was known already

  3. Bats, Blood-Feeders and Biodiversity

    DEFF Research Database (Denmark)

    Bohmann, Kristine

    minimising the occurrence of errors. Centered around metabarcoding dietary studies of bat droppings and leech gut contents, this continuous exploration and refinement is reflected in both the work and structure of this thesis. After a thesis introduction and two chapters on environmental DNA and biodiversity...

  4. Summer ecology of Indiana bats in Ohio.

    Science.gov (United States)

    2011-05-01

    The Indiana bat (Myotis sodalis) is a tree roosting species found throughout the eastern United States that is federally listed as endangered by the U.S. Fish and Wildlife Service. A more detailed understanding of summer roosting and foraging habitat...

  5. Neurophysiological analysis of echolocation in bats

    Science.gov (United States)

    Suga, N.

    1972-01-01

    An analysis of echolocation and signal processing in brown bats is presented. Data cover echo detection, echo ranging, echolocalization, and echo analysis. Efforts were also made to identify the part of the brain that carries out the most essential processing function for echolocation. Results indicate the inferior colliculus and the auditory nuclei function together to process this information.

  6. The innervation of the bat cochlea

    NARCIS (Netherlands)

    Firbas, Wilhelm

    1970-01-01

    For different species of bats, fixed in 5 % formaldehyd, an estimation of the number of neurons in the spiral ganglion was made. The cochleae were decalcified in EDTA and embedded in paraffin. The complete series of sections were stained with hematoxylin. On the sections through the ganglion, the

  7. Hibernation by tree-roosting bats.

    Science.gov (United States)

    Turbill, Christopher; Geiser, Fritz

    2008-07-01

    In summer, long-eared bats (Nyctophilus spp.) roost under bark and in tree cavities, where they appear to benefit from diurnal heating of roosts. In contrast, hibernation is thought to require a cool stable temperature, suggesting they should prefer thermally insulated tree cavities during winter. To test this prediction, we quantified the winter thermoregulatory physiology and ecology of hibernating tree-roosting bats, Nyctophilus geoffroyi and N. gouldi in the field. Surprisingly, bats in winter continued to roost under exfoliating bark (65%) on the northern, sunny side of trees and in shallow tree cavities (35%). Despite passive re-warming of torpid bats by 10-20 degrees C per day, torpor bouts lasted up to 15 days, although shorter bouts were also common. Arousals occurred more frequently and subsequent activity lasted longer on warmer nights, suggesting occasional winter foraging. We show that, because periodic arousals coincide with maximum roost temperatures, when costs of rewarming and normothermic thermoregulation are minimal, exposure to a daily temperature cycle could largely reduce energy expenditure during hibernation. Our study provides further evidence that models of torpor patterns and energy expenditure from hibernators in cold temperate climates are not directly applicable in milder climates, where prolonged torpor can be interspersed with more frequent arousals and occasional foraging.

  8. Bat records from Malawi (Mammalia, Chiroptera)

    NARCIS (Netherlands)

    Bergmans, Wim; Jachmann, Hugo

    1983-01-01

    Five species of bats are recorded from Kasungu National Park, Malawi: Eidolon helvum (Kerr, 1792); Epomophorus anurus Heuglin, 1864; Epomophorus minor Dobson, 1880; Epomops dobsonii (Bocage, 1889); and Scotoecus hindei Thomas, 1901. Some other Malawian records of these species, based on literature

  9. Fire and the endangered Indiana bat

    Science.gov (United States)

    Matthew B. Dickinson; Michael J. Lacki; Daniel R. Cox

    2009-01-01

    Fire and Indiana bats (Myotis sodalis) have coexisted for millennia in the central hardwoods region, yet past declines in populations of this endangered species, and the imperative of fire use in oak silviculture and ecosystem conservation, call for an analysis of both the risks and opportunities associated with using fires on landscapes in...

  10. One-Humped Camels (Camelus dromedaries Hard Ticks Infestation in Qeshm Island, Iran

    Directory of Open Access Journals (Sweden)

    Saeed Nazifi

    2011-06-01

    Full Text Available The economic importance of tick infestation on camels are important as they are important meat and milk producer animals in the less vegetation area of Iran and their health and production are greatly affected by the high tick infestation. In this investigation, tick infestations on camels (Camelus dromedarius were determined in Qeshm Island, Iran. A total number of 912 adult ticks (472 males and 440 females were collected and identified. Hyalomma dromedarii was the predominant tick specie and accounted for 61.9% of the adult ticks. Other hard ticks were H. anatolicum excavatum (22 %, H. asiaticum asiaticum (14.2 %, H. marginatum (1.9 %, H. impeltatum (0.4 % and Ripicephalus bursa (0.4 %. In conclusion, The provision of tick control programs in the Qeshm Island would seem a prerequisite for improving camel meat and milk production.

  11. Reducing the Risk of Tick-Borne Diseases through Smart, Safe and Sustainable Pest Control

    Science.gov (United States)

    Each year PestWise programs form new partnerships to address ongoing and emerging issues. Reducing the risk from ticks and tick-borne disease is an issue of importance and EPA is contributing to a larger federal effort.

  12. Molecular characterization of novel sulfotransferases from the tick, Ixodes scapularis

    Directory of Open Access Journals (Sweden)

    King Roberta S

    2011-06-01

    Full Text Available Abstract Background Ixodes scapularis, commonly known as the blacklegged or deer tick, is the main vector of Lyme disease in the United States. Recent progress in transcriptome research has uncovered hundreds of different proteins expressed in the salivary glands of hard ticks, the majority of which have no known function, and include many novel protein families. We recently identified transcripts coding for two putative cytosolic sulfotransferases in these ticks which recognized phenolic monoamines as their substrates. In this current study, we characterize the genetic expression of these two cytosolic sulfotransferases throughout the tick life cycle as well as the enzymatic properties of the corresponding recombinant proteins. Interestingly, the resultant recombinant proteins showed sulfotransferase activity against both neurotransmitters dopamine and octopamine. Results The two sulfotransferase genes were coded as Ixosc SULT 1 & 2 and corresponding proteins were referred as Ixosc Sult 1 and 2. Using gene-specific primers, the sulfotransferase transcripts were detected throughout the blacklegged tick life cycle, including eggs, larvae, nymphs, adult salivary glands and adult midgut. Notably, the mRNA and protein levels were altered upon feeding during both the larval and nymphal life stages. Quantitative PCR results confirm that Ixosc SULT1 was statistically increased upon blood feeding while Ixosc SULT 2 was decreased. This altered expression led us to further characterize the function of these proteins in the Ixodid tick. The sulfotransferase genes were cloned and expressed in a bacterial expression system, and purified recombinant proteins Ixosc Sult 1(R and 2(R showed sulfotransferase activity against neurotransmitters dopamine and octopamine as well as the common sulfotransferase substrate p-nitrophenol. Thus, dopamine- or octopamine-sulfonation may be involved in altering the biological signal for salivary secretion in I. scapularis

  13. Host body size and the diversity of tick assemblages on Neotropical vertebrates

    Directory of Open Access Journals (Sweden)

    Helen J. Esser

    2016-12-01

    Full Text Available Identifying the factors that influence the species diversity and distribution of ticks (Acari: Ixodida across vertebrate host taxa is of fundamental ecological and medical importance. Host body size is considered one of the most important determinants of tick abundance, with larger hosts having higher tick burdens. The species diversity of tick assemblages should also be greater on larger-bodied host species, but empirical studies testing this hypothesis are lacking. Here, we evaluate this relationship using a comparative dataset of feeding associations from Panama between 45 tick species and 171 host species that range in body size by three orders of magnitude. We found that tick species diversity increased with host body size for adult ticks but not for immature ticks. We also found that closely related host species tended to have similar tick species diversity, but correcting for host phylogeny did not alter the relationships between host body size and tick species diversity. The distribution of tick species was highly aggregated, with approximately 20% of the host species harboring 80% of all tick species, following the Pareto principle or 20/80 Rule. Thus, the aggregated pattern commonly observed for tick burdens and disease transmission also holds for patterns of tick species richness. Our finding that the adult ticks in this system preferentially parasitize large-bodied host species suggests that the ongoing anthropogenic loss of large-bodied vertebrates is likely to result in host-tick coextinction events, even when immature stages feed opportunistically. As parasites play critical roles in ecological and evolutionary processes, such losses may profoundly affect ecosystem functioning and services.

  14. Bats are rare reservoirs of Staphylococcus aureus complex in Gabon.

    Science.gov (United States)

    Held, Jana; Gmeiner, Markus; Mordmüller, Benjamin; Matsiégui, Pierre-Blaise; Schaer, Juliane; Eckerle, Isabella; Weber, Natalie; Matuschewski, Kai; Bletz, Stefan; Schaumburg, Frieder

    2017-01-01

    The colonization of afro-tropical wildlife with Staphylococcus aureus and the derived clade Staphylococcus schweitzeri remains largely unknown. A reservoir in bats could be of importance since bats and humans share overlapping habitats. In addition, bats are food sources in some African regions and can be the cause of zoonotic diseases. Here, we present a cross-sectional survey employing pharyngeal swabs of captured and released bats (n=133) in a forest area of Gabon. We detected low colonization rates of S. aureus (4-6%) and S. schweitzeri (4%) in two out of four species of fruit bats, namely Rousettus aegyptiacus and Micropteropus pusillus, but not in insectivorous bats. Multilocus sequence typing showed that S. aureus from Gabonese bats (ST2984, ST3259, ST3301, ST3302) were distinct from major African human associated clones (ST15, ST121, ST152). S. schweitzeri from bats (ST1697, ST1700) clustered with S. schweitzeri from other species (bats, monkeys) from Nigeria and Côte d'Ivoire. In conclusion, colonization rates of bats with S. aureus and S. schweitzeri were low in our study. Phylogenetic analysis supports an intense geographical dispersal of S. schweitzeri among different mammalian wildlife hosts. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Timing matters: sonar call groups facilitate target localization in bats.

    Science.gov (United States)

    Kothari, Ninad B; Wohlgemuth, Melville J; Hulgard, Katrine; Surlykke, Annemarie; Moss, Cynthia F

    2014-01-01

    To successfully negotiate a cluttered environment, an echolocating bat must control the timing of motor behaviors in response to dynamic sensory information. Here we detail the big brown bat's adaptive temporal control over sonar call production for tracking prey, moving predictably or unpredictably, under different experimental conditions. We studied the adaptive control of vocal-motor behaviors in free-flying big brown bats, Eptesicus fuscus, as they captured tethered and free-flying insects, in open and cluttered environments. We also studied adaptive sonar behavior in bats trained to track moving targets from a resting position. In each of these experiments, bats adjusted the features of their calls to separate target and clutter. Under many task conditions, flying bats produced prominent sonar sound groups identified as clusters of echolocation pulses with relatively stable intervals, surrounded by longer pulse intervals. In experiments where bats tracked approaching targets from a resting position, bats also produced sonar sound groups, and the prevalence of these sonar sound groups increased when motion of the target was unpredictable. We hypothesize that sonar sound groups produced during flight, and the sonar call doublets produced by a bat tracking a target from a resting position, help the animal resolve dynamic target location and represent the echo scene in greater detail. Collectively, our data reveal adaptive temporal control over sonar call production that allows the bat to negotiate a complex and dynamic environment.

  16. Mercury accumulation in bats near hydroelectric reservoirs in Peninsular Malaysia.

    Science.gov (United States)

    Syaripuddin, Khairunnisa; Kumar, Anjali; Sing, Kong-Wah; Halim, Muhammad-Rasul Abdullah; Nursyereen, Muhammad-Nasir; Wilson, John-James

    2014-09-01

    In large man-made reservoirs such as those resulting from hydroelectric dam construction, bacteria transform the relatively harmless inorganic mercury naturally present in soil and the submerged plant matter into toxic methylmercury. Methylmercury then enters food webs and can accumulate in organisms at higher trophic levels. Bats feeding on insects emerging from aquatic systems can show accumulation of mercury consumed through their insect prey. In this study, we investigated whether the concentration of mercury in the fur of insectivorous bat species was significantly higher than that in the fur of frugivorous bat species, sampled near hydroelectric reservoirs in Peninsular Malaysia. Bats were sampled at Temenggor Lake and Kenyir Lake and fur samples from the most abundant genera of the two feeding guilds-insectivorous (Hipposideros and Rhinolophus) and frugivorous (Cynopterus and Megaerops) were collected for mercury analysis. We found significantly higher concentrations of total mercury in the fur of insectivorous bats. Mercury concentrations also differed significantly between insectivorous bats sampled at the two sites, with bats from Kenyir Lake, the younger reservoir, showing higher mercury concentrations, and between the insectivorous genera, with Hipposideros bats showing higher mercury concentrations. Ten bats (H. cf. larvatus) sampled at Kenyir Lake had mercury concentrations approaching or exceeding 10 mg/kg, which is the threshold at which detrimental effects occur in humans, bats and mice.

  17. Response of neotropical bat assemblages to human land use.

    Science.gov (United States)

    García-Morales, Rodrigo; Badano, Ernesto I; Moreno, Claudia E

    2013-10-01

    Neotropical bats are sensitive to human-induced habitat changes, and some authors believe bats can be used as bioindicators. In the literature, however, the results are disparate. Some results show bat diversity deceases as disturbance increases, whereas others indicate no effect. Determining the general response patterns of bats when they encounter different degrees of human-induced disturbance across the Neotropics would help to determine their usefulness as bioindicators. In a series of meta-analyses, we compared the occurrence frequency of bat species between well-preserved forests and human-use areas. We obtained data through an extensive review of published peer-reviewed articles, theses, and reports. The overall effect size indicated that human-use areas harbored more bat species than well-preserved forests. Different response patterns emerged when meta-analyses were conducted separately by family, feeding habit, vegetation stratum, and conservation status. Our results suggest that bat assemblages display strong responses to forest loss and land-use change and that the direction and magnitude of these responses depends on the bat group under study and the type of disturbance. Our results are consistent with the idea that bats are useful for assessing the effects of habitat changes in the Neotropics. However, with our meta-analyses we could not detect fine differences in bat feeding habits, especially within Phyllostomidae, or elucidate the effect of landscape configuration. © 2013 Society for Conservation Biology.

  18. A decade of U.S. Air Force bat strikes

    Science.gov (United States)

    Peurach, Suzanne C.; Dove, Carla J.; Stepko, Laura

    2009-01-01

    From 1997 through 2007, 821 bat strikes were reported to the U.S. Air Force (USAF) Safety Center by aircraft personnel or ground crew and sent to the National Museum of Natural History, Smithsonian Institution, for identification. Many samples were identified by macroscopic and or microscopic comparisons with bat specimens housed in the museum and augmented during the last 2 years by DNA analysis. Bat remains from USAF strikes during this period were received at the museum from 40 states in the United States and from 20 countries. We confirmed that 46% of the strikes were caused by bats, but we did not identify them further; we identified 5% only to the family or genus level, and 49% to the species level. Fifty-five of the 101 bat-strike samples submitted for DNA analysis have been identified to the species level. Twenty-five bat species have been recorded striking USAF planes worldwide. The Brazilian free-tailed bat (Tadarida brasiliensis; n = 173) is the species most commonly identified in USAF strike impacts, followed by the red bat (Lasiurus borealis; n = 83). Bat strikes peak during the spring and fall, with >57% occurring from August through October; 82% of the reports that included time of strike were recorded between 2100 and 0900 hours. More than 12% of the bat strikes were reported at >300 m above ground level (AGL). Although $825,000 and >50% of this sum was attributable to 5 bat-strike incidents. Only 5 bats from the 10 most damaging bat strikes were identified to the species level, either because we did not receive remains with the reports or the sample was insufficient for identification.

  19. In-vitro Acaricidal efficacy evaluation trial of Ixodid ticks at Borana ...

    African Journals Online (AJOL)

    perceptions on acaricide (usage, delivery and methods of tick control practice). Acaricide treatment is the only .... These ticks were placed individually in different plastic flasks prelabeled with time, date, place of collection .... Ticks affects livestock in general and cattle in particular by reducing milk production, growth and birth.

  20. Precise identification of different stages of a tick, Ixodes granulatus Supino, 1897 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Ernieenor Faraliana Che Lah

    2016-07-01

    Conclusions: These findings demonstrated for the first time the establishment of COI gene for identifying I. granulatus nymphal tick which is of paramount importance to the control of potential tick-borne infections in Malaysia. Moreover, this study provides evidence that a combination of morphology and molecular data was corroborated as an accurate tool for tick identification.

  1. Confirmation of Tick Bite by Detection of Antibody to Ixodes Calreticulin Salivary Protein▿

    Science.gov (United States)

    Alarcon-Chaidez, Francisco; Ryan, Raymond; Wikel, Stephen; Dardick, Kenneth; Lawler, Caroline; Foppa, Ivo M.; Tomas, Patricio; Cushman, Alexis; Hsieh, Ann; Spielman, Andrew; Bouchard, Keith R.; Dias, Filiciano; Aslanzadeh, Jaber; Krause, Peter J.

    2006-01-01

    Ticks introduce a variety of pharmacologically active molecules into their host during attachment and feeding in order to obtain a blood meal. People who are repeatedly exposed to ticks may develop an immune response to tick salivary proteins. Despite this response, people usually are unaware of having been bitten, especially if they are not repeatedly exposed to ticks. In order to develop a laboratory marker of tick exposure that would be useful in understanding the epidemiology of tick-borne infection and the immune response to tick bite, we developed an enzyme-linked immunosorbent assay (ELISA) to detect antibody to a recombinant form of calreticulin protein found in the salivary glands of Ixodes scapularis, a member of a complex of Ixodes ticks that serve as the vectors for Lyme disease, human babesiosis, and human granulocytic anaplasmosis. Using this assay, we tested sera obtained from C3H/HeN and BALB/c mice before and after experimental deer tick infestation. These mice developed antibody to Ixodes calreticulin antigen after infestation. We then used the same assay to test sera obtained from people before and after they experienced deer tick bite(s). People experiencing deer tick bite(s) developed Ixodes calreticulin-specific antibody responses that persisted for up to 17 months. This Ixodes recombinant calreticulin ELISA provides objective evidence of deer tick exposure in people. PMID:16928887

  2. Confirmation of tick bite by detection of antibody to Ixodes calreticulin salivary protein.

    Science.gov (United States)

    Alarcon-Chaidez, Francisco; Ryan, Raymond; Wikel, Stephen; Dardick, Kenneth; Lawler, Caroline; Foppa, Ivo M; Tomas, Patricio; Cushman, Alexis; Hsieh, Ann; Spielman, Andrew; Bouchard, Keith R; Dias, Filiciano; Aslanzadeh, Jaber; Krause, Peter J

    2006-11-01

    Ticks introduce a variety of pharmacologically active molecules into their host during attachment and feeding in order to obtain a blood meal. People who are repeatedly exposed to ticks may develop an immune response to tick salivary proteins. Despite this response, people usually are unaware of having been bitten, especially if they are not repeatedly exposed to ticks. In order to develop a laboratory marker of tick exposure that would be useful in understanding the epidemiology of tick-borne infection and the immune response to tick bite, we developed an enzyme-linked immunosorbent assay (ELISA) to detect antibody to a recombinant form of calreticulin protein found in the salivary glands of Ixodes scapularis, a member of a complex of Ixodes ticks that serve as the vectors for Lyme disease, human babesiosis, and human granulocytic anaplasmosis. Using this assay, we tested sera obtained from C3H/HeN and BALB/c mice before and after experimental deer tick infestation. These mice developed antibody to Ixodes calreticulin antigen after infestation. We then used the same assay to test sera obtained from people before and after they experienced deer tick bite(s). People experiencing deer tick bite(s) developed Ixodes calreticulin-specific antibody responses that persisted for up to 17 months. This Ixodes recombinant calreticulin ELISA provides objective evidence of deer tick exposure in people.

  3. 78 FR 44521 - Environmental Impact Statement; Proposed Cattle Fever Tick Control Barrier in South Texas

    Science.gov (United States)

    2013-07-24

    ...'') carry protozoan parasites that cause babesiosis. The disease and the cattle fever ticks were officially...] Environmental Impact Statement; Proposed Cattle Fever Tick Control Barrier in South Texas AGENCY: Animal and... result from installing game fencing as a barrier to keep animals that carry cattle fever ticks and...

  4. Bat detective-Deep learning tools for bat acoustic signal detection.

    Science.gov (United States)

    Mac Aodha, Oisin; Gibb, Rory; Barlow, Kate E; Browning, Ella; Firman, Michael; Freeman, Robin; Harder, Briana; Kinsey, Libby; Mead, Gary R; Newson, Stuart E; Pandourski, Ivan; Parsons, Stuart; Russ, Jon; Szodoray-Paradi, Abigel; Szodoray-Paradi, Farkas; Tilova, Elena; Girolami, Mark; Brostow, Gabriel; Jones, Kate E

    2018-03-01

    Passive acoustic sensing has emerged as a powerful tool for quantifying anthropogenic impacts on biodiversity, especially for echolocating bat species. To better assess bat population trends there is a critical need for accurate, reliable, and open source tools that allow the detection and classification of bat calls in large collections of audio recordings. The majority of existing tools are commercial or have focused on the species classification task, neglecting the important problem of first localizing echolocation calls in audio which is particularly problematic in noisy recordings. We developed a convolutional neural network based open-source pipeline for detecting ultrasonic, full-spectrum, search-phase calls produced by echolocating bats. Our deep learning algorithms were trained on full-spectrum ultrasonic audio collected along road-transects across Europe and labelled by citizen scientists from www.batdetective.org. When compared to other existing algorithms and commercial systems, we show significantly higher detection performance of search-phase echolocation calls with our test sets. As an example application, we ran our detection pipeline on bat monitoring data collected over five years from Jersey (UK), and compared results to a widely-used commercial system. Our detection pipeline can be used for the automatic detection and monitoring of bat populations, and further facilitates their use as indicator species on a large scale. Our proposed pipeline makes only a small number of bat specific design decisions, and with appropriate training data it could be applied to detecting other species in audio. A crucial novelty of our work is showing that with careful, non-trivial, design and implementation considerations, state-of-the-art deep learning methods can be used for accurate and efficient monitoring in audio.

  5. Bat detective—Deep learning tools for bat acoustic signal detection

    Science.gov (United States)

    Barlow, Kate E.; Firman, Michael; Freeman, Robin; Harder, Briana; Kinsey, Libby; Mead, Gary R.; Newson, Stuart E.; Pandourski, Ivan; Russ, Jon; Szodoray-Paradi, Abigel; Tilova, Elena; Girolami, Mark; Jones, Kate E.

    2018-01-01

    Passive acoustic sensing has emerged as a powerful tool for quantifying anthropogenic impacts on biodiversity, especially for echolocating bat species. To better assess bat population trends there is a critical need for accurate, reliable, and open source tools that allow the detection and classification of bat calls in large collections of audio recordings. The majority of existing tools are commercial or have focused on the species classification task, neglecting the important problem of first localizing echolocation calls in audio which is particularly problematic in noisy recordings. We developed a convolutional neural network based open-source pipeline for detecting ultrasonic, full-spectrum, search-phase calls produced by echolocating bats. Our deep learning algorithms were trained on full-spectrum ultrasonic audio collected along road-transects across Europe and labelled by citizen scientists from www.batdetective.org. When compared to other existing algorithms and commercial systems, we show significantly higher detection performance of search-phase echolocation calls with our test sets. As an example application, we ran our detection pipeline on bat monitoring data collected over five years from Jersey (UK), and compared results to a widely-used commercial system. Our detection pipeline can be used for the automatic detection and monitoring of bat populations, and further facilitates their use as indicator species on a large scale. Our proposed pipeline makes only a small number of bat specific design decisions, and with appropriate training data it could be applied to detecting other species in audio. A crucial novelty of our work is showing that with careful, non-trivial, design and implementation considerations, state-of-the-art deep learning methods can be used for accurate and efficient monitoring in audio. PMID:29518076

  6. Tick-borne infections in human and animal population worldwide

    Directory of Open Access Journals (Sweden)

    José Brites-Neto

    2015-03-01

    Full Text Available The abundance and activity of ectoparasites and its hosts are affected by various abiotic factors, such as climate and other organisms (predators, pathogens and competitors presenting thus multiples forms of association (obligate to facultative, permanent to intermittent and superficial to subcutaneous developed during long co-evolving processes. Ticks are ectoparasites widespread globally and its eco epidemiology are closely related to the environmental conditions. They are obligatory hematophagous ectoparasites and responsible as vectors or reservoirs at the transmission of pathogenic fungi, protozoa, viruses, rickettsia and others bacteria during their feeding process on the hosts. Ticks constitute the second vector group that transmit the major number of pathogens to humans and play a role primary for animals in the process of diseases transmission. Many studies on bioecology of ticks, considering the information related to their population dynamics, to the host and the environment, comes possible the application and efficiency of tick control measures in the prevention programs of vector-borne diseases. In this review were considered some taxonomic, morphological, epidemiological and clinical fundamental aspects related to the tick-borne infections that affect human and animal populations.

  7. Plant products and secondary metabolites with acaricide activity against ticks.

    Science.gov (United States)

    Rosado-Aguilar, J A; Arjona-Cambranes, K; Torres-Acosta, J F J; Rodríguez-Vivas, R I; Bolio-González, M E; Ortega-Pacheco, A; Alzina-López, A; Gutiérrez-Ruiz, E J; Gutiérrez-Blanco, E; Aguilar-Caballero, A J

    2017-04-30

    The present review documents the results of studies evaluating the acaricidal activity of different plant products and secondary metabolites against ticks that are resistant and susceptible to conventional acaricides. Studies published from 1998 to 2016 were included. The acaricidal activity of plant extracts, essential oils and secondary compounds from plants have been evaluated using bioassays with ticks in the larval and adult stages. There is variable effectiveness according to the species of plant and the concentrations used, with observed mortalities ranging from 5 to 100% against the Rhipicephalus (Boophilus), Amblyomma, Dermacentor, Hyalomma, and Argas genera. A number of plants have been reported to cause high mortalities and/or affect the reproductive capacity of ticks in the adult phase. In the majority of these trials, the main species of plants evaluated correspond to the families Lamiaceae, Fabaceae, Asteraceae, Piperaceae, Verbenaceae, and Poaceae. Different secondary metabolites such as thymol, carvacrol, 1,8-cineol and n-hexanal, have been found to be primarily responsible for the acaricidal activity of different essential oils against different species of ticks, while nicotine, dibenzyldisulfide and dibenzyltrisulfide have been evaluated for plant extracts. Only thymol, carvacrol and 1,8-cineol have been evaluated for acaricidal activity under in vivo conditions. The information in the present review allows the conclusion that the secondary metabolites contained in plant products could be used as an alternative for the control of ticks that are susceptible or resistant to commercial acaricides. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Tick-borne encephalitis: a disease neglected by travel medicine.

    Science.gov (United States)

    Haditsch, Martin; Kunze, Ursula

    2013-01-01

    Tick-borne encephalitis (TBE) is a vector-borne disease that is primarily transmitted to humans by infected ticks and causes infection of the central nervous system. Clinical presentations range from meningitis to encephalitis with or without myelitis, and infection may result in death or long-term neurological sequelae. TBE is endemic in regions of at least 27 European as well as in some Asian countries. Infection and disease, however, can be averted successfully by tick-bite prevention and active vaccination. The risk of infection has shifted from daily life and occupational exposure to leisure-time activities, including travelling. Outdoor activities during the tick season with contact with nature increase the risk of tick bites. Although the number of travel-associated cases is unknown, it is certainly under-estimated because there is hardly any awareness of TBE in non-endemic countries. Therefore, the majority of cases remain undiagnosed, also because of the lack of diagnostic serology, as there is no routine screening for TBE in non-endemic regions. Because of the increasing number of travellers from TBE non-endemic to endemic regions, and in view of the fact that TBE was included in the list of notifiable diseases in the European Union in September 2012, this disease needs to become an important issue in travel medicine. Copyright © 2013 Elsevier Ltd. All rights reserved.

  9. TICK-BORNE ENCEPHALITIS VIRUS INFECTION IN HUMANS.

    Science.gov (United States)

    Hrnjaković Cvjetković, Ivana; Cvjetković, Dejan; Patić, Aleksandra; Radovanov, Jelena; Kovacević, Gordana; Milosević, Vesna

    2016-01-01

    Tick-borne meningoencephalitis virus is a flavivirus that causes the most important vector-borne central nervous system infection in many countries of Europe and Asia. There are three subtypes of tick-borne encephalitis virus: European, Siberian and the Far-Eastern subtype. In endemic areas, the virus remains in transmissive cycles between Ixodes ticks and small rodents. In most cases (70-98%) infection goes asymptomatically. In about one-third of meningitis cases, meningoencephalitis or meningomyelitis is developed. Postencephalytic syndrome may be the complication of the infection, presenting with neurological symptoms. Etiologic diagnosis of tick-borne meningoencephalitis is only made on basis of laboratory analyses. Reverse transcription-polymerase chain reaction is used for determining the presence of virus in the blood and cerebrospinal fluid. Antibodies in blood and cerebrospinal fluid can be detected by serological tests. The most efficient way to control this potentially severe disease with possible serious long-term consequences is vaccination. It should be recommended to persons who live or travel to endemic areas. In Serbia, tick-borne encephalitis virus infection belongs to the list of reportable diseases; however, there are no reported cases because the diagnostics is not performed routinely. We believe that the significance of this zoonosis must be examined in our country and some of its parts because of preliminary positive serological findings found out in Vojvodina as well as because of reported cases in neighboring countries such as Hungary and Croatia and its worldwide distribution.

  10. Monitoring Sensitive Bat Species at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Schoenberg, Kari M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-01-15

    Bats play a critical role in ecosystems and are vulnerable to disturbance and disruption by human activities. In recent decades, bat populations in the United States and elsewhere have decreased tremendously. There are 47 different species of bat in the United States and 28 of these occur in New Mexico with 15 different species documented at the Los Alamos National Laboratory (LANL) and surrounding areas. Euderma maculatum(the spotted bat) is listed as “threatened” by the state of New Mexico and is known to occur at LANL. Four other species of bats are listed as “sensitive” and also occur here. In 1995, a four year study was initiated at LANL to assess the status of bat species of concern, elucidate distribution and relative abundance, and obtain information on roosting sites. There have been no definitive studies since then. Biologists in the Environmental Protection Division at LANL initiated a multi-year monitoring program for bats in May 2013 to implement the Biological Resources Management Plan. The objective of this ongoing study is to monitor bat species diversity and seasonal activity over time at LANL. Bat species diversity and seasonal activity were measured using an acoustic bat detector, the Pettersson D500X. This ultrasound recording unit is intended for long-term, unattended recording of bat and other high frequency animal calls. During 2013, the detector was deployed at two locations around LANL. Study sites were selected based on proximity to water where bats may be foraging. Recorded bat calls were analyzed using Sonobat, software that can help determine specific species of bat through their calls. A list of bat species at the two sites was developed and compared to lists from previous studies. Species diversity and seasonal activity, measured as the number of call sequences recorded each month, were compared between sites and among months. A total of 17,923 bat calls were recorded representing 15 species. Results indicate that there is a

  11. Iron storage disease (hemochromatosis) and hepcidin response to iron load in two species of pteropodid fruit bats relative to the common vampire bat.

    Science.gov (United States)

    Stasiak, Iga M; Smith, Dale A; Ganz, Tomas; Crawshaw, Graham J; Hammermueller, Jutta D; Bienzle, Dorothee; Lillie, Brandon N

    2018-03-29

    Hepcidin is the key regulator of iron homeostasis in the body. Iron storage disease (hemochromatosis) is a frequent cause of liver disease and mortality in captive Egyptian fruit bats (Rousettus aegyptiacus), but reasons underlying this condition are unknown. Hereditary hemochromatosis in humans is due to deficiency of hepcidin or resistance to the action of hepcidin. Here, we investigated the role of hepcidin in iron metabolism in one species of pteropodid bat that is prone to iron storage disease [Egyptian fruit bat (with and without hemochromatosis)], one species of pteropodid bat where iron storage disease is rare [straw-colored fruit bat (Eidolon helvum)], and one species of bat with a natural diet very high in iron, in which iron storage disease is not reported [common vampire bat (Desmodus rotundus)]. Iron challenge via intramuscular injection of iron dextran resulted in significantly increased liver iron content and histologic iron scores in all three species, and increased plasma iron in Egyptian fruit bats and straw-colored fruit bats. Hepcidin mRNA expression increased in response to iron administration in healthy Egyptian fruit bats and common vampire bats, but not in straw-colored fruit bats or Egyptian fruit bats with hemochromatosis. Hepcidin gene expression significantly correlated with liver iron content in Egyptian fruit bats and common vampire bats, and with transferrin saturation and plasma ferritin concentration in Egyptian fruit bats. Induction of hepcidin gene expression in response to iron challenge is absent in straw-colored fruit bats and in Egyptian fruit bats with hemochromatosis and, relative to common vampire bats and healthy humans, is low in Egyptain fruit bats without hemochromatosis. Limited hepcidin response to iron challenge may contribute to the increased susceptibility of Egyptian fruit bats to iron storage disease.

  12. Management of tick infestation in dogs

    Directory of Open Access Journals (Sweden)

    Somasani Ayodhya

    2014-09-01

    Full Text Available The present study was carried out during the month of January 2014 when a total of 148 dogs with history of various diseases were presented to the Campus Veterinary Hospital, Teaching Veterinary Clinical Complex, College of Veterinary Science, Rajendranagar, Hyderabad, India. Out of 148 dogs that were presented to the hospital, 48 dogs had the clinical signs of loss of hair, itching, and reduced food intake. The dogs were restless and continuously rubbed their bodies against the walls in the houses, and scratching with their legs. Clinical examination of the dogs revealed presence of alopecia, pruritus, and the formation of small crusts. All 48 dogs were treated with ivermectin by subcutaneous injection dosed at 0.02 mL/kg body weight at a weekly interval for 2 to 3 weeks. All dogs were bathed with cypermethrin shampoo weekly once for 2-3 weeks. In the present study, it was observed that ivermectin/cypermethrin combination therapy was effective for the management of tick infestation in dogs.

  13. Enzootic and Epizootic Rabies Associated with Vampire Bats, Peru

    Science.gov (United States)

    Streicker, Daniel G.; Cabezas-Sanchez, Cesar; Velasco-Villa, Andres

    2013-01-01

    During the past decade, incidence of human infection with rabies virus (RABV) spread by the common vampire bat (Desmodus rotundus) increased considerably in South America, especially in remote areas of the Amazon rainforest, where these bats commonly feed on humans. To better understand the epizootiology of rabies associated with vampire bats, we used complete sequences of the nucleoprotein gene to infer phylogenetic relationships among 157 RABV isolates collected from humans, domestic animals, and wildlife, including bats, in Peru during 2002–2007. This analysis revealed distinct geographic structuring that indicates that RABVs spread gradually and involve different vampire bat subpopulations with different transmission cycles. Three putative new RABV lineages were found in 3 non–vampire bat species that may represent new virus reservoirs. Detection of novel RABV variants and accurate identification of reservoir hosts are critically important for the prevention and control of potential virus transmission, especially to humans.

  14. Pathogenic Leptospira spp. in bats: Molecular investigation in Southern Brazil.

    Science.gov (United States)

    Mayer, Fabiana Quoos; Dos Reis, Emily Marques; Bezerra, André Vinícius Andrade; Cerva, Cristine; Rosa, Júlio; Cibulski, Samuel Paulo; Lima, Francisco Esmaile Sales; Pacheco, Susi Missel; Rodrigues, Rogério Oliveira

    2017-06-01

    The present study aimed to investigate the frequency of pathogenic Leptospira spp. in Brazilian bats and to determine possible risk factors associated to it. Ninety two bats of 12 species were evaluated. Whole genomic DNA from kidneys was extracted and real-time PCR specific to pathogenic Leptospira spp. was applied. Association between the frequency of specimens positive for Leptospira spp. and sex, age, bat species or family, season of collection, geographic localization and feeding habits was evaluated. The results showed that 39.13% of analyzed bats were found positive for Leptospira spp. Nine bat species had at least one positive result. There was no association among the evaluated variables and frequency of pathogenic Leptospira spp. Although the limitations due to lack of Leptospira spp. isolation, leptospiral carriage was demonstrated in bats of different species from southern Brazil, which reinforces the need for surveillance of infectious agents in wild animals. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Supraclavicular skin temperature and BAT activity in lean healthy adults.

    Science.gov (United States)

    van der Lans, Anouk A J J; Vosselman, Maarten J; Hanssen, Mark J W; Brans, Boudewijn; van Marken Lichtenbelt, Wouter D

    2016-01-01

    The 'gold standard' for measuring brown adipose tissue (BAT) in humans is [(18)F]FDG-PET/CT-imaging. With this technique subjects are exposed to ionizing radiation and are therefore limited in the number of scans that can be performed. We investigated the relation between supraclavicular skin temperatures and BAT activity values using a strictly temperature-controlled air-cooling protocol. Data of 36 male subjects was analyzed. BAT activity was evaluated by [(18)F]FDG-PET/CT-imaging and skin temperature was measured by means of wireless temperature sensors. Supraclavicular skin temperature dropped less compared to skin temperatures at other sites (all P values BAT activity (R (2) 0.23), and the change in supraclavicular skin temperature and non-shivering thermogenesis (R (2) 0.18, both P values BAT activity and BAT thermogenesis.

  16. Ticks and Tick-Borne Pathogens of the Caribbean: Current Understanding and Future Directions for More Comprehensive Surveillance.

    Science.gov (United States)

    Gondard, Mathilde; Cabezas-Cruz, Alejandro; Charles, Roxanne A; Vayssier-Taussat, Muriel; Albina, Emmanuel; Moutailler, Sara

    2017-01-01

    Ticks are obligate hematophagous arthropods of significant importance to human and veterinary medicine. They transmit a vast array of pathogens, including bacteria, viruses, protozoa, and helminths. Most epidemiological data on ticks and tick-borne pathogens (TBPs) in the West Indies are limited to common livestock pathogens such as Ehrlichia ruminantium, Babesia spp. (i.e., B. bovis and B. bigemina ), and Anaplasma marginale , and less information is available on companion animal pathogens. Of note, human tick-borne diseases (TBDs) remain almost completely uncharacterized in the West Indies. Information on TBP presence in wildlife is also missing. Herein, we provide a comprehensive review of the ticks and TBPs affecting human and animal health in the Caribbean, and introduce the challenges associated with understanding TBD epidemiology and implementing successful TBD management in this region. In particular, we stress the need for innovative and versatile surveillance tools using high-throughput pathogen detection (e.g., high-throughput real-time microfluidic PCR). The use of such tools in large epidemiological surveys will likely improve TBD prevention and control programs in the Caribbean.

  17. Ticks and tick-borne pathogens and putative symbionts of black bears (Ursus americanus floridanus) from Georgia and Florida.

    Science.gov (United States)

    Yabsley, Michael J; Nims, Todd N; Savage, Mason Y; Durden, Lance A

    2009-10-01

    Ticks were collected from 38 black bears (Ursus americanus floridanus) from northwestern Florida (n = 18) from 2003 to 2005 and southern Georgia (n = 20) in 2006. Five species (Amblyomma americanum, A. maculatum, Dermacentor variabilis, Ixodes scapularis, and I. affinis) were collected from Florida bears, and 4 species (A. americanum, A. maculatum, D. variabilis, I. scapularis) were collected from bears in Georgia. Ixodes scapularis was the most frequently collected tick, followed by D. variabilis, A. americanum, A. maculatum, and I. affinis. The collection of I. affinis from a Florida bear represents a new host record. A subset of ticks was screened for pathogens and putative symbionts by polymerase chain reaction (PCR). The zoonotic tick-borne pathogens Ehrlichia chaffeensis and Rickettsia parkeri were detected in 1 of 23 (4.3%) A. americanum and 1 of 12 (8.3%) A. maculatum, respectively. The putative zoonotic pathogen "Rickettsia amblyommii" was detected in 4 (17.4%) A. americanum and 1 (8.3%) A. maculatum. Other putative symbiotic rickettsiae detected included R. bellii and R. montanensis in D. variabilis, a Rickettsia cooleyi-like sp. and Rickettsia sp. Is-1 in I. scapularis, and Rickettsia TR39-like sp. in I. scapularis and A. americanum. All ticks were PCR-negative for Anaplasma phagocytophilum, Panola Mountain Ehrlichia sp., E. ewingii, Francisella tularensis, and Borrelia spp.

  18. Ticks and Tick-Borne Pathogens of the Caribbean: Current Understanding and Future Directions for More Comprehensive Surveillance

    Directory of Open Access Journals (Sweden)

    Mathilde Gondard

    2017-11-01

    Full Text Available Ticks are obligate hematophagous arthropods of significant importance to human and veterinary medicine. They transmit a vast array of pathogens, including bacteria, viruses, protozoa, and helminths. Most epidemiological data on ticks and tick-borne pathogens (TBPs in the West Indies are limited to common livestock pathogens such as Ehrlichia ruminantium, Babesia spp. (i.e., B. bovis and B. bigemina, and Anaplasma marginale, and less information is available on companion animal pathogens. Of note, human tick-borne diseases (TBDs remain almost completely uncharacterized in the West Indies. Information on TBP presence in wildlife is also missing. Herein, we provide a comprehensive review of the ticks and TBPs affecting human and animal health in the Caribbean, and introduce the challenges associated with understanding TBD epidemiology and implementing successful TBD management in this region. In particular, we stress the need for innovative and versatile surveillance tools using high-throughput pathogen detection (e.g., high-throughput real-time microfluidic PCR. The use of such tools in large epidemiological surveys will likely improve TBD prevention and control programs in the Caribbean.

  19. Characterization of a Novel Bat Adenovirus Isolated from Straw-Colored Fruit Bat (Eidolon helvum

    Directory of Open Access Journals (Sweden)

    Hirohito Ogawa

    2017-12-01

    Full Text Available Bats are important reservoirs for emerging zoonotic viruses. For extensive surveys of potential pathogens in straw-colored fruit bats (Eidolon helvum in Zambia, a total of 107 spleen samples of E. helvum in 2006 were inoculated onto Vero E6 cells. The cell culture inoculated with one of the samples (ZFB06-106 exhibited remarkable cytopathic changes. Based on the ultrastructural property in negative staining and cross-reactivity in immunofluorescence assays, the virus was suspected to be an adenovirus, and tentatively named E. helvum adenovirus 06-106 (EhAdV 06-106. Analysis of the full-length genome of 30,134 bp, determined by next-generation sequencing, showed the presence of 28 open reading frames. Phylogenetic analyses confirmed that EhAdV 06-106 represented a novel bat adenovirus species in the genus Mastadenovirus. The virus shared similar characteristics of low G + C contents with recently isolated members of species Bat mastadenoviruses E, F and G, from which EhAdV 06-106 diverged by more than 15% based on the distance matrix analysis of DNA polymerase amino acid sequences. According to the taxonomic criteria, we propose the tentative new species name “Bat mastadenovirus H”. Because EhAdV 06-106 exhibited a wide in vitro cell tropism, the virus might have a potential risk as an emerging virus through cross-species transmission.

  20. Characterization of a Novel Bat Adenovirus Isolated from Straw-Colored Fruit Bat (Eidolon helvum).

    Science.gov (United States)

    Ogawa, Hirohito; Kajihara, Masahiro; Nao, Naganori; Shigeno, Asako; Fujikura, Daisuke; Hang'ombe, Bernard M; Mweene, Aaron S; Mutemwa, Alisheke; Squarre, David; Yamada, Masao; Higashi, Hideaki; Sawa, Hirofumi; Takada, Ayato

    2017-12-04

    Bats are important reservoirs for emerging zoonotic viruses. For extensive surveys of potential pathogens in straw-colored fruit bats ( Eidolon helvum ) in Zambia, a total of 107 spleen samples of E. helvum in 2006 were inoculated onto Vero E6 cells. The cell culture inoculated with one of the samples (ZFB06-106) exhibited remarkable cytopathic changes. Based on the ultrastructural property in negative staining and cross-reactivity in immunofluorescence assays, the virus was suspected to be an adenovirus, and tentatively named E. helvum adenovirus 06-106 (EhAdV 06-106). Analysis of the full-length genome of 30,134 bp, determined by next-generation sequencing, showed the presence of 28 open reading frames. Phylogenetic analyses confirmed that EhAdV 06-106 represented a novel bat adenovirus species in the genus Mastadenovirus . The virus shared similar characteristics of low G + C contents with recently isolated members of species Bat mastadenoviruses E , F and G , from which EhAdV 06-106 diverged by more than 15% based on the distance matrix analysis of DNA polymerase amino acid sequences. According to the taxonomic criteria, we propose the tentative new species name " Bat mastadenovirus H ". Because EhAdV 06-106 exhibited a wide in vitro cell tropism, the virus might have a potential risk as an emerging virus through cross-species transmission.

  1. Investigations into Ixodidae ticks in cattle in Lahore, Pakistan

    Directory of Open Access Journals (Sweden)

    Shabbir Ahmed

    2012-06-01

    Full Text Available A total of 2 160 cattle, comprising adults and calves of exotic, crossbred and indigenous breeds, were examined for tick infestation between 1996 and 2000. Of these, 1 417 (65.6% were infested with ticks, with a total of 220 (61% from exotic breeds, 262 (72% were crossbred and 172 (48% were indigenous adult cattle. Calves of exotic, crossbred and indigenous breeds were infested with ticks at the following rates: 246 (68%, 294 (82% and 223 (62%, respectively. Higher infestation levels were noted with Rhipicephalus microplus which affected 912 (64.3% animals, in comparison to Hyalomma anatolicum anatolicum which affected 302 (21.3%. Rhipicephalus infestation was more extensive than that with genus Hyalomma.

  2. Efficacy of afoxolaner against Ixodes scapularis ticks in dogs.

    Science.gov (United States)

    Mitchell, Elizabeth B; McCall, John W; Theodore Chester, S; Larsen, Diane

    2014-04-02

    Efficacy of afoxolaner, a novel isoxazoline insecticide/acaricide, against Ixodes scapularis was evaluated in a laboratory study. One day prior to treatment, beagle dogs (n=16) were infested with 50 unfed wild adult ticks. Repeat infestations were performed weekly for four additional weeks. The number of live ticks remaining on each dog was determined 48 h after treatment and after each subsequent infestation. A single oral treatment with a dose approaching the minimum effective dose of afoxolaner (2.5mg/kg) eliminated the pre-existing infestations of I. scapularis ticks and controlled weekly re-infestations, with efficacy between 98% and 100% recorded until Day 23 and 94% at Day 30. Copyright © 2014 The Authors. Published by Elsevier B.V. All rights reserved.

  3. Group A Rotaviruses in Chinese Bats: Genetic Composition, Serology, and Evidence for Bat-to-Human Transmission and Reassortment.

    Science.gov (United States)

    He, Biao; Huang, Xiaohong; Zhang, Fuqiang; Tan, Weilong; Matthijnssens, Jelle; Qin, Shaomin; Xu, Lin; Zhao, Zihan; Yang, Ling'en; Wang, Quanxi; Hu, Tingsong; Bao, Xiaolei; Wu, Jianmin; Tu, Changchun

    2017-06-15

    Bats are natural reservoirs for many pathogenic viruses, and increasing evidence supports the notion that bats can also harbor group A rotaviruses (RVAs), important causative agents of diarrhea in children and young animals. Currently, 8 RVA strains possessing completely novel genotype constellations or genotypes possibly originating from other mammals have been identified from African and Chinese bats. However, all the data were mainly based on detection of RVA RNA, present only during acute infections, which does not permit assessment of the true exposure of a bat population to RVA. To systematically investigate the genetic diversity of RVAs, 547 bat anal swabs or gut samples along with 448 bat sera were collected from five South Chinese provinces. Specific reverse transcription-PCR (RT-PCR) screening found four RVA strains. Strain GLRL1 possessed a completely novel genotype constellation, whereas the other three possessed a constellation consistent with the MSLH14-like genotype, a newly characterized group of viruses widely prevalent in Chinese insectivorous bats. Among the latter, strain LZHP2 provided strong evidence of cross-species transmission of RVAs from bats to humans, whereas strains YSSK5 and BSTM70 were likely reassortants between typical MSLH14-like RVAs and human RVAs. RVA-specific antibodies were detected in 10.7% (48/448) of bat sera by an indirect immunofluorescence assay (IIFA). Bats in Guangxi and Yunnan had a higher RVA-specific antibody prevalence than those from Fujian and Zhejiang provinces. These observations provide evidence for cross-species transmission of MSLH14-like bat RVAs to humans, highlighting the impact of bats as reservoirs of RVAs on public health. IMPORTANCE Bat viruses, such as severe acute respiratory syndrome (SARS), Middle East respiratory syndrome (MERS), Ebola, Hendra, and Nipah viruses, are important pathogens causing outbreaks of severe emerging infectious diseases. However, little is known about bat viruses capable

  4. A Bat Algorithm with Mutation for UCAV Path Planning

    OpenAIRE

    Gaige Wang; Lihong Guo; Hong Duan; Luo Liu; Heqi Wang

    2012-01-01

    Path planning for uninhabited combat air vehicle (UCAV) is a complicated high dimension optimization problem, which mainly centralizes on optimizing the flight route considering the different kinds of constrains under complicated battle field environments. Original bat algorithm (BA) is used to solve the UCAV path planning problem. Furthermore, a new bat algorithm with mutation (BAM) is proposed to solve the UCAV path planning problem, and a modification is applied to mutate between bats duri...

  5. Pliocene bats (Chiroptera) from Kanapoi, Turkana Basin, Kenya.

    Science.gov (United States)

    Gunnell, Gregg F; Manthi, Fredrick K

    2018-04-05

    Fossil bats from the Pliocene of Africa are extremely rare, especially in East Africa where meager records have been reported only from two localities in the Omo River Basin Shungura Formation and from a scattering of localities in the Afar Depression, both in Ethiopia. Here we report on a diverse assemblage of bats from Kanapoi in the Turkana Basin that date to approximately 4.19 million years ago. The Kanapoi bat community consists of four different species of fruit bats including a new genus and two new species as well as five species of echolocating bats, the most common of which are two new species of the molossid genus Mops. Additionally, among the echolocating bats, a new species of the emballonurid Saccolaimus is documented at Kanapoi along with an additional Saccolaimus species and a potentially new species of the nycterid Nycteris. Compared to other East African Pliocene bat assemblages, the Kanapoi bat community is unique in preserving molossids and curiously lacks any evidence of cave dwelling bats like rhinolophids or hipposiderids, which are both common at other East African sites. The bats making up the Kanapoi community all typically roost in trees, with some preferring deeper forests and larger trees (molossids), while the others (pteropodids, nycterids and emballonurids) roost in trees near open areas. Living fruit bats that are related to Kanapoi species typically forage for fruits along the margins of forests and in open savannah. The echolocating forms from Kanapoi consist of groups that aerially hawk for insects in open areas between patches of forest and along water courses. The habitats preferred by living relatives of the Kanapoi bats are in agreement with those constructed for Kanapoi based on other lines of evidence. Copyright © 2018. Published by Elsevier Ltd.

  6. Diseases in free-ranging bats from Germany

    Directory of Open Access Journals (Sweden)

    Wibbelt Gudrun

    2011-10-01

    Full Text Available Abstract Background The emergence of important viral diseases and their potential threat to humans has increased the interest in bats as potential reservoir species. Whereas the majority of studies determined the occurrence of specific zoonotic agents in chiropteran species, little is known about actual bat pathogens and impacts of disease on bat mortality. Combined pathological and microbiological investigations in free-ranging bats are sparse and often limited by small sample sizes. In the present study about 500 deceased bats of 19 European species (family Vespertilionidae were subjected to a post-mortem examination followed by histo-pathological and bacteriological investigations. The bat carcasses originated from different geographical regions in Germany and were collected by bat researchers and bat rehabilitation centers. Results Pathological examination revealed inflammatory lesions in more than half of the investigated bats. Lung was the predominantly affected organ (40% irrespective of bat species, sex and age. To a lesser extent non-inflammatory organ tissue changes were observed. Comparative analysis of histo-pathology and bacteriology results identified 22 different bacterial species that were clearly associated with pathological lesions. Besides disease-related mortality, traumatic injuries represented an additional major cause of death. Here, attacks by domestic cats accounted for almost a half of these cases. Conclusions The present study shows that free-ranging bats not only serve as a reservoir of infectious agents, they are also vulnerable to various infectious diseases. Some of these microbial agents have zoonotic potential, but there is no evidence that European bats would pose a higher health hazard risk to humans in comparison to other wildlife.

  7. The evolution of echolocation in bats: a comparative approach

    OpenAIRE

    Collen, A. L.

    2012-01-01

    The evolutionary history of echolocation in bats is poorly understood, as fossils provide little direct evidence, and most studies into echolocation have taken an ecological approach. Bats use a wide variety of echolocation call structures despite facing similar sensory challenges, and it is not clear how and why these echolocation call types evolved, or what impact they have on other aspects of the evolution of bats. Here, I use phylogenetic comparative methods and newly-collated echolocatio...

  8. Sensory ecology of water detection by bats: a field experiment.

    Directory of Open Access Journals (Sweden)

    Danilo Russo

    Full Text Available Bats face a great risk of dehydration, so sensory mechanisms for water recognition are crucial for their survival. In the laboratory, bats recognized any smooth horizontal surface as water because these provide analogous reflections of echolocation calls. We tested whether bats also approach smooth horizontal surfaces other than water to drink in nature by partly covering watering troughs used by hundreds of bats with a Perspex layer mimicking water. We aimed 1 to confirm that under natural conditions too bats mistake any horizontal smooth surface for water by testing this on large numbers of individuals from a range of species and 2 to assess the occurrence of learning effects. Eleven bat species mistook Perspex for water relying chiefly on echoacoustic information. Using black instead of transparent Perspex did not deter bats from attempting to drink. In Barbastella barbastellus no echolocation differences occurred between bats approaching the water and the Perspex surfaces respectively, confirming that bats perceive water and Perspex to be acoustically similar. The drinking attempt rates at the fake surface were often lower than those recorded in the laboratory: bats then either left the site or moved to the control water surface. This suggests that bats modified their behaviour as soon as the lack of drinking reward had overridden the influence of echoacoustic information. Regardless of which of two adjoining surfaces was covered, bats preferentially approached and attempted to drink from the first surface encountered, probably because they followed a common route, involving spatial memory and perhaps social coordination. Overall, although acoustic recognition itself is stereotyped and its importance in the drinking process overwhelming, our findings point at the role of experience in increasing behavioural flexibility under natural conditions.

  9. Genetic Characteristics of Coronaviruses from Korean Bats in 2016.

    Science.gov (United States)

    Lee, Saemi; Jo, Seong-Deok; Son, Kidong; An, Injung; Jeong, Jipseol; Wang, Seung-Jun; Kim, Yongkwan; Jheong, Weonhwa; Oem, Jae-Ku

    2018-01-01

    Bats have increasingly been recognized as the natural reservoir of severe acute respiratory syndrome (SARS), coronavirus, and other coronaviruses found in mammals. However, little research has been conducted on bat coronaviruses in South Korea. In this study, bat samples (332 oral swabs, 245 fecal samples, 38 urine samples, and 57 bat carcasses) were collected at 33 natural bat habitat sites in South Korea. RT-PCR and sequencing were performed for specific coronavirus genes to identify the bat coronaviruses in different bat samples. Coronaviruses were detected in 2.7% (18/672) of the samples: 13 oral swabs from one species of the family Rhinolophidae, and four fecal samples and one carcass (intestine) from three species of the family Vespertiliodae. To determine the genetic relationships of the 18 sequences obtained in this study and previously known coronaviruses, the nucleotide sequences of a 392-nt region of the RNA-dependent RNA polymerase (RdRp) gene were analyzed phylogenetically. Thirteen sequences belonging to SARS-like betacoronaviruses showed the highest nucleotide identity (97.1-99.7%) with Bat-CoV-JTMC15 reported in China. The other five sequences were most similar to MERS-like betacoronaviruses. Four nucleotide sequences displayed the highest identity (94.1-95.1%) with Bat-CoV-HKU5 from Hong Kong. The one sequence from a carcass showed the highest nucleotide identity (99%) with Bat-CoV-SC2013 from China. These results suggest that careful surveillance of coronaviruses from bats should be continued, because animal and human infections may result from the genetic variants present in bat coronavirus reservoirs.

  10. An Investigation of bat durability by wood species

    Science.gov (United States)

    Eric Ruggiero; James Sherwood; Patrick Drane; David Kretschmann

    2012-01-01

    Northern white ash had been the wood of choice for Major League Baseball (MLB) bats until the introduction of hard maple in the late 1990s. Since the introduction of maple to the game, there has been a perceived increase in the rate of bats to exhibit multi-piece failures (MPF)—both ash and maple. Lab and field data indicate that while a maple bat is as...

  11. Causes of bat fatalities at wind turbines: Hypotheses and predictions

    Science.gov (United States)

    Cryan, P.M.; Barclay, R.M.R.

    2009-01-01

    Thousands of industrial-scale wind turbines are being built across the world each year to meet the growing demand for sustainable energy. Bats of certain species are dying at wind turbines in unprecedented numbers. Species of bats consistently affected by turbines tend to be those that rely on trees as roosts and most migrate long distances. Although considerable progress has been made in recent years toward better understanding the problem, the causes of bat fatalities at turbines remain unclear. In this synthesis, we review hypothesized causes of bat fatalities at turbines. Hypotheses of cause fall into 2 general categoriesproximate and ultimate. Proximate causes explain the direct means by which bats die at turbines and include collision with towers and rotating blades, and barotrauma. Ultimate causes explain why bats come close to turbines and include 3 general types: random collisions, coincidental collisions, and collisions that result from attraction of bats to turbines. The random collision hypothesis posits that interactions between bats and turbines are random events and that fatalities are representative of the bats present at a site. Coincidental hypotheses posit that certain aspects of bat distribution or behavior put them at risk of collision and include aggregation during migration and seasonal increases in flight activity associated with feeding or mating. A surprising number of attraction hypotheses suggest that bats might be attracted to turbines out of curiosity, misperception, or as potential feeding, roosting, flocking, and mating opportunities. Identifying, prioritizing, and testing hypothesized causes of bat collisions with wind turbines are vital steps toward developing practical solutions to the problem. ?? 2009 American Society of Mammalogists.

  12. Nipah virus infection in bats (order Chiroptera) in peninsular Malaysia.

    Science.gov (United States)

    Yob, J. M.; Field, H.; Rashdi, A. M.; Morrissy, C.; van der Heide, B.; Rota, P.; bin Adzhar, A.; White, J.; Daniels, P.; Jamaluddin, A.; Ksiazek, T.

    2001-01-01

    Nipah virus, family Paramyxoviridae, caused disease in pigs and humans in peninsular Malaysia in 1998-99. Because Nipah virus appears closely related to Hendra virus, wildlife surveillance focused primarily on pteropid bats (suborder Megachiroptera), a natural host of Hendra virus in Australia. We collected 324 bats from 14 species on peninsular Malaysia. Neutralizing antibodies to Nipah virus were demonstrated in five species, suggesting widespread infection in bat populations in peninsular Malaysia. PMID:11384522

  13. Models of Eucalypt phenology predict bat population flux.

    Science.gov (United States)

    Giles, John R; Plowright, Raina K; Eby, Peggy; Peel, Alison J; McCallum, Hamish

    2016-10-01

    Fruit bats (Pteropodidae) have received increased attention after the recent emergence of notable viral pathogens of bat origin. Their vagility hinders data collection on abundance and distribution, which constrains modeling efforts and our understanding of bat ecology, viral dynamics, and spillover. We addressed this knowledge gap with models and data on the occurrence and abundance of nectarivorous fruit bat populations at 3 day roosts in southeast Queensland. We used environmental drivers of nectar production as predictors and explored relationships between bat abundance and virus spillover. Specifically, we developed several novel modeling tools motivated by complexities of fruit bat foraging ecology, including: (1) a dataset of spatial variables comprising Eucalypt-focused vegetation indices, cumulative precipitation, and temperature anomaly; (2) an algorithm that associated bat population response with spatial covariates in a spatially and temporally relevant way given our current understanding of bat foraging behavior; and (3) a thorough statistical learning approach to finding optimal covariate combinations. We identified covariates that classify fruit bat occupancy at each of our three study roosts with 86-93% accuracy. Negative binomial models explained 43-53% of the variation in observed abundance across roosts. Our models suggest that spatiotemporal heterogeneity in Eucalypt-based food resources could drive at least 50% of bat population behavior at the landscape scale. We found that 13 spillover events were observed within the foraging range of our study roosts, and they occurred during times when models predicted low population abundance. Our results suggest that, in southeast Queensland, spillover may not be driven by large aggregations of fruit bats attracted by nectar-based resources, but rather by behavior of smaller resident subpopulations. Our models and data integrated remote sensing and statistical learning to make inferences on bat ecology

  14. Leishmania (L. mexicana infected bats in Mexico: novel potential reservoirs.

    Directory of Open Access Journals (Sweden)

    Miriam Berzunza-Cruz

    2015-01-01

    Full Text Available Leishmania (Leishmania mexicana causes cutaneous leishmaniasis, an endemic zoonosis affecting a growing number of patients in the southeastern states of Mexico. Some foci are found in shade-grown cocoa and coffee plantations, or near perennial forests that provide rich breeding grounds for the sand fly vectors, but also harbor a variety of bat species that live off the abundant fruits provided by these shade-giving trees. The close proximity between sand flies and bats makes their interaction feasible, yet bats infected with Leishmania (L. mexicana have not been reported. Here we analyzed 420 bats from six states of Mexico that had reported patients with leishmaniasis. Tissues of bats, including skin, heart, liver and/or spleen were screened by PCR for Leishmania (L. mexicana DNA. We found that 41 bats (9.77%, belonging to 13 species, showed positive PCR results in various tissues. The infected tissues showed no evidence of macroscopic lesions. Of the infected bats, 12 species were frugivorous, insectivorous or nectarivorous, and only one species was sanguivorous (Desmodus rotundus, and most of them belonged to the family Phyllostomidae. The eco-region where most of the infected bats were caught is the Gulf Coastal Plain of Chiapas and Tabasco. Through experimental infections of two Tadarida brasiliensis bats in captivity, we show that this species can harbor viable, infective Leishmania (L. mexicana parasites that are capable of infecting BALB/c mice. We conclude that various species of bats belonging to the family Phyllostomidae are possible reservoir hosts for Leishmania (L. mexicana, if it can be shown that such bats are infective for the sand fly vector. Further studies are needed to determine how these bats become infected, how long the parasite remains viable inside these potential hosts and whether they are infective to sand flies to fully evaluate their impact on disease epidemiology.

  15. Increased mortality of black-browed albatross chicks at a colony heavily-infested with the tick Ixodes uriae.

    Science.gov (United States)

    Bergström, S; Haemig, P D; Olsen, B

    1999-09-01

    At Bird Island, South Georgia, we studied the effects of the tick Ixodes uriae on survival of chicks at two colonies of the black-browed albatross Diomedea melanophrys, one where most chicks were infested with ticks, the other where most chicks were tick-free. When the two colonies were compared, it was found that the colony heavily-infested with ticks had significantly greater chick mortality than the colony lightly-infested with ticks. However, within each of the two colonies, there was no significant difference in survival between chicks with ticks and those without ticks.

  16. Clinico-epidemiologichesky aspects of the mixed tick-borne infections in the endemic region

    Directory of Open Access Journals (Sweden)

    E. S. Aleshkovskaya

    2013-01-01

    Full Text Available Detection of clinico-epidemiological features of the mixed tick-borne infections – tick-borne Lyme disease and a human granulocytic anaplasmosis was the purpose of the conducted research. During the spring – summer period 146 patients with tick-borne borreliosis were surveyed. As a result at 45 (30,82% patients authentically diagnosed the mixed tick-borne infection. Features of clinical manifestations of a mixed tick-borne infection revealed: catarrhal phenomena (20%, liver defeats (33%, nephros (31, 7%, frequent secondary erythems (20%. Changes in haemogram defined: thrombocytopenia (42,2%, anemia (20%, leukopenia (13,3%.

  17. Diversity of Babesia in Ixodes ricinus ticks in Poland.

    Science.gov (United States)

    Welc-Falęciak, R; Bajer, A; Paziewska-Harris, A; Baumann-Popczyk, A; Siński, E

    2012-01-01

    The aims of this study were: (1) to estimate Babesia prevalence in the most common species of tick in Poland, Ixodes ricinus, in two recreational areas (Urwitałt in the Mazury Lake District and Bielański Forest in Warsaw), and (2) to evaluate the molecular diversity of Babesia isolates in questing I. ricinus in Poland. Questing ticks were collected from vegetation in forest areas in Urwitałt near Mikołajki and in Bielański Forest (Warsaw). Purified genomic DNA was used with specific primers to amplify a fragment of the Babesia spp. 18S rRNA gene. Tick-drag indices for I. ricinus were high in both study areas, reaching somewhat higher values in Urwitałt than in Bielański Forest. The overall prevalence of Babesia spp. in examined ticks was 1.6%. In Urwitałt, two strains of B. microti were identified using rRNA sequences: the enzootic Munich strain and an isolate close to the zoonotic Jena strain. The proportion of infections due to these two strains in questing ticks reversed over a six-year period. During 3 years of study in Bielański Forest, all Babesia isolates obtained from I. ricinus were identical to Babesia sp. EU1 (B. venatorum), previously recognized as an agent of human babesiosis. This study has confirmed the presence of enzoonotic and zoonotic Babesia species/strains in the abundant human-biting tick I. ricinus in recreational areas in Poland. It has also shown that the distribution of different genotypes has changed over time, however the reasons for these fluctuations still remain to be investigated.

  18. Neotropical Bats from Costa Rica harbour Diverse Coronaviruses.

    Science.gov (United States)

    Moreira-Soto, A; Taylor-Castillo, L; Vargas-Vargas, N; Rodríguez-Herrera, B; Jiménez, C; Corrales-Aguilar, E

    2015-11-01

    Bats are hosts of diverse coronaviruses (CoVs) known to potentially cross the host-species barrier. For analysing coronavirus diversity in a bat species-rich country, a total of 421 anal swabs/faecal samples from Costa Rican bats were screened for CoV RNA-dependent RNA polymerase (RdRp) gene sequences by a pancoronavirus PCR. Six families, 24 genera and 41 species of bats were analysed. The detection rate for CoV was 1%. Individuals (n = 4) from four different species of frugivorous (Artibeus jamaicensis, Carollia perspicillata and Carollia castanea) and nectivorous (Glossophaga soricina) bats were positive for coronavirus-derived nucleic acids. Analysis of 440 nt. RdRp sequences allocated all Costa Rican bat CoVs to the α-CoV group. Several CoVs sequences clustered near previously described CoVs from the same species of bat, but were phylogenetically distant from the human CoV sequences identified to date, suggesting no recent spillover events. The Glossophaga soricina CoV sequence is sufficiently dissimilar (26% homology to the closest known bat CoVs) to represent a unique coronavirus not clustering near other CoVs found in the same bat species so far, implying an even higher CoV diversity than previously suspected. © 2015 Blackwell Verlag GmbH.

  19. Morphology-Induced Information Transfer in Bat Sonar

    Science.gov (United States)

    Reijniers, Jonas; Vanderelst, Dieter; Peremans, Herbert

    2010-10-01

    It has been argued that an important part of understanding bat echolocation comes down to understanding the morphology of the bat sound processing apparatus. In this Letter we present a method based on information theory that allows us to assess target localization performance of bat sonar, without a priori knowledge on the position, size, or shape of the reflecting target. We demonstrate this method using simulated directivity patterns of the frequency-modulated bat Micronycteris microtis. The results of this analysis indicate that the morphology of this bat’s sound processing apparatus has evolved to be a compromise between sensitivity and accuracy with the pinnae and the noseleaf playing different roles.

  20. Molecular evidence of Ebola Reston virus infection in Philippine bats.

    Science.gov (United States)

    Jayme, Sarah I; Field, Hume E; de Jong, Carol; Olival, Kevin J; Marsh, Glenn; Tagtag, Anson M; Hughes, Tom; Bucad, Anthony C; Barr, Jennifer; Azul, Rachel R; Retes, Lilia M; Foord, Adam; Yu, Meng; Cruz, Magdalena S; Santos, Imelda J; Lim, Theresa Mundita S; Benigno, Carolyn C; Epstein, Jonathan H; Wang, Lin-Fa; Daszak, Peter; Newman, Scott H

    2015-07-17

    In 2008-09, evidence of Reston ebolavirus (RESTV) infection was found in domestic pigs and pig workers in the Philippines. With species of bats having been shown to be the cryptic reservoir of filoviruses elsewhere, the Philippine government, in conjunction with the Food and Agriculture Organization of the United Nations, assembled a multi-disciplinary and multi-institutional team to investigate Philippine bats as the possible reservoir of RESTV. The team undertook surveillance of bat populations at multiple locations during 2010 using both serology and molecular assays. A total of 464 bats from 21 species were sampled. We found both molecular and serologic evidence of RESTV infection in multiple bat species. RNA was detected with quantitative PCR (qPCR) in oropharyngeal swabs taken from Miniopterus schreibersii, with three samples yielding a product on conventional hemi-nested PCR whose sequences differed from a Philippine pig isolate by a single nucleotide. Uncorroborated qPCR detections may indicate RESTV nucleic acid in several additional bat species (M. australis, C. brachyotis and Ch. plicata). We also detected anti-RESTV antibodies in three bats (Acerodon jubatus) using both Western blot and ELISA. The findings suggest that ebolavirus infection is taxonomically widespread in Philippine bats, but the evident low prevalence and low viral load warrants expanded surveillance to elaborate the findings, and more broadly, to determine the taxonomic and geographic occurrence of ebolaviruses in bats in the region.

  1. Reproductive ecology of Commerson's leaf-nosed bats ...

    African Journals Online (AJOL)

    Reproductive ecology of Commerson's leaf-nosed bats Hipposideros commersoni (Chiroptera: Hipposideridae) in South-Central Africa: interactions between seasonality and large body size; and implications for conservation.

  2. Adaptive vocal behavior drives perception by echolocation in bats.

    Science.gov (United States)

    Moss, Cynthia F; Chiu, Chen; Surlykke, Annemarie

    2011-08-01

    Echolocation operates through adaptive sensorimotor systems that collectively enable the bat to localize and track sonar objects as it flies. The features of sonar signals used by a bat to probe its surroundings determine the information available to its acoustic imaging system. In turn, the bat's perception of a complex scene guides its active adjustments in the features of subsequent sonar vocalizations. Here, we propose that the bat's active vocal-motor behaviors play directly into its representation of a dynamic auditory scene. Copyright © 2011 Elsevier Ltd. All rights reserved.

  3. Sensorimotor Model of Obstacle Avoidance in Echolocating Bats.

    Science.gov (United States)

    Vanderelst, Dieter; Holderied, Marc W; Peremans, Herbert

    2015-10-01

    Bat echolocation is an ability consisting of many subtasks such as navigation, prey detection and object recognition. Understanding the echolocation capabilities of bats comes down to isolating the minimal set of acoustic cues needed to complete each task. For some tasks, the minimal cues have already been identified. However, while a number of possible cues have been suggested, little is known about the minimal cues supporting obstacle avoidance in echolocating bats. In this paper, we propose that the Interaural Intensity Difference (IID) and travel time of the first millisecond of the echo train are sufficient cues for obstacle avoidance. We describe a simple control algorithm based on the use of these cues in combination with alternating ear positions modeled after the constant frequency bat Rhinolophus rouxii. Using spatial simulations (2D and 3D), we show that simple phonotaxis can steer a bat clear from obstacles without performing a reconstruction of the 3D layout of the scene. As such, this paper presents the first computationally explicit explanation for obstacle avoidance validated in complex simulated environments. Based on additional simulations modelling the FM bat Phyllostomus discolor, we conjecture that the proposed cues can be exploited by constant frequency (CF) bats and frequency modulated (FM) bats alike. We hypothesize that using a low level yet robust cue for obstacle avoidance allows bats to comply with the hard real-time constraints of this basic behaviour.

  4. Sensorimotor Model of Obstacle Avoidance in Echolocating Bats.

    Directory of Open Access Journals (Sweden)

    Dieter Vanderelst

    2015-10-01

    Full Text Available Bat echolocation is an ability consisting of many subtasks such as navigation, prey detection and object recognition. Understanding the echolocation capabilities of bats comes down to isolating the minimal set of acoustic cues needed to complete each task. For some tasks, the minimal cues have already been identified. However, while a number of possible cues have been suggested, little is known about the minimal cues supporting obstacle avoidance in echolocating bats. In this paper, we propose that the Interaural Intensity Difference (IID and travel time of the first millisecond of the echo train are sufficient cues for obstacle avoidance. We describe a simple control algorithm based on the use of these cues in combination with alternating ear positions modeled after the constant frequency bat Rhinolophus rouxii. Using spatial simulations (2D and 3D, we show that simple phonotaxis can steer a bat clear from obstacles without performing a reconstruction of the 3D layout of the scene. As such, this paper presents the first computationally explicit explanation for obstacle avoidance validated in complex simulated environments. Based on additional simulations modelling the FM bat Phyllostomus discolor, we conjecture that the proposed cues can be exploited by constant frequency (CF bats and frequency modulated (FM bats alike. We hypothesize that using a low level yet robust cue for obstacle avoidance allows bats to comply with the hard real-time constraints of this basic behaviour.

  5. Host and viral ecology determine bat rabies seasonality and maintenance

    Science.gov (United States)

    George, D.B.; Webb, C.T.; Farnsworth, Matthew L.; O'Shea, T.J.; Bowen, R.A.; Smith, D.L.; Stanley, T.R.; Ellison, L.E.; Rupprecht, C.E.

    2011-01-01

    Rabies is an acute viral infection that is typically fatal. Most rabies modeling has focused on disease dynamics and control within terrestrial mammals (e.g., raccoons and foxes). As such, rabies in bats has been largely neglected until recently. Because bats have been implicated as natural reservoirs for several emerging zoonotic viruses, including SARS-like corona viruses, henipaviruses, and lyssaviruses, understanding how pathogens are maintained within a population becomes vital. Unfortunately, little is known about maintenance mechanisms for any pathogen in bat populations. We present a mathematical model parameterized with unique data from an extensive study of rabies in a Colorado population of big brown bats (Eptesicus fuscus) to elucidate general maintenance mechanisms. We propose that life history patterns of many species of temperate-zone bats, coupled with sufficiently long incubation periods, allows for rabies virus maintenance. Seasonal variability in bat mortality rates, specifically low mortality during hibernation, allows long-term bat population viability. Within viable bat populations, sufficiently long incubation periods allow enough infected individuals to enter hibernation and survive until the following year, and hence avoid an epizootic fadeout of rabies virus. We hypothesize that the slowing effects of hibernation on metabolic and viral activity maintains infected individuals and their pathogens until susceptibles from the annual birth pulse become infected and continue the cycle. This research provides a context to explore similar host ecology and viral dynamics that may explain seasonal patterns and maintenance of other bat-borne diseases.

  6. Bats and Emerging Infections: An Ecological and Virological Puzzle.

    Science.gov (United States)

    Serra-Cobo, Jordi; López-Roig, Marc

    2017-01-01

    More than 200 viruses have been detected in bats. Some unique bat characteristics can explain the roles played in the maintenance and transmission of viruses: long phylogenetic history can have originated coevolution processes, great number of species are adapted to live in different environments, big mobility, long lifespan and gregarious behaviour of many species.To analyse zoonoses long longitudinal studies are needed with a multidisciplinary approximation to obtain the following eco-epidemiological data: colony size, number of bats per species, population structure, behaviour of each species, degree of contact between bats, social structure, remaining time of bats in the colony, colony type, foraging area, turnover rate of individuals, shelter temperature, relationship with other colonies and co-infection processes. These data allows assessing the epidemiological risk and which preventive measures are necessary to take.The structure and functionality of ecosystems are changing worldwide at an unprecedented rate and can modify the interactions between humans and infected bats. There are more or less local factors that can affect the emergence and spread of diseases (environmental alterations, changes in land use, human population growth, changes in human socioeconomic behavior or social structure, people mobility increase, trade increase, forest fires, extreme weather events, wars, breakdown in public health infrastructure, etc.).Twenty-three percent of all bat species in the world are decreasing. How does the regression of bat species affect the dynamic of viruses? The dichotomy between health risk and bat preservation is compatible with a preventive task based on more information and training.

  7. [Ixodid ticks in the mountainous part of the Crimea].

    Science.gov (United States)

    Markeshin, S Ia; Evstaf'ev, I L; Kovin, V V; Evstratov, Iu V

    1992-01-01

    About a hundred of patients with tick-borne encephalitis (TBE) were recorded over the latest decade in the Crimea, and 60 TBE virus strains were isolated from the ticks collected on the peninsula. The results of studies carried out in 1986-1990 helped define the borders of 4 local natural foci of TBE, study their acarifauna, detect the principal TBE vector--Ixodes ricinus (with a mean virophority of 0.6%), and distinguish two foci with a combination of TBE and Crimean-Congo hemorrhagic fever.

  8. Interaction of the tick immune system with transmitted pathogens

    Czech Academy of Sciences Publication Activity Database

    Hajdušek, Ondřej; Šíma, Radek; Ayllón, N.; Jalovecká, M.; Pernes, J.; de la Fuente, J.; Kopáček, Petr

    2013-01-01

    Roč. 3, Jul 2013 (2013), a26 ISSN 2235-2988 R&D Projects: GA ČR GAP506/10/2136; GA ČR GA13-11043S; GA ČR GP13-27630P; GA ČR GP13-12816P; GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : Anaplasma * Babesia * Borrelia * antimicrobial peptides * innate immunity * phagocytosis * tick * tick-borne diseases Subject RIV: EC - Immunology Impact factor: 2.620, year: 2013

  9. Emerging Tick-Borne Viruses in the Twenty-First Century

    Directory of Open Access Journals (Sweden)

    Karen L. Mansfield

    2017-07-01

    Full Text Available Ticks, as a group, are second only to mosquitoes as vectors of pathogens to humans and are the primary vector for pathogens of livestock, companion animals, and wildlife. The role of ticks in the transmission of viruses has been known for over 100 years and yet new pathogenic viruses are still being detected and known viruses are continually spreading to new geographic locations. Partly as a result of their novelty, tick-virus interactions are at an early stage in understanding. For some viruses, even the principal tick-vector is not known. It is likely that tick-borne viruses will continue to emerge and challenge public and veterinary health long into the twenty-first century. However, studies focusing on tick saliva, a critical component of tick feeding, virus transmission, and a target for control of ticks and tick-borne diseases, point toward solutions to emerging viruses. The aim of this review is to describe some currently emerging tick-borne diseases, their causative viruses, and to discuss research on virus-tick interactions. Through focus on this area, future protein targets for intervention and vaccine development may be identified.

  10. Tick infestation on wild snakes in northern part of western Ghats of India.

    Science.gov (United States)

    Pandit, Pranav; Bandivdekar, Ruta; Geevarghese, G; Pande, Satish; Mandke, Omkar

    2011-05-01

    In total, 167 individuals of 30 species of snakes belonging to 22 genera and five families were examined for tick infestation from November 2008 to March 2010. Only two species of snakes, Ptyas mucosa (L., 1758) (Indian rat snake) and Naja naja (L., 1758) (spectacled cobra), were found infested by ticks. All ticks collected were identified to be Amblyomma gervaisi [previously Aponomma gervaisi (Lucas, 1847) 1. The average prevalence of these ticks on Indian rat snakes (n=48) was 29.16%, with abundance of 7.02 ticks per individual; on spectacled cobras (n=20), average prevalence was 30.00%, with abundance of 6.9 ticks per individual. The nymphs and males were predominant. All the ticks were found on the dorsal aspect of the body of the snake, and no ticks were recorded on the head, tail, or ventral body. The rate of tick infestation was highest in scrubland and was lowest in evergreen forests. Female Indian rat snakes showed higher tick infestation rates than male Indian rat snakes. Using Mann-Whitney U test, we found that longer snakes of both species had significantly higher rate of tick infestation in both the species of snakes.

  11. Potential exposure to Australian bat lyssavirus is unlikely to prevent future bat handling among adults in South East Queensland.

    Science.gov (United States)

    Young, M K; Banu, S; McCall, B J; Vlack, S; Carroll, H; Bennett, S; Davison, R; Francis, D

    2018-02-01

    Despite ongoing public health messages about the risks associated with bat contact, the number of potential exposures to Australian bat lyssavirus (ABLV) due to intentional handling by members of the general public in Queensland has remained high. We sought to better understand the reasons for intentional handling among these members of the public who reported their potential exposure to inform future public health messages. We interviewed adults who resided in a defined geographic area in South East Queensland and notified potential exposure to ABLV due to intentional handling of bats by telephone between 1 January 2012 and 31 December 2013. The participation rate was 54%. Adults who reported they had intentionally handled bats in South East Queensland indicated high levels of knowledge and perception of a moderately high risk associated with bats with overall low intentions to handle bats in the future. However, substantial proportions of people would attempt to handle bats again in some circumstances, particularly to protect their children or pets. Fifty-two percent indicated that they would handle a bat if a child was about to pick up or touch a live bat, and 49% would intervene if a pet was interacting with a bat. Future public health communications should recognize the situations in which even people with highrisk perceptions of bats will attempt to handle them. Public health messages currently focus on avoidance of bats in all circumstances and recommend calling in a trained vaccinated handler, but messaging directed at adults for circumstances where children or pets may be potentially exposed should provide safe immediate management options. © 2017 Blackwell Verlag GmbH.

  12. Heat Transfer of Fibrous Insulation Battings

    Science.gov (United States)

    1984-01-01

    This was achiev the lower bulk-density regular fiber and the fine bulk-densities of the uncompressed higher bulk- de Sets of pb and d curves for the...34, J. of Thermal Insulation, Vol. 1, July, 1977, p. 49. 10. Mark, M., and Derecho , C. T., Jr., "Packing Coefficient and...Specification MIL-S-43880, Sleeping Bag, Extreme Cold (Down and Polyester Batting), 15 Mar 1979. 19. Breckenridge, J. R., "Insulating Effectiveness

  13. Identifying Hendra virus diversity in pteropid bats.

    Directory of Open Access Journals (Sweden)

    Ina Smith

    Full Text Available Hendra virus (HeV causes a zoonotic disease with high mortality that is transmitted to humans from bats of the genus Pteropus (flying foxes via an intermediary equine host. Factors promoting spillover from bats to horses are uncertain at this time, but plausibly encompass host and/or agent and/or environmental factors. There is a lack of HeV sequence information derived from the natural bat host, as previously sequences have only been obtained from horses or humans following spillover events. In order to obtain an insight into possible variants of HeV circulating in flying foxes, collection of urine was undertaken in multiple flying fox roosts in Queensland, Australia. HeV was found to be geographically widespread in flying foxes with a number of HeV variants circulating at the one time at multiple locations, while at times the same variant was found circulating at disparate locations. Sequence diversity within variants allowed differentiation on the basis of nucleotide changes, and hypervariable regions in the genome were identified that could be used to differentiate circulating variants. Further, during the study, HeV was isolated from the urine of flying foxes on four occasions from three different locations. The data indicates that spillover events do not correlate with particular HeV isolates, suggesting that host and/or environmental factors are the primary determinants of bat-horse spillover. Thus future spillover events are likely to occur, and there is an on-going need for effective risk management strategies for both human and animal health.

  14. On the potential roles of ticks and migrating birds in the ecology of West Nile virus

    Directory of Open Access Journals (Sweden)

    Karl Hagman

    2014-01-01

    Full Text Available Background: Mosquitoes are the primary vectors of West Nile virus (WNV. Ticks have, however, been suggested to be potential reservoirs of WNV. To investigate their role in the spread of the virus, ticks, which had been collected from birds migrating northward from Africa to Europe, were analyzed for the potential presence of WNV RNA. Methods: On the Mediterranean islands of Capri and Antikythira, a total of 14,824 birds were captured and investigated from which 747 ticks were collected. Results and conclusions: Most of the identified ticks (93% were nymphs and larvae of Hyalomma marginatum sensu lato (s.l., most of which were or appear to be Hyalomma rufipes. Of these ticks, 729 were individually screened for WNV RNA. None of the ticks was found to be WNV positive. Thus, there was no evidence that H. marginatum s.l. ticks play a role in the spread of WNV from Africa to Europe.

  15. Borrelia miyamotoi in host-seeking Ixodes ricinus ticks in England.

    Science.gov (United States)

    Hansford, K M; Fonville, M; Jahfari, S; Sprong, H; Medlock, J M

    2015-04-01

    This paper reports the first detection of Borrelia miyamotoi in UK Ixodes ricinus ticks. It also reports on the presence and infection rates of I. ricinus for a number of other tick-borne pathogens of public health importance. Ticks from seven regions in southern England were screened for B. miyamotoi, Borrelia burgdorferi sensu lato (s.l.), Anaplasma phagocytophilum and Neoehrlichia mikurensis using qPCR. A total of 954 I. ricinus ticks were tested, 40 were positive for B. burgdorferi s.l., 22 positive for A. phagocytophilum and three positive for B. miyamotoi, with no N. mikurensis detected. The three positive B. miyamotoi ticks came from three geographically distinct areas, suggesting a widespread distribution, and from two separate years, suggesting some degree of endemicity. Understanding the prevalence of Borrelia and other tick-borne pathogens in ticks is crucial for locating high-risk areas of disease transmission.

  16. [Geographic data for Neotropical bats (Chiroptera)].

    Science.gov (United States)

    Noguera-Urbano, Elkin A; Escalante, Tania

    2014-03-01

    The global effort to digitize biodiversity occurrence data from collections, museums and other institutions has stimulated the development of important tools to improve the knowledge and conservation of biodiversity. The Global Biodiversity Information Facility (GBIF) enables and opens access to biodiversity data of 321 million of records, from 379 host institutions. Neotropical bats are a highly diverse and specialized group, and the geographic information about them is increasing since few years ago, but there are a few reports about this topic. The aim of this study was to analyze the number of digital records in GBIF of Neotropical bats with distribution in 21 American countries, evaluating their nomenclatural and geographical consistence at scale of country. Moreover, we evaluated the gaps of information on 1 degrees latitude x 1 degrees longitude grids cells. There were over 1/2 million records, but 58% of them have no latitude and longitude data; and 52% full fit nomenclatural and geographic evaluation. We estimated that there are no records in 54% of the analyzed area; the principal gaps are in biodiversity hotspots like the Colombian and Brazilian Amazonia and Southern Venezuela. In conclusion, our study suggests that available data on GBIF have nomenclatural and geographic biases. GBIF data represent partially the bat species richness and the main gaps in information are in South America.

  17. Structures of bats; Komori no kozo

    Energy Technology Data Exchange (ETDEWEB)

    Natori, M. [Institute of the Space and Astronautical Science,Tokyo (Japan); Kishimoto, N. [The University of Tokyo, Tokyo (Japan)

    1999-12-05

    This paper gives an outline of the structures of bats. Unlike birds, bats have a wing membrane structure. The membrane constituted of the skin is spread between five fingers to form the wing. The wing membrane is seen in the forelimbs and the tail. In the chest and the shoulder, the ligament sheet supports the muscles. The wing membrane is about 0.5mm in thickness, with a fiber net woven through reflecting a tension field in flying. The fiber net is composed of compound materials of elastin and collagen. The shoulder joints consists of the clavicle, scapula and humerus, which is close to human beings. The elbow joints rotate only inside the plane of the wings. The leg joints are hook-shaped, with the tendon sheath provided with ruggedness. The carpus is made up of eight bones and is characterized by the ability of spreading and storing the wings. At the time of storing the wing membrane, the finger joints are stored and, during the flight after the wings are spread, it forms the flapping wing plane. Lightweight and formation of the sturdy front edge are characteristics common to other flying creatures. The spreading and the storing are possible through the direct motion of the hands. The shoulder joints and the carpus of the human beings are closer to those of bats than to those of birds. (NEDO)

  18. Visual-Motor Control in Baseball Batting

    Directory of Open Access Journals (Sweden)

    Rob Gray

    2011-05-01

    Full Text Available With margins for error of a few milliseconds and fractions of an inch it is not surprising that hitting a baseball is considered to be one of the most difficult acts in all of sports. We have been investigating this challenging behavior using a virtual baseball batting setup in which simulations of an approaching ball, pitcher, and field are combined with real-time recording of bat and limb movements. I will present evidence that baseball batting involves variable pre-programmed control in which the swing direction and movement time (MT are set prior to the initiation of the action but can take different values from swing-to-swing. This programming process utilizes both advance information (pitch history and count and optical information picked-up very early in the ball's flight (ball time to contact TTC and rotation direction. The pre-programmed value of MT is used to determine a critical value of TTC for swing initiation. Finally, because a baseball swing is an action that is occasionally interrupted online (i.e., a “check swing”, I will discuss experiments that examine when this pre-programmed action can be stopped and the sources of optical information that trigger stopping.

  19. Bats of the Western Indian Ocean Islands

    Directory of Open Access Journals (Sweden)

    John O’Brien

    2011-08-01

    Full Text Available The natural colonisation of many remote oceanic islands by bats, including those of the western Indian Ocean, has been facilitated by their unique capability among mammals for powered flight. In the western Indian Ocean region, only the Malagasy islands of Madagascar and the Comoros archipelago have been naturally colonised by non-volant mammals. Despite their greater potential for inter-island dispersal, and thus gene transfer, endemicity of Chiroptera in the western Indian Ocean islands is high. Given their vulnerability to stochastic and anthropogenic disturbances, greater focus needs to be placed on investigating the demographic and ecological history of bats on Western Indian Ocean islands to safeguard not only their future, but also the ecosystem functioning on these islands, for which they are undoubtedly such an integral part. Here, I summarise the taxonomic and life history information available on bats from Western Indian Ocean islands and highlight knowledge gaps and conservation issues that threaten the continued persistence of some species.

  20. To beat or not to beat a tick: comparison of DNA extraction methods for ticks (Ixodes scapularis

    Directory of Open Access Journals (Sweden)

    Alyssa D. Ammazzalorso

    2015-08-01

    Full Text Available Background. Blacklegged ticks (Ixodes scapularis are important disease vectors in the United States, known to transmit a variety of pathogens to humans, including bacteria, protozoa, and viruses. Their importance as a disease vector necessitates reliable and comparable methods for extracting microbial DNA from ticks. Furthermore, to explore the population genetics or genomics of this tick, appropriate DNA extraction techniques are needed for both the vector and its microbes. Although a few studies have investigated different methods of DNA isolation from ticks, they are limited in the number and types of DNA extraction and lack species-specific quantification of DNA yield.Methods. Here we determined the most efficient and consistent method of DNA extraction from two different developmental stages of I. scapularis—nymph and adult—that are the most important for disease transmission. We used various methods of physical disruption of the hard, chitinous exoskeleton, as well as commercial and non-commercial DNA isolation kits. To gauge the effectiveness of these methods, we quantified the DNA yield and confirmed the DNA quality via PCR of both tick and microbial genetic material.Results. DNA extraction using the Thermo GeneJET Genomic DNA Purification Kit resulted in the highest DNA yields and the most consistent PCR amplification when combined with either cutting or bead beating with select matrices across life stages. DNA isolation methods using ammonium hydroxide as well as the MoBio PowerSoil kit also produced strong and successful PCR amplification, but only for females.Discussion. We contrasted a variety of readily available methods of DNA extraction from single individual blacklegged ticks and presented the results through a quantitative and qualitative assessment.