WorldWideScience

Sample records for bat tick carios

  1. Ticks infesting bats (Mammalia: Chiroptera) in the Brazilian Pantanal.

    Science.gov (United States)

    Muñoz-Leal, Sebastián; Eriksson, Alan; Santos, Carolina Ferreira; Fischer, Erich; de Almeida, Juliana Cardoso; Luz, Hermes R; Labruna, Marcelo B

    2016-05-01

    Ticks associated with bats have been poorly documented in the Neotropical Zoogeographical Region. In this study, a total of 1028 bats were sampled for tick infestations in the southern portion of the Brazilian Pantanal. A total of 368 ticks, morphologically identified as Ornithodoros hasei (n = 364) and O. mimon (n = 4), were collected from the following bat species: Artibeus planirostris, Platyrrhinus lineatus, Phyllostomus hastatus, Mimon crenulatum and Noctilio albiventris. Morphological identification of O. hasei was confirmed by molecular analysis. Regarding the most abundant bat species, only 40 (6.2%) out of 650 A. planirostris were infested by O. hasei, with a mean intensity of 7.2 ticks per infested bat, or a mean abundance of 0.44 ticks per sampled bat. Noteworthy, one single P. hastatus was infested by 55 O. hasei larvae, in contrast to the 2.5-7.2 range of mean intensity values for the whole study. As a complement to the present study, a total of 8 museum bat specimens (6 Noctilio albiventris and 2 N. leporinus), collected in the northern region of Pantanal, were examined for tick infestations. These bats contained 176 ticks, which were all morphologically identified as O. hasei larvae. Mean intensity of infestation was 22, with a range of 1-46 ticks per infested bat. Our results suggest that A. planirostris might play an important role in the natural life cycle of O. hasei in the Pantanal.

  2. Ticks parasitizing bats (Mammalia: Chiroptera in the Caatinga Biome, Brazil

    Directory of Open Access Journals (Sweden)

    Hermes Ribeiro Luz

    Full Text Available Abstract In this paper, the authors report ticks parasitizing bats from the Serra das Almas Natural Reserve (RPPN located in the municipality of Crateús, state of Ceará, in the semiarid Caatinga biome of northeastern Brazil. The study was carried out during nine nights in the dry season (July 2012 and 10 nights in the rainy season (February 2013. Only bats of the Phyllostomidae and Mormoopidae families were parasitized by ticks. The species Artibeus planirostris and Carolia perspicillata were the most parasitized. A total of 409 larvae were collected and classified into three genera: Antricola (n = 1, Nothoaspis (n = 1 and Ornithodoros (n = 407. Four species were morphologically identified as Nothoaspis amazoniensis, Ornithodoros cavernicolous, Ornithodoros fonsecai, Ornithodoros hasei, and Ornithodoros marinkellei. Ornithodoros hasei was the most common tick associated with bats in the current study. The present study expand the distributional ranges of at least three soft ticks into the Caatinga biome, and highlight an unexpected richness of argasid ticks inhabiting this arid ecosystem.

  3. DUA KEBENARAN DALAM NASKAH SUNDA CARIOS TAMIM

    Directory of Open Access Journals (Sweden)

    Rohim Rohim

    2015-02-01

    Full Text Available Artikel ini bertujuan menghadirkan teks naskah Sunda Carios Tamim yangberbentuk wawacan melalui suntingan teks dan analisis struktur. Selainsuntingan teks dan analisis struktur, untuk mengetahui keterpaduanperistiwa dalam mengeksplorasi tokoh digunakan teori aktan dan modelfungsional yang dikembangkan oleh Greimas. Dari hasil pembahasandiperoleh simpulan bahwa struktur formal Carios Tamim menggunakan 14jenis pupuh dengan 390 bait, 2644 larik dengan tiga unsur pembangun ceritayaitu manggala, isi cerita, dan penutup. Hasil analisis struktur teks naratifCarios Tamim ditemukan jalinan erat alur, tokoh, penokohan, dan latar sehingga terungkap tema cerita yaitu tegaknya kebenaran di antara duakebenaran. Kebenaran dalam teks Carios Tamim berhubungan denganmasalah munâkahah (pernikahan.  Berdasarkan uraian aktan dan modelfungsional  yang diajukan oleh Greimas, tokoh Tamim Ibnu Habib Al-Dâridan istrinya sebagai subjek berhasil memperoleh objek berkat peristiwa yangdialami keduanya saling berkaitan dalam hubungan sebab akibat.

  4. Evidence of Bartonella spp. in Blood and Ticks (Ornithodoros hasei) of Bats, in French Guiana.

    Science.gov (United States)

    Davoust, Bernard; Marié, Jean-Lou; Dahmani, Mustapha; Berenger, Jean-Michel; Bompar, Jean-Michel; Blanchet, Denis; Cheuret, Marie; Raoult, Didier; Mediannikov, Oleg

    2016-08-01

    We screened blood from 59 bats from French Guiana for Bartonella spp. PCRs were positive for 13.6% and culture was positive in one Noctilio albiventris and one Pteronotus parnellii, as well as in Ornithodoros hasei ticks collected from bats. Two isolated strains represent possible two new species.

  5. TWO TRUTHS IN SUNDANESE SCRIPT CARIOS TAMIM

    Directory of Open Access Journals (Sweden)

    Rohim

    2014-10-01

    Full Text Available This article aims to describe the Sundanese manuscript of wawacan Carios Tamim by way of editing its text and analyzing its structure.Besides, this article also explores how, by applying the actant theory and functional model promoted by Greimas, the events are sequentially related through the characters. From the analysis, it can be seen that the formal structure of Carios Tamim contains 14 pupuh in 390 couplets and 2644 lines in three elements of story making, i.e. the manggala (preliminary, the content of the story, and the ending. Meanwhile, the analysis of its narrative structure shows that Carios Tamim has the plot, the characters, the characterization, and the setting so closely related that they build up the theme of the story, i.e. raising a truth out of two truths. The truth as revealed in Carios Tamim is strongly concerned with the munakahat (marriage. On the ground of Greimas’ actant theory and functional model, the character Tamim Ibnu Habib Ad-Dāri and his wife as subjects are successfully managed to get on the object owing to the events they are experiencing are closely related one another in a causal relationship.

  6. Ticks

    Science.gov (United States)

    ... gov . Recommend on Facebook Tweet Share Compartir Avoiding Ticks Preventing tick bites Preventing ticks on your pets ... ticks in the yard New materials for this tick season: Medscape Expert Commentary — Tickborne Rickettsial Diseases: ...

  7. [Taxonomy of the Sokuluk virus (SOKV) (Flaviviridae, Flavivirus, Entebbe bat virus group) isolated from bats (Vespertilio pipistrellus Schreber, 1774), ticks (Argasidae Koch, 1844), and birds in Kyrgyzstan].

    Science.gov (United States)

    L'vov, D K; Al'khovskiĭ, S V; Shchelkanov, M Iu; Shchetinin, A M; Deriabin, P G; Gitel'man, A K; Samokhvalov, E I; Botikov, A G

    2014-01-01

    Complete genome sequencing of the Sokuluk virus (SOKV) isolated in Kyrgyzstan from bats Vespertilio pipistrellus and their obligatory parasites--Argasidae Koch, 1844, ticks was carried out. SOKV was classified as attributed to the Flaviviridae family, Flavivirus genus. The maximum homology (71% for nucleotide and 79% for amino acid sequences) was detected with respect to the Entebbe bat virus (ENTV). ENTV and SOKV form a group joining to the yellow fever virus (YFV) within the limits of the mosquito flavivirus branch. Close relation of SOKV with bat covers and human housings permits to assume SOKV potentially patogenic to human health.

  8. Bats.

    Science.gov (United States)

    Naturescope, 1986

    1986-01-01

    Presents information about bats, including definitions and descriptions of the characteristics of bats. Provides teaching activities such as "Bat and Math,""A Bat Like That,""Bat Party,""Ears in the Dark," and "The Big Bat Mystery." Contains reproducible handouts and quizzes. (TW)

  9. Ticks

    Science.gov (United States)

    Ginsberg, H.S.; Faulde, M.K.

    2008-01-01

    The most common vector-borne diseases in both Europe and North America are transmitted by ticks. Lyme borreliosis (LB), a tick-borne bacterial zoonosis, is the most highly prevalent. Other important tick-borne diseases include TBE (tick-borne encephalitis) and Crimean-Congo haemorrhagic fever in Europe, Rocky Mountain spotted fever (RMSF) in North America, and numerous less common tick-borne bacterial, viral, and protozoan diseases on both continents. The major etiological agent of LB is Borrelia burgdorferi in North America, while in Europe several related species of Borrelia can also cause human illness. These Borrelia genospecies differ in clinical manifestations, ecology (for example, some have primarily avian and others primarily mammalian reservoirs), and transmission cycles, so the epizootiology of LB is more complex in Europe than in North America. Ticks dwell predominantly in woodlands and meadows, and in association with animal hosts, with only limited colonization of human dwellings by a few species. Therefore, suburbanization has contributed substantially to the increase in tick-borne disease transmission in North America by fostering increased exposure of humans to tick habitat. The current trend toward suburbanization in Europe could potentially result in similar increases in transmission of tick-borne diseases. Incidence of tick-borne diseases can be lowered by active public education campaigns, targeted at the times and places of greatest potential for encounter between humans and infected ticks. Similarly, vaccines (e.g., against TBE) are most effective when made available to people at greatest risk, and for high-prevalence diseases such as LB. Consultation with vector-borne disease experts during the planning stages of new human developments can minimize the potential for residents to encounter infected ticks (e.g., by appropriate dwelling and landscape design). Furthermore, research on tick vectors, pathogens, transmission ecology, and on

  10. Ectoparasites in an urban population of big brown bats (Eptesicus fuscus) in Colorado

    Science.gov (United States)

    Pearce, R.D.; O'Shea, T.J.

    2007-01-01

    Ectoparasites of an urban population of big brown bats (Eptesicus fuscus) in Fort Collins, Colorado, were investigated during summers 2002, 2003, and 2004. Eleven species of ectoparasites were found (the macronyssid mite Steatonyssus occidentalis, the wing mite Spinturnix bakeri, the myobiid mites Acanthophthirius caudata and Pteracarus aculeus, the chirodiscid mite Alabidocarpus eptesicus, the demodicid mite Demodex sp., the chigger Leptotrombidium myotis, the soft tick Carios kelleyi, the batfly Basilia forcipata, the batbug Cimex pilosellus, and the flea Myodopsylla borealis). Five species were analyzed by prevalence and intensity (C. pilosellus, M. borealis, L. myotis, S. bakeri, and S. occidentalis) based on 2,161 counts of 1,702 marked individual bats over the 3 summer study periods. We investigated 4 factors potentially influencing prevalence and intensity: age class of the host, reproductive status of adult female hosts, roosts in which the hosts were found, and abiotic conditions during the year sampled. The macronyssid mite, S. occidentalis, was the most prevalent and abundant ectoparasite. Adult big brown bats had more ectoparasites than volant juveniles for most of the species analyzed. In a sample of known age bats at 1 large colony, bats of 4 yr of age or greater had higher ectoparasite loads of S. occidentalis and S. bakeri when compared with younger bats. Lactating female bats had the highest prevalence and intensities of most ectoparasites. Annual differences in ectoparasite prevalence and intensity were related to temperature and humidity, which can affect the nidicolous species of ectoparasites. Residents of 2 buildings sprayed insecticides in response to Cimex sp., and this appeared to reduce ectoparasitism of S. occidentalis and C. pilosellus present at these buildings. Intensity of S. occidentalis had no influence on annual survival of big brown bats. ?? American Society of Parasitologists 2007.

  11. Tick Paralysis

    Science.gov (United States)

    ... Physician’s Resources Contact About The Foundation Select Page Tick Paralysis Menu What is Tick Paralysis? Where is ... How to Remove a Tick Deer Tick Ecology Tick-Borne Diseases Anaplasmosis Babesiosis Borrelia miyamotoi infections Colorado ...

  12. Tick Removal

    Science.gov (United States)

    ... ticks Tickborne diseases abroad Borrelia miyamotoi Borrelia mayonii Tick Removal Recommend on Facebook Tweet Share Compartir If ... a tick quite effectively. How to remove a tick Use fine-tipped tweezers to grasp the tick ...

  13. Tick Bites

    Science.gov (United States)

    ... that go outdoors, you need to beware of ticks. Ticks are small bloodsucking parasites. Many species transmit diseases ... of the diseases you can get from a tick bite are Lyme disease, ehrlichiosis, Rocky Mountain spotted ...

  14. Stop Ticks

    Science.gov (United States)

    ... this? Submit Button Past Emails CDC Features Stop Ticks Language: English Español (Spanish) Recommend on Facebook Tweet ... What to Do if You Find an Attached Tick Remove the attached tick as soon as you ...

  15. Detection of a novel Rickettsia sp. in soft ticks (Acari: Argasidae) in Algeria.

    Science.gov (United States)

    Lafri, Ismail; Leulmi, Hamza; Baziz-Neffah, Fadhila; Lalout, Reda; Mohamed, Chergui; Mohamed, Karakallah; Parola, Philippe; Bitam, Idir

    2015-01-01

    Argasid ticks are vectors of viral and bacterial agents that can infect humans and animals. In Africa, relapsing fever borreliae are neglected arthropod-borne pathogens that cause mild to deadly septicemia and miscarriage. It would be incredibly beneficial to be able to simultaneous detect and identify other pathogens transmitted by Argasid ticks. From 2012 to 2014, we conducted field surveys in 4 distinct areas of Algeria. We investigated the occurrence of soft ticks in rodent burrows and yellow-legged gull (Larus michahellis) nests in 10 study sites and collected 154 soft ticks. Molecular identification revealed the occurrence of two different soft tick genera and five species, including Carios capensis in yellow-legged gull nests and Ornithodoros occidentalis, Ornithodoros rupestris, Ornithodoros sonrai, Ornithodoros erraticus in rodent burrows. Rickettsial DNA was detected in 41/154, corresponding to a global detection rate of 26.6%. Sequences of the citrate synthase (gltA) gene suggest that this agent is a novel spotted fever group Rickettsia. For the first time in Algeria, we characterize a novel Rickettsia species by molecular means in soft ticks.

  16. Diversity and global distribution of the Coxiella intracellular bacterium in seabird ticks.

    Science.gov (United States)

    Duron, Olivier; Jourdain, Elsa; McCoy, Karen D

    2014-09-01

    The obligate intracellular bacterium Coxiella burnetii is the etiological agent of Q fever, a widespread zoonotic disease whose most common animal reservoirs are domestic ruminants. Recently, a variety of Coxiella-like organisms have also been reported from non-mammalian hosts, including pathogenic forms in birds and forms without known effects in ticks, raising questions about the potential importance of non-mammalian hosts as reservoirs of Coxiella in the wild. In the present study, we examined the potential role of globally-distributed seabird ticks as reservoirs of these bacteria. To this aim, we tested for Coxiella infection 11 geographically distinct populations of two tick species frequently found in seabird breeding colonies, the hard tick Ixodes uriae (Ixodidae) and soft ticks of the Ornithodoros (Carios) capensis group (Argasidae). We found Coxiella-like organisms in all O. capensis sensu lato specimens, but only in a few I. uriae specimens of one population. The sequencing of 16S rDNA and GroEL gene sequences further revealed an unexpected Coxiella diversity, with seven genetically distinct Coxiella-like organisms present in seabird tick populations. Phylogenetic analyses show that these Coxiella-like organisms originate from three divergent subclades within the Coxiella genus and that none of the Coxiella strains found in seabird ticks are genetically identical to the forms known to be associated with pathogenicity in vertebrates, including C. burnetii. Using this data set, we discuss the potential epidemiological significance of the presence of Coxiella in seabird ticks. Notably, we suggest that these organisms may not be pathogenic forms, but rather behave as endosymbionts engaged in intricate interactions with their tick hosts.

  17. Detection and identification of putative bacterial endosymbionts and endogenous viruses in tick cell lines☆

    Science.gov (United States)

    Alberdi, M. Pilar; Dalby, Matthew J.; Rodriguez-Andres, Julio; Fazakerley, John K.; Kohl, Alain; Bell-Sakyi, Lesley

    2012-01-01

    As well as being vectors of many viral, bacterial, and protozoan pathogens of medical and veterinary importance, ticks harbour a variety of microorganisms which are not known to be pathogenic for vertebrate hosts. Continuous cell lines established from ixodid and argasid ticks could be infected with such endosymbiotic bacteria and endogenous viruses, but to date very few cell lines have been examined for their presence. DNA and RNA extracted from over 50 tick cell lines deposited in the Roslin Wellcome Trust Tick Cell Biobank (http://tickcells.roslin.ac.uk) were screened for presence of bacteria and RNA viruses, respectively. Sequencing of PCR products amplified using pan-16S rRNA primers revealed the presence of DNA sequences from bacterial endosymbionts in several cell lines derived from Amblyomma and Dermacentor spp. ticks. Identification to species level was attempted using Rickettsia- and Francisella-specific primers. Pan-Nairovirus primers amplified PCR products of uncertain specificity in cell lines derived from Rhipicephalus, Hyalomma, Ixodes, Carios, and Ornithodoros spp. ticks. Further characterisation attempted with primers specific for Crimean-Congo haemorrhagic fever virus segments confirmed the absence of this arbovirus in the cells. A set of pan-Flavivirus primers did not detect endogenous viruses in any of the cell lines. Transmission electron microscopy revealed the presence of endogenous reovirus-like viruses in many of the cell lines; only 4 of these lines gave positive results with primers specific for the tick Orbivirus St Croix River virus, indicating that there may be additional, as yet undescribed ‘tick-only’ viruses inhabiting tick cell lines. PMID:22743047

  18. Detection and identification of putative bacterial endosymbionts and endogenous viruses in tick cell lines.

    Science.gov (United States)

    Alberdi, M Pilar; Dalby, Matthew J; Rodriguez-Andres, Julio; Fazakerley, John K; Kohl, Alain; Bell-Sakyi, Lesley

    2012-06-01

    As well as being vectors of many viral, bacterial, and protozoan pathogens of medical and veterinary importance, ticks harbour a variety of microorganisms which are not known to be pathogenic for vertebrate hosts. Continuous cell lines established from ixodid and argasid ticks could be infected with such endosymbiotic bacteria and endogenous viruses, but to date very few cell lines have been examined for their presence. DNA and RNA extracted from over 50 tick cell lines deposited in the Roslin Wellcome Trust Tick Cell Biobank (http://tickcells.roslin.ac.uk) were screened for presence of bacteria and RNA viruses, respectively. Sequencing of PCR products amplified using pan-16S rRNA primers revealed the presence of DNA sequences from bacterial endosymbionts in several cell lines derived from Amblyomma and Dermacentor spp. ticks. Identification to species level was attempted using Rickettsia- and Francisella-specific primers. Pan-Nairovirus primers amplified PCR products of uncertain specificity in cell lines derived from Rhipicephalus, Hyalomma, Ixodes, Carios, and Ornithodoros spp. ticks. Further characterisation attempted with primers specific for Crimean-Congo haemorrhagic fever virus segments confirmed the absence of this arbovirus in the cells. A set of pan-Flavivirus primers did not detect endogenous viruses in any of the cell lines. Transmission electron microscopy revealed the presence of endogenous reovirus-like viruses in many of the cell lines; only 4 of these lines gave positive results with primers specific for the tick Orbivirus St Croix River virus, indicating that there may be additional, as yet undescribed 'tick-only' viruses inhabiting tick cell lines.

  19. Pesky Ticks

    Centers for Disease Control (CDC) Podcasts

    2013-04-09

    In this podcast for kids, the Kidtastics talk about the dangers of ticks and how to protect yourself from them.  Created: 4/9/2013 by Centers for Disease Control and Prevention (CDC).   Date Released: 4/9/2013.

  20. Ticks: Geographic Distribution

    Science.gov (United States)

    ... of 4,000 to 10,500 feet. Transmits: Rocky Mountain spotted fever , Colorado tick fever , and tularemia . Comments: Adult ticks feed primarily on large mammals. Larvae and nymphs feed on small rodents. Adult ...

  1. Biological control of ticks

    Science.gov (United States)

    Samish, M.; Ginsberg, H.; Glazer, I.; Bowman, A.S.; Nuttall, P.

    2004-01-01

    Ticks have numerous natural enemies, but only a few species have been evaluated as tick biocontrol agents (BCAs). Some laboratory results suggest that several bacteria are pathogenic to ticks, but their mode of action and their potential value as biocontrol agents remain to be determined. The most promising entomopathogenic fungi appear to be Metarhizium anisopliae and Beauveria bassiana, strains of which are already commercially available for the control of some pests. Development of effective formulations is critical for tick management. Entomopathogenic nematodes that are pathogenic to ticks can potentially control ticks, but improved formulations and selection of novel nematode strains are needed. Parasitoid wasps of the genus Ixodiphagus do not typically control ticks under natural conditions, but inundative releases show potential value. Most predators of ticks are generalists, with a limited potential for tick management (one possible exception is oxpeckers in Africa). Biological control is likely to play a substantial role in future IPM programmes for ticks because of the diversity of taxa that show high potential as tick BCAs. Considerable research is required to select appropriate strains, develop them as BCAs, establish their effectiveness, and devise production strategies to bring them to practical use.

  2. Preventing Ticks on Your Pets

    Science.gov (United States)

    ... of ticks in the environment Prevents tickborne disease Cons: Tick bites can cause a painful wound and ... wounds and possible resulting infections Prevents tickborne disease Cons: Will not reduce the number of ticks in ...

  3. Learning about Bats and Rabies

    Science.gov (United States)

    ... About CDC.gov . Rabies Rabies Homepage Share Compartir Learning about bats and rabies Most bats don t ... Monday-Friday Closed Holidays cdcinfo@cdc.gov Bats Learning about bats and rabies Coming in contact with ...

  4. Management of ticks and tick-borne diseases

    Science.gov (United States)

    Ginsberg, H.S.; Stafford, K.C.; Goodman, J.L.; Dennis, D.T.; Sonenshine, D .E.

    2005-01-01

    The mainstays of tick management and protection from tick-borne diseases have traditionally been personal precautions and the application of acaricides. These techniques maintain their value, and current innovations hold considerable promise for future improvement in effective targeting of materials for tick control. Furthermore, an explosion of research in the past few decades has resulted in the development and expansion of several novel and potentially valuable approaches to tick control, including vaccination against tick-borne pathogen transmission and against tick attachment, host management, use of natural enemies (especially entomopathogenic fungi), and pheromone-based techniques. The situations that require tick management are diverse, and occur under varied ecological conditions. Therefore, the likelihood of finding a single ?magic bullet? for tick management is low. In practical terms, the approach to tick management or to management of tick-borne disease must be tailored to the specific conditions at hand. One area that needs increased attention is the decision-making process in applying IPM to tick control. Further development of novel tick control measures, and increased efficiency in their integration and application to achieve desired goals, holds great promise for effective future management of ticks and tick-borne diseases.

  5. [Rabies in bats].

    Science.gov (United States)

    Beranová, Kateřina; Zendulková, Dagmar

    2016-06-01

    Rabies is a zoonosis ending fatally in all mammals, including humans. Unlike the other mammals, this disease is usually not fatal in bats. Rabies is caused by lyssaviruses which are divided into several distinct phylogroups comprising 15 known viruses. It is believed that the original hosts of all lyssaviruses are bats. Classical rabies virus (RABV) occurs in bats across Americas and represents the major cause of rabies in humans and domestic animals there. European bat lyssavirus type 1 (EBLV-1) and European bat lyssavirus type 2 (EBLV-2) are the most frequently diagnosed lyssaviruses in Eurasia. The transmission of EBLV-1 and EBLV-2 from bats to other mammals is very rare. As of now, more detailed information is missing about the other Eurasian lyssaviruses - West Caucasian bat virus (WCBV), Bokeloh bat lyssavirus (BBLV), Aravan virus (ARAV), Irkut virus (IRKV), Khujand virus (KHUV) and Lleida virus. The lyssavirus most frequently found in Africa is Lagos bat virus (LBV). In Australia, only Australian bat lyssavirus (ABLV) has been demonstrated as yet. In the Czech Republic, a total of five cases of rabies in bats were confirmed between 1994 and 2015. Rabies can be transmitted from bats mainly by biting or scratching. Clinically ill bats suffer from nervous disorders or produce abnormal sounds. If rabies is suspected, laboratory tests are essential. Protection of human health is based on pre-exposure and/or post-exposure vaccination. However, the available vaccines do not protect against some newly identified lyssaviruses such as WCBV. Nevertheless, most bat species pose a minimal risk to humans.

  6. Biocontrol of ticks.

    Science.gov (United States)

    Samish, M

    2000-01-01

    The increasing resistance of arthropodes to pesticides, their high price, and the growing public demand for safer food and a cleaner environment are obliging animal growers to minimize the use of pesticides by introducing alternative means for tick control. The development of a biological tick control method has been neglected as compared to the control of plant pests or dipterous insects harmful to men and animals. There are abundant observations, but only a few studies have as yet been conducted on pathogens, parasitoides, and predators of ticks. A first attempt at tick biocontrol was made with the introduction of tick-parasitic wasps from France to the USA and Russia. During the past decade, interest in developing antitick biocontrol agents such as birds (Brazil, Kenya, and Zimbabwe), parasitoides (Kenya and USA), entomopathogenic nematodes (Egypt, Israel, Guadeloupe, and USA), entomopathogenic fungi (Brazil, Cuba, Israel, Kenya, and USA), and bacteria (Brazil) has gained momentum. The reintroduction of oxpecker birds in some areas of Zimbabwe remains up to now the only known successful attempt at tick biocontrol.

  7. Ticks and Diseases: Bite Fright!

    Science.gov (United States)

    ... of this page please turn Javascript on. Feature: Ticks and Diseases Bite Fright! Past Issues / Spring - Summer ... can bring on serious health problems. What Are Ticks? If you spend any time outdoors, you've ...

  8. Tick-Borne Encephalitis (TBE)

    Science.gov (United States)

    ... Search The CDC Cancel Submit Search The CDC Tick-borne Encephalitis (TBE) Note: Javascript is disabled or ... CDC.gov . Recommend on Facebook Tweet Share Compartir Tick-borne encephalitis, or TBE, is a human viral ...

  9. It's Open Season on Ticks

    Science.gov (United States)

    It’s Open Season on Ticks Protect yourself from tickborne disease this hunting season Ticks feed on the blood of animals (such as rodents, rabbits, deer, and birds), but will bite humans too. Ticks live in grassy or wooded areas, or on ...

  10. Bat predation by spiders.

    Directory of Open Access Journals (Sweden)

    Martin Nyffeler

    Full Text Available In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S. Most reports refer to the Neotropics (42% of observed incidences, Asia (28.8%, and Australia-Papua New Guinea (13.5%. Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter. The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64% and Emballonuridae (22% and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death, there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation. This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

  11. Bats and SARS

    Centers for Disease Control (CDC) Podcasts

    2006-11-08

    Bats are a natural reservoir for emerging viruses, among them henipaviruses and rabies virus variants. Dr. Nina Marano, Chief, Geographic Medicine and Health Promotion Branch, Division of Global Migration and Quarantine, CDC, explains connection between horseshoe bats and SARS coronavirus transmission.  Created: 11/8/2006 by Emerging Infectious Diseases.   Date Released: 11/17/2006.

  12. Parasites of domestic and wild animals in South Africa. XXII. Ixodid ticks on domestic dogs and on wild carnivores.

    Science.gov (United States)

    Horak, I G; Guillarmod, A J; Moolman, L C; de Vos, V

    1987-12-01

    Ixodid ticks were collected from 4 dogs on smallholdings near Grahamstown, eastern Cape Province, on 1 or more occasions each week for periods ranging from 9-36 months. Fourteen tick species were recovered and the seasonal abundance of adult Haemaphysalis leachi and adult Rhipicephalus simus was determined. Complete collections of ticks were made from 50 caracals (Felis caracal) in the Cradock, Graaff-Reinet and Southwell regions in the eastern Cape Province. The animals from Cradock and Graaff-Reinet harboured 13 ixodid tick species. The caracals from Southwell were infested with 11 tick species and the seasonal abundance of Ixodes pilosus on these animals was determined. A small-spotted genet (Genetta genetta), 1 bat-eared fox (Otocyon megalotis), 1 aardwolf (Proteles cristatus) and 6 black-backed jackal (Canis mesomelas) from various localities in the eastern Cape Province were examined for ticks and 9 species were collected. Complete tick collections were made from a side-striped jackal (Canis adustus), 2 wild dogs (Lycaon pictus), a spotted hyaena (Crocuta crocuta), a several (Felis serval), 2 African civets (Civettictis civetta), 2 leopards (Panthera pardus) and a lion (Panthera leo) in the Kruger National Park in the north-eastern Transvaal. Twelve ixodid tick specis were recovered from these animals.

  13. Tick vaccines and the control of tick-borne pathogens.

    Science.gov (United States)

    Merino, Octavio; Alberdi, Pilar; Pérez de la Lastra, José M; de la Fuente, José

    2013-01-01

    Ticks are obligate hematophagous ectoparasites that transmit a wide variety of pathogens to humans and animals. The incidence of tick-borne diseases has increased worldwide in both humans and domestic animals over the past years resulting in greater interest in the study of tick-host-pathogen interactions. Advances in vector and pathogen genomics and proteomics have moved forward our knowledge of the vector-pathogen interactions that take place during the colonization and transmission of arthropod-borne microbes. Tick-borne pathogens adapt from the vector to the mammalian host by differential gene expression thus modulating host processes. In recent years, studies have shown that targeting tick proteins by vaccination can not only reduce tick feeding and reproduction, but also the infection and transmission of pathogens from the tick to the vertebrate host. In this article, we review the tick-protective antigens that have been identified for the formulation of tick vaccines and the effect of these vaccines on the control of tick-borne pathogens.

  14. More Trouble from Ticks

    Centers for Disease Control (CDC) Podcasts

    2011-08-18

    Dr. Chris Paddock, a rickettsiologist and infectious disease pathologist discusses a tick-transmitted bacterium, Rickettsia parkeri.  Created: 8/18/2011 by National Center for Emerging Zoonotic and Infectious Diseases (NCEZID).   Date Released: 8/18/2011.

  15. African tick bite fever

    DEFF Research Database (Denmark)

    Johansen, Jakob Aaquist; Thybo, Søren

    2011-01-01

    The incident of spotted fever imported to Denmark is unknown. We present a classic case of African Tick Bite Fever (ATBF) to highlight a disease, which frequently infects wildlife enthusiasts and hunters on vacation in South Africa. ATBF has a good prognosis and is easily treated with doxycyclin...

  16. Tick-Borne Diseases

    Science.gov (United States)

    ... Health Topics Tick-Borne Disease Hazards to Outdoor Workers Physical Hazards Heat Stress Cold Stress Sun Exposure Noise Biological Hazards Insects ... No Longer Available Lyme Disease Hazards to Outdoor Workers Physical Hazards Heat Stress Cold Stress Sun Exposure Noise Biological Hazards Insects ...

  17. Tick-Borne Diseases: The Big Two

    Science.gov (United States)

    ... of this page please turn Javascript on. Feature: Ticks and Diseases Tick-borne Diseases: The Big Two Past Issues / Spring - ... on the skin where there has been a tick bite. Photo: CDC/James Gathany Lyme disease Lyme ...

  18. Tick imbedded in the skin (image)

    Science.gov (United States)

    This is a close-up photograph of a tick embedded in the skin. Ticks are important because they can carry diseases such as Rocky Mountain spotted fever, tularemia, Colorado tick fever, Lyme disease, and others.

  19. The bats of Suriname

    NARCIS (Netherlands)

    Husson, A.M.

    1962-01-01

    CONTENTS I. Introduction.................. 3 A. Scope of the present paper............. 3 B. Measurements................ 7 C. Nomenclature................ 8 D. Acknowledgements............... 9 II. General Part.................. 10 A. History of the study of Suriname bats.......... 10 B. Remarks on

  20. The bats of Wyoming

    Science.gov (United States)

    Bogan, Michael A.; Cryan, Paul M.; Choate, Jerry R.

    2000-01-01

    We examined 1280 bats of 12 species submitted to the Wyoming State Veterinary Laboratory (WSVL) for ra­bies testing between 1981 and 1992. The most abundant species in the sample was Myotis lucifugus, followed by Epte­sicus fuscus, Lasionycteris noetivagans, M. ciliolabrum, and M. volans. Using the WSVL sample and additional museum specimens, we summarized available records and knowledge for 17 species of bats in Wyoming, Records of the WSVL show that, between 1981 and 1992, 113 bats actually tested positive for rabies. We examined 45 of those rabies­ positive bats; E. fuscus had the highest incidence (60%) in the sample, followed by L. noctivagans (11 %) and L. cinereus (9%).

  1. A Tick on the Move?

    Centers for Disease Control (CDC) Podcasts

    2016-08-04

    CDC’s tick expert, Dr. Christopher Paddock, discusses ticks found in a new location.  Created: 8/4/2016 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 8/4/2016.

  2. MetaBAT

    Energy Technology Data Exchange (ETDEWEB)

    2014-04-01

    Assembling individual genomes from shotgun metagenomic sequences derived from complex microbial communities is so far one of the most challenging problems in bioinformatics. As it is impractical to directly assemble full-length genomes, a first step that groups contigs from the same organisms, called metagenome binning, has been developed to provide insights of individual organisms. However, current binning methods perform poorly in the context of large complex community, and as a result they fail to recover many novel genomes. To overcome this limitation, we developed integrated software, called MetaBAT, which automatically forms hundreds of individual genome bins from metagenome contigs. Probabilistic models of abundance and tetranucleotide frequency were trained by extensive empirical studies and integrated to decide the membership of contigs iteratively. To test the performance of MetaBAT, we applied MetaBAT to both synthetic and several large-scale real world metagenome datasets. By using two independent metrics, we demonstrate that in all the data sets tested MetaBAT achieves good sensitivity (16~87%) and very high specificity (56~99%) in forming genome bins. Further analyses of the novel genomes recovered from the human gut microbiome suggest a subset of these genomes are potentially associated with pathological conditions. In conclusion, we believe MetaBAT is a powerful tool

  3. Transport of ixodid ticks and tick-borne pathogens by migratory birds.

    Science.gov (United States)

    Hasle, Gunnar

    2013-01-01

    Birds, particularly passerines, can be parasitized by Ixodid ticks, which may be infected with tick-borne pathogens, like Borrelia spp., Babesia spp., Anaplasma, Rickettsia/Coxiella, and tick-borne encephalitis virus. The prevalence of ticks on birds varies over years, season, locality and different bird species. The prevalence of ticks on different species depends mainly on the degree of feeding on the ground. In Europe, the Turdus spp., especially the blackbird, Turdus merula, appears to be most important for harboring ticks. Birds can easily cross barriers, like fences, mountains, glaciers, desserts and oceans, which would stop mammals, and they can move much faster than the wingless hosts. Birds can potentially transport tick-borne pathogens by transporting infected ticks, by being infected with tick-borne pathogens and transmit the pathogens to the ticks, and possibly act as hosts for transfer of pathogens between ticks through co-feeding. Knowledge of the bird migration routes and of the spatial distribution of tick species and tick-borne pathogens is crucial for understanding the possible impact of birds as spreaders of ticks and tick-borne pathogens. Successful colonization of new tick species or introduction of new tick-borne pathogens will depend on suitable climate, vegetation and hosts. Although it has never been demonstrated that a new tick species, or a new tick pathogen, actually has been established in a new locality after being seeded there by birds, evidence strongly suggests that this could occur.

  4. Transport of Ixodid ticks and tick-borne pathogens by migratory birds.

    Directory of Open Access Journals (Sweden)

    Gunnar eHasle

    2013-09-01

    Full Text Available Birds, particularly passerines, can be parasitized by Ixodid ticks, which may be infected with tick-borne pathogens, like Borrelia spp., Babesia spp., Anaplasma, Rickettsia/Coxiella, and tick-borne encephalitis virus. The prevalence of ticks on birds varies over years, season, locality and different bird species. The prevalence of ticks on different species depends mainly on the degree of feeding on the ground. In Europe, the Turdus spp., especially the blackbird, Turdus merula, appears to be most important for harboring ticks. Birds can easily cross barriers, like fences, mountains, glaciers, desserts and oceans, which would stop mammals, and they can move much faster than the wingless hosts. Birds can potentially transport tick-borne pathogens by transporting infected ticks, by being infected with tick-borne pathogens and transmit the pathogens to the ticks, and possibly act as hosts for transfer of pathogens between ticks through co-feeding. Knowledge of the bird migration routes and of the spatial distribution of tick species and tick-borne pathogens is crucial for understanding the possible impact of birds as spreaders of ticks and tick-borne pathogens. Successful colonization of new tick species or introduction of new tick-borne pathogens will depend on suitable climate, vegetation and hosts. Although it has never been demonstrated that a new tick species, or a new tick pathogen, actually has been established in a new locality after being seeded there by birds, evidence strongly suggests that this could occur.

  5. Bat Rabies Surveillance in Europe

    DEFF Research Database (Denmark)

    Schatz, J.; Fooks, A. R.; McElhinney, L.

    2013-01-01

    Rabies is the oldest known zoonotic disease and was also the first recognized bat associated infection in humans. To date, four different lyssavirus species are the causative agents of rabies in European bats: the European Bat Lyssaviruses type 1 and 2 (EBLV-1, EBLV-2), the recently discovered pu...

  6. Indiana Bat Project data

    Science.gov (United States)

    Erickson, Richard A.

    2016-01-01

    Our model is a full-annual-cycle population model {hostetler2015full} that tracks groups of bat surviving through four seasons: breeding season/summer, fall migration, non-breeding/winter, and spring migration. Our state variables are groups of bats that use a specific maternity colony/breeding site and hibernaculum/non-breeding site. Bats are also accounted for by life stages (juveniles/first-year breeders versus adults) and seasonal habitats (breeding versus non-breeding) during each year, This leads to four states variable (here depicted in vector notation): the population of juveniles during the non-breeding season, the population of adults during the non-breeding season, the population of juveniles during the breeding season, and the population of adults during the breeding season, Each vector's elements depict a specific migratory pathway, e.g., is comprised of elements, {non-breeding sites}, {breeding sites}The variables may be summed by either breeding site or non-breeding site to calculate the total population using a specific geographic location. Within our code, we account for this using an index column for breeding sites and an index column for non-breeding sides within the data table. Our choice of state variables caused the time step (i.e. \\(t\\)) to be 1 year. However, we recorded the population of each group during the breeding and non-breeding season as an artifact of our state-variable choice. We choose these state variables partially for their biological information and partially to simplify programming. We ran our simulation for 30 years because the USFWS currently issues Indiana Bat take permits for 30 years. Our model covers the range of the Indiana Bat, which is approximately the eastern half of the contiguous United States (Figure \\ref{fig:BatInput}). The boundaries of our range was based upon the United States boundary, the NatureServe Range map, and observations of the species. The maximum migration distance was 500-km, which was based

  7. Bat flight and zoonotic viruses

    Science.gov (United States)

    O'Shea, Thomas; Cryan, Paul M.; Cunningham, Andrew A.; Fooks, Anthony R.; Hayman, David T.S.; Luis, Angela D.; Peel, Alison J.; Plowright, Raina K.; Wood, James L.N.

    2014-01-01

    Bats are sources of high viral diversity and high-profile zoonotic viruses worldwide. Although apparently not pathogenic in their reservoir hosts, some viruses from bats severely affect other mammals, including humans. Examples include severe acute respiratory syndrome coronaviruses, Ebola and Marburg viruses, and Nipah and Hendra viruses. Factors underlying high viral diversity in bats are the subject of speculation. We hypothesize that flight, a factor common to all bats but to no other mammals, provides an intensive selective force for coexistence with viral parasites through a daily cycle that elevates metabolism and body temperature analogous to the febrile response in other mammals. On an evolutionary scale, this host–virus interaction might have resulted in the large diversity of zoonotic viruses in bats, possibly through bat viruses adapting to be more tolerant of the fever response and less virulent to their natural hosts.

  8. Looking in ticks for human bacterial pathogens.

    Science.gov (United States)

    Mediannikov, O; Fenollar, F

    2014-12-01

    Ticks are considered to be second worldwide to mosquitoes as vectors of human diseases and the most important vectors of disease-causing pathogens in domestic and wild animals. A number of emerging tick-borne pathogens are already discovered; however, the proportion of undiagnosed infectious diseases, especially in tropical regions, may suggest that there are still more pathogens associated with ticks. Moreover, the identification of bacteria associated with ticks may provide new tool for the control of ticks and tick-borne diseases. Described here molecular methods of screening of ticks, extensive use of modern culturomics approach, newly developed artificial media and different cell line cultures may significantly improve our knowledge about the ticks as the agents of human and animal pathology.

  9. Isolation of Tacaribe virus, a Caribbean arenavirus, from host-seeking Amblyomma americanum ticks in Florida.

    Directory of Open Access Journals (Sweden)

    Katherine A Sayler

    Full Text Available Arenaviridae are a family of single stranded RNA viruses of mammals and boid snakes. Twenty-nine distinct mammalian arenaviruses have been identified, many of which cause severe hemorrhagic disease in humans, particularly in parts of sub-Saharan Africa, and in Central and South America. Humans typically become infected with an arenavirus through contact with excreta from infected rodents. Tacaribe virus (TCRV is an arenavirus that was first isolated from bats and mosquitoes during a rabies surveillance survey conducted in Trinidad from 1956 to 1958. Tacaribe virus is unusual because it has never been associated with a rodent host and since that one time isolation, the virus has not been isolated from any vertebrate or invertebrate hosts. We report the re-isolation of the virus from a pool of 100 host-seeking Amblyomma americanum (lone star ticks collected in a Florida state park in 2012. TCRV was isolated in two cell lines and its complete genome was sequenced. The tick-derived isolate is nearly identical to the only remaining isolate from Trinidad (TRVL-11573, with 99.6% nucleotide identity across the genome. A quantitative RT-PCR assay was developed to test for viral RNA in host-seeking ticks collected from 3 Florida state parks. Virus RNA was detected in 56/500 (11.2% of surveyed ticks. As this virus was isolated from ticks that parasitize humans, the ability of the tick to transmit the virus to people should be evaluated. Furthermore, reservoir hosts for the virus need to be identified in order to develop risk assessment models of human infection.

  10. Isolation of Tacaribe virus, a Caribbean arenavirus, from host-seeking Amblyomma americanum ticks in Florida.

    Science.gov (United States)

    Sayler, Katherine A; Barbet, Anthony F; Chamberlain, Casey; Clapp, William L; Alleman, Rick; Loeb, Julia C; Lednicky, John A

    2014-01-01

    Arenaviridae are a family of single stranded RNA viruses of mammals and boid snakes. Twenty-nine distinct mammalian arenaviruses have been identified, many of which cause severe hemorrhagic disease in humans, particularly in parts of sub-Saharan Africa, and in Central and South America. Humans typically become infected with an arenavirus through contact with excreta from infected rodents. Tacaribe virus (TCRV) is an arenavirus that was first isolated from bats and mosquitoes during a rabies surveillance survey conducted in Trinidad from 1956 to 1958. Tacaribe virus is unusual because it has never been associated with a rodent host and since that one time isolation, the virus has not been isolated from any vertebrate or invertebrate hosts. We report the re-isolation of the virus from a pool of 100 host-seeking Amblyomma americanum (lone star ticks) collected in a Florida state park in 2012. TCRV was isolated in two cell lines and its complete genome was sequenced. The tick-derived isolate is nearly identical to the only remaining isolate from Trinidad (TRVL-11573), with 99.6% nucleotide identity across the genome. A quantitative RT-PCR assay was developed to test for viral RNA in host-seeking ticks collected from 3 Florida state parks. Virus RNA was detected in 56/500 (11.2%) of surveyed ticks. As this virus was isolated from ticks that parasitize humans, the ability of the tick to transmit the virus to people should be evaluated. Furthermore, reservoir hosts for the virus need to be identified in order to develop risk assessment models of human infection.

  11. Social Grooming in Bats: Are Vampire Bats Exceptional?

    Science.gov (United States)

    Carter, Gerald; Leffer, Lauren

    2015-01-01

    Evidence for long-term cooperative relationships comes from several social birds and mammals. Vampire bats demonstrate cooperative social bonds, and like primates, they maintain these bonds through social grooming. It is unclear, however, to what extent vampires are special among bats in this regard. We compared social grooming rates of common vampire bats Desmodus rotundus and four other group-living bats, Artibeus jamaicensis, Carollia perspicillata, Eidolon helvum and Rousettus aegyptiacus, under the same captive conditions of fixed association and no ectoparasites. We conducted 13 focal sampling sessions for each combination of sex and species, for a total of 1560 presence/absence observations per species. We observed evidence for social grooming in all species, but social grooming rates were on average 14 times higher in vampire bats than in other species. Self-grooming rates did not differ. Vampire bats spent 3.7% of their awake time social grooming (95% CI = 1.5-6.3%), whereas bats of the other species spent 0.1-0.5% of their awake time social grooming. Together with past data, this result supports the hypothesis that the elevated social grooming rate in the vampire bat is an adaptive trait, linked to their social bonding and unique regurgitated food sharing behavior.

  12. Social Grooming in Bats: Are Vampire Bats Exceptional?

    Directory of Open Access Journals (Sweden)

    Gerald Carter

    Full Text Available Evidence for long-term cooperative relationships comes from several social birds and mammals. Vampire bats demonstrate cooperative social bonds, and like primates, they maintain these bonds through social grooming. It is unclear, however, to what extent vampires are special among bats in this regard. We compared social grooming rates of common vampire bats Desmodus rotundus and four other group-living bats, Artibeus jamaicensis, Carollia perspicillata, Eidolon helvum and Rousettus aegyptiacus, under the same captive conditions of fixed association and no ectoparasites. We conducted 13 focal sampling sessions for each combination of sex and species, for a total of 1560 presence/absence observations per species. We observed evidence for social grooming in all species, but social grooming rates were on average 14 times higher in vampire bats than in other species. Self-grooming rates did not differ. Vampire bats spent 3.7% of their awake time social grooming (95% CI = 1.5-6.3%, whereas bats of the other species spent 0.1-0.5% of their awake time social grooming. Together with past data, this result supports the hypothesis that the elevated social grooming rate in the vampire bat is an adaptive trait, linked to their social bonding and unique regurgitated food sharing behavior.

  13. Ticks infesting humans in Northern Misiones, Argentina.

    Science.gov (United States)

    Lamattina, Daniela; Nava, Santiago

    2016-01-01

    This work presents records of ticks infesting humans in northern Misiones Province, Argentina. Also, notes on potential transmission of tick-borne pathogens are included. A total of 282 ticks attached to researchers were collected and identified by their morphological characters. Eight tick species were found: Amblyomma brasiliense, Amblyomma coelebs, Amblyomma dubitatum, Amblyomma incisum, Amblyomma ovale, Haemaphysalis juxtakochi, Rhipicephalus sanguineus and Rhipicephalus microplus. Some of these species as A. dubitatum, A. ovale and R. sanguineus have been found infected with spotted fever group rickettsiae pathogenic to humans in Brazil and Argentina. The potential role as vectors of humans pathogens of the ticks found attached to humans in this study is discussed.

  14. The aural anatomy of bats

    NARCIS (Netherlands)

    Pye, Ade

    1970-01-01

    The fine structure of the ears of 62 species of bats from 13 families has been studied by means of serial sections. The bats were caught alive in Britain, West Indies, Panama, Central and North Africa and were intra-vitally perfused with fixative in order to obtain perfect preservation of the intern

  15. Bartonella spp. in Bats, Guatemala

    OpenAIRE

    BAI, YING; Kosoy, Michael; Recuenco, Sergio; Alvarez, Danilo; Moran, David; Turmelle, Amy; Ellison, James; Garcia, Daniel L.; Estevez, Alejandra; Lindblade, Kim; Rupprecht, Charles

    2011-01-01

    To better understand the role of bats as reservoirs of Bartonella spp., we estimated Bartonella spp. prevalence and genetic diversity in bats in Guatemala during 2009. We found prevalence of 33% and identified 21 genetic variants of 13 phylogroups. Vampire bat–associated Bartonella spp. may cause undiagnosed illnesses in humans.

  16. Vampire bat control in Mexico

    NARCIS (Netherlands)

    Schmidt, U.; Greenhall, A.M.; Lopez-Forment, W.

    1970-01-01

    Though usually beneficial, bats sometimes are a nuisance to humans (Greenhall & Stell, 1960), or may even constitute serious economic problems and health hazards. Most important in this respect are the vampire bats, especially of the genus Desmodus, which are abundant from northern Argentina through

  17. Automated Acoustic Identification of Bats

    Science.gov (United States)

    2011-10-01

    routine assesses a combination of signal quality indicators such as amplitude, frequency bandwidth, tonal trend of the signal, signal to noise ratio ...signal strength as indicated by a low signal to noise ratio ...bats All North American bats emit regular pulses of vocalizations during flight to generate echoes they use for navigation, detecting, and pursuing

  18. Tick paralysis cases in Argentina

    Directory of Open Access Journals (Sweden)

    Carlos Remondegui

    2012-08-01

    Full Text Available Tick paralysis (TP occurs worldwide and is caused by a neurotoxin secreted by engorged female ticks that affects the peripheral and central nervous system. The clinical manifestations range from mild or nonspecific symptoms to manifestations similar to Guillain-Barré syndrome, bulbar involvement, and death in 10% of the patients. The diagnosis of TP is clinical. To our knowledge, there are no formal reports of TP in humans in South America, although clusters of TP among hunting dogs in Argentina have been identified recently. In this paper, clinical features of two cases of TP occurring during 1994 in Jujuy Province, Argentina, are described.

  19. Amitraz: a tick and flea repellent and tick detachment drug.

    Science.gov (United States)

    Folz, S D; Ash, K A; Conder, G A; Rector, D L

    1986-06-01

    A topical formulation of amitraz (Mitaban Liquid Concentrate, The Upjohn Company, Kalamazoo, Michigan, U.S.A.) was evaluated as a tick repellent and detachment agent, and flea repellent. The diluted liquid concentrate (250 p.p.m. active drug) was topically applied as a single treatment to dogs; the concentration was identical to the rate recommended for treatment of demodicosis and scabies. Brown dog tick (Rhipicephalus sanguineus) and American dog tick (Dermacentor variabilis) populations were eliminated and repelled. Repellent activity (92-95%) was observed against R. sanguineus for 2 weeks post-treatment; the treatment was moderately active (63%) during the third week, and at 4 weeks post-treatment the drug was inactive. Established R. sanguineus populations were also treated, and the diluted liquid concentrate had 100% tick-detachment efficacy. Repellent activity (99%) was also detected against D. variabilis; the activity was monitored for only 7 days. The ectoparasiticide had low to moderate flea (Ctenocephalides felis) repellent activity (42%) for 4 days post-treatment; thereafter the treatment was ineffective. Side-effects were not observed in any of the dogs treated with amitraz, or the placebo.

  20. Tick size and stock returns

    Science.gov (United States)

    Onnela, Jukka-Pekka; Töyli, Juuso; Kaski, Kimmo

    2009-02-01

    Tick size is an important aspect of the micro-structural level organization of financial markets. It is the smallest institutionally allowed price increment, has a direct bearing on the bid-ask spread, influences the strategy of trading order placement in electronic markets, affects the price formation mechanism, and appears to be related to the long-term memory of volatility clustering. In this paper we investigate the impact of tick size on stock returns. We start with a simple simulation to demonstrate how continuous returns become distorted after confining the price to a discrete grid governed by the tick size. We then move on to a novel experimental set-up that combines decimalization pilot programs and cross-listed stocks in New York and Toronto. This allows us to observe a set of stocks traded simultaneously under two different ticks while holding all security-specific characteristics fixed. We then study the normality of the return distributions and carry out fits to the chosen distribution models. Our empirical findings are somewhat mixed and in some cases appear to challenge the simulation results.

  1. Avoid Logs to Avoid Ticks

    Institute of Scientific and Technical Information of China (English)

    莫文佳

    2004-01-01

    扁虱是莱姆关节炎的罪魁祸首。研究人员为了弄明白何处扁虱最猖獗, 不惜以身作饵,他们发现:The ticks were all over the log surface。因此告诫人 们:Avoid sitting on logs。

  2. Soft tick sampling and collection

    Science.gov (United States)

    Several soft tick species in the genus Ornithodoros are vectors of African swine fever virus (ASFV) in nature, or known to be susceptible to infection. African swine fever (ASF) caused by ASFV is considered one of the most serious transboundary swine diseases because of its high lethality for pigs, ...

  3. Bat 21: A Case Study

    Science.gov (United States)

    1990-04-02

    review from Library Journal : While he [Anderson] succeeds in telling a rousing tale...one questions whether this ought to be considered more fiction...Day in a Long War, Random House, 1989.1 27. Lane, Mel D. "Bat 21." Library Journal , Vol. 105, 15 October 1980, pp. 2194-2195. 28. Stone, Judy. " ’Bat...5. Ibid., 187. 6. Ibid., liner notes. 7. Interview, p. 88. 8. Anderson, pp. 186. 9. Anderson, copyright notes. 10. Mel D. Lane, "Bat 21," Library

  4. Tick paralysis: first zoonosis record in Egypt.

    Science.gov (United States)

    Mosabah, Amira A Abd El-rahman; Morsy, Tosson A

    2012-04-01

    Tick paralysis caused by the secretion of toxin with saliva while taking a blood meal is an important veterinary disease, but is rare in humans. Although it has certain geographical proclivities, it exists worldwide. Tick paralysis was demonstrated for the first time in Egypt among four children living in rural area at Giza Governorate. The clinical pictures were confused with rabies; myasthensia gravis; botulism; diphtheritic polyneuropathy encountered in rural areas. The recovery of tick infesting the four little children and negative clinical and laboratory data of all diseases denoted tick paralysis. The encountered ticks infesting their animals were Rhipicephalus sanguineus on dogs, Hyalomma dromedarii on camels and Hyalomma anatolicum excavatum and Haemaphysalis sp. on goats. The case was recognized as first record of tick paralysis in Egypt.

  5. Tick Bite by Nymphal Amblyomma testudinarium

    Science.gov (United States)

    Kim, Yeong Ho; Lee, Ji Hyun; Park, Young Min

    2016-01-01

    Ticks are parasites that usually suck the blood of wild or domestic animals; rarely, they ingest human blood and spread various febrile infectious diseases along with skin problems. Out of 40 cases of tick bite reported in Korea, only 3 were caused by nymphal ticks, and tick bites by nymphal Amblyomma testudinarium have not been reported previously. Herein, we report a rare case of tick bite by nymphal A. testudinarium. A 57-year-old woman presented with an asymptomatic solitary erythematous nodule on the left thigh that had been present for 6 days. The tick, which the patient removed from the lesion and brought to the hospital, was identified as a nymphal A. testudinarium. Doxycycline (200 mg) was used as treatment, and after seven days of use, the patient improved and no other lesions were detected. PMID:27904278

  6. Virus Discovery Using Tick Cell Lines

    Science.gov (United States)

    Bell-Sakyi, Lesley; Attoui, Houssam

    2016-01-01

    While ticks have been known to harbor and transmit pathogenic arboviruses for over 80 years, the application of high-throughput sequencing technologies has revealed that ticks also appear to harbor a diverse range of endogenous tick-only viruses belonging to many different families. Almost nothing is known about these viruses; indeed, it is unclear in most cases whether the identified viral sequences are derived from actual replication-competent viruses or from endogenous virus elements incorporated into the ticks’ genomes. Tick cell lines play an important role in virus discovery and isolation through the identification of novel viruses chronically infecting such cell lines and by acting as host cells to aid in determining whether or not an entire replication-competent, infective virus is present in a sample. Here, we review recent progress in tick-borne virus discovery and comment on the actual and potential applications for tick cell lines in this emerging research area. PMID:27679414

  7. Tick-borne Diseases in Animals and USDA Research on Tick Control

    Science.gov (United States)

    Tick-borne diseases represent a major threat to animal health in the United States. The cattle industry in the United States has benefited greatly from the continued USDA efforts through the Cattle Fever Tick Eradication Program in preventing the re-introduction of cattle ticks and associated pathog...

  8. Tick Genome Assembled: New Opportunities for Research on Tick-Host-Pathogen Interactions

    Science.gov (United States)

    de la Fuente, José; Waterhouse, Robert M.; Sonenshine, Daniel E.; Roe, R. Michael; Ribeiro, Jose M.; Sattelle, David B.; Hill, Catherine A.

    2016-01-01

    As tick-borne diseases are on the rise, an international effort resulted in the sequence and assembly of the first genome of a tick vector. This result promotes research on comparative, functional and evolutionary genomics and the study of tick-host-pathogen interactions to improve human, animal and ecosystem health on a global scale. PMID:27695689

  9. Tick bite granuloma : recommendations for surgical treatment

    OpenAIRE

    Hirota, Keisuke; Kurosawa, Yoshinaga; Goto, Keisuke; Adachi, Koji; Yoshida, Yuichi; Yamamoto, Osamu

    2015-01-01

    Tick bite is known as a possible cause of some infectious diseases such as Lyme disease, spotted fever and related illnesses. The reaction to a tick bite may persist for several months to several years and can sometimes cause histopathological granuloma. The long-term reaction to salivary extracts from the tick could be responsible for development of granuloma in our patient. We recommended complete resection as the only sure way to treat formed granuloma.

  10. Vaccinomics Approach to Tick Vaccine Development.

    Science.gov (United States)

    Contreras, Marinela; Villar, Margarita; Alberdi, Pilar; de la Fuente, José

    2016-01-01

    Ticks are blood-feeding arthropod ectoparasites that transmit disease-causing pathogens to humans and animals worldwide. Vaccines using tick antigens have proven to be cost-effective and environmental friendly for the control of vector infestations and pathogen infection and transmission. However, new strategies are needed to identify tick protective antigens for development of improved vaccines. These strategies will be greatly enhanced by vaccinomics approaches starting from the study of tick-host-pathogen molecular interactions and ending in the characterization and validation of vaccine formulations. The discovery of tick antigens that affect both tick infestations and pathogen infection/transmission could be used for vaccines targeting human and animal populations at risk and reservoir species to reduce host exposure to ticks while reducing the number of infected ticks and their vector capacity for pathogens that affect human and animal health. In this chapter, we describe methods of the vaccinomics platform using transcriptomics and proteomics for the identification of candidate protective antigens in Ixodes scapularis, the vector for human and animal granulocytic anaplasmosis, tick-borne encephalitis, and Lyme disease.

  11. Entomopathogenic fungi associated with Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Kalsbeek, Vibeke; Frandsen, F.; Steenberg, Tove

    1995-01-01

    The objective of this study was to demonstrate the occurrence of entomopathogenic fungi on Ixodes ricinus ticks in relation to the tick stage, engorgement and season. Ticks were collected from the vegetation, from small rodents and from deer. All entomopathogenic fungi found belonged...... infected with fungi. Thirty-three out of 149 engorged females were infected, whereas males and engorged larvae were not infected. Throughout the season, a significantly higher proportion of ticks collected in autumn were infected. Entomopathogenic fungi may have a significant impact on the size of the I...

  12. Research on the ecology of ticks and tick-borne pathogens--methodological principles and caveats.

    Science.gov (United States)

    Estrada-Peña, Agustín; Gray, Jeremy S; Kahl, Olaf; Lane, Robert S; Nijhof, Ard M

    2013-01-01

    Interest in tick-transmitted pathogens has experienced an upsurge in the past few decades. Routine application of tools for the detection of fragments of foreign DNA in ticks, together with a high degree of interest in the quantification of disease risk for humans, has led to a marked increase in the number of reports on the eco-epidemiology of tick-borne diseases. However, procedural errors continue to accumulate in the scientific literature, resulting in misleading information. For example, unreliable identification of ticks and pathogens, erroneous interpretations of short-term field studies, and the hasty acceptance of some tick species as vectors have led to ambiguities regarding the vector role of these arthropods. In this review, we focus on the ecological features driving the life cycle of ticks and the resulting effects on the eco-epidemiology of tick-transmitted pathogens. We review the factors affecting field collections of ticks, and we describe the biologically and ecologically appropriate procedures for describing tick host-seeking activity and its correlation with environmental traits. We detail the climatic variables that have biological importance on ticks and explain how they should be properly measured and analyzed. We also provide evidence to critically reject the use of some environmental traits that are being increasingly reported as the drivers of the behavior of ticks. With the aim of standardization, we propose unambiguous definitions of the status of hosts and ticks regarding their ability to maintain and spread a given pathogen. We also describe laboratory procedures and standards for evaluating the vectorial capacity of a tick or the reservoir role of a host. This approach should provide a coherent framework for the reporting of research findings concerning ticks and tick-borne diseases.

  13. Research on the ecology of ticks and tick-borne pathogens - methodological principles and caveats

    Directory of Open Access Journals (Sweden)

    Agustín eEstrada-Peña

    2013-08-01

    Full Text Available Interest in tick-transmitted pathogens has experienced an upsurge in the past few decades. Routine application of tools for the detection of fragments of foreign DNA in ticks, together with a high degree of interest in the quantification of disease risk for humans, has led to a marked increase in the number of reports on the eco-epidemiology of tick-borne diseases. However, procedural errors continue to accumulate in the scientific literature, resulting in misleading information. For example, unreliable identification of ticks and pathogens, erroneous interpretations of short-term field studies, and the hasty acceptance of some tick species as vectors have led to ambiguities regarding the vector role of these arthropods. In this review, we focus on the ecological features driving the life cycle of ticks and the resulting effects on the eco-epidemiology of tick-transmitted pathogens. We review the factors affecting field collections of ticks, and we describe the biologically and ecologically appropriate procedures for describing tick host-seeking activity and its correlation with environmental traits. We detail the climatic variables that have biological importance on ticks and explain how they should be properly measured and analyzed. We also provide evidence to critically reject the use of some environmental traits that are being increasingly reported as the drivers of the behavior of ticks. With the aim of standardization, we propose unambiguous definitions of the status of hosts and ticks regarding their ability to maintain and spread a given pathogen. We also describe laboratory procedures and standards for evaluating the vectorial status of a tick or the reservoir role of a host. Such harmonization in protocols and terms should provide a coherent framework for the reporting of research findings concerning ticks and tick-borne diseases.

  14. BGD: a database of bat genomes.

    Directory of Open Access Journals (Sweden)

    Jianfei Fang

    Full Text Available Bats account for ~20% of mammalian species, and are the only mammals with true powered flight. For the sake of their specialized phenotypic traits, many researches have been devoted to examine the evolution of bats. Until now, some whole genome sequences of bats have been assembled and annotated, however, a uniform resource for the annotated bat genomes is still unavailable. To make the extensive data associated with the bat genomes accessible to the general biological communities, we established a Bat Genome Database (BGD. BGD is an open-access, web-available portal that integrates available data of bat genomes and genes. It hosts data from six bat species, including two megabats and four microbats. Users can query the gene annotations using efficient searching engine, and it offers browsable tracks of bat genomes. Furthermore, an easy-to-use phylogenetic analysis tool was also provided to facilitate online phylogeny study of genes. To the best of our knowledge, BGD is the first database of bat genomes. It will extend our understanding of the bat evolution and be advantageous to the bat sequences analysis. BGD is freely available at: http://donglab.ecnu.edu.cn/databases/BatGenome/.

  15. Tick-borne rickettsial pathogens in questing ticks, removed from humans and animals in Mexico

    Science.gov (United States)

    Vargas-Sandoval, Margarita; Torres, Javier

    2016-01-01

    Tick-borne rickettsial diseases (TBRD) are commonly encountered in medical and veterinary clinical settings. The control of these diseases is difficult, requiring disruption of a complex transmission chain involving a vertebrate host and ticks. The geographical distribution of the diseases is related to distribution of the vector, which is an indicator of risk for the population. A total of 1,107 ticks were collected by tick dragging from forests, ecotourism parks and hosts at 101 sites in 22 of the 32 states of Mexico. Collected ticks were placed in 1.5 mL cryovials containing 70% ethanol and were identified to species. Ticks were pooled according to location/host of collection, date of collection, sex, and stage of development. A total of 51 ticks were assayed by polymerase chain reaction (PCR) to confirm species identification using morphological methods. A total of 477 pools of ticks were assayed using PCR techniques for selected tick-borne pathogens. Anaplasma phagocytophilum was the most commonly detected pathogen (45 pools), followed by, Ehrlichia (E.) canis (42), Rickettsia (R.) rickettsii (11), E. chaffeensis (8), and R. amblyommii (1). Rhipicephalus sanguineus was the tick most frequently positive for selected pathogens. Overall, our results indicate that potential tick vectors positive for rickettsial pathogens are distributed throughout the area surveyed in Mexico. PMID:26726019

  16. Molecular survey of hard ticks in endemic areas of tick-borne diseases in China.

    Science.gov (United States)

    Lu, Xin; Lin, Xian-Dan; Wang, Jian-Bo; Qin, Xin-Cheng; Tian, Jun-Hua; Guo, Wen-Ping; Fan, Fei-Neng; Shao, Renfu; Xu, Jianguo; Zhang, Yong-Zhen

    2013-06-01

    Over the past several years, there was a substantial increase in the number of cases of known and novel tick-borne infections in humans in China. To better understand the ticks associated with these infections, we collected hard ticks from animals or around livestock shelters in 29 localities in 5 provinces (Beijing, Henan, Hubei, Inner Mongolia, and Zhejiang) where cases of tick-borne illness were reported. We collected 2950 hard ticks representing 7 species of 4 genera (Dermacentor sinicus, Haemaphysalis flava, Haemaphysalis longicornis, Ixodes granulatus, Ixodes persulcatus, Rhipicephalus microplus, and Rhipicephalus sanguineus). These ticks were identified to species using morphological characters initially. We then sequenced the mitochondrial small subunit rRNA (12S rRNA) gene, cytochrome oxidase subunit 1 (COI) gene, and the second internal transcribed spacer (ITS2) gene of these ticks, and conducted phylogenetic analyses. Our analyses showed that the molecular and morphological data are consistent in the identification of the 7 tick species. Furthermore, all these 7 tick species from China were genetically closely related to the same species or related species found outside China. Rapid and accurate identification and long-term monitoring of these ticks will be of significance to the prevention and control of tick-borne diseases in China.

  17. [Bats and Viruses: complex relationships].

    Science.gov (United States)

    Rodhain, F

    2015-10-01

    With more than 1 200 species, bats and flying foxes (Order Chiroptera) constitute the most important and diverse order of Mammals after Rodents. Many species of bats are insectivorous while others are frugivorous and few of them are hematophagous. Some of these animals fly during the night, others are crepuscular or diurnal. Some fly long distances during seasonal migrations. Many species are colonial cave-dwelling, living in a rather small home range while others are relatively solitary. However, in spite of the importance of bats for terrestrial biotic communities and ecosystem ecology, the diversity in their biology and lifestyles remain poorly known and underappreciated. More than sixty viruses have been detected or isolated in bats; these animals are therefore involved in the natural cycles of many of them. This is the case, for instance, of rabies virus and other Lyssavirus (Family Rhabdoviridae), Nipah and Hendra viruses (Paramyxoviridae), Ebola and Marburg viruses (Filoviridae), SARS-CoV and MERS-CoV (Coronaviridae). For these zoonotic viruses, a number of bat species are considered as important reservoir hosts, efficient disseminators or even directly responsible of the transmission. Some of these bat-borne viruses cause highly pathogenic diseases while others are of potential significance for humans and domestic or wild animals; so, bats are an important risk in human and animal public health. Moreover, some groups of viruses developed through different phylogenetic mechanisms of coevolution between viruses and bats. The fact that most of these viral infections are asymptomatic in bats has been observed since a long time but the mechanisms of the viral persistence are not clearly understood. The various bioecology of the different bat populations allows exchange of virus between migrating and non-migrating conspecific species. For a better understanding of the role of bats in the circulation of these viral zoonoses, epidemiologists must pay attention to

  18. Take Caution When Bats Are Near

    Science.gov (United States)

    ... potential exposure to a rabid animal, including bats. Histoplasmosis is another disease associated with bats. Its symptoms ... it can be fatal if untreated. In addition, Histoplasmosis is caused by a fungus that grows in ...

  19. Bat study in the Kharaa region, Mongolia

    Directory of Open Access Journals (Sweden)

    Ariunbold Jargalsaikhan

    2016-06-01

    Full Text Available Our study objectives were to determine bat species composition and to study the genetic variations and sound characteristics in bats of the Kharaa, Shatan, and Ulgii areas of Mongolia. This study is the first bat survey in this area. Nineteen species were from Mongolia. Six bat species belonged to three genera. We performed mitochondrial DNA sequencing of Myotis bombinus, Myotis gracilis, and Myotis petax to confirm the morphological identification of these species. We also determined the sound frequencies of the six bat species, based on their echolocation calls. The conservation status was determined using World Conservation Union red list categories and criteria. Sixteen bats from three species were ringed during this study and three artificial boxes were placed on trees in the Kharaa River Valley. Other than the northern bat, all species were eastern Palearctic. The northern bat (Eptesicus nilssonii species is widespread in the northern Palearctic region.

  20. Survey for bats in Jackson County, Colorado

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report covers a targeted bat survey of Jackson County in north-central Colorado to better understand the abundance and distribution of bats in Colorado. The...

  1. Swing Weights of Baseball and Softball Bats

    Science.gov (United States)

    Russell, Dan

    2010-01-01

    Baseball and softball bats are sold according to length in inches and weight in ounces. Much to the consternation of players buying new bats, however, not all bats that weigh the same swing the same. The reason for this has to do with moment of inertia of the bat about a pivot point on the handle, or what the sporting goods industry refers to as…

  2. Bat predation on nocturnally migrating birds

    OpenAIRE

    Ibáñez, Carlos; Juste, Javier; García-Mudarra, Juan L.; Agirre-Mendi, Pablo T.

    2001-01-01

    Bat predation on birds is a very rare phenomenon in nature. Most documented reports of bird-eating bats refer to tropical bats that occasionally capture resting birds. Millions of small birds concen- trate and cross over the world’s temperate regions during migra- tion, mainly at night, but no nocturnal predators are known to benefit from this enormous food resource. An analysis of 14,000 fecal pellets of the greater noctule bat (Nyctalus lasiopterus) reveals that this species captures a...

  3. Talking to Patients about Preventing Tick Bites

    Centers for Disease Control (CDC) Podcasts

    2012-02-14

    This podcast will help health care providers identify patients who are at increased risk of getting tick bites and provide these patients with tick bite prevention and removal tips.  Created: 2/14/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 2/14/2012.

  4. Coronavirus antibodies in African bat species.

    Science.gov (United States)

    Müller, Marcel A; Paweska, Janusz T; Leman, Patricia A; Drosten, Christian; Grywna, Klaus; Kemp, Alan; Braack, Leo; Sonnenberg, Karen; Niedrig, Matthias; Swanepoel, Robert

    2007-09-01

    Asian bats have been identified as potential reservoir hosts of coronaviruses associated with severe acute respiratory syndrome (SARS-CoV). We detected antibody reactive with SARS-CoV antigen in 47 (6.7%) of 705 bat serum specimens comprising 26 species collected in Africa; thus, African bats may harbor agents related to putative group 4 CoV.

  5. Guide to the BATS Resource Trunk.

    Science.gov (United States)

    Arizona Game and Fish Dept., Phoenix.

    This guide provides detailed information, resources, and activities to teach students about the bats of Arizona. Chapters include: (1) "What is a Bat?"; (2) "Megabat or Microbat?"; (3) "Bat Anatomy"; (4) Diet and Feeding"; (5) Echolocation"; (6) Reproduction and Lifespan"; (7) "Flight"; (8) "Migration and Hibernation"; (9) Habitat and Roost…

  6. Intensity and directionality of bat echolocation signals

    DEFF Research Database (Denmark)

    Jakobsen, Lasse; Brinkløv, Signe; Surlykke, Annemarie

    2013-01-01

    and the louder open space hunting bats have been recorded at above 135 dB SPL. This implies that maximum emitted intensities are generally 30 dB or more above initial estimates. Bats' dynamic control of acoustic features also includes the intensity and directionality of their sonar calls. Aerial hawking bats...

  7. Adaptive evolution of Leptin in heterothermic bats.

    Directory of Open Access Journals (Sweden)

    Lihong Yuan

    Full Text Available Heterothermy (hibernation and daily torpor is a key strategy that animals use to survive in harsh conditions and is widely employed by bats, which are found in diverse habitats and climates. Bats comprise more than 20% of all mammals and although heterothermy occurs in divergent lineages of bats, suggesting it might be an ancestral condition, its evolutionary history is complicated by complex phylogeographic patterns. Here, we use Leptin, which regulates lipid metabolism and is crucial for thermogenesis of hibernators, as molecular marker and combine physiological, molecular and biochemical analyses to explore the possible evolutionary history of heterothermy in bat. The two tropical fruit bats examined here were homeothermic; in contrast, the two tropical insectivorous bats were clearly heterothermic. Molecular evolutionary analyses of the Leptin gene revealed positive selection in the ancestors of all bats, which was maintained or further enhanced the lineages comprising mostly heterothermic species. In contrast, we found evidence of relaxed selection in homeothermic species. Biochemical assays of bat Leptin on the activity on adipocyte degradation revealed that Leptin in heterothermic bats was more lipolytic than in homeothermic bats. This shows that evolutionary sequence changes in this protein are indeed functional and support the interpretation of our physiological results and the molecular evolutionary analyses. Our combined data strongly support the hypothesis that heterothermy is the ancestral state of bats and that this involved adaptive changes in Leptin. Subsequent loss of heterothermy in some tropical lineages of bats likely was associated with range and dietary shifts.

  8. Borrelia Diversity and Co-infection with Other Tick Borne Pathogens in Ticks

    Science.gov (United States)

    Raileanu, Cristian; Moutailler, Sara; Pavel, Ionuţ; Porea, Daniela; Mihalca, Andrei D.; Savuta, Gheorghe; Vayssier-Taussat, Muriel

    2017-01-01

    Identifying Borrelia burgdorferi as the causative agent of Lyme disease in 1981 was a watershed moment in understanding the major impact that tick-borne zoonoses can have on public health worldwide, particularly in Europe and the USA. The medical importance of tick-borne diseases has long since been acknowledged, yet little is known regarding the occurrence of emerging tick-borne pathogens such as Borrelia spp., Anaplasma phagocytophilum, Rickettsia spp., Bartonella spp., “Candidatus Neoehrlichia mikurensis”, and tick-borne encephalitis virus in questing ticks in Romania, a gateway into Europe. The objective of our study was to identify the infection and co-infection rates of different Borrelia genospecies along with other tick-borne pathogens in questing ticks collected from three geographically distinct areas in eastern Romania. We collected 557 questing adult and nymph ticks of three different species (534 Ixodes ricinus, 19 Haemaphysalis punctata, and 4 Dermacentor reticulatus) from three areas in Romania. We analyzed ticks individually for the presence of eight different Borrelia genospecies with high-throughput real-time PCR. Ticks with Borrelia were then tested for possible co-infections with A. phagocytophilum, Rickettsia spp., Bartonella spp., “Candidatus Neoehrlichia mikurensis”, and tick-borne encephalitis virus. Borrelia spp. was detected in I. ricinus ticks from all sampling areas, with global prevalence rates of 25.8%. All eight Borrelia genospecies were detected in I. ricinus ticks: Borrelia garinii (14.8%), B. afzelii (8.8%), B. valaisiana (5.1%), B. lusitaniae (4.9%), B. miyamotoi (0.9%), B. burgdorferi s.s (0.4%), and B. bissettii (0.2%). Regarding pathogen co-infection 64.5% of infected I. ricinus were positive for more than one pathogen. Associations between different Borrelia genospecies were detected in 9.7% of ticks, and 6.9% of I. ricinus ticks tested positive for co-infection of Borrelia spp. with other tick-borne pathogens. The

  9. Anaplasma phagocytophilum in ticks in Slovenia

    Directory of Open Access Journals (Sweden)

    Knap Nataša

    2010-11-01

    Full Text Available Abstract Ticks act as vectors of many pathogens of domestic animals and humans. Anaplasma phagocytophilum in Europe is transmitted by the ixodid tick vector Ixodes ricinus. A. phagocytophilum causes a disease with diverse clinical signs in various hosts. A great genetic diversity of the groESL operon of A. phagocytophilum has been found in ticks elsewhere. In Slovenia, the variety of the groESL operon was conducted only on deer samples. In this study, the prevalence of infected ticks was estimated and the diversity of A. phagocytophilum was evaluated. On 8 locations in Slovenia, 1924 and 5049 (6973 I. ricinus ticks were collected from vegetation in the years 2005 and 2006, respectively. All three feeding stages of the tick's life cycle were examined. The prevalence of ticks infected with A. phagocytophilum in the year 2005 and in the year 2006 was 0.31% and 0.63%, respectively, and it did not differ considerably between locations. The similarity among the sequences of groESL ranged from 95.6% to 99.8%. They clustered in two genetic lineages along with A. phagocytophilum from Slovenian deer. One sequence formed a separate cluster. According to our study, the prevalence of A. phagocytophilum in ticks is comparable to the findings in other studies in Europe, and it does not vary considerably between locations and tick stages. According to groESL operon analysis, two genetic lineages have been confirmed and one proposed. Further studies on other genes would be useful to obtain more information on genetic diversity of A. phagocytophilum in ticks in Slovenia.

  10. The ecology of ticks and epidemiology of tick-borne viral diseases.

    Science.gov (United States)

    Estrada-Peña, Agustín; de la Fuente, José

    2014-08-01

    A number of tick-borne diseases of humans have increased in incidence and geographic range over the past few decades, and there is concern that they will pose an even greater threat to public health in future. Although global warming is often cited as the underlying mechanism favoring the spread of tick-borne diseases, climate is just one of many factors that determine which tick species are found in a given geographic region, their population density, the likelihood that they will be infected with microbes pathogenic for humans and the frequency of tick-human contact. This article provides basic information needed for microbiologists to understand the many factors that affect the geographic range and population density of ticks and the risk of human exposure to infected ticks. It first briefly summarizes the life cycle and basic ecology of ticks and how ticks and vertebrate hosts interact, then reviews current understanding of the role of climate, sociodemographic factors, agricultural development and changes in human behavior that affect the incidence of tick-borne diseases. These concepts are then illustrated in specific discussions of tick-borne encephalitis and Crimean-Congo hemorrhagic fever.

  11. Tick-borne rickettsial pathogens in questing ticks, removed from humans and animals in Mexico.

    Science.gov (United States)

    Sosa-Gutierrez, Carolina G; Vargas-Sandoval, Margarita; Torres, Javier; Gordillo-Pérez, Guadalupe

    2016-09-30

    Tick-borne rickettsial diseases (TBRD) are commonly encountered in medical and veterinary clinical settings. The control of these diseases is difficult, requiring disruption of a complex transmission chain involving a vertebrate host and ticks. The geographical distribution of the diseases is related to distribution of the vector, which is an indicator of risk for the population. A total of 1107 were collected by tick drag from forests, ecotourism parks and hosts at 101 sites in 22 of the 32 states of Mexico. Collected ticks were placed in 1.5 mL cryovials containing 70% ethanol and were identified to species. Ticks were pooled according to location/host of collection, date of collection, sex, and stage of development. A total of 51 ticks were assayed by polymerase chain reaction (PCR) to confirm species identification using morphological methods. A total of 477 pools of ticks were assayed using PCR techniques for selected tick-borne pathogens. Anaplasma phagocytophilum was the most commonly detected pathogen (45 pools), followed by, Ehrlichia (E.) canis (42), Rickettsia (R.) rickettsii (11), E. chaffeensis (8), and R. amblyommii (1). Rhipicephalus sanguineus was the tick most frequently positive for selected pathogens. Overall, our results indicate that potential tick vectors positive for rickettsial pathogens are distributed throughout the area surveyed in Mexico.

  12. A perspective on bats (Chiroptera

    Directory of Open Access Journals (Sweden)

    M. Brock Fenton

    2013-03-01

    Full Text Available With over 130 species, bats are the most diverse group of mammals almost everywhere in sub-Saharan Africa. Since 2000, two books (Monadjem et al. 2010; Taylor 2000 have made it much easier to appreciate this reality. Species previously unrecognised are frequent discoveries (e.g. Taylor et al. 2012. Whilst most species are mainly insectivorous, some rely more directly on plants, taking fruit and visiting flowers to obtain nectar and pollen. The combination of mobility, long lifespan and diversity of trophic roles makes bats potentially valuable as indicators of ecosystem health (Cumming & Spiesman 2006. Lack of detailed information, however, makes it easy to overlook bats when focusing on issues of conservation.

  13. An attempt of rationalization of tick-borne disease prevention using a multifunctional container for Tick Twister ®

    Directory of Open Access Journals (Sweden)

    Barbara Oczko-Grzesik

    2013-12-01

    Full Text Available Ticks are reservoir and transmission vectors of many bacteria, viruses and parasites, which are pathogenic for humans. Early and correct tick removal is crucial as prevention of tick-borne diseases. The aim of the study is an attempt at rationalization of tick-borne disease prevention using a multifunctional container for Tick Twister®. In practice, it should enable people to use Tick Twister® in all circumstances contributing to the improvement of efficiency in tick-borne diseases prevention, and as a result, to a decrease in their frequency and after effects.

  14. Novel Coronaviruses and Astroviruses in Bats

    Institute of Scientific and Technical Information of China (English)

    Daniel K. W. Chu; J. S. Malik Peiris; Leo L. M. Poon

    2009-01-01

    Zoonotic transmissions of emerging pathogens from wildlife to human have shaped the history of mankind. These events have also highlighted our poor understanding of microorganisms circulated in wild animals. Coronaviruses and astroviruses, which can be found from a wide range of mammals, were recently detected in bats. Strikingly, these bat viruses are genetically highly diverse and these interesting findings might help to better understand the evolution and ecology of these viruses. The discoveries of these novel bats viruses not only suggested that bats are important hosts for these virus families, but also reiterated the role of bats as a reservoir of viruses that might pose a zoonotic threat to human health.

  15. A One Health Message about Bats Increases Intentions to Follow Public Health Guidance on Bat Rabies.

    Directory of Open Access Journals (Sweden)

    Hang Lu

    Full Text Available Since 1960, bat rabies variants have become the greatest source of human rabies deaths in the United States. Improving rabies awareness and preventing human exposure to rabid bats remains a national public health priority today. Concurrently, conservation of bats and the ecosystem benefits they provide is of increasing importance due to declining populations of many bat species. This study used a visitor-intercept experiment (N = 521 in two U.S. national parks where human and bat interactions occur on an occasional basis to examine the relative persuasiveness of four messages differing in the provision of benefit and uncertainty information on intentions to adopt a rabies exposure prevention behavior. We found that acknowledging benefits of bats in a risk message led to greater intentions to adopt the recommended rabies exposure prevention behavior without unnecessarily stigmatizing bats. These results signify the importance of communicating benefits of bats in bat rabies prevention messages to benefit both human and wildlife health.

  16. BAT-BORNE RABIES IN LATIN AMERICA

    Directory of Open Access Journals (Sweden)

    Luis E. Escobar

    2015-02-01

    Full Text Available The situation of rabies in America is complex: rabies in dogs has decreased dramatically, but bats are increasingly recognized as natural reservoirs of other rabies variants. Here, bat species known to be rabies-positive with different antigenic variants, are summarized in relation to bat conservation status across Latin America. Rabies virus is widespread in Latin American bat species, 22.5%75 of bat species have been confirmed as rabies-positive. Most bat species found rabies positive are classified by the International Union for Conservation of Nature as “Least Concern”. According to diet type, insectivorous bats had the most species known as rabies reservoirs, while in proportion hematophagous bats were the most important. Research at coarse spatial scales must strive to understand rabies ecology; basic information on distribution and population dynamics of many Latin American and Caribbean bat species is needed; and detailed information on effects of landscape change in driving bat-borne rabies outbreaks remains unassessed. Finally, integrated approaches including public health, ecology, and conservation biology are needed to understand and prevent emergent diseases in bats.

  17. How do tiger moths jam bat sonar?

    Science.gov (United States)

    Corcoran, Aaron J; Barber, Jesse R; Hristov, Nickolay I; Conner, William E

    2011-07-15

    The tiger moth Bertholdia trigona is the only animal in nature known to defend itself by jamming the sonar of its predators - bats. In this study we analyzed the three-dimensional flight paths and echolocation behavior of big brown bats (Eptesicus fuscus) attacking B. trigona in a flight room over seven consecutive nights to determine the acoustic mechanism of the sonar-jamming defense. Three mechanisms have been proposed: (1) the phantom echo hypothesis, which states that bats misinterpret moth clicks as echoes; (2) the ranging interference hypothesis, which states that moth clicks degrade the bats' precision in determining target distance; and (3) the masking hypothesis, which states that moth clicks mask the moth echoes entirely, making the moth temporarily invisible. On nights one and two of the experiment, the bats appeared startled by the clicks; however, on nights three through seven, the bats frequently missed their prey by a distance predicted by the ranging interference hypothesis (∼15-20 cm). Three-dimensional simulations show that bats did not avoid phantom targets, and the bats' ability to track clicking prey contradicts the predictions of the masking hypothesis. The moth clicks also forced the bats to reverse their stereotyped pattern of echolocation emissions during attack, even while bats continued pursuit of the moths. This likely further hinders the bats' ability to track prey. These results have implications for the evolution of sonar jamming in tiger moths, and we suggest evolutionary pathways by which sonar jamming may have evolved from other tiger moth defense mechanisms.

  18. Novel phleboviruses detected in ticks, Greece.

    Science.gov (United States)

    Papa, Anna; Kontana, Anastasia; Tsioka, Katerina; Chaligiannis, Ilias; Sotiraki, Smaragda

    2016-07-01

    Since 2009, when severe fever with thrombocytopenia syndrome virus and Heartland virus have been identified and associated with disease in humans, the interest on tick-borne phleboviruses is increasing rapidly. The aim of the present study was to investigate the presence of tick-borne phleboviruses in Greece and compare them with respective ones detected worldwide. Ticks collected from goats and sheep in 60 sites of 13 regional units of Greece were grouped in pools (1-3 ticks per pool) and tested for the presence of phleboviral RNA. Six of 210 pools were positive; they consisted of Rhipicephalus sanguineus ticks collected from sheep in 3 regional units of Greece: Pella (2/30, 6.7%), Imathia (2/21, 9.5%), and Ioannina (2/28, 7.1%). The overall tick minimum infection rate was 2.1%. The sequences of the Greek phlebovirus (provisionally named Antigone virus) form a distinct clade in the tick-borne phleboviruses, differing by >40% from the currently known phleboviruses. Any probable implication of these viruses to public health remains to be elucidated.

  19. Influence of the biotope on the tick infestation of cattle and on the tick-borne pathogen repertoire of cattle ticks in Ethiopia.

    Directory of Open Access Journals (Sweden)

    Sándor Hornok

    Full Text Available BACKGROUND: The majority of vector-borne infections occur in the tropics, including Africa, but molecular eco-epidemiological studies are seldom reported from these regions. In particular, most previously published data on ticks in Ethiopia focus on species distribution, and only a few molecular studies on the occurrence of tick-borne pathogens or on ecological factors influencing these. The present study was undertaken to evaluate, if ticks collected from cattle in different Ethiopian biotopes harbour (had access to different pathogens. METHODS: In South-Western Ethiopia 1032 hard ticks were removed from cattle grazing in three kinds of tick biotopes. DNA was individually extracted from one specimen of both sexes of each tick species per cattle. These samples were molecularly analysed for the presence of tick-borne pathogens. RESULTS: Amblyomma variegatum was significantly more abundant on mid highland, than on moist highland. Rhipicephalus decoloratus was absent from savannah lowland, where virtually only A. cohaerens was found. In the ticks Coxiella burnetii had the highest prevalence on savannah lowland. PCR positivity to Theileria spp. did not appear to depend on the biotope, but some genotypes were unique to certain tick species. Significantly more A. variegatum specimens were rickettsia-positive, than those of other tick species. The presence of rickettsiae (R. africae appeared to be associated with mid highland in case of A. variegatum and A. cohaerens. The low level of haemoplasma positivity seemed to be equally distributed among the tick species, but was restricted to one biotope type. CONCLUSIONS: The tick biotope, in which cattle are grazed, will influence not only the tick burden of these hosts, but also the spectrum of pathogens in their ticks. Thus, the presence of pathogens with alternative (non-tick-borne transmission routes, with transstadial or with transovarial transmission by ticks appeared to be associated with the biotope

  20. A list of the 70 species of Australian ticks; diagnostic guides to and species accounts of Ixodes holocyclus (paralysis tick), Ixodes cornuatus (southern paralysis tick) and Rhipicephalus australis (Australian cattle tick); and consideration of the place of Australia in the evolution of ticks with comments on four controversial ideas.

    Science.gov (United States)

    Barker, Stephen C; Walker, Alan R; Campelo, Dayana

    2014-10-15

    Seventy species of ticks are known from Australia: 14 soft ticks (family Argasidae) and 56 hard ticks (family Ixodidae). Sixteen of the 70 ticks in Australia may feed on humans and domestic animals (Barker and Walker 2014). The other 54 species of ticks in Australia feed only on wild mammals, reptiles and birds. At least 12 of the species of ticks in Australian also occur in Papua New Guinea. We use an image-matching system much like the image-matching systems of field guides to birds and flowers to identify Ixodes holocyclus (paralysis tick), Ixodes cornuatus (southern paralysis tick) and Rhipicephalus (Boophilus) australis (Australian cattle tick). Our species accounts have reviews of the literature on I. holocyclus (paralysis tick) from the first paper on the biology of an Australian tick by Bancroft (1884), on paralysis of dogs by I. holocyclus, to papers published recently, and of I. cornuatus (southern paralysis tick) and Rhipicephalus (Boophilus) australis (Australian cattle tick). We comment on four controversial questions in the evolutionary biology of ticks: (i) were labyrinthodont amphibians in Australia in the Devonian the first hosts of soft, hard and nuttalliellid ticks?; (ii) are the nuttalliellid ticks the sister-group to the hard ticks or the soft ticks?; (iii) is Nuttalliella namaqua the missing link between the soft and hard ticks?; and (iv) the evidence for a lineage of large bodied parasitiform mites (ticks plus the holothyrid mites plus the opiliocarid mites).

  1. Coendangered hard-ticks: threatened or threatening?

    Directory of Open Access Journals (Sweden)

    Cozma Vasile

    2011-05-01

    Full Text Available Abstract The overwhelming majority of animal conservation projects are focused on vertebrates, despite most of the species on Earth being invertebrates. Estimates state that about half of all named species of invertebrates are parasitic in at least one stage of their development. The dilemma of viewing parasites as biodiversity or pest has been discussed by several authors. However, ticks were omitted. The latest taxonomic synopses of non-fossil Ixodidae consider valid 700 species. Though, how many of them are still extant is almost impossible to tell, as many of them are known only from type specimens in museums and were never collected since their original description. Moreover, many hosts are endangered and as part of conservation efforts of threatened vertebrates, a common practice is the removal of, and treatment for external parasites, with devastating impact on tick populations. There are several known cases when the host became extinct with subsequent coextinction of their ectoparasites. For our synoptic approach we have used the IUCN status of the host in order to evaluate the status of specifically associated hard-ticks. As a result, we propose a number of 63 coendangered and one extinct hard-tick species. On the other side of the coin, the most important issue regarding tick-host associations is vectorial transmission of microbial pathogens (i.e. viruses, bacteria, protozoans. Tick-borne diseases of threatened vertebrates are sometimes fatal to their hosts. Mortality associated with pathogens acquired from ticks has been documented in several cases, mostly after translocations. Are ticks a real threat to their coendangered host and should they be eliminated? Up to date, there are no reliable proofs that ticks listed by us as coendangered are competent vectors for pathogens of endangered animals.

  2. Host specialization in ticks and transmission of tick-borne diseases: a review.

    Science.gov (United States)

    McCoy, Karen D; Léger, Elsa; Dietrich, Muriel

    2013-01-01

    Determining patterns of host use, and the frequency at which these patterns change, are of key importance if we are to understand tick population dynamics, the evolution of tick biodiversity, and the circulation and evolution of associated pathogens. The question of whether ticks are typically host specialists or host generalists has been subject to much debate over the last half-century. Indeed, early research proposed that morphological diversity in ticks was linked to host specific adaptations and that most ticks were specialists. Later work disputed this idea and suggested that ticks are largely limited by biogeographic conditions and tend to use all locally available host species. The work presented in this review suggests that the actual answer likely lies somewhere between these two extremes. Although recent observational studies support the view that phylogenetically diverse host species share ticks when found on similar ecological ranges, theory on host range evolution predicts that host specialization should evolve in ticks given their life history characteristics. Contemporary work employing population genetic tools to examine host-associated population structure in several tick systems support this prediction and show that simple species records are not enough to determine whether a parasite is a true host generalist; host specialization does evolve in ticks at local scales, but may not always lead to speciation. Ticks therefore seem to follow a pattern of being global generalists, local specialists. Given this, the notion of host range needs to be modified from an evolutionary perspective, where one simply counts the number of hosts used across the geographic distribution, to a more ecological view, where one considers host use at a local scale, if we are to better understand the circulation of tick-borne pathogens and exposure risks for humans and livestock.

  3. Host specialisation in ticks and transmission of tick-borne diseases: a review

    Directory of Open Access Journals (Sweden)

    Karen Denise Mccoy

    2013-10-01

    Full Text Available Determining patterns of host use, and the frequency at which these patterns change, are of key importance if we are to understand tick population dynamics, the evolution of tick biodiversity, and the circulation and evolution of associated pathogens. The question of whether ticks are typically host specialists or host generalists has been subject to much debate over the last half-century. Indeed, early research proposed that morphological diversity in ticks was linked to host specific adaptations and that most ticks were specialists. Later work disputed this idea and suggested that ticks are largely limited by biogeographic conditions and tend to use all locally available host species. The work presented in this review suggests that the actual answer likely lies somewhere between these two extremes. Although recent observational studies support the view that phylogenetically diverse host species share ticks when found on similar ecological ranges, theory on host range evolution predicts that host specialisation should evolve in ticks given their life history characteristics. Contemporary work employing population genetic tools to examine host-associated population structure in several tick systems support this prediction and show that simple species records are not enough to determine whether a parasite is a true host generalist; host specialisation does evolve in ticks at local scales, but may not always lead to speciation. Ticks therefore seem to follow a pattern of being global generalists, local specialists. Given this, the notion of host range needs to be modified from an evolutionary perspective, where one simply counts the number of hosts used across the geographic distribution, to a more ecological view, where one considers host use at a local scale, if we are to better understand the circulation of tick-borne pathogens and exposure risks for humans and livestock.

  4. Lignite coke moving bed adsorber for cement plants - BAT or beyond BAT?

    Energy Technology Data Exchange (ETDEWEB)

    Schoenberger, H. [European Commission, Seville (Spain). Joint Research Center

    2011-06-15

    The IPPC Directive requires permits which must contain emission limit values and other conditions based on BAT. The BAT are characterised and the terms 'conditional BAT' and 'beyond BAT' are defined and explained. The borderline between BAT and beyond BAT is explained by means of an outstanding example which is the lignite coke moving bed adsorber for the abatement of the waste gas from a cement plant where waste for co-incineration is fed to a considerable extent is described in detail. Worldwide, this technique has been successfully applied at one cement plant for sixteen years.

  5. Bat Flight and Zoonotic Viruses

    Centers for Disease Control (CDC) Podcasts

    2014-05-30

    Reginald Tucker reads an abridged version of the EID perspective Bat Flight and Zoonotic Viruses.  Created: 5/30/2014 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 6/2/2014.

  6. Identification of tick-borne pathogens in ticks feeding on humans in Turkey.

    Directory of Open Access Journals (Sweden)

    Ömer Orkun

    2014-08-01

    Full Text Available The importance of tick-borne diseases is increasing all over the world, including Turkey. The tick-borne disease outbreaks reported in recent years and the abundance of tick species and the existence of suitable habitats increase the importance of studies related to the epidemiology of ticks and tick-borne pathogens in Turkey. The aim of this study was to investigate the presence of and to determine the infection rates of some tick-borne pathogens, including Babesia spp., Borrelia burgdorferi sensu lato and spotted fever group rickettsiae in the ticks removed from humans in different parts of Ankara.A total of 169 ticks belonging to the genus Haemaphysalis, Hyalomma, Ixodes and Rhipicephalus were collected by removing from humans in different parts of Ankara. Ticks were molecularly screened for Babesia spp., Borrelia burgdorferi sensu lato and spotted fever group rickettsiae by PCR and sequencing analysis. We detected 4 Babesia spp.; B. crassa, B. major, B. occultans and B. rossi, one Borrelia spp.; B. burgdorferi sensu stricto and 3 spotted fever group rickettsiae; R. aeschlimannii, R. slovaca and R. hoogstraalii in the tick specimens analyzed. This is the report showing the presence of B. rossi in a region that is out of Africa and in the host species Ha. parva. In addition, B. crassa, for which limited information is available on its distribution and vector species, and B. occultans, for which no conclusive information is available on its presence in Turkey, were identified in Ha. parva and H. marginatum, respectively. Two human pathogenic rickettsia species (R. aeschlimannii and R. slovaca were detected with a high prevalence in ticks. Additionally, B. burgdorferi sensu stricto was detected in unusual tick species (H. marginatum, H. excavatum, Hyalomma spp. (nymph and Ha. parva.This study investigates both the distribution of several tick-borne pathogens affecting humans and animals, and the presence of new tick-borne pathogens in Turkey

  7. Problem of ticks and tick-borne diseases in India with special emphasis on progress in tick control research: a review.

    Science.gov (United States)

    Ghosh, Srikant; Nagar, Gaurav

    2014-12-01

    Ticks, as vectors of several zoonotic diseases, are ranked second only to mosquitoes as vectors. The diseases spread by ticks are a major constraint to animal productivity while causing morbidity and mortality in both animals and humans. A number of tick species have been recognised since long as vectors of lethal pathogens, viz. Crimean-Congo haemorrhagic fever virus (CCHFV), Kyasanur forest disease virus (KFDV), Babesia spp, Theileria, Rickettsia conorii, Anaplasma marginale, etc. and the damages caused by them are well-recognised. There is a need to reassess the renewed threat posed by the tick vectors and to prioritize the tick control research programme. This review is focused on the major tick-borne human and animal diseases in India and the progress in vector control research with emphasis on acaricide resistance, tick vaccine and the development of potential phytoacaricides as an integral part of integrated tick control programme.

  8. Anti-tick biological control agents: assessment and future perspectives

    Science.gov (United States)

    Samish, M.; Ginsberg, H.S.; Glazer, I.; Bowman, Alan. S.; Nuttall, Patricia A.

    2008-01-01

    Widespread and increasing resistance to most available acaracides threatens both global livestock industries and public health. This necessitates better understanding of ticks and the diseases they transmit in the development of new control strategies. Ticks: Biology, Disease and Control is written by an international collection of experts and covers in-depth information on aspects of the biology of the ticks themselves, various veterinary and medical tick-borne pathogens, and aspects of traditional and potential new control methods. A valuable resource for graduate students, academic researchers and professionals, the book covers the whole gamut of ticks and tick-borne diseases from microsatellites to satellite imagery and from exploiting tick saliva for therapeutic drugs to developing drugs to control tick populations. It encompasses the variety of interconnected fields impinging on the economically important and biologically fascinating phenomenon of ticks, the diseases they transmit and methods of their control.

  9. [Behavioral therapy of ticks with negative reinforcement in children].

    Science.gov (United States)

    Nabieva, T N; Mukhin, E I

    2003-01-01

    Thirty-two children suffering from motor and vocal ticks exhibited weakness and distonia of ticks-prone muscles were examined. Based on the results obtained earlier, a complex of physical exercises has been worked out and conducted for 20 days. The patients were divided into 3 groups: 1st (n = 10) group did the exercises daily for training the ticks-prone muscles; the 2nd one (n = 10) exercised only after tick's appearance--negative reinforcement; 3rd group (n = 12) did exercises after tick's appearance as well but on irregular basis--probable negative reinforcement. In the 1st group, the exercising resulted in muscle strengthening and decrease of tick's number. The patients of the 2nd group got rid of ticks for 20 days. The probable tick's reinforcement in children of the 3rd group did not change pathological muscle activity. The central mechanisms of cortical plasticity in behavioral therapy of ticks are discussed.

  10. Interaction of the tick immune system with transmitted pathogens

    Directory of Open Access Journals (Sweden)

    Ondrej eHajdusek

    2013-07-01

    Full Text Available Ticks are hematophagous arachnids transmitting a wide variety of pathogens including viruses, bacteria, and protozoans to their vertebrate hosts. The tick vector competence has to be intimately linked to the ability of transmitted pathogens to evade tick defense mechanisms encountered on their route through the tick body comprising midgut, hemolymph, salivary glands or ovaries. Tick innate immunity is, like in other invertebrates, based on an orchestrated action of humoral and cellular immune responses. The direct antimicrobial defense in ticks is accomplished by a variety of small molecules such as defensins, lysozymes or by tick-specific antimicrobial compounds such as microplusin/hebraein or 5.3-kDa family proteins. Phagocytosis of the invading microbes by tick hemocytes seems to be mediated by the primordial complement-like system composed of thioester-containing proteins, fibrinogen-related lectins and convertase-like factors. Moreover, an important role in survival of the ingested microbes seems to be played by host proteins and redox balance maintenance in the tick midgut. Here, we summarize recent knowledge about the major components of tick immune system and focus on their interaction with the relevant tick-transmitted pathogens, represented by spirochetes (Borrelia, rickettsiae (Anaplasma, and protozoans (Babesia. Availability of the tick genomic database and feasibility of functional genomics based on RNA interference greatly contribute to the understanding of molecular and cellular interplay at the tick-pathogen interface and may provide new targets for blocking the transmission of tick pathogens.

  11. Ultraviolet vision may be widespread in bats

    Science.gov (United States)

    Gorresen, P. Marcos; Cryan, Paul; Dalton, David C.; Wolf, Sandy; Bonaccorso, Frank

    2015-01-01

    Insectivorous bats are well known for their abilities to find and pursue flying insect prey at close range using echolocation, but they also rely heavily on vision. For example, at night bats use vision to orient across landscapes, avoid large obstacles, and locate roosts. Although lacking sharp visual acuity, the eyes of bats evolved to function at very low levels of illumination. Recent evidence based on genetics, immunohistochemistry, and laboratory behavioral trials indicated that many bats can see ultraviolet light (UV), at least at illumination levels similar to or brighter than those before twilight. Despite this growing evidence for potentially widespread UV vision in bats, the prevalence of UV vision among bats remains unknown and has not been studied outside of the laboratory. We used a Y-maze to test whether wild-caught bats could see reflected UV light and whether such UV vision functions at the dim lighting conditions typically experienced by night-flying bats. Seven insectivorous species of bats, representing five genera and three families, showed a statistically significant ‘escape-toward-the-light’ behavior when placed in the Y-maze. Our results provide compelling evidence of widespread dim-light UV vision in bats.

  12. Molecular Ecological Insights into Neotropical Bird-Tick Interactions.

    Directory of Open Access Journals (Sweden)

    Matthew J Miller

    Full Text Available In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds' role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually-sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna. Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical-Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically-identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly-discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology

  13. Tick control: trapping, biocontrol, host management and other alternative strategies

    Science.gov (United States)

    Ginsberg, Howard S.; Edited by Sonenshine, Daniel E.; Roe, R. Michael

    2014-01-01

    Biology of Ticks is the most comprehensive work on tick biology and tick-borne diseases. This second edition is a multi-authored work, featuring the research and analyses of renowned experts across the globe. Spanning two volumes, the book examines the systematics, biology, structure, ecological adaptations, evolution, genomics and the molecular processes that underpin the growth, development and survival of these important disease-transmitting parasites. Also discussed is the remarkable array of diseases transmitted (or caused) by ticks, as well as modern methods for their control. This book should serve as a modern reference for students, scientists, physicians, veterinarians and other specialists. Volume I covers the biology of the tick and features chapters on tick systematics, tick life cycles, external and internal anatomy, and others dedicated to specific organ systems, specifically, the tick integument, mouthparts and digestive system, salivary glands, waste removal, salivary glands, respiratory system, circulatory system and hemolymph, fat body, the nervous and sensory systems and reproductive systems. Volume II includes chapters on the ecology of non-nidicolous and nidicolous ticks, genetics and genomics (including the genome of the Lyme disease vector Ixodes scapularis) and immunity, including host immune responses to tick feeding and tick-host interactions, as well as the tick's innate immune system that prevents and/or controls microbial infections. Six chapters cover in depth the many diseases caused by the major tick-borne pathogens, including tick-borne protozoa, viruses, rickettsiae of all types, other types of bacteria (e.g., the Lyme disease agent) and diseases related to tick paralytic agents and toxins. The remaining chapters are devoted to tick control using vaccines, acaricides, repellents, biocontrol, and, finally, techniques for breeding ticks in order to develop tick colonies for scientific study.

  14. Molecular Ecological Insights into Neotropical Bird–Tick Interactions

    Science.gov (United States)

    Esser, Helen J.; Loaiza, Jose R.; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds’ role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually–sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna). Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical–Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically–identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly–discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology and the

  15. Small risk of developing symptomatic tick-borne diseases following a tick bite in the Netherlands

    Directory of Open Access Journals (Sweden)

    Hofhuis Agnetha

    2011-02-01

    Full Text Available Abstract Background In The Netherlands, the incidence of Lyme borreliosis is on the rise. Besides its causative agent, Borrelia burgdorferi s.l., other potential pathogens like Rickettsia, Babesia and Ehrlichia species are present in Ixodes ricinus ticks. The risk of disease associated with these microorganisms after tick-bites remains, however, largely unclear. A prospective study was performed to investigate how many persons with tick-bites develop localized or systemic symptoms and whether these are associated with tick-borne microorganisms. Results In total, 297 Ixodes ricinus ticks were collected from 246 study participants who consulted a general practitioner on the island of Ameland for tick bites. Ticks were subjected to PCR to detect DNA of Borrelia burgdorferi s.l., Rickettsia spp., Babesia spp. or Ehrlichia/Anaplasma spp.. Sixteen percent of the collected ticks were positive for Borrelia burgdorferi s.l., 19% for Rickettsia spp., 12% for Ehrlichia/Anaplasma spp. and 10% for Babesia spp.. At least six months after the tick bite, study participants were interviewed on symptoms by means of a standard questionnaire. 14 out of 193 participants (8.3% reported reddening at the bite site and 6 participants (4.1% reported systemic symptoms. No association between symptoms and tick-borne microorganisms was found. Attachment duration ≥24 h was positively associated with reddening at the bite site and systemic symptoms. Using logistic regression techniques, reddening was positively correlated with presence of Borrelia afzelii, and having 'any symptoms' was positively associated with attachment duration. Conclusion The risk of contracting acute Lyme borreliosis, rickettsiosis, babesiosis or ehrlichiosis from a single tick bite was

  16. Wild birds and urban ecology of ticks and tick-borne pathogens, Chicago, Illinois, USA, 2005-2010.

    Science.gov (United States)

    Hamer, Sarah A; Goldberg, Tony L; Kitron, Uriel D; Brawn, Jeffrey D; Anderson, Tavis K; Loss, Scott R; Walker, Edward D; Hamer, Gabriel L

    2012-10-01

    Bird-facilitated introduction of ticks and associated pathogens is postulated to promote invasion of tick-borne zoonotic diseases into urban areas. Results of a longitudinal study conducted in suburban Chicago, Illinois, USA, during 2005-2010 show that 1.6% of 6,180 wild birds captured in mist nets harbored ticks. Tick species in order of abundance were Haemaphysalis leporispalustris, Ixodes dentatus, and I. scapularis, but 2 neotropical tick species of the genus Amblyomma were sampled during the spring migration. I. scapularis ticks were absent at the beginning of the study but constituted the majority of ticks by study end and were found predominantly on birds captured in areas designated as urban green spaces. Of 120 ticks, 5 were infected with Borrelia burgdorferi, spanning 3 ribotypes, but none were infected with Anaplasma phagocytophilum. Results allow inferences about propagule pressure for introduction of tick-borne diseases and emphasize the large sample sizes required to estimate this pressure.

  17. Ticks imported to Europe with exotic reptiles.

    Science.gov (United States)

    Mihalca, Andrei Daniel

    2015-09-30

    It is known that traded exotic animals carry with them an immense number of associated symbionts, including parasites. Reptiles are no exception. Most of the imported reptiles originate from tropical countries and their possibility to carry potentially dangerous pathogens is high. According to CITES, Europe is currently the main reptile importer in the world. Despite this, there is no review or analysis available for the risk related to the importation of tick-borne diseases with traded reptile to the EU. The main aim of the manuscript is to provide a review on the available literature on ticks introduced to and exchanged between European countries via the live reptile trade. So far, the published reports of ticks imported on reptiles are limited to few European countries: Italy, Poland, Spain, Netherlands, Belgium, Slovenia and UK. The following species have been reported: Hyalomma aegyptium, Amblyomma dissimile, Amblyomma exornatum, Amblyomma flavomaculatum, Amblyomma fuscolineatum, Amblyomma latum, Amblyomma quadricavum, Amblyomma marmoreum, Amblyomma nuttalli, Amblyomma sparsum, Amblyomma sphenodonti, Amblyomma transversale and Amblyomma varanense. The majority of species are of African origin, followed by American and Asian species. All groups of reptiles (chelonians, snakes, lizards, crocodiles, tuataras) were involved. However, it seems that certain groups (i.e. tortoises of genus Testudo, monitor lizards of genus Varanus, snakes of genus Python) are more important as host for imported ticks, but this may be related to higher levels of international trade. Even fewer are the reports of tick-borne pathogens associated with imported reptile ticks. Despite the diversity of tick species reported on imported reptiles, the situations of truly invasive species are atypical and are limited in natural environments to maximum two cases where H. aegyptium was involved. Otherwise, the risk associated with reptile trade for introduction of invasive tick to Europe is low

  18. Mechanism of Immunity to Tick infestation in Livestock

    Directory of Open Access Journals (Sweden)

    Biswa Ranjan Maharana

    2011-06-01

    Full Text Available Immunological interaction at the tick host interface involves both innate and acquired host defenses against infestation and Immunomodulatory countermeasures by thetick. Acquired resistance to tick infestation involves humoral and cellular immlmoregulatory effector pathways. Tick-borne disease-causing agentspr exploit tick suppression of host defenses during transmission and initiation of infection. Because of the public health importance of ticks and tick-borne diseases, it is crucial that we understand these interactions and exploit them in novel immunological control. [Vet. World 2011; 4(3.000: 131-135

  19. Risk of Lyme disease development after a tick bite

    Directory of Open Access Journals (Sweden)

    Mladenović Jovan

    2010-01-01

    Full Text Available Background/Aim. Despite numerous research of Lyme disease (LD, there are still many concerns about environmental of infectious agent of LD, as well as its prophylaxis, diagnosis and treatment. The aim of this work was to determine the risk of LD in relation to the way of removing ticks and duration of tick attachment. Methods. In the period from 2000 to 2007 a prospective study was conducted including persons with tick bite referred to the Institute of Epidemiology, Military Medical Academy, and followed for the occurrence of early Lyme disease up to six months after a tick bite. Epidemiological questionnaire was used to collect relevant information about the place and time of tick bites, the way of a removing tick, duration of tick attachment, remnants of a tick left in the skin (parts of the mouth device and the signs of clinical manifestations of LD. Duration of tick attachment was determined on the basis of size of engorged tick and epidemiological data. Removed ticks were determined by the key of Pomerancev. Professional removing of attached tick was considered to be removing of tick with mechanical means by healthcare personnel. Fisher's exact test, Chi squares test and calculation of the relative risk (RR were used for data analysis. Results. Of 3 126 patients with tick bite, clinical manifestations of LD were demonstrated in 19 (0.61%. In the group of subjects (n = 829 in which a tick was not removed professionally there were 17 (2.05% cases with LD, while in the group of respondents (n=2 297 in who a tick was removed professionally there were 2 (0.09% cases with LD after tick bite (RR, 23.55; p < 0.0001. The disease was most frequent in the group of respondents with incompletely and unprofessionally removed ticks (2.46%. In the groups of patients with unprofessionally but completely removed ticks LD occurred in 0.89%, while in the group of subjects with a tick removed by an expert, but incompletely in 0.78% cases. The disease occurred

  20. Bat Species Occurrence and Long-Term Bat Population Monitoring on Refuges using Acoustical Detection.

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This is a proposal to: Determine baseline occurrence of bat species on refuges in the southeast during the breeding season. 2. Index bat populations on a species by...

  1. Ticks as vectors: taxonomy, biology and ecology.

    Science.gov (United States)

    Estrada-Peña, A

    2015-04-01

    Ticks are prominent parasites and competent vectors of pathogens that affect both humans and animals. This review outlines and illustrates the main features of the morphology of ticks of the families Ixodidae and Argasidae, and summarises the basic components of their life cycles. It focuses mainly on development processes and mortality among tick populations so as to provide an overview of how they are regulated in nature and how pathogens can be transmitted under such a framework. The effects of the weather on these life cycles are reviewed. The author also examines how landscape structure and biotic factors, such as the presence and abundance of hosts, may shape the density of tick populations. The uncertainty inherent in dealing with the transmission of pathogens by ticks is highlighted; this results from the sometimes complex relationships among the vectors, the climate and the presence and density of host populations. The need to obtain reliable field estimations of such relationships before drawing conclusions about the effects of the isolated components of the system is stressed. A section is devoted to addressing the expected (and not yet totally understood) effects of trends in climate on the spread of ticks, and how these can be analysed and tracked.

  2. Bartonella species in bats (Chiroptera) and bat flies (Nycteribiidae) from Nigeria, West Africa.

    Science.gov (United States)

    Kamani, Joshua; Baneth, Gad; Mitchell, Mark; Mumcuoglu, Kosta Y; Gutiérrez, Ricardo; Harrus, Shimon

    2014-09-01

    Previous and ongoing studies have incriminated bats as reservoirs of several emerging and re-emerging zoonoses. Most of these studies, however, have focused on viral agents and neglected important bacterial pathogens. To date, there has been no report investigating the prevalence of Bartonella spp. in bats and bat flies from Nigeria, despite the fact that bats are used as food and for cultural ritual purposes by some ethnic groups in Nigeria. To elucidate the role of bats as reservoirs of bartonellae, we screened by molecular methods 148 bats and 34 bat flies, Diptera:Hippoboscoidea:Nycteribiidae (Cyclopodia greeffi) from Nigeria for Bartonella spp. Overall, Bartonella spp. DNA was detected in 76 out of 148 (51.4%) bat blood samples tested and 10 out of 24 (41.7%) bat flies tested by qPCR targeting the 16S-23S internal transcribed spacer (ITS) locus. Bartonella was isolated from 23 of 148 (15.5%) bat blood samples, and the isolates were genetically characterized. Prevalence of Bartonella spp. culture-positive samples ranged from 0% to 45.5% among five bat species. Micropterus spp. bats had a significantly higher relative risk of 3.45 for being culture positive compared to Eidolon helvum, Epomophorus spp., Rhinolophus spp., and Chaerephon nigeriae. Bartonella spp. detected in this study fall into three distinct clusters along with other Bartonella spp. isolated from bats and bat flies from Kenya and Ghana, respectively. The isolation of Bartonella spp. in 10.0-45.5% of four out of five bat species screened in this study indicates a widespread infection in bat population in Nigeria. Further investigation is warranted to determine the role of these bacteria as a cause of human and animal diseases in Nigeria.

  3. Molecular determinants of bat wing development.

    Science.gov (United States)

    Sears, K E

    2008-01-01

    The specialization of the forelimb into a wing allowed bats to become the only mammals to achieve powered flight. Recent studies in developmental biology have begun to elucidate the molecular mechanisms behind elements of this important morphological transformation. Specifically, researchers have identified molecular changes contributing to: the formation of the bat wing membrane, the elongation of skeletal elements of the bat wing and the reduction of the bat ulna. The general picture emerging from this research is that small changes in the expression of genes critical to many aspects of development have driven large changes in bat wing morphology. Thus, bats can be added to the growing list of groups in which expression changes in key developmental genes have been linked to the evolution of morphological innovations (e.g. early bilaterians, cetaceans, insects).

  4. Failure of ticks to transmit Scopulariopsis brevicaulis (Deuteromycota), a common filamentous fungal commensal of ticks.

    Science.gov (United States)

    Yoder, Jay A; Benoit, Joshua B; Rellinger, Eric J; Telford, Sam R

    2005-05-01

    The capacity of ticks to transmit a fungus was examined by analyzing tick saliva, host tissue from feeding sites, and host blood for presence of Scopulariopsis brevicaulis (Sacc.) Bainier, an internal mycosymbiont of the American dog tick, Dermacentor variabilis (Say), and lone star tick, Amnblyomma americanum (L.). Although >85% of ticks were infected with S. brevicaulis, conidia presence was low (0-5% of samples) in microscopic observations and mycological culturing of saliva expressed from larvae, nymphs, and adults. Additionally, the recovery of S. brevicaulis from blood and tissue feeding sites from a rabbit where S. brevicaulis-positive adult ticks had attached and fed was not increased compared with control tissue where no feeding occurred, indicating that transmission does not occur by the blood-feeding route. Tick mouthparts were found to contain S. brevicaulis in addition to Penicillium glabrum (Wehmer) Westling, but these agents were sparse in isolations from the feeding sites, which makes it unlikely that ticks act frequently as a mechanical fungal vector.

  5. Effects of Climate Change on Ticks and Tick-Borne Diseases in Europe

    Directory of Open Access Journals (Sweden)

    J. S. Gray

    2009-01-01

    Full Text Available Zoonotic tick-borne diseases are an increasing health burden in Europe and there is speculation that this is partly due to climate change affecting vector biology and disease transmission. Data on the vector tick Ixodes ricinus suggest that an extension of its northern and altitude range has been accompanied by an increased prevalence of tick-borne encephalitis. Climate change may also be partly responsible for the change in distribution of Dermacentor reticulatus. Increased winter activity of  I. ricinus is probably due to warmer winters and a retrospective study suggests that hotter summers will change the dynamics and pattern of seasonal activity, resulting in the bulk of the tick population becoming active in the latter part of the year. Climate suitability models predict that eight important tick species are likely to establish more northern permanent populations in a climate-warming scenario. However, the complex ecology and epidemiology of such tick-borne diseases as Lyme borreliosis and tick-borne encephalitis make it difficult to implicate climate change as the main cause of their increasing prevalence. Climate change models are required that take account of the dynamic biological processes involved in vector abundance and pathogen transmission in order to predict future tick-borne disease scenarios.

  6. Induction and suppression of tick cell antiviral RNAi responses by tick-borne flaviviruses

    NARCIS (Netherlands)

    Schnettler, E.; Tykalova, H.; Watson, M.; Sharma, M.; Sterken, M.G.; Obbard, D.J.; Lewis, S.H.; McFarlane, M.; Bell-Sakyi, L.; Barry, G.; Weisheit, S.; Best, S.M.; Kuhn, R.J.; Pijlman, G.P.; Chase-Topping, M.E.; Gould, E.A.; Grubhoffer, L.; Fazakerley, J.K.; Kohl, A.

    2014-01-01

    Arboviruses are transmitted by distantly related arthropod vectors such as mosquitoes (class Insecta) and ticks (class Arachnida). RNA interference (RNAi) is the major antiviral mechanism in arthropods against arboviruses. Unlike in mosquitoes, tick antiviral RNAi is not understood, although this in

  7. Mixtures of compound Poisson processes as models of tick-by-tick financial data

    CERN Document Server

    Scalas, E

    2006-01-01

    A model for the phenomenological description of tick-by-tick share prices in a stock exchange is introduced. It is based on mixtures of compound Poisson processes. Preliminary results based on Monte Carlo simulation show that this model can reproduce various stylized facts.

  8. Mixtures of compound Poisson processes as models of tick-by-tick financial data

    Science.gov (United States)

    Scalas, Enrico

    2007-10-01

    A model for the phenomenological description of tick-by-tick share prices in a stock exchange is introduced. It is based on mixtures of compound Poisson processes. Preliminary results based on Monte Carlo simulation show that this model can reproduce various stylized facts.

  9. Known and potential ticks and tick-borne pathogens of Micronesia

    Directory of Open Access Journals (Sweden)

    Vander Velde, N.

    2013-04-01

    Full Text Available Ticks have long been known to be the vectors of diseases, to both humans and animals. Yet very little work has been done regarding tick species found in Micronesia, and much of that is now decades old. Many parts of Micronesia have long undergone considerable change by outside influences and hence the natural and social environments have undergone major upheavals. Ticks as vectors of veterinary disease have long been documented in Micronesia, but ticks connected with human disease are often presumed not to exist. Hence another look would seem justified. This paper provides an initial review of information on tick species reported from Micronesia. Some diseases that such ticks transmit are presented, along with some hypothetical consideration of other diseases potentially associated with ticks of Micronesia. As this information on the ecology of ticks in Micronesia and the environments and circumstances allowing for the possibility of transmission of disease to humans come together, there emerges an intriguing picture of an often-overlooked part of the environment in which humans live in Micronesia.

  10. Presence of European bat lyssavirus RNas in apparently healthy Rousettus aegyptiacus bats

    NARCIS (Netherlands)

    Wellenberg, G.J.; Audry, L.; Ronsholt, L.; Poel, van der W.H.M.; Bruschke, C.J.M.; Bourhy, H.

    2002-01-01

    Apparently healthy Rousettus aegyptiacus bats were randomly chosen from a Dutch colony naturally infected with European bat lyssavirus subgenotype 1a (EBL1a). These bats were euthanised three months after the first evidence of an EBL1a infection in the colony. EBL1a genomic and antigenomic RNAs of t

  11. Detection of European bat lyssavirus type 2 in Danish Daubenton’s bats

    DEFF Research Database (Denmark)

    Rasmussen, Thomas Bruun; Chriél, Mariann; Baagøe, Hans J.;

    European bat lyssavirus (EBLV) is considered to be endemic in the Danish bat populations, but limited information exists about the types of EBLV strains currently in circulation. EBLV type 1 (EBLV-1) is seen as the predominant type in the Serotine bats (Eptesicus serotinus) with the latest case...

  12. Distribution pattern and number of ticks on lizards.

    Science.gov (United States)

    Dudek, Krzysztof; Skórka, Piotr; Sajkowska, Zofia Anna; Ekner-Grzyb, Anna; Dudek, Monika; Tryjanowski, Piotr

    2016-02-01

    The success of ectoparasites depends primarily on the site of attachment and body condition of their hosts. Ticks usually tend to aggregate on vertebrate hosts in specific areas, but the distribution pattern may depend on host body size and condition, sex, life stage or skin morphology. Here, we studied the distribution of ticks on lizards and tested the following hypothesis: occurrence or high abundance of ticks is confined with body parts with smaller scales and larger interscalar length because such sites should provide ticks with superior attachment conditions. This study was performed in field conditions in central Poland in 2008-2011. In total, 500 lizards (Lacerta agilis) were caught and 839 ticks (Ixodes ricinus, larvae and nymphs) were collected from them. Using generalised linear mixed models, we found that the ticks were most abundant on forelimbs and their axillae, with 90% of ticks attached there. This part of the lizard body and the region behind the hindlimb were covered by the smallest scales with relatively wide gaps between them. This does not fully support our hypothesis that ticks prefer locations with easy access to skin between scales, because it does not explain why so few ticks were in the hindlimb area. We found that the abundance of ticks was positively correlated with lizard body size index (snout-vent length). Tick abundance was also higher in male and mature lizards than in female and young individuals. Autotomy had no effect on tick abundance. We found no correlation between tick size and lizard morphology, sex, autotomy and body size index. The probability of occurrence of dead ticks was positively linked with the total number of ticks on the lizard but there was no relationship between dead tick presence and lizard size, sex or age. Thus lizard body size and sex are the major factors affecting the abundance of ticks, and these parasites are distributed nearly exclusively on the host's forelimbs and their axillae.

  13. Widespread Rickettsia spp. Infections in Ticks (Acari: Ixodoidea) in Taiwan.

    Science.gov (United States)

    Kuo, Chi-Chien; Shu, Pei-Yun; Mu, Jung-Jung; Lee, Pei-Lung; Wu, Yin-Wen; Chung, Chien-Kung; Wang, Hsi-Chieh

    2015-09-01

    Ticks are second to mosquitoes as the most important disease vectors, and recent decades have witnessed the emergence of many novel tick-borne rickettsial diseases, but systematic surveys of ticks and tick-borne rickettsioses are generally lacking in Asia. We collected and identified ticks from small mammal hosts between 2006 and 2010 in different parts of Taiwan. Rickettsia spp. infections in ticks were identified by targeting ompB and gltA genes with nested polymerase chain reaction. In total, 2,732 ticks were collected from 1,356 small mammals. Rhipicephalus haemaphysaloides Supino (51.8% of total ticks), Haemaphysalis bandicota Hoogstraal & Kohls (28.0%), and Ixodes granulatus Supino (20.0%) were the most common tick species, and Rattus losea Swinhoe (44.7% of total ticks) and Bandicota indica Bechstein (39.9%) were the primary hosts. The average Rickettsia infective rate in 329 assayed ticks was 31.9% and eight Rickettsia spp. or closely related species were identified. This study shows that rickettsiae-infected ticks are widespread in Taiwan, with a high diversity of Rickettsia spp. circulating in the ticks. Because notifiable rickettsial diseases in Taiwan only include mite-borne scrub typhus and flea-borne murine typhus, more studies are warranted for a better understanding of the real extent of human risks to rickettsioses in Taiwan.

  14. Behavior of bats at wind turbines.

    Science.gov (United States)

    Cryan, Paul M; Gorresen, P Marcos; Hein, Cris D; Schirmacher, Michael R; Diehl, Robert H; Huso, Manuela M; Hayman, David T S; Fricker, Paul D; Bonaccorso, Frank J; Johnson, Douglas H; Heist, Kevin; Dalton, David C

    2014-10-21

    Wind turbines are causing unprecedented numbers of bat fatalities. Many fatalities involve tree-roosting bats, but reasons for this higher susceptibility remain unknown. To better understand behaviors associated with risk, we monitored bats at three experimentally manipulated wind turbines in Indiana, United States, from July 29 to October 1, 2012, using thermal cameras and other methods. We observed bats on 993 occasions and saw many behaviors, including close approaches, flight loops and dives, hovering, and chases. Most bats altered course toward turbines during observation. Based on these new observations, we tested the hypotheses that wind speed and blade rotation speed influenced the way that bats interacted with turbines. We found that bats were detected more frequently at lower wind speeds and typically approached turbines on the leeward (downwind) side. The proportion of leeward approaches increased with wind speed when blades were prevented from turning, yet decreased when blades could turn. Bats were observed more frequently at turbines on moonlit nights. Taken together, these observations suggest that bats may orient toward turbines by sensing air currents and using vision, and that air turbulence caused by fast-moving blades creates conditions that are less attractive to bats passing in close proximity. Tree bats may respond to streams of air flowing downwind from trees at night while searching for roosts, conspecifics, and nocturnal insect prey that could accumulate in such flows. Fatalities of tree bats at turbines may be the consequence of behaviors that evolved to provide selective advantages when elicited by tall trees, but are now maladaptive when elicited by wind turbines.

  15. Convergences in the diversification of bats

    OpenAIRE

    M. Brock Fenton

    2010-01-01

    Twenty-five characters or suites of characters from bats are considered in light of changes in bat classification. The characters include some associated with flower-visiting (two), echolocation (12), roosting (six), reproduction (two) and three are of unknown adaptive function. In both the 1998 and 2006 classifications of bats into suborders (Megachiroptera and Microchiroptera versus Yinpterochiroptera and Yangochiroptera, respectively), some convergences between suborders are the same (e.g....

  16. Behavior of bats at wind turbines

    Science.gov (United States)

    Cryan, Paul M.; Gorresen, P. Marcos; Hine, Cris D.; Schirmacher, Michael; Diehl, Robert H.; Huso, Manuela M.; Hayman, David T.S.; Fricker, Paul D.; Bonaccorso, Frank J.; Johnson, Douglas H.; Heist, Kevin W.; Dalton, David C.

    2014-01-01

    Wind turbines are causing unprecedented numbers of bat fatalities. Many fatalities involve tree-roosting bats, but reasons for this higher susceptibility remain unknown. To better understand behaviors associated with risk, we monitored bats at three experimentally manipulated wind turbines in Indiana, United States, from July 29 to October 1, 2012, using thermal cameras and other methods. We observed bats on 993 occasions and saw many behaviors, including close approaches, flight loops and dives, hovering, and chases. Most bats altered course toward turbines during observation. Based on these new observations, we tested the hypotheses that wind speed and blade rotation speed influenced the way that bats interacted with turbines. We found that bats were detected more frequently at lower wind speeds and typically approached turbines on the leeward (downwind) side. The proportion of leeward approaches increased with wind speed when blades were prevented from turning, yet decreased when blades could turn. Bats were observed more frequently at turbines on moonlit nights. Taken together, these observations suggest that bats may orient toward turbines by sensing air currents and using vision, and that air turbulence caused by fast-moving blades creates conditions that are less attractive to bats passing in close proximity. Tree bats may respond to streams of air flowing downwind from trees at night while searching for roosts, conspecifics, and nocturnal insect prey that could accumulate in such flows. Fatalities of tree bats at turbines may be the consequence of behaviors that evolved to provide selective advantages when elicited by tall trees, but are now maladaptive when elicited by wind turbines.

  17. Bat flight: aerodynamics, kinematics and flight morphology.

    Science.gov (United States)

    Hedenström, Anders; Johansson, L Christoffer

    2015-03-01

    Bats evolved the ability of powered flight more than 50 million years ago. The modern bat is an efficient flyer and recent research on bat flight has revealed many intriguing facts. By using particle image velocimetry to visualize wake vortices, both the magnitude and time-history of aerodynamic forces can be estimated. At most speeds the downstroke generates both lift and thrust, whereas the function of the upstroke changes with forward flight speed. At hovering and slow speed bats use a leading edge vortex to enhance the lift beyond that allowed by steady aerodynamics and an inverted wing during the upstroke to further aid weight support. The bat wing and its skeleton exhibit many features and control mechanisms that are presumed to improve flight performance. Whereas bats appear aerodynamically less efficient than birds when it comes to cruising flight, they have the edge over birds when it comes to manoeuvring. There is a direct relationship between kinematics and the aerodynamic performance, but there is still a lack of knowledge about how (and if) the bat controls the movements and shape (planform and camber) of the wing. Considering the relatively few bat species whose aerodynamic tracks have been characterized, there is scope for new discoveries and a need to study species representing more extreme positions in the bat morphospace.

  18. Green roofs provide habitat for urban bats

    Directory of Open Access Journals (Sweden)

    K.L. Parkins

    2015-07-01

    Full Text Available Understanding bat use of human-altered habitat is critical for developing effective conservation plans for this ecologically important taxon. Green roofs, building rooftops covered in growing medium and vegetation, are increasingly important conservation tools that make use of underutilized space to provide breeding and foraging grounds for urban wildlife. Green roofs are especially important in highly urbanized areas such as New York City (NYC, which has more rooftops (34% than green space (13%. To date, no studies have examined the extent to which North American bats utilize urban green roofs. To investigate the role of green roofs in supporting urban bats, we monitored bat activity using ultrasonic recorders on four green and four conventional roofs located in highly developed areas of NYC, which were paired to control for location, height, and local variability in surrounding habitat and species diversity. We then identified bat vocalizations on these recordings to the species level. We documented the presence of five of nine possible bat species over both roof types: Lasiurus borealis, L. cinereus, L. noctivagans, P. subflavus,andE. fuscus. Of the bat calls that could be identified to the species level, 66% were from L. borealis. Overall levels of bat activity were higher over green roofs than over conventional roofs. This study provides evidence that, in addition to well documented ecosystem benefits, urban green roofs contribute to urban habitat availability for several North American bat species.

  19. Identification of tick-borne encephalitis virus in ticks collected in southeastern Hungary.

    Science.gov (United States)

    Pintér, Réka; Madai, Mónika; Vadkerti, Edit; Németh, Viktória; Oldal, Miklós; Kemenesi, Gábor; Dallos, Bianka; Gyuranecz, Miklós; Kiss, Gábor; Bányai, Krisztián; Jakab, Ferenc

    2013-09-01

    Tick-borne encephalitis virus (TBEV) is an arthropod-borne viral pathogen causing infections in Europe and is responsible for most arbovirus central nervous system infections in Hungary. Assessing the TBEV prevalence in ticks through detection of genomic RNA is a broadly accepted approach to estimate the transmission risk from a tick bite. For this purpose, 2731 ticks were collected from the neighboring area of the town of Dévaványa, located in southeastern Hungary, which is considered a low-risk-transmission area for TBEV. Altogether, 2300 ticks were collected from the vegetation, while 431 were collected from rodents. Samples were pooled and then screened for TBEV with a newly designed semi-nested RT-PCR (RT-snPCR) targeting the NS1 genomic region. PCR results were confirmed by direct sequencing of the second round amplicons. Among the 3 different collected tick species (Ixodes ricinus, Haemaphysalis concinna, Dermacentor marginatus), I. ricinus was the only species that tested positive for TBEV. TBEV-positive ticks were collected from small mammals or from the vegetation. One nymphal pool and 4 larval pools tested positive for TBEV. The only positive nymphal pool was unfed and came from vegetation, while ticks of the 4 positive larval pools were collected from rodents. Minimal TBEV prevalence in ticks was 0.08% for unfed nymphs and 0.78% for feeding larvae. Our results indicate that further long-term investigations on the occurrence of TBEV are needed to better describe the geographic distribution and the prevalence of infected ticks in Hungary.

  20. Ticks and tick-borne pathogens at the cutaneous interface: host defenses, tick countermeasures, and a suitable environment for pathogen establishment

    Directory of Open Access Journals (Sweden)

    Stephen eWikel

    2013-11-01

    Full Text Available Ticks are unique among hematophagous arthropods by continuous attachment to host skin and blood feeding for days; complexity and diversity of biologically active molecules differentially expressed in saliva of tick species; their ability to modulate the host defenses of pain and itch, hemostasis, inflammation, innate and adaptive immunity, and wound healing; and, the diverse array of infectious agents they transmit. All of these interactions occur at the cutaneous interface in a complex sequence of carefully choreographed host defense responses and tick countermeasures resulting in an environment that facilitates successful blood feeding and establishment of tick-borne infectious agents within the host. Here, we examine diverse patterns of tick attachment to host skin, blood feeding mechanisms, salivary gland transcriptomes, bioactive molecules in tick saliva, timing of pathogen transmission, and host responses to tick bite. Ticks engage and modulate cutaneous and systemic immune defenses involving keratinocytes, natural killer cells, dendritic cells, T cell subpopulations (Th1, Th2, Th17, Treg , B cells, neutrophils, mast cells, basophils, endothelial cells, cytokines, chemokines, complement, and extracellular matrix. A framework is proposed that integrates tick induced changes of skin immune effectors with their ability to respond to tick-borne pathogens. Implications of these changes are addressed. What are the consequences of tick modulation of host cutaneous defenses? Does diversity of salivary gland transcriptomes determine differential modulation of host inflammation and immune defenses and therefore, in part, the clades of pathogens effectively transmitted by different tick species? Do ticks create an immunologically modified cutaneous environment that enhances specific pathogen establishment? Can tick saliva molecules be used to develop vaccines that block pathogen transmission?

  1. A comparison of bats and rodents as reservoirs of zoonotic viruses: are bats special?

    Science.gov (United States)

    Luis, Angela D; Hayman, David T S; O'Shea, Thomas J; Cryan, Paul M; Gilbert, Amy T; Pulliam, Juliet R C; Mills, James N; Timonin, Mary E; Willis, Craig K R; Cunningham, Andrew A; Fooks, Anthony R; Rupprecht, Charles E; Wood, James L N; Webb, Colleen T

    2013-04-01

    Bats are the natural reservoirs of a number of high-impact viral zoonoses. We present a quantitative analysis to address the hypothesis that bats are unique in their propensity to host zoonotic viruses based on a comparison with rodents, another important host order. We found that bats indeed host more zoonotic viruses per species than rodents, and we identified life-history and ecological factors that promote zoonotic viral richness. More zoonotic viruses are hosted by species whose distributions overlap with a greater number of other species in the same taxonomic order (sympatry). Specifically in bats, there was evidence for increased zoonotic viral richness in species with smaller litters (one young), greater longevity and more litters per year. Furthermore, our results point to a new hypothesis to explain in part why bats host more zoonotic viruses per species: the stronger effect of sympatry in bats and more viruses shared between bat species suggests that interspecific transmission is more prevalent among bats than among rodents. Although bats host more zoonotic viruses per species, the total number of zoonotic viruses identified in bats (61) was lower than in rodents (68), a result of there being approximately twice the number of rodent species as bat species. Therefore, rodents should still be a serious concern as reservoirs of emerging viruses. These findings shed light on disease emergence and perpetuation mechanisms and may help lead to a predictive framework for identifying future emerging infectious virus reservoirs.

  2. A comparison of bats and rodents as reservoirs of zoonotic viruses: are bats special?

    Science.gov (United States)

    Luis, Angela D.; Hayman, David T.S.; O'Shea, Thomas J.; Cryan, Paul M.; Gilbert, Amy T.; Pulliam, Juliet R.C.; Mills, James N.; Timonin, Mary E.; Willis, Craig K.R.; Cunningham, Andrew A.; Fooks, Anthony R.; Rupprecht, Charles E.; Wood, James L.N.; Webb, Colleen T.

    2013-01-01

    Bats are the natural reservoirs of a number of high-impact viral zoonoses. We present a quantitative analysis to address the hypothesis that bats are unique in their propensity to host zoonotic viruses based on a comparison with rodents, another important host order. We found that bats indeed host more zoonotic viruses per species than rodents, and we identified life-history and ecological factors that promote zoonotic viral richness. More zoonotic viruses are hosted by species whose distributions overlap with a greater number of other species in the same taxonomic order (sympatry). Specifically in bats, there was evidence for increased zoonotic viral richness in species with smaller litters (one young), greater longevity and more litters per year. Furthermore, our results point to a new hypothesis to explain in part why bats host more zoonotic viruses per species: the stronger effect of sympatry in bats and more viruses shared between bat species suggests that interspecific transmission is more prevalent among bats than among rodents. Although bats host more zoonotic viruses per species, the total number of zoonotic viruses identified in bats (61) was lower than in rodents (68), a result of there being approximately twice the number of rodent species as bat species. Therefore, rodents should still be a serious concern as reservoirs of emerging viruses. These findings shed light on disease emergence and perpetuation mechanisms and may help lead to a predictive framework for identifying future emerging infectious virus reservoirs.

  3. Tick Removal: A Step-by-Step Guide (For Parents)

    Science.gov (United States)

    ... Old Feeding Your 1- to 2-Year-Old Tick Removal: A Step-by-Step Guide KidsHealth > For Parents > Tick Removal: A Step-by-Step Guide A A ... isn't a freckle at all. It's a tick. What should you do? First, don't panic. ...

  4. The bacterial microbiome of dermacentor andersoni ticks influences pathogen susceptibility

    Science.gov (United States)

    Ticks are of medical and veterinary importance due to their ability to transmit pathogens to humans and animals. The Rocky Mountain wood tick, Dermacentor andersoni, is a vector of a number of pathogens, including Anaplasma marginale, which is the most widespread tick-borne pathogen of livestock. Al...

  5. Molecular ecological insights into neotropical bird-tick interactions

    NARCIS (Netherlands)

    Miller, Matthew J.; Esser, Helen J.; Loaiza, Jose R.; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, i

  6. Ticks associated with domestic dogs and cats in Florida, USA

    Science.gov (United States)

    Voluntary collections of ticks from domestic dogs and cats by veterinary practitioners across Florida were conducted over a 10 month period. Of the 1,337 ticks submitted, five species of ixodid ticks were identified and included Rhipicephalus sanguineus, Amblyomma americanum, A. maculatum, Dermacen...

  7. Possible Tick-Borne Human Enterovirus Resulting in Aseptic Meningitis

    OpenAIRE

    Freundt, Eric C.; Beatty, Douglas C.; Stegall-Faulk, Teresa; Wright, Stephen M.

    2005-01-01

    Enterovirus-specific genetic sequences were isolated from two Amblyomma americanum tick pools. Identical genetic sequences were later obtained from cerebrospinal fluid of a patient with aseptic meningitis and a recent history of tick attachment. These observations suggest the possibility of an emerging tick-borne human enterovirus associated with aseptic meningitis.

  8. Methods of tick removal: A systematic review of the literature

    Directory of Open Access Journals (Sweden)

    Coleman Nikki

    2017-01-01

    Full Text Available Background An increase in tick borne diseases in Australia has seen an interest in appropriate removal of ticks (order Ixodida in order to prevent anaphylaxis, allergy and transmission of tick borne diseases. Aims A systematic review of peer-reviewed literature to determine what method of tick removal should be promoted in terms of preventing future health complications. Methods Thematic synthesis was used in two stages: – tick removal studies conducted on animals and humans were examined and the conclusions from all of these studies were compared, in order to ascertain the best tick removal method in relation to prevention of future medical problems (including tick bite allergy and transmission of infection. Conclusion This systematic review documents the best method of tick removal based on scientific and medical studies between 1985 and 2016. It concludes that the best method is to remove the tick as soon as possible after it is detected, using either fine-tipped tweezers or a reputable commercially produced tick removal tool to pull the tick away from the site of attachment. Some methods of removal, such as applying chemicals like petroleum jelly, alcohol, or nail polish to the tick, have been discredited. Other methods of removal, such as freezing, while promising, have not yet been scientifically validated

  9. Bacteria associated with Amblyomma cajennense tick eggs

    Directory of Open Access Journals (Sweden)

    Erik Machado-Ferreira

    2015-01-01

    Full Text Available AbstractTicks represent a large group of pathogen vectors that blood feed on a diversity of hosts. In the Americas, the Ixodidae ticks Amblyomma cajennense are responsible for severe impact on livestock and public health. In the present work, we present the isolation and molecular identification of a group of culturable bacteria associated with A. cajennense eggs from females sampled in distinct geographical sites in southeastern Brazil. Additional comparative analysis of the culturable bacteria from Anocentor nitens, Rhipicephalus sanguineus and Ixodes scapularis tick eggs were also performed. 16S rRNA gene sequence analyses identified 17 different bacterial types identified as Serratia marcescens, Stenotrophomonas maltophilia, Pseudomonas fluorescens, Enterobacter spp., Micrococcus luteus, Ochrobactrum anthropi, Bacillus cereus and Staphylococcus spp., distributed in 12 phylogroups. Staphylococcus spp., especially S. sciuri,was the most prevalent bacteria associated with A. cajennenseeggs, occurring in 65% of the samples and also frequently observed infecting A. nitens eggs. S. maltophilia, S. marcescens and B. cereus occurred infecting eggs derived from specific sampling sites, but in all cases rising almost as pure cultures from infected A. cajennense eggs. The potential role of these bacterial associations is discussed and they possibly represent new targets for biological control strategies of ticks and tick borne diseases.

  10. Tick (Amblyomma chabaudi) infestation of endemic tortoises in southwest Madagascar and investigation of tick-borne pathogens.

    Science.gov (United States)

    Ehlers, Julian; Ganzhorn, Jörg U; Silaghi, Cornelia; Krüger, Andreas; Pothmann, Daniela; Ratovonamana, R Yedidya; Veit, Alexandra; Keller, Christian; Poppert, Sven

    2016-03-01

    Little is known about the role of endemic ticks as vectors for bacterial and protozoan pathogens for animals and humans in Madagascar and their interaction in anthropogenic habitats where humans, their livestock and native Malagasy species (vectors and hosts) come into more frequent contact than in natural forest ecosystems. The aims of the study were (1) to test whether habitat degradation is associated with increased infestation of tortoises by ticks and (2) to investigate whether ticks carried Babesia, Borrelia or Rickettsia species that might be pathogenic for humans and livestock. We studied hard ticks of two endemic Malagasy tortoises, Astrochelys radiata and Pyxis arachnoides in March and April 2013 in southwest Madagascar. Two tortoise habitats were compared, the National Park of Tsimanampetsotsa and the adjacent degraded pasture and agricultural land at the end of the wet season. Ticks were screened for protozoan and bacterial pathogens via PCR on DNA isolated from ticks using genus-specific primers. Only one out of 42 A. radiata collected from both habitats had ticks. The low prevalence did not allow further analyses of the effect of habitat degradation. Forty-two P. arachnoides were found in the anthropogenic habitat and 36 individuals in the national park. Tick infestation rates of P. arachnoides differed significantly between the two study sites. Tortoises inside the park had lower tick prevalence than outside (8 of 36 (22%) versus 32 of 42 individuals (76%)) and infected animals tended to have fewer ticks inside than outside the park. All ticks collected in both habitats were adults of the ixodid tick Amblyomma chabaudi, which is supposed to be a host-specific tick of P. arachnoides. Screening for Borrelia sp. and Babesia sp. was negative in all ticks. But all A. chabaudi ticks were infected with Rickettsia africae, known to cause spotted fever in humans. Thus, habitat degradation seems to be linked to higher infestation of tortoises with ticks with

  11. Of ticks, mice and men - shaping the ecology of tick-borne pathogens in Baden-Württemberg

    OpenAIRE

    Littwin, Nina-Vanessa

    2016-01-01

    Ticks cause more vector-borne diseases than any other blood-feeding arthropod in Europe; and their abundance is increasing. Influential US studies show that small mammals are key hosts regulating ticks and tick-borne pathogens (TBP), serving as blood meal hosts and TBP reservoirs. The relevance of these studies to Europe is, however, unknown. Therefore, my aim was the determination of the relative influence of small mammal hosts and environmental factors on the dynamics of ticks and TBPs in BW.

  12. Bats initiate vital agroecological interactions in corn.

    Science.gov (United States)

    Maine, Josiah J; Boyles, Justin G

    2015-10-01

    In agroecosystems worldwide, bats are voracious predators of crop pests and may provide services to farmers worth billions of U.S. dollars. However, such valuations make untested assumptions about the ecological effect of bats in agroecosystems. Specifically, estimates of the value of pest suppression services assume bats consume sufficient numbers of crop pests to affect impact pest reproduction and subsequent damage to crops. Corn is an essential crop for farmers, and is grown on more than 150 million hectares worldwide. Using large exclosures in corn fields, we show that bats exert sufficient pressure on crop pests to suppress larval densities and damage in this cosmopolitan crop. In addition, we show that bats suppress pest-associated fungal growth and mycotoxin in corn. We estimate the suppression of herbivory by insectivorous bats is worth more than 1 billion USD globally on this crop alone, and bats may further benefit farmers by indirectly suppressing pest-associated fungal growth and toxic compounds on corn. Bats face a variety of threats globally, but their relevance as predators of insects in ubiquitous corn-dominated landscapes underlines the economic and ecological importance of conserving biodiversity.

  13. Dengue Virus in Bats from Southeastern Mexico

    Science.gov (United States)

    Sotomayor-Bonilla, Jesús; Chaves, Andrea; Rico-Chávez, Oscar; Rostal, Melinda K.; Ojeda-Flores, Rafael; Salas-Rojas, Mónica; Aguilar-Setien, Álvaro; Ibáñez-Bernal, Sergio; Barbachano-Guerrero, Arturo; Gutiérrez-Espeleta, Gustavo; Aguilar-Faisal, J. Leopoldo; Aguirre, A. Alonso; Daszak, Peter; Suzán, Gerardo

    2014-01-01

    To identify the relationship between landscape use and dengue virus (DENV) occurrence in bats, we investigated the presence of DENV from anthropogenically changed and unaltered landscapes in two Biosphere Reserves: Calakmul (Campeche) and Montes Azules (Chiapas) in southern Mexico. Spleen samples of 146 bats, belonging to 16 species, were tested for four DENV serotypes with standard reverse transcriptase polymerase chain reaction (RT-PCR) protocols. Six bats (4.1%) tested positive for DENV-2: four bats in Calakmul (two Glossophaga soricina, one Artibeus jamaicensis, and one A. lituratus) and two bats in Montes Azules (both A. lituratus). No effect of anthropogenic disturbance on the occurrence of DENV was detected; however, all three RT-PCR–positive bat species are considered abundant species in the Neotropics and well-adapted to disturbed habitats. To our knowledge, this study is the first study conducted in southeastern Mexico to identify DENV-2 in bats by a widely accepted RT-PCR protocol. The role that bats play on DENV's ecology remains undetermined. PMID:24752688

  14. Vampire Bat Rabies: Ecology, Epidemiology and Control

    Directory of Open Access Journals (Sweden)

    Nicholas Johnson

    2014-04-01

    Full Text Available Extensive surveillance in bat populations in response to recent emerging diseases has revealed that this group of mammals acts as a reservoir for a large range of viruses. However, the oldest known association between a zoonotic virus and a bat is that between rabies virus and the vampire bat. Vampire bats are only found in Latin America and their unique method of obtaining nutrition, blood-feeding or haematophagy, has only evolved in the New World. The adaptations that enable blood-feeding also make the vampire bat highly effective at transmitting rabies virus. Whether the virus was present in pre-Columbian America or was introduced is much disputed, however, the introduction of Old World livestock and associated landscape modification, which continues to the present day, has enabled vampire bat populations to increase. This in turn has provided the conditions for rabies re-emergence to threaten both livestock and human populations as vampire bats target large mammals. This review considers the ecology of the vampire bat that make it such an efficient vector for rabies, the current status of vampire-transmitted rabies and the future prospects for spread by this virus and its control.

  15. Target Images in the Sonar of Bats

    Science.gov (United States)

    1988-10-01

    targets was regulated by controlling the delay of the echoes electronically. The bat was rewarded with a piece of a mealworm offered in forceps for each...and on the test-days each bat was run on a number of trials that was determined by its current body weight and the quantity of mealworms consumed

  16. Tick cell culture isolation and growth of Rickettsia raoultii from Dutch Dermacentor reticulatus ticks.

    Science.gov (United States)

    Alberdi, M Pilar; Nijhof, Ard M; Jongejan, Frans; Bell-Sakyi, Lesley

    2012-12-01

    Tick cell lines play an important role in research on ticks and tick-borne pathogenic and symbiotic microorganisms. In an attempt to derive continuous Dermacentor reticulatus cell lines, embryo-derived primary cell cultures were set up from eggs laid by field ticks originally collected as unfed adults in The Netherlands and maintained for up to 16 months. After several months, it became evident that cells in the primary cultures were infected with a Rickettsia-like intracellular organism. Supernatant medium containing some D. reticulatus cells was inoculated into cultures of 2 Rhipicephalus (Boophilus) microplus cell lines, BME/CTVM2 and BME/CTVM23, where abundant growth of the bacteria occurred intracellularly on transfer to both cell lines. Bacterial growth was monitored by light (live, inverted microscope, Giemsa-stained cytocentrifuge smears) and transmission electron microscopy revealing heavy infection with typical intracytoplasmic Rickettsia-like bacteria, not present in uninfected cultures. DNA was extracted from bacteria-infected and uninfected control cultures, and primers specific for Rickettsia 16S rRNA, ompB, and sca4 genes were used to generate PCR products that were subsequently sequenced. D. reticulatus primary cultures and both infected tick cell lines were positive for all 3 Rickettsia genes. Sequencing of PCR products revealed 99-100% identity with published Rickettsia raoultii sequences. The R. raoultii also grew abundantly in the D. nitens cell line ANE58, poorly in the D. albipictus cell line DALBE3, and not at all in the D. andersoni cell line DAE15. In conclusion, primary tick cell cultures and cell lines are useful systems for isolation and propagation of fastidious tick-borne microorganisms. In vitro isolation of R. raoultii from Dutch D. reticulatus confirms previous PCR-based detection in field ticks, and presence of the bacteria in the tick eggs used to initiate the primary cultures confirms that transovarial transmission of this

  17. Infestation and seasonal activity of Ixodes vespertilionis Koch, 1844 (Acari: Ixodidae) on the Maghreb mouse-eared bat, Myotis punicus Felten, 1977, in northeastern Algeria.

    Science.gov (United States)

    Bendjeddou, Mohammed Lamine; Bouslama, Zihad; Amr, Zuhair S; BaniHani, Rihan

    2016-06-01

    Infestation of Ixodes vespertilionis Koch, 1844 on Myotis punicus Felten, 1977 from two sites (Trios Tunnel and Sidi Trad cave) in northeastern Algeria was studied. An overall infestation of 41.4% for all stages was found among bats collected from both sites. By stage, a total of eight females, 70 nymphs, and 107 larvae were recovered from both populations. The number of females recovered per bat at Sidi Trad ranged from 0-1, for nymphs 0-2, and for larvae 0-2. While no female ticks were collected at Trios Tunnel, the number of nymphs ranged from 0-2 and for larvae 0-2. At Trios Tunnel, the number of nymphs was significantly higher during April and June but not for July and September. On the other hand, the number of larvae increased from July to November, while at Sidi Trad cave, female ticks were recovered during April and May and then disappeared until the end of the study period. Significant differences were noted during all the months when compared with all stages. Nymphs infested bats significantly during April and May, declined in June and July, and then became steady until October. Larvae peaked in July, with low frequency in April, and then fluctuated from August to November.

  18. Bat predation on nocturnally migrating birds.

    Science.gov (United States)

    Ibáñez, C; Juste, J; García-Mudarra, J L; Agirre-Mendi, P T

    2001-08-14

    Bat predation on birds is a very rare phenomenon in nature. Most documented reports of bird-eating bats refer to tropical bats that occasionally capture resting birds. Millions of small birds concentrate and cross over the world's temperate regions during migration, mainly at night, but no nocturnal predators are known to benefit from this enormous food resource. An analysis of 14,000 fecal pellets of the greater noctule bat (Nyctalus lasiopterus) reveals that this species captures and eats large numbers of migrating passerines, making it the only bat species so far known that regularly preys on birds. The echolocation characteristics and wing morphology of this species strongly suggest that it captures birds in flight.

  19. Bats and Viruses: a Brief Review

    Institute of Scientific and Technical Information of China (English)

    Lin-Fa Wang

    2009-01-01

    Bats, probably the most abundant, diverse and geographically dispersed vertebrates on earth, have recently been shown to be the reservoir hosts of a number of emerging viruses responsible for severe human and livestock disease outbreaks. Flying foxes have been demonstrated to be the natural reservoir for Hendra and Nipah viruses. Evidence supporting the possibility of bats as potential reservoirs for SARS coronavirus (SARS-CoV) and Ebola virus has also been reported. The recent discovery of these viruses and other viruses occurring naturally in the bat population provides a unique insight into a diverse pool of potentially emergent and pathogenic viruses. The factors which influence the ability of zoonotic viruses to effectively cross the species barrier from bats to other animal populations are poorly understood. A brief review is provided here on the recently emerged bat viruses and on current and future strategies for research in this area.

  20. Poxviruses in Bats … so What?

    Directory of Open Access Journals (Sweden)

    Kate S. Baker

    2014-04-01

    Full Text Available Poxviruses are important pathogens of man and numerous domestic and wild animal species. Cross species (including zoonotic poxvirus infections can have drastic consequences for the recipient host. Bats are a diverse order of mammals known to carry lethal viral zoonoses such as Rabies, Hendra, Nipah, and SARS. Consequent targeted research is revealing bats to be infected with a rich diversity of novel viruses. Poxviruses were recently identified in bats and the settings in which they were found were dramatically different. Here, we review the natural history of poxviruses in bats and highlight the relationship of the viruses to each other and their context in the Poxviridae family. In addition to considering the zoonotic potential of these viruses, we reflect on the broader implications of these findings. Specifically, the potential to explore and exploit this newfound relationship to study coevolution and cross species transmission together with fundamental aspects of poxvirus host tropism as well as bat virology and immunology.

  1. Bats and Rodents Shape Mammalian Retroviral Phylogeny.

    Science.gov (United States)

    Cui, Jie; Tachedjian, Gilda; Wang, Lin-Fa

    2015-11-09

    Endogenous retroviruses (ERVs) represent past retroviral infections and accordingly can provide an ideal framework to infer virus-host interaction over their evolutionary history. In this study, we target high quality Pol sequences from 7,994 Class I and 8,119 Class II ERVs from 69 mammalian genomes and surprisingly find that retroviruses harbored by bats and rodents combined occupy the major phylogenetic diversity of both classes. By analyzing transmission patterns of 30 well-defined ERV clades, we corroborate the previously published observation that rodents are more competent as originators of mammalian retroviruses and reveal that bats are more capable of receiving retroviruses from non-bat mammalian origins. The powerful retroviral hosting ability of bats is further supported by a detailed analysis revealing that the novel bat gammaretrovirus, Rhinolophus ferrumequinum retrovirus, likely originated from tree shrews. Taken together, this study advances our understanding of host-shaped mammalian retroviral evolution in general.

  2. Ticks, ivermectin, and experimental Chagas disease

    Directory of Open Access Journals (Sweden)

    João Carlos Pinto Dias

    2005-12-01

    Full Text Available Following an infestation of dogticks in kennels housing dogs used for long-term studies of the pathogenesis of Chagas disease, we examined the effect of ivermectin treatment on the dogs, ticks, trypanosome parasites, and also on triatomine vectors of Chagas disease. Ivermectin treatment was highly effective in eliminating the ticks, but showed no apparent effect on the dogs nor on their trypanosome infection. Triatominae fed on the dogs soon after ivermectin treatment showed high mortality, but this effect quickly declined for bugs fed at successive intervals after treatment. In conclusion, although ivermectin treatment may have a transient effect on peridomestic populations of Triatominae, it is not the treatment of choice for this situation. The study also showed that although the dogticks could become infected with Trypanosoma cruzi, this only occurred when feeding on dogs in the acute phase of infection, and there was no evidence of subsequent parasite development in the ticks.

  3. Evaluation of Certain Insecticides and Repellents Against Ticks

    Directory of Open Access Journals (Sweden)

    D. Kapoor

    1972-07-01

    Full Text Available The susceptibility of two commonly occurring species of Ixodid ticks viz., the cattle tick, Hyalomma anatolicum anatolicum Koch and the brown dog tick, Rhipicephalus sanguineus Latr to certain newer insecticdes was investigated under controlled environmental conditions. The repellency of diethyl toluamide (Deet to the two species of ticks was also investigated by a specially devised laboratory technique. It was found that based on LC/sub 50/ values, the two species were most susceptible to pyrethrins followed by carbaryl whereas malathion was found least toxic to the ticks.

  4. Alphacoronaviruses Detected in French Bats Are Phylogeographically Linked to Coronaviruses of European Bats

    Science.gov (United States)

    Goffard, Anne; Demanche, Christine; Arthur, Laurent; Pinçon, Claire; Michaux, Johan; Dubuisson, Jean

    2015-01-01

    Bats are a reservoir for a diverse range of viruses, including coronaviruses (CoVs). To determine the presence of CoVs in French bats, fecal samples were collected between July and August of 2014 from four bat species in seven different locations around the city of Bourges in France. We present for the first time the presence of alpha-CoVs in French Pipistrellus pipistrellus bat species with an estimated prevalence of 4.2%. Based on the analysis of a fragment of the RNA-dependent RNA polymerase (RdRp) gene, phylogenetic analyses show that alpha-CoVs sequences detected in French bats are closely related to other European bat alpha-CoVs. Phylogeographic analyses of RdRp sequences show that several CoVs strains circulate in European bats: (i) old strains detected that have probably diverged a long time ago and are detected in different bat subspecies; (ii) strains detected in Myotis and Pipistrellus bat species that have more recently diverged. Our findings support previous observations describing the complexity of the detected CoVs in bats worldwide. PMID:26633467

  5. Alphacoronaviruses Detected in French Bats Are Phylogeographically Linked to Coronaviruses of European Bats

    Directory of Open Access Journals (Sweden)

    Anne Goffard

    2015-12-01

    Full Text Available Bats are a reservoir for a diverse range of viruses, including coronaviruses (CoVs. To determine the presence of CoVs in French bats, fecal samples were collected between July and August of 2014 from four bat species in seven different locations around the city of Bourges in France. We present for the first time the presence of alpha-CoVs in French Pipistrellus pipistrellus bat species with an estimated prevalence of 4.2%. Based on the analysis of a fragment of the RNA-dependent RNA polymerase (RdRp gene, phylogenetic analyses show that alpha-CoVs sequences detected in French bats are closely related to other European bat alpha-CoVs. Phylogeographic analyses of RdRp sequences show that several CoVs strains circulate in European bats: (i old strains detected that have probably diverged a long time ago and are detected in different bat subspecies; (ii strains detected in Myotis and Pipistrellus bat species that have more recently diverged. Our findings support previous observations describing the complexity of the detected CoVs in bats worldwide.

  6. Vampire bats exhibit evolutionary reduction of bitter taste receptor genes common to other bats.

    Science.gov (United States)

    Hong, Wei; Zhao, Huabin

    2014-08-01

    The bitter taste serves as an important natural defence against the ingestion of poisonous foods and is thus believed to be indispensable in animals. However, vampire bats are obligate blood feeders that show a reduced behavioural response towards bitter-tasting compounds. To test whether bitter taste receptor genes (T2Rs) have been relaxed from selective constraint in vampire bats, we sampled all three vampire bat species and 11 non-vampire bats, and sequenced nine one-to-one orthologous T2Rs that are assumed to be functionally conserved in all bats. We generated 85 T2R sequences and found that vampire bats have a significantly greater percentage of pseudogenes than other bats. These results strongly suggest a relaxation of selective constraint and a reduction of bitter taste function in vampire bats. We also found that vampire bats retain many intact T2Rs, and that the taste signalling pathway gene Calhm1 remains complete and intact with strong functional constraint. These results suggest the presence of some bitter taste function in vampire bats, although it is not likely to play a major role in food selection. Together, our study suggests that the evolutionary reduction of bitter taste function in animals is more pervasive than previously believed, and highlights the importance of extra-oral functions of taste receptor genes.

  7. Alphacoronaviruses Detected in French Bats Are Phylogeographically Linked to Coronaviruses of European Bats.

    Science.gov (United States)

    Goffard, Anne; Demanche, Christine; Arthur, Laurent; Pinçon, Claire; Michaux, Johan; Dubuisson, Jean

    2015-12-02

    Bats are a reservoir for a diverse range of viruses, including coronaviruses (CoVs). To determine the presence of CoVs in French bats, fecal samples were collected between July and August of 2014 from four bat species in seven different locations around the city of Bourges in France. We present for the first time the presence of alpha-CoVs in French Pipistrellus pipistrellus bat species with an estimated prevalence of 4.2%. Based on the analysis of a fragment of the RNA-dependent RNA polymerase (RdRp) gene, phylogenetic analyses show that alpha-CoVs sequences detected in French bats are closely related to other European bat alpha-CoVs. Phylogeographic analyses of RdRp sequences show that several CoVs strains circulate in European bats: (i) old strains detected that have probably diverged a long time ago and are detected in different bat subspecies; (ii) strains detected in Myotis and Pipistrellus bat species that have more recently diverged. Our findings support previous observations describing the complexity of the detected CoVs in bats worldwide.

  8. Removing a tick: proper technique in children

    Directory of Open Access Journals (Sweden)

    Susana Rueda Pérez

    2012-06-01

    Full Text Available There is medical consensus on the need to remove the tick within 24 hours the mite parasites to the human host, to avoid possible complications. The preferred way is by gently traction the mite, aided by forceps without twisting or chokes with toxic agents, because of the possibility that the mite excretes bacteria mixed with substances. The average time of extraction is estimated between one or three minutes. In children parasitized by ticks this amount of time can be excessive when it’s necessary restraint without the consent of the minor. Using this technique we reduce the time to seconds and the damage caused to the skin is minimal.

  9. Molecular detection of Bartonella species in ticks from Peru.

    Science.gov (United States)

    Billeter, Sarah A; Cáceres, Abraham G; Gonzales-Hidalgo, James; Luna-Caypo, Deysi; Kosoy, Michael Y

    2011-11-01

    A total of 103 ticks, collected from canines, horses, donkeys, and snakes from Peru, were screened for the presence of Bartonella DNA by polymerase chain reaction analysis. Bartonella DNA was detected in two ticks using Bartonella 16S-23S intergenic spacer region primers and in an additional two ticks using Bartonella NADH dehydrogenase gamma subunit gene (nuoG) primers. Bartonella rochalimae Eremeeva et al., B. quintana Schmincke, and B. elizabethae Daly et al. DNA was detected in a Rhipicephalus sanguineus Latreille (Acari: Ixodidae) female tick removed from a dog and B. quintana DNA was present in a Dermacentor nitens Neumann (Acari: Ixodidae) pool of five larvae, one nymph, and one adult male tick collected from donkeys. This is the first study to report the detection of B. rochalimae, B. quintana, and B. elizabethae DNA in ticks from Peru. Further investigations must be performed to decipher the role ticks may play in the transmission of Bartonella species.

  10. Research Progress of Ticks and Tick-borne Disease%蜱及蜱传病的研究进展

    Institute of Scientific and Technical Information of China (English)

    刘琪; 王伟利; 孟庆峰

    2013-01-01

    对蜱的种属、生物学特性和传播疾病及诊断方法进行了综述.针对蜱及常见蜱传病的特性,有助于找到切实有效的方法,从根本上消灭蜱所带来的危害.%The genus, biological characteristics of tick and diagnosis methods for tick-borne disease were reviewed. Aiming at characteristics of tick and several common tick-bome diseases, effective methods were easy to found, so as to eliminate damages brought by tick.

  11. Seasonal activity and tick-borne pathogen infection rates of Ixodes ricinus ticks in Hungary.

    Science.gov (United States)

    Egyed, László; Elő, Péter; Sréter-Lancz, Zsuzsanna; Széll, Zoltán; Balogh, Zsuzsanna; Sréter, Tamás

    2012-04-01

    Ixodes ricinus is the most important tick species in Europe as it is most widely distributed and transmits the majority of tick-borne zoonotic pathogens. As limited data are available for Hungary, the aim of the present study was to investigate the seasonal timing of questing by I. ricinus and the infection rate of this tick species with all major tick-borne zoonotic pathogens. Monthly collections of I. ricinus were carried out over 3 consecutive years by dragging a blanket in 6 biotopes representing different areas of Hungary. Altogether, 1800 nymphs (300 per collection point) were screened as pooled samples (each of 5 specimens) by PCR-based methods for tick-borne pathogens. I. ricinus larvae, nymphs, and adults had bimodal activity patterns with a major peak in the spring. As newly moulted ticks of all stages are thought to emerge in the autumn of each year, it appears that most newly emerged ticks delayed their questing until the following spring. The minimum prevalence of Borrelia burgdorferi sensu lato was 2.5%. Borr. afzelii, Borr. burgdorferi sensu stricto, Borr. garinii, Borr. lusitaniae, and Borr. valaisiana were identified by hybridization. The minimum infection rate with spotted fever group rickettsiae was 1.9%. Rickettsia helvetica was identified in all biotopes. The minimum prevalence of Anaplasma phagocytophilum, Babesia divergens and Bab. microti was low (0.3-0.5%). Bartonella spp.-, Francisella tularensis-, and TBE virus-specific amplification products were not detected. Relative to the results of comparable studies carried out in the Carpathian Basin, the prevalence of tick-borne pathogens was low in Hungary. This might be attributed to the climatic difference between the lowland areas of Hungary and submountain areas of the surrounding countries involved in the studies.

  12. Ticks of Australia. The species that infest domestic animals and humans.

    Science.gov (United States)

    Barker, Stephen C; Walker, Alan R

    2014-06-18

    The book Australian Ticks by F.H.S. Roberts (1970) is a land-mark in Australian tick biology. But it is time for a new and improved book on the ticks of Australia. The present book has identification guides and accounts of the biology and diseases associated with the 16 species of ticks that may feed on domestic animals and humans in Australia. These comprise five argasid (soft) ticks: Argas persicus (poultry tick), Argas robertsi (Robert's bird tick), Ornithodoros capensis (seabird soft tick), O. gurneyi (kangaroo soft tick), Otobius megnini (spinose ear tick); and 11 ixodid (hard) ticks, Amblyomma triguttatum (ornate kangaroo tick), Bothriocroton auruginans (wombat tick), B. hydrosauri (southern reptile tick), Haemaphysalis bancrofti (wallaby tick), H. longicornis (bush tick), Ixodes cornuatus (southern paralysis tick), I. hirsti (Hirst's marsupial tick), I. holocyclus (paralysis tick), I. tasmani (common marsupial tick), Rhipicephalus (Boophilus) australis (Australian cattle tick) and R. sanguineus (brown dog tick).  We use an image-matching system to identify ticks, much like the image-matching systems used in field-guides for birds and flowers. Ticks may be identified by drawings that emphasise unique matrices of uniformly defined morphological characters that, together, allow these 16 ticks to be identified by morphology unequivocally. The species accounts have seven sections: (i) General; (ii)  Differential diagnosis; (iii) Hosts; (iv) Life-cycle and seasonality; (v) Disease; (vi) Habitat and geographic distribution; (vii) Genes and genomes; and (viii) Other information. There are 71 figures and tables, including a glossary character matrices, drawings of life-cycles, drawings of genera, species, and colour photographs of tick biology.

  13. Deconstructing the Essential Elements of Bat Flight

    Science.gov (United States)

    Tafti, Danesh; Viswanath, Kamal; Krishnamurthy, Nagendra

    2013-11-01

    There are over 1000 bat species worldwide with a wide range of wing morphologies. Bat wing motion is characterized by an active adaptive three-dimensional highly deformable wing surface which is distinctive in its complex kinematics facilitated by the skeletal and skin membrane manipulation, large deviations from the stroke plane, and large wing cambers. In this study we use measured wing kinematics of a fruit bat in a straight line climbing path to study the fluid dynamics and the forces generated by the wing using an Immersed Boundary Method. This is followed by a proper orthogonal decomposition to investigate the dimensional complexity as well as the key kinematic modes used by the bat during a representative flapping cycle. It is shown that the complex wing motion of the fruit bat can mostly be broken down into canonical descriptors of wing motion such as translation, rotation, out of stroke deviation, and cambering, which the bat uses with great efficacy to generate lift and thrust. Research supported through a grant from the Army Research Office (ARO). Bat wing kinemtaics was provided by Dr. Kenny Breuer, Brown University.

  14. Non-kin cooperation in bats.

    Science.gov (United States)

    Wilkinson, Gerald S; Carter, Gerald G; Bohn, Kirsten M; Adams, Danielle M

    2016-02-01

    Many bats are extremely social. In some cases, individuals remain together for years or even decades and engage in mutually beneficial behaviours among non-related individuals. Here, we summarize ways in which unrelated bats cooperate while roosting, foraging, feeding or caring for offspring. For each situation, we ask if cooperation involves an investment, and if so, what mechanisms might ensure a return. While some cooperative outcomes are likely a by-product of selfish behaviour as they are in many other vertebrates, we explain how cooperative investments can occur in several situations and are particularly evident in food sharing among common vampire bats (Desmodus rotundus) and alloparental care by greater spear-nosed bats (Phyllostomus hastatus). Fieldwork and experiments on vampire bats indicate that sharing blood with non-kin expands the number of possible donors beyond kin and promotes reciprocal help by strengthening long-term social bonds. Similarly, more than 25 years of recapture data and field observations of greater spear-nosed bats reveal multiple cooperative investments occurring within stable groups of non-kin. These studies illustrate how bats can serve as models for understanding how cooperation is regulated in social vertebrates.

  15. Bats of the Savannah River Site and vicinity.

    Energy Technology Data Exchange (ETDEWEB)

    M.A. Menzel; J.M. Menzel; J.C. Kilgo; W.M. Ford; T.C. Carter; J.W. Edwards

    2003-10-01

    The U.S. Department of Energy's Savannah River Site supports a diverse bat community. Nine species occur there regularly, including the eastern pipistrelle (Pipistrellus subflavus), southeastern myotis (Myotis austroriparius), evening bat (Nycticeius humeralis), Rafinesque's big-eared bat (Corynorhinus rafinesquii), silver-haired bat (Lasionycteris noctivagans), eastern red bat (Lasiurus borealis), Seminole bat (L. seminolus), hoary bat (L. cinereus), and big brown bat (Eptesicus fuscus). There are extralimital capture records for two additional species: little brown bat (M. lucifigus) and northern yellow bat (Lasiurus intermedius). Acoustical sampling has documented the presence of Brazilian free-tailed bats (Tadarida brasiliensis), but none has been captured. Among those species common to the Site, the southeastern myotis and Rafinesque's big-eared bat are listed in South Carolina as threatened and endangered, respectively. The presence of those two species, and a growing concern for the conservation of forest-dwelling bats, led to extensive and focused research on the Savannah River Site between 1996 and 2002. Summarizing this and other bat research, we provide species accounts that discuss morphology and distribution, roosting and foraging behaviors, home range characteristics, habitat relations, and reproductive biology. We also present information on conservation needs and rabies issues; and, finally, identification keys that may be useful wherever the bat species we describe are found.

  16. European bat lyssaviruses: an emerging zoonosis.

    Science.gov (United States)

    Fooks, A. R.; Brookes, S. M.; Johnson, N.; McElhinney, L. M.; Hutson, A. M.

    2003-01-01

    In Europe, two bat lyssaviruses referred to as European bat lyssaviruses (EBLVs) types 1 and 2 (genotypes 5 and 6 respectively) which are closely related to classical rabies virus are responsible for an emerging zoonosis. EBLVs are host restricted to bats, and have been known to infect not only their primary hosts but also in rare circumstances, induce spillover infections to terrestrial mammals including domestic livestock, wildlife and man. Although spillover infections have occurred, there has been no evidence that the virus adapted to a new host. Since 1977, four human deaths from EBLVs have been reported. None of them had a record of prophylactic rabies immunization. Only fragmentary data exist about the effectiveness of current vaccines in cross-protection against EBLVs. It is clear that EBLV in bats cannot be eliminated using conventional strategies similar to the control programmes based on vaccine baits used for fox rabies in Europe during the 1980s. Due to the protected status of bats in Europe, our knowledge of EBLV prevalence and epidemiology is limited. It is possible that EBLV is under-reported and that the recorded cases of EBLV represent only a small proportion of the actual number of infected bats. For this reason, any interaction between man and bats in Europe must be considered as a possible exposure. Human exposure through biting incidents, especially unprovoked attacks, should be treated immediately with rabies post-exposure treatment and the bat, where possible, retained for laboratory analysis. Preventative measures include educating all bat handlers of the risks posed by rabies-infected animals and advising them to be immunized. This review provides a brief history of EBLVs, their distribution in host species and the public health risks. PMID:14959767

  17. Rabies virus infection in Eptesicus fuscus bats born in captivity (naive bats.

    Directory of Open Access Journals (Sweden)

    April D Davis

    Full Text Available The study of rabies virus infection in bats can be challenging due to quarantine requirements, husbandry concerns, genetic differences among animals, and lack of medical history. To date, all rabies virus (RABV studies in bats have been performed in wild caught animals. Determining the RABV exposure history of a wild caught bat based on the presence or absence of viral neutralizing antibodies (VNA may be misleading. Previous studies have demonstrated that the presence of VNA following natural or experimental inoculation is often ephemeral. With this knowledge, it is difficult to determine if a seronegative, wild caught bat has been previously exposed to RABV. The influence of prior rabies exposure in healthy, wild caught bats is unknown. To investigate the pathogenesis of RABV infection in bats born in captivity (naïve bats, naïve bats were inoculated intramuscularly with one of two Eptesicus fuscus rabies virus variants, EfV1 or EfV2. To determine the host response to a heterologous RABV, a separate group of naïve bats were inoculated with a Lasionycteris noctivagans RABV (LnV1. Six months following the first inoculation, all bats were challenged with EfV2. Our results indicate that naïve bats may have some level of innate resistance to intramuscular RABV inoculation. Additionally, naïve bats inoculated with the LnV demonstrated the lowest clinical infection rate of all groups. However, primary inoculation with EfV1 or LnV did not appear to be protective against a challenge with the more pathogenic EfV2.

  18. Ecological factors associated with European bat lyssavirus seroprevalence in spanish bats.

    Directory of Open Access Journals (Sweden)

    Jordi Serra-Cobo

    Full Text Available Bats have been proposed as major reservoirs for diverse emerging infectious viral diseases, with rabies being the best known in Europe. However, studies exploring the ecological interaction between lyssaviruses and their natural hosts are scarce. This study completes our active surveillance work on Spanish bat colonies that began in 1992. Herein, we analyzed ecological factors that might affect the infection dynamics observed in those colonies. Between 2001 and 2011, we collected and tested 2,393 blood samples and 45 dead bats from 25 localities and 20 bat species. The results for dead confirmed the presence of EBLV-1 RNA in six species analyzed (for the first time in Myotis capaccinii. Samples positive for European bat lyssavirus-1 (EBLV-1-neutralizing antibodies were detected in 68% of the localities sampled and in 13 bat species, seven of which were found for the first time (even in Myotis daubentonii, a species to date always linked to EBLV-2. EBLV-1 seroprevalence (20.7% ranged between 11.1 and 40.2% among bat species and seasonal variation was observed, with significantly higher antibody prevalence in summer (July. EBLV-1 seroprevalence was significantly associated with colony size and species richness. Higher seroprevalence percentages were found in large multispecific colonies, suggesting that intra- and interspecific contacts are major risk factors for EBLV-1 transmission in bat colonies. Although bat-roosting behavior strongly determines EBLV-1 variability, we also found some evidence that bat phylogeny might be involved in bat-species seroprevalence. The results of this study highlight the importance of life history and roost ecology in understanding EBLV-1-prevalence patterns in bat colonies and also provide useful information for public health officials.

  19. Ecological Factors Associated with European Bat Lyssavirus Seroprevalence in Spanish Bats

    Science.gov (United States)

    Serra-Cobo, Jordi; López-Roig, Marc; Seguí, Magdalena; Sánchez, Luisa Pilar; Nadal, Jacint; Borrás, Miquel; Lavenir, Rachel; Bourhy, Hervé

    2013-01-01

    Bats have been proposed as major reservoirs for diverse emerging infectious viral diseases, with rabies being the best known in Europe. However, studies exploring the ecological interaction between lyssaviruses and their natural hosts are scarce. This study completes our active surveillance work on Spanish bat colonies that began in 1992. Herein, we analyzed ecological factors that might affect the infection dynamics observed in those colonies. Between 2001 and 2011, we collected and tested 2,393 blood samples and 45 dead bats from 25 localities and 20 bat species. The results for dead confirmed the presence of EBLV-1 RNA in six species analyzed (for the first time in Myotis capaccinii). Samples positive for European bat lyssavirus-1 (EBLV-1)–neutralizing antibodies were detected in 68% of the localities sampled and in 13 bat species, seven of which were found for the first time (even in Myotis daubentonii, a species to date always linked to EBLV-2). EBLV-1 seroprevalence (20.7%) ranged between 11.1 and 40.2% among bat species and seasonal variation was observed, with significantly higher antibody prevalence in summer (July). EBLV-1 seroprevalence was significantly associated with colony size and species richness. Higher seroprevalence percentages were found in large multispecific colonies, suggesting that intra- and interspecific contacts are major risk factors for EBLV-1 transmission in bat colonies. Although bat-roosting behavior strongly determines EBLV-1 variability, we also found some evidence that bat phylogeny might be involved in bat-species seroprevalence. The results of this study highlight the importance of life history and roost ecology in understanding EBLV-1–prevalence patterns in bat colonies and also provide useful information for public health officials. PMID:23700480

  20. Molecular Detection of Tick-Borne Pathogens in Humans with Tick Bites and Erythema Migrans, in the Netherlands

    Science.gov (United States)

    Jahfari, Setareh; Hofhuis, Agnetha; Fonville, Manoj; van der Giessen, Joke; van Pelt, Wilfrid; Sprong, Hein

    2016-01-01

    Background Tick-borne diseases are the most prevalent vector-borne diseases in Europe. Knowledge on the incidence and clinical presentation of other tick-borne diseases than Lyme borreliosis and tick-borne encephalitis is minimal, despite the high human exposure to these pathogens through tick bites. Using molecular detection techniques, the frequency of tick-borne infections after exposure through tick bites was estimated. Methods Ticks, blood samples and questionnaires on health status were collected from patients that visited their general practitioner with a tick bite or erythema migrans in 2007 and 2008. The presence of several tick-borne pathogens in 314 ticks and 626 blood samples of this cohort were analyzed using PCR-based methods. Using multivariate logistic regression, associations were explored between pathogens detected in blood and self-reported symptoms at enrolment and during a three-month follow-up period. Results Half of the ticks removed from humans tested positive for Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, Candidatus Neoehrlichia mikurensis, Rickettsia helvetica, Rickettsia monacensis, Borrelia miyamotoi and several Babesia species. Among 92 Borrelia burgdorferi s. l. positive ticks, 33% carried another pathogen from a different genus. In blood of sixteen out of 626 persons with tick bites or erythema migrans, DNA was detected from Candidatus Neoehrlichia mikurensis (n = 7), Anaplasma phagocytophilum (n = 5), Babesia divergens (n = 3), Borrelia miyamotoi (n = 1) and Borrelia burgdorferi s. l. (n = 1). None of these sixteen individuals reported any overt symptoms that would indicate a corresponding illness during the three-month follow-up period. No associations were found between the presence of pathogen DNA in blood and; self-reported symptoms, with pathogen DNA in the corresponding ticks (n = 8), reported tick attachment duration, tick engorgement, or antibiotic treatment at enrolment. Conclusions Based on molecular

  1. A New Metaheuristic Bat-Inspired Algorithm

    CERN Document Server

    Yang, Xin-She

    2010-01-01

    Metaheuristic algorithms such as particle swarm optimization, firefly algorithm and harmony search are now becoming powerful methods for solving many tough optimization problems. In this paper, we propose a new metaheuristic method, the Bat Algorithm, based on the echolocation behaviour of bats. We also intend to combine the advantages of existing algorithms into the new bat algorithm. After a detailed formulation and explanation of its implementation, we will then compare the proposed algorithm with other existing algorithms, including genetic algorithms and particle swarm optimization. Simulations show that the proposed algorithm seems much superior to other algorithms, and further studies are also discussed.

  2. Navigation: Bat orientation using Earth's magnetic field

    DEFF Research Database (Denmark)

    Holland, Richard A.; Thorup, Kasper; Vonhof, Maarten J.;

    2006-01-01

    Bats famously orientate at night by echolocation 1 , but this works over only a short range, and little is known about how they navigate over longer distances 2 . Here we show that the homing behaviour of Eptesicus fuscus, known as the big brown bat, can be altered by artificially shifting the Ea...... the Earth's magnetic field, indicating that these bats rely on a magnetic compass to return to their home roost. This finding adds to the impressive array of sensory abilities possessed by this animal for navigation in the dark....

  3. Navigation: bat orientation using Earth's magnetic field.

    Science.gov (United States)

    Holland, Richard A; Thorup, Kasper; Vonhof, Maarten J; Cochran, William W; Wikelski, Martin

    2006-12-07

    Bats famously orientate at night by echolocation, but this works over only a short range, and little is known about how they navigate over longer distances. Here we show that the homing behaviour of Eptesicus fuscus, known as the big brown bat, can be altered by artificially shifting the Earth's magnetic field, indicating that these bats rely on a magnetic compass to return to their home roost. This finding adds to the impressive array of sensory abilities possessed by this animal for navigation in the dark.

  4. How the bat got its buzz

    DEFF Research Database (Denmark)

    Ratcliffe, John M; Elemans, Coen P H; Jakobsen, Lasse

    2013-01-01

    its importance for hunting success. Superfast muscles, previously unknown in mammals, are responsible for the extreme vocalization rate. Some bats produce a second phase-buzz II-defined by a large drop in the fundamental frequency (F(0)) of their calls. By doing so, bats broaden their acoustic field...... tension. Furthermore, we propose that buzz II represents a countermeasure against the evasive flight of eared prey in the evolutionary arms-race that saw the independent evolution of bat-detecting ears in various groups of night-flying insects....

  5. Novel rickettsia in ticks, Tasmania, Australia.

    Science.gov (United States)

    Izzard, Leonard; Graves, Stephen; Cox, Erika; Fenwick, Stan; Unsworth, Nathan; Stenos, John

    2009-10-01

    A novel rickettsia was detected in Ixodes tasmani ticks collected from Tasmanian devils. A total of 55% were positive for the citrate synthase gene by quantitative PCR. According to current criteria for rickettsia speciation, this new rickettsia qualifies as Candidatus Rickettsia tasmanensis, named after the location of its detection.

  6. Thirty years of tick population genetics: a comprehensive review.

    Science.gov (United States)

    Araya-Anchetta, Ana; Busch, Joseph D; Scoles, Glen A; Wagner, David M

    2015-01-01

    Population genetic studies provide insights into the basic biology of arthropod disease vectors by estimating dispersal patterns and their potential to spread pathogens. In wingless vectors, such as ticks, gene flow will be defined in large part by the mobility of their hosts. However, tick behaviors and life cycle strategies can limit their dispersal even on highly mobile hosts and lead to an increase in genetic structure. In this review we synthesize the published literature from three decades of tick population genetic studies. Based on studies from 22 tick species (including representatives from Amblyomma, Bothriocroton, Dermacentor, Ixodes, Ornithodoros, and Rhipicephalus), observed levels of population genetic structure in ticks varied from no structure to very high levels. In about half of the species (including representatives from Amblyomma, Bothriocroton, Dermacentor, and Ornithodoros), tick genetic structure appeared to be determined primarily by the movement capacity of hosts, with low gene flow observed in ticks that use smaller bodied less mobile hosts and high gene flow in ticks using highly mobile hosts. In a number of other species (primarily from Ixodes, Ornithodoros, and Rhipicephalus), behavioral limitations to gene flow appeared to result in greater genetic structure than expected based upon host movement capability alone. We also discuss the strengths and limitations of genetic markers and their applicability to ticks and suggest possible analyses when planning population genetic studies for ticks.

  7. The role of cystatins in tick physiology and blood feeding.

    Science.gov (United States)

    Schwarz, Alexandra; Valdés, James J; Kotsyfakis, Michalis

    2012-06-01

    Ticks, as obligate hematophagous ectoparasites, impact greatly on animal and human health because they transmit various pathogens worldwide. Over the last decade, several cystatins from different hard and soft ticks were identified and biochemically analyzed for their role in the physiology and blood feeding lifestyle of ticks. All these cystatins are potent inhibitors of papain-like cysteine proteases, but not of legumain. Tick cystatins were either detected in the salivary glands and/or the midgut, key tick organs responsible for blood digestion and the expression of pharmacologically potent salivary proteins for blood feeding. For example, the transcription of two cystatins named HlSC-1 and Sialostatin L2 was highly upregulated in these tick tissues during feeding. Vaccinating hosts against Sialostatin L2 and Om-cystatin 2 as well as silencing of a cystatin gene from Amblyomma americanum significantly inhibited the feeding ability of ticks. Additionally, Om-cystatin 2 and Sialostatin L possessed strong host immunosuppressive properties by inhibiting dendritic cell maturation due to their interaction with cathepsin S. These two cystatins, together with Sialostatin L2 are the first tick cystatins with resolved three-dimensional structure. Sialostatin L, furthermore, showed preventive properties against autoimmune diseases. In the case of the cystatin Hlcyst-2, experimental evidence showed its role in tick innate immunity, since increased Hlcyst-2 transcript levels were detected in Babesia gibsoni-infected larval ticks and the protein inhibited Babesia growth. Other cystatins, such as Hlcyst-1 or Om-cystatin 2 are assumed to be involved in regulating blood digestion. Only for Bmcystatin was a role in tick embryogenesis suggested. Finally, all the biochemically analyzed tick cystatins are powerful protease inhibitors, and some may be novel antigens for developing anti-tick vaccines and drugs of medical importance due to their stringent target specificity.

  8. Bats as reservoirs of severe emerging infectious diseases.

    Science.gov (United States)

    Han, Hui-Ju; Wen, Hong-ling; Zhou, Chuan-Min; Chen, Fang-Fang; Luo, Li-Mei; Liu, Jian-wei; Yu, Xue-Jie

    2015-07-01

    In recent years severe infectious diseases have been constantly emerging, causing panic in the world. Now we know that many of these terrible diseases are caused by viruses originated from bats (Table 1), such as Ebola virus, Marburg, SARS coronavirus (SARS-CoV), MERS coronavirus (MERS-CoV), Nipah virus (NiV) and Hendra virus (HeV). These viruses have co-evolved with bats due to bats' special social, biological and immunological features. Although bats are not in close contact with humans, spillover of viruses from bats to intermediate animal hosts, such as horses, pigs, civets, or non-human primates, is thought to be the most likely mode to cause human infection. Humans may also become infected with viruses through aerosol by intruding into bat roosting caves or via direct contact with bats, such as catching bats or been bitten by bats.

  9. Economic Dispatch Using Modified Bat Algorithm

    Directory of Open Access Journals (Sweden)

    Aadil Latif

    2014-07-01

    Full Text Available Economic dispatch is an important non-linear optimization task in power systems. In this process, the total power demand is distributed amongst the generating units such that each unit satisfies its generation limit constraints and the cost of power production is minimized. This paper presents an over view of three optimization algorithms namely real coded genetic algorithm, particle swarm optimization and a relatively new optimization technique called bat algorithm. This study will further propose modifications to the original bat. Simulations are carried out for two test cases. First is a six-generator power system with a simplified convex objective function. The second test case is a five-generator system with a non-convex objective function. Finally the results of the modified algorithm are compared with the results of genetic algorithm, particle swarm and the original bat algorithm. The results demonstrate the improvement in the Bat Algorithm.

  10. The Bats of Latium : Past and Present

    OpenAIRE

    Crucitti, Pierangelo

    2010-01-01

    After briefly reviewing past research, the present status of our knowledge on the bats of Latium, Central Italy, one of the richest biodiversity districts of the Central Mediterranean Ecoregion, is  outlined, highlighting the contribution of Benedetto Lanza.

  11. North American Bat Ranges - Direct Download

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This map layer portrays our current understanding of the distributions of United States and Canadian bat species during the past 100-150 years. The specimen and...

  12. Somatosensory substrates of flight control in bats.

    Science.gov (United States)

    Marshall, Kara L; Chadha, Mohit; deSouza, Laura A; Sterbing-D'Angelo, Susanne J; Moss, Cynthia F; Lumpkin, Ellen A

    2015-05-12

    Flight maneuvers require rapid sensory integration to generate adaptive motor output. Bats achieve remarkable agility with modified forelimbs that serve as airfoils while retaining capacity for object manipulation. Wing sensory inputs provide behaviorally relevant information to guide flight; however, components of wing sensory-motor circuits have not been analyzed. Here, we elucidate the organization of wing innervation in an insectivore, the big brown bat, Eptesicus fuscus. We demonstrate that wing sensory innervation differs from other vertebrate forelimbs, revealing a peripheral basis for the atypical topographic organization reported for bat somatosensory nuclei. Furthermore, the wing is innervated by an unusual complement of sensory neurons poised to report airflow and touch. Finally, we report that cortical neurons encode tactile and airflow inputs with sparse activity patterns. Together, our findings identify neural substrates of somatosensation in the bat wing and imply that evolutionary pressures giving rise to mammalian flight led to unusual sensorimotor projections.

  13. Somatosensory Substrates of Flight Control in Bats

    Directory of Open Access Journals (Sweden)

    Kara L. Marshall

    2015-05-01

    Full Text Available Flight maneuvers require rapid sensory integration to generate adaptive motor output. Bats achieve remarkable agility with modified forelimbs that serve as airfoils while retaining capacity for object manipulation. Wing sensory inputs provide behaviorally relevant information to guide flight; however, components of wing sensory-motor circuits have not been analyzed. Here, we elucidate the organization of wing innervation in an insectivore, the big brown bat, Eptesicus fuscus. We demonstrate that wing sensory innervation differs from other vertebrate forelimbs, revealing a peripheral basis for the atypical topographic organization reported for bat somatosensory nuclei. Furthermore, the wing is innervated by an unusual complement of sensory neurons poised to report airflow and touch. Finally, we report that cortical neurons encode tactile and airflow inputs with sparse activity patterns. Together, our findings identify neural substrates of somatosensation in the bat wing and imply that evolutionary pressures giving rise to mammalian flight led to unusual sensorimotor projections.

  14. Site 300 Bat Monitoring Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Drennan, Joe [Garcia and Associates, San Francisco, CA (United States); Tortosa, Justin [Garcia and Associates, San Francisco, CA (United States)

    2016-07-18

    From June 15 to 18, 2015, GANDA biologist Graham Neale assisted in programming and fieldtesting of the bat monitoring equipment. The equipment was deployed in the field on a meteorological (MET) tower within Site 300 on June 18, 2015.

  15. Tick-borne rickettsial pathogens in ticks and small mammals in Korea.

    Science.gov (United States)

    Kim, Chul-Min; Yi, Ying-Hua; Yu, Do-Hyeon; Lee, Mi-Jin; Cho, Mae-Rim; Desai, Atul R; Shringi, Smriti; Klein, Terry A; Kim, Heung-Chul; Song, Jin-Won; Baek, Luck-Ju; Chong, Sung-Tae; O'guinn, Monica L; Lee, John S; Lee, In-Yong; Park, Jin-Ho; Foley, Janet; Chae, Joon-Seok

    2006-09-01

    In order to investigate the prevalence of tick-borne infectious agents among ticks, ticks comprising five species from two genera (Hemaphysalis spp. and Ixodes spp.) were screened using molecular techniques. Ticks (3,135) were collected from small wild-caught mammals or by dragging/flagging in the Republic of Korea (ROK) and were pooled into a total of 1,638 samples (1 to 27 ticks per pool). From the 1,638 tick samples, species-specific fragments of Anaplasma phagocytophilum (1 sample), Anaplasma platys (52 samples), Ehrlichia chaffeensis (29 samples), Ehrlichia ewingii (2 samples), Ehrlichia canis (18 samples), and Rickettsia rickettsii (28 samples) were amplified by PCR assay. Twenty-one pooled and individual tick samples had mixed infections of two (15 samples) or three (6 samples) pathogens. In addition, 424 spleen samples from small captured mammals (389 rodents, 33 insectivores, and 2 weasels) were screened for selected zoonotic pathogens. Species-specific DNA fragments of A. phagocytophilum (110 samples), A. platys (68 samples), E. chaffeensis (8 samples), E. ewingii (26 samples), E. canis (51 samples), and Rickettsia sp. (22 samples) were amplified by PCR assay. One hundred thirty small mammals had single infections, while 4, 14, and 21 striped field mice (Apodemus agrarius) had mixed infections of four, three, and two pathogens, respectively. Phylogenetic analysis based on nucleotide sequence comparison also revealed that Korean strains of E. chaffeensis clustered closely with those from China and the United States, while the Rickettsia (rOmpA) sequences clustered within a clade together with a Chinese strain. These results suggest that these agents should be considered in differential diagnosis while examining cases of acute febrile illnesses in humans as well as animals in the ROK.

  16. Climate change, biodiversity, ticks and tick-borne diseases: The butterfly effect

    Directory of Open Access Journals (Sweden)

    Filipe Dantas-Torres

    2015-12-01

    Full Text Available We have killed wild animals for obtaining food and decimated forests for many reasons. Nowadays, we are burning fossil fuels as never before and even exploring petroleum in deep waters. The impact of these activities on our planet is now visible to the naked eye and the debate on climate change is warming up in scientific meetings and becoming a priority on the agenda of both scientists and policy decision makers. On the occasion of the Impact of Environmental Changes on Infectious Diseases (IECID meeting, held in the 2015 in Sitges, Spain, I was invited to give a keynote talk on climate change, biodiversity, ticks and tick-borne diseases. The aim of the present article is to logically extend my rationale presented on the occasion of the IECID meeting. This article is not intended to be an exhaustive review, but an essay on climate change, biodiversity, ticks and tick-borne diseases. It may be anticipated that warmer winters and extended autumn and spring seasons will continue to drive the expansion of the distribution of some tick species (e.g., Ixodes ricinus to northern latitudes and to higher altitudes. Nonetheless, further studies are advocated to improve our understanding of the complex interactions between landscape, climate, host communities (biodiversity, tick demography, pathogen diversity, human demography, human behaviour, economics, and politics, also considering all ecological processes (e.g., trophic cascades and other possible interacting effects (e.g., mutual effects of increased greenhouse gas emissions and increased deforestation rates. The multitude of variables and interacting factors involved, and their complexity and dynamism, make tick-borne transmission systems beyond (current human comprehension. That is, perhaps, the main reason for our inability to precisely predict new epidemics of vector-borne diseases in general.

  17. Presence of Chlamydiales DNA in ticks and fleas suggests that ticks are carriers of Chlamydiae.

    Science.gov (United States)

    Croxatto, Antony; Rieille, Nadia; Kernif, Tahar; Bitam, Idir; Aeby, Sébastien; Péter, Olivier; Greub, Gilbert

    2014-06-01

    The Chlamydiales order includes the Chlamydiaceae, Parachlamydiaceae, Waddliaceae, Simkaniaceae, Criblamydiaceae, Rhabdochlamydiaceae, Clavichlamydiaceae, and Piscichlamydiaceae families. Members of the Chlamydiales order are obligate intracellular bacteria that replicate within eukaryotic cells of different origins including humans, animals, and amoebae. Many of these bacteria are pathogens or emerging pathogens of both humans and animals, but their true diversity is largely underestimated, and their ecology remains to be investigated. Considering their potential threat on human health, it is important to expand our knowledge on the diversity of Chlamydiae, but also to define the host range colonized by these bacteria. Thus, using a new pan-Chlamydiales PCR, we analyzed the prevalence of Chlamydiales DNA in ticks and fleas, which are important vectors of several viral and bacterial infectious diseases. To conduct this study, 1340 Ixodes ricinus ticks prepared in 192 pools were collected in Switzerland and 55 other ticks belonging to different tick species and 97 fleas belonging to different flea species were harvested in Algeria. In Switzerland, the prevalence of Chlamydiales DNA in the 192 pools was equal to 28.1% (54/192) which represents an estimated prevalence in the 1340 individual ticks of between 4.0% and 28.4%. The pan-Chlamydiales qPCR was positive for 45% (25/55) of tick samples collected in Algeria. The sequencing of the positive qPCR amplicons revealed a high diversity of Chlamydiales species. Most of them belonged to the Rhabdochlamydiaceae and Parachlamydiaceae families. Thus, ticks may carry Chlamydiales and should thus be considered as possible vectors for Chlamydiales propagation to both humans and animals.

  18. Molecular detection and characterization of tick-borne pathogens in dogs and ticks from Nigeria.

    Directory of Open Access Journals (Sweden)

    Joshua Kamani

    Full Text Available BACKGROUND: Only limited information is currently available on the prevalence of vector borne and zoonotic pathogens in dogs and ticks in Nigeria. The aim of this study was to use molecular techniques to detect and characterize vector borne pathogens in dogs and ticks from Nigeria. METHODOLOGY/PRINCIPAL FINDINGS: Blood samples and ticks (Rhipicephalus sanguineus, Rhipicephalus turanicus and Heamaphysalis leachi collected from 181 dogs from Nigeria were molecularly screened for human and animal vector-borne pathogens by PCR and sequencing. DNA of Hepatozoon canis (41.4%, Ehrlichia canis (12.7%, Rickettsia spp. (8.8%, Babesia rossi (6.6%, Anaplasma platys (6.6%, Babesia vogeli (0.6% and Theileria sp. (0.6% was detected in the blood samples. DNA of E. canis (23.7%, H. canis (21.1%, Rickettsia spp. (10.5%, Candidatus Neoehrlichia mikurensis (5.3% and A. platys (1.9% was detected in 258 ticks collected from 42 of the 181 dogs. Co- infections with two pathogens were present in 37% of the dogs examined and one dog was co-infected with 3 pathogens. DNA of Rickettsia conorii israelensis was detected in one dog and Rhipicephalus sanguineus tick. DNA of another human pathogen, Candidatus N. mikurensis was detected in Rhipicephalus sanguineus and Heamaphysalis leachi ticks, and is the first description of Candidatus N. mikurensis in Africa. The Theileria sp. DNA detected in a local dog in this study had 98% sequence identity to Theileria ovis from sheep. CONCLUSIONS/SIGNIFICANCE: The results of this study indicate that human and animal pathogens are abundant in dogs and their ticks in Nigeria and portray the potential high risk of human exposure to infection with these agents.

  19. A survey of tick-borne pathogens in dogs and their ticks in the Pantanal biome, Brazil.

    Science.gov (United States)

    Melo, A L T; Witter, R; Martins, T F; Pacheco, T A; Alves, A S; Chitarra, C S; Dutra, V; Nakazato, L; Pacheco, R C; Labruna, M B; Aguiar, D M

    2016-03-01

    Tick and blood samples collected from domestic dogs in the Brazilian Pantanal were tested by molecular methods for the presence of tick-borne protozoa and bacteria. Among 320 sampled dogs, 3.13% were infected by Babesia vogeli (Piroplasmida: Babesiidae), 8.75% by Hepatozoon canis (Eucoccidiorida: Hepatozoidae), 7.19% by Anaplasma platys (Rickettsiales: Anaplasmataceae), and 0.94% by an unclassified Anaplasma sp. In three tick species collected from dogs, the following tick-borne agents were detected: (a) B. vogeli, An. platys and Ehrlichia canis (Rickettsiales: Anaplasmataceae), infecting Rhipicephalus sanguineus sensu lato (Ixodida: Ixodidae) ticks; (b) H. canis, an unclassified Anaplasma sp. and Rickettsia amblyommii (Rickettsiales: Rickettsiaceae), infecting Amblyomma cajennense sensu lato (Ixodida: Ixodidae) ticks, and (c) Rickettsia sp. strain Atlantic rainforest, an emerging human pathogen, infecting Amblyomma ovale ticks. Molecular analysis, based on a mitochondrial gene, revealed that the Am. cajennense s.l. ticks of the present study corresponded to Amblyomma sculptum, a member of the Am. cajennense species complex, and that Rh. sanguineus s.l. belonged to the tropical lineage. Whereas dogs are exposed to a number of tick-borne bacterial and protozoan agents in the Pantanal biome, humans are potentially exposed to infection by spotted fever group rickettsiae (e.g. R. amblyommii and Rickettsia sp. strain Atlantic rainforest) because both Am. sculptum and Am. ovale are among the most important human-biting ticks in Brazil.

  20. SWIFT BAT Survey of AGN

    Science.gov (United States)

    Tueller, J.; Mushotzky, R. F.; Barthelmy, S.; Cannizzo, J. K.; Gehrels, N.; Markwardt, C. B.; Skinner, G. K.; Winter, L. M.

    2008-01-01

    We present the results1 of the analysis of the first 9 months of data of the Swift BAT survey of AGN in the 14-195 keV band. Using archival X-ray data or follow-up Swift XRT observations, we have identified 129 (103 AGN) of 130 objects detected at [b] > 15deg and with significance > 4.8-delta. One source remains unidentified. These same X-ray data have allowed measurement of the X-ray properties of the objects. We fit a power law to the logN - log S distribution, and find the slope to be 1.42+/-0.14. Characterizing the differential luminosity function data as a broken power law, we find a break luminosity logL*(ergs/s)= 43.85+/-0.26. We obtain a mean photon index 1.98 in the 14-195 keV band, with an rms spread of 0.27. Integration of our luminosity function gives a local volume density of AGN above 10(exp 41) erg/s of 2.4x10(exp -3) Mpc(sup -3), which is about 10% of the total luminous local galaxy density above M* = -19.75. We have obtained X-ray spectra from the literature and from Swift XRT follow-up observations. These show that the distribution of log nH is essentially flat from nH = 10(exp 20)/sq cm to 10(exp 24)/sq cm, with 50% of the objects having column densities of less than 10(exp 22)/sq cm. BAT Seyfert galaxies have a median redshift of 0.03, a maximum log luminosity of 45.1, and approximately half have log nH > 22.

  1. Effects of deer density on tick infestation of rodents and the hazard of tick-borne encephalitis. I: empirical assessment.

    Science.gov (United States)

    Cagnacci, F; Bolzoni, L; Rosà, R; Carpi, G; Hauffe, H C; Valent, M; Tagliapietra, V; Kazimirova, M; Koci, J; Stanko, M; Lukan, M; Henttonen, H; Rizzoli, A

    2012-04-01

    Tick borne encephalitis (TBE) is endemic to eastern and central Europe with broad temporal and spatial variation in infection risk. Although many studies have focused on understanding the environmental and socio-economic factors affecting exposure of humans to TBE, comparatively little research has been devoted to assessing the underlying ecological mechanisms of TBE occurrence in enzootic cycles, and therefore TBE hazard. The aim of this study was to evaluate the effect of the main ungulate tick hosts on the pattern of tick infestation in rodents and TBE occurrence in rodents and questing adult ticks. In this empirical study, we considered three areas where endemic human TBE occurs and three control sites having no reported human TBE cases. In these six sites located in Italy and Slovakia, we assessed deer density using the pellet group count-plot sampling technique, collected questing ticks, live-trapped rodents (primarily Apodemus flavicollis and Myodes glareolus) and counted ticks feeding on rodents. Both rodents and questing ticks were screened for TBE infection. TBE infection in ticks and rodents was positively associated with the number of co-feeding ticks on rodents and negatively correlated with deer density. We hypothesise that the negative relationship between deer density and TBE occurrence on a local scale (defined by the minimum overlapping area of host species) could be attributed to deer (incompetent hosts) diverting questing ticks from rodents (competent hosts), know as the 'dilution effect hypothesis'. We observed that, after an initial increase, the number of ticks feeding on rodents reached a peak for an intermediate value of estimated deer density and then decreased. Therefore, while at a regional scale, tick host availability has already been shown to be directly correlated with TBE distribution, our results suggest that the interactions between deer, rodents and ticks are much more complex on a local scale, supporting the possibility of a

  2. Bat distribution size or shape as determinant of viral richness in african bats.

    Directory of Open Access Journals (Sweden)

    Gaël D Maganga

    Full Text Available The rising incidence of emerging infectious diseases (EID is mostly linked to biodiversity loss, changes in habitat use and increasing habitat fragmentation. Bats are linked to a growing number of EID but few studies have explored the factors of viral richness in bats. These may have implications for role of bats as potential reservoirs. We investigated the determinants of viral richness in 15 species of African bats (8 Pteropodidae and 7 microchiroptera in Central and West Africa for which we provide new information on virus infection and bat phylogeny. We performed the first comparative analysis testing the correlation of the fragmented geographical distribution (defined as the perimeter to area ratio with viral richness in bats. Because of their potential effect, sampling effort, host body weight, ecological and behavioural traits such as roosting behaviour, migration and geographical range, were included into the analysis as variables. The results showed that the geographical distribution size, shape and host body weight have significant effects on viral richness in bats. Viral richness was higher in large-bodied bats which had larger and more fragmented distribution areas. Accumulation of viruses may be related to the historical expansion and contraction of bat species distribution range, with potentially strong effects of distribution edges on virus transmission. Two potential explanations may explain these results. A positive distribution edge effect on the abundance or distribution of some bat species could have facilitated host switches. Alternatively, parasitism could play a direct role in shaping the distribution range of hosts through host local extinction by virulent parasites. This study highlights the importance of considering the fragmentation of bat species geographical distribution in order to understand their role in the circulation of viruses in Africa.

  3. MICROSTRIP COUPLER DESIGN USING BAT ALGORITHM

    Directory of Open Access Journals (Sweden)

    EzgiDeniz Ulker

    2014-01-01

    Full Text Available Evolutionary and swarm algorithms have found many applications in design problems since todays computing power enables these algorithms to find solutions to complicated design problems very fast. Newly proposed hybridalgorithm, bat algorithm, has been applied for the design of microwave microstrip couplers for the first time. Simulation results indicate that the bat algorithm is a very fast algorithm and it produces very reliable results.

  4. Haemaphysalis longicornis Ticks as Reservoir and Vector of Severe Fever with Thrombocytopenia Syndrome Virus in China

    OpenAIRE

    Luo, Li-mei; Zhao, Li; Wen, Hong-Ling; Zhang, Zhen-Tang; Liu, Jian-Wei; Fang, Li-Zhu; Xue, Zai-Feng; Ma, Dong-Qiang; Zhang, Xiao-Shuang; Ding, Shu-Jun; Lei, Xiao-Ying; Yu, Xue-jie

    2015-01-01

    Severe fever with thrombocytopenia syndrome (SFTS) is an emerging hemorrhagic fever in East Asia caused by SFTS virus (SFTSV), a newly discovered phlebovirus. The Haemaphysalis longicornis tick has been suspected to be the vector of SFTSV. To determine whether SFTSV can be transmitted among ticks, from ticks to animals, and from animals to ticks, we conducted transmission studies between developmental stages of H. longicornis ticks and between ticks and mice. Using reverse transcription PCR, ...

  5. Heavy metal contamination in bats in Britain

    Energy Technology Data Exchange (ETDEWEB)

    Walker, L.A. [NERC Centre for Ecology and Hydrology, Monks Wood, Abbots Ripton, Huntingdon, Cambridgeshire PE28 2LS (United Kingdom); Simpson, V.R. [Wildlife Veterinary Investigation Centre, Jollys Bottom Farm, Chacewater, Truro, Cornwall TR4 8PB (United Kingdom); Rockett, L. [NERC Centre for Ecology and Hydrology, Monks Wood, Abbots Ripton, Huntingdon, Cambridgeshire PE28 2LS (United Kingdom); Wienburg, C.L. [NERC Centre for Ecology and Hydrology, Monks Wood, Abbots Ripton, Huntingdon, Cambridgeshire PE28 2LS (United Kingdom); Shore, R.F. [NERC Centre for Ecology and Hydrology, Monks Wood, Abbots Ripton, Huntingdon, Cambridgeshire PE28 2LS (United Kingdom)]. E-mail: rfs@ceh.ac.uk

    2007-07-15

    Toxic metals are bioaccumulated by insectivorous mammals but few studies (none from Britain) have quantified residues in bats. We measured renal mercury (Hg), lead (Pb) and cadmium (Cd) concentrations in bats from south-west England to determine how they varied with species, sex, age, and over time, and if they were likely to cause adverse effects. Residues were generally highest in whiskered bats (Myotis mystacinus). Compared with other species, pipistrelle (Pipistrellus spp) and Natterer's bats (Myotis nattereri) had significantly lower kidney Hg and Pb concentrations, respectively. Renal Hg increased over time in pipistrelles but the contributory sources are unknown. Kidney Pb did not decrease over time despite concurrent declines in atmospheric Pb. Overall, median renal metal concentrations were similar to those in bats from mainland Europe and 6- to 10-fold below those associated with clinical effect, although 5% of pipistrelles had kidney Pb residues diagnostic of acute lead poisoning. - Heavy metal contamination has been quantified in bats from Britain for the first time and indicates increased accumulation of Hg and no reduction in Pb.

  6. Convergences in the diversification of bats

    Directory of Open Access Journals (Sweden)

    M. Brock FENTON

    2010-08-01

    Full Text Available Twenty-five characters or suites of characters from bats are considered in light of changes in bat classification. The characters include some associated with flower-visiting (two, echolocation (12, roosting (six, reproduction (two and three are of unknown adaptive function. In both the 1998 and 2006 classifications of bats into suborders (Megachiroptera and Microchiroptera versus Yinpterochiroptera and Yangochiroptera, respectively, some convergences between suborders are the same (e.g., foliage roosting, tent building, but others associated with echolocation differ substantially. In the 1998 phylogeny convergences associated with echolocation (high duty cycle echolocation, nasal emission of echolocation calls occurred among the Microchiroptera. In the 2006 phylogeny, they occur between Yinpterochiroptera and Yangochiroptera. While some traits apparently arose independently in two suborders (e.g., foliage-roosting, tent building, low intensity echolocation calls, noseleafs, nasal emission of echolocation calls, high duty cycle echolocation behaviour, others appear to have been ancestral (roosting in narrow spaces, laryngeal echolocation, stylohyal-tympanic contact, oral emission of echolocation calls, and small litter size. A narrow profile through the chest is typical of bats reflecting the thoracic skeleton. This feature suggests that the ancestors of bats spent the day in small crevices. Features associated with laryngeal echolocation appear to be ancestral, suggesting that echolocation evolved early in bats but was subsequently lost in one yinpterochiropteran lineage [Current Zoology 56 (4: 454–468, 2010].

  7. Detection of Rickettsia and Anaplasma from hard ticks in Thailand.

    Science.gov (United States)

    Malaisri, Premnika; Hirunkanokpun, Supanee; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2015-12-01

    We collected a total of 169 adult hard ticks and 120 nymphs from under the leaves of plants located along tourist nature trails in ten localities. The results present data examining the vector competence of ticks of different genera and the presence of Rickettsia and Anaplasma species. The ticks belonged to three genera, Amblyomma, Dermacentor, and Haemaphysalis, comprising 11 species. Rickettsia bacteria were detected at three collection sites, while Anaplasma bacteria were detected at only one site. Phylogenetic analysis revealed new rickettsia genotypes from Thailand that were closely related to Rickettsia tamurae, Rickettsia monacensis, and Rickettsia montana. This study was also the first to show that Anaplasma bacteria are found in Haemaphysalis shimoga ticks and are closely related evolutionarily to Anaplasma bovis. These results provide additional information for the geographical distribution of tick species and tick-borne bacteria in Thailand and can therefore be applied for ecotourism management.

  8. Rickettsia conorii israelensis in Rhipicephalus sanguineus ticks, Sardinia, Italy.

    Science.gov (United States)

    Chisu, Valentina; Masala, Giovanna; Foxi, Cipriano; Socolovschi, Cristina; Raoult, Didier; Parola, Philippe

    2014-06-01

    The presence of tick-borne Rickettsia spp. was examined by PCR using DNA samples extracted from 254 ticks collected from mammals originating from northern and eastern Sardinia, Italy. The spotted fever group rickettsial agent Rickettsia conorii israelensis was detected in 3 Rhipicephalus sanguineus ticks from a dog for the first time in this geographical area. In addition, Ri. massiliae, Ri. slovaca, and Ri. aeschlimannii were detected in Rh. turanicus, Rh. sanguineus, Dermacentor marginatus, and Hyalomma marginatum marginatum ticks from dogs, goats, wild boar, and horse. Moreover, Candidatus Rickettsia barbariae was detected in 2 Rh. turanicus ticks from goats. The detection of Ri. conorii israelensis, an emergent agent which causes Israeli spotted fever, increases our knowledge on tick-borne rickettsioses in Sardinia.

  9. The mitochondrial genome of the lone star tick (Amblyomma americanum).

    Science.gov (United States)

    Williams-Newkirk, Amanda J; Burroughs, Mark; Changayil, Shankar S; Dasch, Gregory A

    2015-09-01

    Amblyomma americanum is an abundant tick in the southeastern, midwestern, and northeastern United States. It is a vector of multiple diseases, but limited genomic resources are available for it. We sequenced the complete mitochondrial genome of a single female A. americanum collected in Georgia using the Illumina platform. The consensus sequence was 14,709 bp long, and the mean coverage across the assembly was >12,000×. All expected tick genomic features were present, including two "Tick-Box" motifs, and in the expected order for the Metastriata. Heteroplasmy rates were low compared to the most closely related tick for which data are available, Amblyomma cajennense. The phylogeny derived from the concatenated protein coding and rRNA genes from the 33 available tick mitochondrial genomes was consistent with those previously proposed for the Acari. This is the first complete mitochondrial sequence for A. americanum, which provides a useful reference for future studies of A. americanum population genetics and tick phylogeny.

  10. Establishing protocols for tick containment at Biosafety Level 4.

    Science.gov (United States)

    Thangamani, Saravanan; Bente, Dennis

    2014-07-01

    Tick-borne diseases continue to emerge and have a great impact on public health and agriculture. In addition, many of the agents of tick-borne diseases, which are classified as Biosafety Level 4 (BSL-4) viruses, have the potential to be used as biothreat agents. In spite of the known importance of these pathogens, there is an acute shortage of facilities and trained personnel to study the pathogenesis of tick-borne diseases and to assess vaccine as well as other therapeutic interventions against tick-borne diseases as they are transmitted in nature. We, at the Galveston National Laboratory, have developed facilities and protocols to safely work with BSL4 virus-infected ticks. This capability adds tremendous value to the Nation's training and research endeavors. In this report we describe the procedures and protocols to establish tick work in a BSL4 laboratory.

  11. Small mammals as hosts of immature ixodid ticks

    OpenAIRE

    Horak, I G; L.J. Fourie; L.E.O. Braack

    2005-01-01

    Two hundred and twenty-five small mammals belonging to 16 species were examined for ticks in Free State, Mpumalanga and Limpopo Provinces, South Africa, and 18 ixodid tick species, of which two could only be identified to genus level, were recovered. Scrub hares, Lepus saxatilis, and Cape hares, Lepus capensis, harboured the largest number of tick species. In Free State Province Namaqua rock mice, Aethomys namaquensis, and four-striped grass mice, Rhabdomys pumilio, were good hosts of th...

  12. Ticks and spotted fever group rickettsiae of southeastern Virginia.

    Science.gov (United States)

    Nadolny, Robyn M; Wright, Chelsea L; Sonenshine, Daniel E; Hynes, Wayne L; Gaff, Holly D

    2014-02-01

    The incidence of tick-borne rickettsial disease in the southeastern United States has been rising steadily through the past decade, and the range expansions of tick species and tick-borne infectious agents, new and old, has resulted in an unprecedented mix of vectors and pathogens. The results of an ongoing 4-year surveillance project describe the relative abundance of questing tick populations in southeastern Virginia. Since 2009, more than 66,000 questing ticks of 7 species have been collected from vegetation in a variety of habitats, with Amblyomma americanum constituting over 95% of ticks collected. Other species represented included Ixodes scapularis, Dermacentor variabilis, Amblyomma maculatum, Ixodes affinis, Haemaphysalis leporispalustris, and Ixodes brunneus. We found that 26.9-54.9% of A. americanum ticks tested were positive for Rickettsia amblyommii, a non-pathogenic symbiont of this tick species. We also found no evidence of R. rickettsii in D. variabilis ticks, although they did show low infection rates of R. montanensis (1.5-2.0%). Rickettsia parkeri and Candidatus R. andeanae were found in 41.8-55.7% and 0-1.5% A. maculatum ticks, respectively. The rate of R. parkeri in A. maculatum ticks is among the highest in the literature and has increased in the 2 years since R. parkeri and A. maculatum were first reported in southeastern Virginia. We conclude that tick populations in southeastern Virginia have recently undergone dramatic changes in species and abundance and that these populations support a variety of rickettsial agents with the potential for increased risk to human health.

  13. Establishing protocols for tick containment at Biosafety Level 4

    OpenAIRE

    2014-01-01

    Tick borne diseases continue to emerge and have a great impact on public health and agriculture. In addition, many of the tick borne diseases agents, which are classified as Biosafety Level 4 (BSL-4) viruses, have the potential to be used as biothreat agents. In spite of the known importance of these pathogens, there is an acute shortage of facilities and trained personnel to study the pathogenesis of tick-borne diseases and to assess vaccine as well as other therapeutic interventions against...

  14. Tick-borne rickettsiae in Guinea and Liberia

    OpenAIRE

    Mediannikov, Oleg; Diatta, G.; Zolia, Y.; Balde, M. C.; Kohar, H.; Trape, Jean-François; Raoult, Didier

    2012-01-01

    While the high seroprevalence for the rickettsiae that cause spotted fevers and the multiple pathogenic rickettsiae is known, the data on the distribution of rickettsial diseases in Africa are often incomplete. We collected ticks from domestic or wild animals (generally a source of bushmeat) that were in contact with humans in 2 neighboring countries of tropical West Africa, Guinea and Liberia. In total, 382 ticks representing 6 species were collected in Liberia and 655 ticks representing 7 s...

  15. Keeping bats cool in the winter: hibernating bats and their exposure to 'hot' incandescent lamplight

    NARCIS (Netherlands)

    Haarsma, A.J.; Hullu, de E.

    2012-01-01

    In order to monitor bat population trends, an annual census is performed of all known underground hibernacula in Europe. During these censuses, bats are sometimes found to show signs of arousal, presumably from non-tactile stimuli caused by the observer, e.g. air currents, sound, light or an increas

  16. Amblyomma variegatum ticks and heartwater on three Caribbean Islands.

    Science.gov (United States)

    Vachiéry, Nathalie; Jeffery, Helena; Pegram, Rupert; Aprelon, Rosalie; Pinarello, Valérie; Kandassamy, Ranleen Lloyd Yane; Raliniaina, Modestine; Molia, Sophie; Savage, Hazel; Alexander, Randolph; Frebling, Mathieu; Martinez, Dominique; Lefrançois, Thierry

    2008-12-01

    Amblyomma variegatum tick infestation, tick infection by Ehrlichia ruminantium (ER), and ER genetic diversity were studied in the Caribbean Islands of Guadeloupe, Marie-Galante, and Antigua between 2003 and 2005. Nested PCR for pCS20 was used to detect ER, while ER strains were characterized by sequencing or by restriction fragment length polymorphism (RFLP) profiles of map-1 PCR products. In 2003 in Guadeloupe, the prevalence of tick-infested herds was 35.6%. In Marie-Galante 79.1% of herds in 2003 and 73.8% in 2005 were infested, while only an average of 2.2% of the herds were infected in Antigua between this same period. In Marie-Galante, 19.1% of ticks were ER positive, and ER-infected ticks were found in 33.3% of the herds. In Antigua only 5.8% of the ticks were ER positive. High ER tick infection rate combined with a very high level of tick infestation highlight the risk of heartwater in Marie-Galante and Guadeloupe more than in Antigua. The three islands still represent a reservoir for tick and heartwater in the Caribbean. Nine different African and Caribbean map-1 ER genotypes were identified. This diversity was observed even in restricted areas, and identical map-1 genotypes were observed on all three islands. This high genetic diversity of ER strains suggests that there was a simultaneous introduction of several strains from African countries into the Caribbean region.

  17. Development of bat flight: morphologic and molecular evolution of bat wing digits.

    Science.gov (United States)

    Sears, Karen E; Behringer, Richard R; Rasweiler, John J; Niswander, Lee A

    2006-04-25

    The earliest fossil bats resemble their modern counterparts in possessing greatly elongated digits to support the wing membrane, which is an anatomical hallmark of powered flight. To quantitatively confirm these similarities, we performed a morphometric analysis of wing bones from fossil and modern bats. We found that the lengths of the third, fourth, and fifth digits (the primary supportive elements of the wing) have remained constant relative to body size over the last 50 million years. This absence of transitional forms in the fossil record led us to look elsewhere to understand bat wing evolution. Investigating embryonic development, we found that the digits in bats (Carollia perspicillata) are initially similar in size to those of mice (Mus musculus) but that, subsequently, bat digits greatly lengthen. The developmental timing of the change in wing digit length points to a change in longitudinal cartilage growth, a process that depends on the relative proliferation and differentiation of chondrocytes. We found that bat forelimb digits exhibit relatively high rates of chondrocyte proliferation and differentiation. We show that bone morphogenetic protein 2 (Bmp2) can stimulate cartilage proliferation and differentiation and increase digit length in the bat embryonic forelimb. Also, we show that Bmp2 expression and Bmp signaling are increased in bat forelimb embryonic digits relative to mouse or bat hind limb digits. Together, our results suggest that an up-regulation of the Bmp pathway is one of the major factors in the developmental elongation of bat forelimb digits, and it is potentially a key mechanism in their evolutionary elongation as well.

  18. Integrated tick and tick-borne disease control trials in crossbred dairy cattle in Malawi

    DEFF Research Database (Denmark)

    Tjørnehøj, Kirsten; Whiteland, A. P.; Mfitilodze, M. W.;

    1996-01-01

    Crossbred dairy heifers on a farm in an East Coast fever (ECF) endemic area in Malawi were immunised against Theileria parva, Anaplasma spp., Babesia bigemina, Babesia bovis and Cowdria ruminantium. They were treated at infrequent intervals with chlorfenvinphos to limit infestation with adult ticks......, without providing complete tick control. In one trial, which tested a threshold dipping regimen, 20 heifers were dipped only once in 6 months to control a flush of Boophilus microplus. Unimmunised controls showed serological evidence of exposure to T. parva and B. bigemina, and one died of ECF......, but there were no incidents of tick-borne disease in the immunised group. In a second trial, which tested a strategic dipping regimen, 107 animals were dipped 9 times over a 6 month period. Despite heavy challenge by B. bovis and moderate challenge by B. bigemina and Anaplasma spp, demonstrated serologically...

  19. Pattern of tick aggregation on mice: larger than expected distribution tail enhances the spread of tick-borne pathogens.

    Directory of Open Access Journals (Sweden)

    Luca Ferreri

    2014-11-01

    Full Text Available The spread of tick-borne pathogens represents an important threat to human and animal health in many parts of Eurasia. Here, we analysed a 9-year time series of Ixodes ricinus ticks feeding on Apodemus flavicollis mice (main reservoir-competent host for tick-borne encephalitis, TBE sampled in Trentino (Northern Italy. The tail of the distribution of the number of ticks per host was fitted by three theoretical distributions: Negative Binomial (NB, Poisson-LogNormal (PoiLN, and Power-Law (PL. The fit with theoretical distributions indicated that the tail of the tick infestation pattern on mice is better described by the PL distribution. Moreover, we found that the tail of the distribution significantly changes with seasonal variations in host abundance. In order to investigate the effect of different tails of tick distribution on the invasion of a non-systemically transmitted pathogen, we simulated the transmission of a TBE-like virus between susceptible and infective ticks using a stochastic model. Model simulations indicated different outcomes of disease spreading when considering different distribution laws of ticks among hosts. Specifically, we found that the epidemic threshold and the prevalence equilibria obtained in epidemiological simulations with PL distribution are a good approximation of those observed in simulations feed by the empirical distribution. Moreover, we also found that the epidemic threshold for disease invasion was lower when considering the seasonal variation of tick aggregation.

  20. Contaminant studies on endangered bats in northeastern Oklahoma

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Three federally listed endangered bat species are known to inhabit Oklahoma. The gray bat (Myotis grisescens) is probably the most abundant, and is presently known...

  1. Isolation of genetically diverse Marburg viruses from Egyptian fruit bats.

    Directory of Open Access Journals (Sweden)

    Jonathan S Towner

    2009-07-01

    Full Text Available In July and September 2007, miners working in Kitaka Cave, Uganda, were diagnosed with Marburg hemorrhagic fever. The likely source of infection in the cave was Egyptian fruit bats (Rousettus aegyptiacus based on detection of Marburg virus RNA in 31/611 (5.1% bats, virus-specific antibody in bat sera, and isolation of genetically diverse virus from bat tissues. The virus isolates were collected nine months apart, demonstrating long-term virus circulation. The bat colony was estimated to be over 100,000 animals using mark and re-capture methods, predicting the presence of over 5,000 virus-infected bats. The genetically diverse virus genome sequences from bats and miners closely matched. These data indicate common Egyptian fruit bats can represent a major natural reservoir and source of Marburg virus with potential for spillover into humans.

  2. Isolation of genetically diverse Marburg viruses from Egyptian fruit bats.

    Science.gov (United States)

    Towner, Jonathan S; Amman, Brian R; Sealy, Tara K; Carroll, Serena A Reeder; Comer, James A; Kemp, Alan; Swanepoel, Robert; Paddock, Christopher D; Balinandi, Stephen; Khristova, Marina L; Formenty, Pierre B H; Albarino, Cesar G; Miller, David M; Reed, Zachary D; Kayiwa, John T; Mills, James N; Cannon, Deborah L; Greer, Patricia W; Byaruhanga, Emmanuel; Farnon, Eileen C; Atimnedi, Patrick; Okware, Samuel; Katongole-Mbidde, Edward; Downing, Robert; Tappero, Jordan W; Zaki, Sherif R; Ksiazek, Thomas G; Nichol, Stuart T; Rollin, Pierre E

    2009-07-01

    In July and September 2007, miners working in Kitaka Cave, Uganda, were diagnosed with Marburg hemorrhagic fever. The likely source of infection in the cave was Egyptian fruit bats (Rousettus aegyptiacus) based on detection of Marburg virus RNA in 31/611 (5.1%) bats, virus-specific antibody in bat sera, and isolation of genetically diverse virus from bat tissues. The virus isolates were collected nine months apart, demonstrating long-term virus circulation. The bat colony was estimated to be over 100,000 animals using mark and re-capture methods, predicting the presence of over 5,000 virus-infected bats. The genetically diverse virus genome sequences from bats and miners closely matched. These data indicate common Egyptian fruit bats can represent a major natural reservoir and source of Marburg virus with potential for spillover into humans.

  3. Report of bat survey Walnut Creek Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Bats are an integral and significant part of the mammalian fauna of Iowa (Bowles 1975, Clark et al. 1987). In particular, the nine species of bats in Iowa are...

  4. Development of vaccines against Ornithodoros soft ticks: An update.

    Science.gov (United States)

    Díaz-Martín, Verónica; Manzano-Román, Raúl; Obolo-Mvoulouga, Prosper; Oleaga, Ana; Pérez-Sánchez, Ricardo

    2015-04-01

    Ticks are parasites of great medical and veterinary importance since they are vectors of numerous pathogens that affect humans, livestock and pets. Among the argasids, several species of the genus Ornithodoros transmit serious diseases such as tick-borne human relapsing fever (TBRF) and African Swine Fever (ASF). In particular, Ornithodoros erraticus is the main vector of these two diseases in the Mediterranean while O. moubata is the main vector in Africa. The presence of these Ornithodoros ticks in domestic and peridomestic environments may greatly hinder the eradication of TBRF and ASF from endemic areas. In addition, there is a constant threat of reintroduction and spreading of ASF into countries from where it has been eradicated (Spain and Portugal) or where it was never present (the Caucasus, Russia and Eastern Europe). In these countries, the presence of Ornithodoros vectors could have a tremendous impact on ASF transmission and long-term maintenance. Therefore, elimination of these ticks from at least synanthropic environments would contribute heavily to the prevention and control of the diseases they transmit. Tick control is a difficult task and although several methods for such control have been used, none of them has been fully effective against all ticks and the problems they cause. Nevertheless, immunological control using anti-tick vaccines offers an attractive alternative to the traditional use of acaricides. The aim of the present paper is to offer a brief overview of the current status in control measure development for Ornithodoros soft ticks, paying special attention to the development of vaccines against O. erraticus and O. moubata. Thus, our contribution includes an analysis of the chief attributes that the ideal antigens for an anti-tick vaccine should have, an exhaustive compilation and analysis of the scant anti-soft tick vaccine trials carried out to date using both concealed and salivary antigens and, finally, a brief description of the

  5. PCR detection of Babesia ovata from questing ticks in Japan.

    Science.gov (United States)

    Sivakumar, Thillaiampalam; Tattiyapong, Muncharee; Okubo, Kazuhiro; Suganuma, Keisuke; Hayashida, Kyoko; Igarashi, Ikuo; Zakimi, Satoshi; Matsumoto, Kotaro; Inokuma, Hisashi; Yokoyama, Naoaki

    2014-04-01

    Babesia ovata is a tick-transmitted hemoprotozoan parasite of cattle. In the present study, we analyzed tick DNA samples (n=1459) prepared from questing ticks collected from various cattle pastures in Hokkaido (Shibecha, Taiki, Otofuke, Memuro, and Shin-Hidaka districts) and Okinawa (Yonaguni Island) prefectures of Japan for B. ovata. When all the tick DNA samples were screened by a previously described B. ovata-specific apical membrane antigen-1 (AMA-1) gene-based polymerase chain reaction (PCR) assay, none of the DNA samples was positive. Therefore, we developed a PCR assay based on the protozoan beta-tubulin (β-tubulin) gene to detect B. ovata from ticks in Japan. In the specificity test, the PCR assay amplified the expected 444-bp target gene fragment from B. ovata DNA. No PCR products were amplified from DNA samples from other blood pathogens, bovine blood, or ticks. In addition, the PCR assay detected 100 fg of B. ovata-genomic DNA extracted from an in vitro culture of the parasites. Subsequently, when all the tick DNA samples were screened by this new PCR assay, 18 were positive for B. ovata. Positive samples were found only in the Yonaguni and Memuro areas. In Okinawa, where all the ticks were identified as Haemaphysalis longicornis, 9.7% of the samples were PCR-positive, while a single tick (Ixodes ovatus) from Memuro was infected with B. ovata. When the nucleotide sequences of the PCR amplicons were phylogenetically analyzed, they formed a separate clade containing a previously described β-tubulin gene sequence from B. ovata (Miyake strain), confirming that the PCR assay had detected only B. ovata from the tick DNA samples. This is the first report that describes the PCR detection of B. ovata in ticks. The findings warrant transmission experiments to evaluate I. ovatus as a potential vector of B. ovata.

  6. Immunization of Cattle with Tick Salivary Gland Extracts

    Directory of Open Access Journals (Sweden)

    Ali Nikpay

    2016-01-01

    Full Text Available Background: Rhipicephalus (Boophilus annulatus tick is one of the most important ectoparasite of cattle. Re­cently, several laboratories in the world have been concentrated on immunizing cattle against tick using various types of tissue extracts of ticks. The aim of this study was to evaluate the effect of immunization of cattle with tick salivary gland extract on biological parameters of ticks and humoral immune responses of cattle.Methods: Fourteen more dominant protein bands identified as immunogenic by Western-blot analysis were eluted from polyacrylamide gel. Test and control groups were injected three times with eluted proteins and sterile PBS (pH= 7.2 respectively with equivalent amount of adjuvant. After four weeks a tick challenge was performed. Fi­nally, biological parameters of collected engorged female ticks were recorded and humoral immune responses to immunization measured by ELISA.Results: The results indicated immunization of cattle resulted in reduction in mean tick counts, attachment, en­gorgement weights, feeding index, egg mass weight, hatchability and fertility index (respectively 63.1%, 62.6%, 30.2%, 36.4%, 40%, 78.7% and 13.3% and increased duration of feeding, pre-oviposition and incubation period of eggs (respectively 8.6%, 45 and 31.34%. All changes were statistically significant (P< 0.05. Results showed an increase in antibody production of test group from the first week after immunization. The antibody level was boosted following tick infestation.Conclusion: This investigation indicates that immunization of cattle with these antigens could induce a protective immune response against Rh. (B. annulatus tick that would be expected to provide a safe non-chemical means of tick control.

  7. Antioxidant Defenses in the Brains of Bats during Hibernation.

    Science.gov (United States)

    Yin, Qiuyuan; Ge, Hanxiao; Liao, Chen-Chong; Liu, Di; Zhang, Shuyi; Pan, Yi-Hsuan

    2016-01-01

    Hibernation is a strategy used by some mammals to survive a cold winter. Small hibernating mammals, such as squirrels and hamsters, use species- and tissue-specific antioxidant defenses to cope with oxidative insults during hibernation. Little is known about antioxidant responses and their regulatory mechanisms in hibernating bats. We found that the total level of reactive oxygen species (ROS) and reactive nitrogen species (RNS) in the brain of each of the two distantly related hibernating bats M. ricketti and R. ferrumequinum at arousal was lower than that at torpid or active state. We also found that the levels of malondialdehyde (product of lipid peroxidation) of the two hibernating species of bats were significantly lower than those of non-hibernating bats R. leschenaultia and C. sphinx. This observation suggests that bats maintain a basal level of ROS/RNS that does no harm to the brain during hibernation. Results of Western blotting showed that hibernating bats expressed higher amounts of antioxidant proteins than non-hibernating bats and that M. ricketti bats upregulated the expression of some enzymes to overcome oxidative stresses, such as superoxide dismutase, glutathione reductase, and catalase. In contrast, R. ferrumequinum bats maintained a relatively high level of superoxide dismutase 2, glutathione reductase, and thioredoxin-2 throughout the three different states of hibernation cycles. The levels of glutathione (GSH) were higher in M. ricketti bats than in R. ferrumequinum bats and were significantly elevated in R. ferrumequinum bats after torpor. These data suggest that M. ricketti bats use mainly antioxidant enzymes and R. ferrumequinum bats rely on both enzymes and low molecular weight antioxidants (e.g., glutathione) to avoid oxidative stresses during arousal. Furthermore, Nrf2 and FOXOs play major roles in the regulation of antioxidant defenses in the brains of bats during hibernation. Our study revealed strategies used by bats against oxidative

  8. Sexually selected infanticide in a polygynous bat.

    Directory of Open Access Journals (Sweden)

    Mirjam Knörnschild

    Full Text Available BACKGROUND: Adult individuals of many species kill unrelated conspecific infants for several adaptive reasons ranging from predation or resource competition to the prevention of misdirected parental care. Moreover, infanticide can increase the reproductive success of the aggressor by killing the offspring of competitors and thereafter mating with the victimized females. This sexually selected infanticide predominantly occurs in polygynous species, with convincing evidence for primates, carnivores, equids, and rodents. Evidence for bats was predicted but lacking. METHODOLOGY/PRINCIPAL FINDINGS: Here we report the first case, to our knowledge, of sexually selected infanticide in a bat, the polygynous white-throated round-eared bat, Lophostoma silvicolum. Behavioral studies in a free-living population revealed that an adult male repeatedly attacked and injured the pups of two females belonging to his harem, ultimately causing the death of one pup. The infanticidal male subsequently mated with the mother of the victimized pup and this copulation occurred earlier than any other in his harem. CONCLUSIONS/SIGNIFICANCE: Our findings indicate that sexually selected infanticide is more widespread than previously thought, adding bats as a new taxon performing this strategy. Future work on other bats, especially polygynous species in the tropics, has great potential to investigate the selective pressures influencing the evolution of sexually selected infanticide and to study how infanticide impacts reproductive strategies and social structures of different species.

  9. Monitoring bat activity at the Dutch EEZ in 2014

    NARCIS (Netherlands)

    Lagerveld, S.; Jonge Poerink, B.; Vries, de P.

    2015-01-01

    IMARES conducted studies in 2012 and 2013 to monitor offshore bat activity with passive acoustic ultrasonic recorders. In the follow-up project reported here, more data on the offshore occurrence of bats was collected in 2014. Using the same methodology as in 2012 and 2013, bat activity was monitore

  10. Rabies in the insectivorous bat Tadarida brasiliensis in Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Uieda Wilson

    1998-01-01

    Full Text Available This is the first recorded case of rabies in the insectivorous bat Tadarida brasiliensis in the State of S. Paulo, Southeastern Brazil. The infected bat was found in the afternoon while hanging on the internal wall of an urban building. This observation reinforces the notion as to the caution one must exercise regarding bats found in unusual situations.

  11. Multiple mortality events in bats: a global review

    Science.gov (United States)

    O'Shea, Thomas J.; Cryan, Paul; Hayman, David TH; Plowright, Raina K.; Streicker, Daniel G.

    2016-01-01

    Despite conservation concerns for many species of bats, factors causing mortality in bats have not been reviewed since 1970. Here, we review and qualitatively describe trends in the occurrence and apparent causes of multiple mortality events (MMEs) in bats around the world.

  12. Acute pasteurellosis in wild big brown bats (Eptesicus fuscus)

    Science.gov (United States)

    Blehert, David S.; Maluping, Ramón P.; Green, David E.; Berlowski-Zier, Brenda M.; Ballmann, Anne E.; Langenberg, Julia

    2014-01-01

    We report acute fatal pasteurellosis in wild big brown bats (Eptesicus fuscus) in Wisconsin, USA. Mortality of approximately 100 bats was documented over 4 wk, with no evidence for predatory injuries. Pasteurella multocida serotype 1 was isolated from multiple internal organs from four of five bats examined postmortem.

  13. Food resource partitioning inb syntopic nectarivorous bats on Puerto Rico

    Science.gov (United States)

    We analyzed stable isotopes (δ13C, δ15N) to estimate the importance of plants and insects to the diet of two nectar-feeding bats on Puerto Rico, the brown flower bat (Erophylla bombifrons) and the Greater Antillean long-tongued bat (Monophyllus redmani). Concentrations of stable ...

  14. Isolation of a European bat lyssavirus type 2 from a Daubenton's bat in the United Kingdom.

    Science.gov (United States)

    Johnson, N; Selden, D; Parsons, G; Healy, D; Brookes, S M; McElhinney, L M; Hutson, A M; Fooks, A R

    2003-03-29

    European bat lyssavirus type 2 (EBLV-2) has been isolated once previously from a bat in the UK in June 1996. In September 2002, a Daubenton's bat (Myotis daubentonii) found in Lancashire developed abnormal behaviour, including unprovoked aggression, while it was in captivity. Brain samples from the bat were tested for virus of the Lyssavirus genus, which includes EBLV-2 (genotype 6), and classical rabies virus (genotype 1). A positive fluorescent antibody test confirmed that it was infected with a lyssavirus, and PCR and genomic sequencing identified the virus as an EBLV-2a. Phylogenetic comparisons with all the published sequences from genotype 6 showed that it was closely related to the previous isolate of EBLV-2 in the UK and suggested links to isolates from bats in The Netherlands. The isolation of EBLV-2 from a bat found on the west coast of England provides evidence that this virus may be present within the UK Daubenton's bat population at a low prevalence level.

  15. Surveillance of tick-borne encephalitis virus in wild birds and ticks in Tomsk city and its suburbs (Western Siberia).

    Science.gov (United States)

    Mikryukova, Tamara P; Moskvitina, Nina S; Kononova, Yulia V; Korobitsyn, Igor G; Kartashov, Mikhail Y; Tyuten Kov, Oleg Y; Protopopova, Elena V; Romanenko, Vladimir N; Chausov, Evgeny V; Gashkov, Sergey I; Konovalova, Svetlana N; Moskvitin, Sergey S; Tupota, Natalya L; Sementsova, Alexandra O; Ternovoi, Vladimir A; Loktev, Valery B

    2014-03-01

    To study the role of wild birds in the transmission of tick borne encephalitis virus (TBEV), we investigated randomly captured wild birds bearing ixodid ticks in a very highly endemic TBE region located in Tomsk city and its suburbs in the south of Western Siberia, Russia. The 779 wild birds representing 60 species were captured carrying a total of 841 ticks, Ixodes pavlovskyi Pom., 1946 (n=531), Ixodes persulcatus P. Sch., 1930 (n=244), and Ixodes plumbeus Leach. 1815 (n=66). The highest average number of ticks per bird in a particular species was found for the fieldfare (Turdus pilaris Linnaeus, 1758) (5.60 ticks/bird) and the tree pipit (Anthus trivialis Linnaeus, 1758) (13.25 ticks/bird). Samples from wild birds and ticks collected in highly endemic periods from 2006 to 2011 were tested for the TBEV markers using monoclonal modified enzyme immunoassay (EIA) and RT-PCR. TBEV RNA and antigen were found in 9.7% and 22.8% samples collected from wild birds, respectively. TBEV markers were also detected in 14.1% I. persulcatus ticks, 5.2% I. pavlovskyi, and 4.2% I. plumbeus ticks collected from wild birds. Two TBEV strains were also isolated on PKE (pig kidney embryo) cells from fieldfare and Blyth's reed warbler (Acrocephalus dumetorum Blyth, 1849). Sequencing of 5'-NCR of TBEV revealed that all TBEV isolates belong to Far Eastern (dominate) and Siberian genotypes. Several phylogenetic subgroups included TBEV sequences novel for the Tomsk region. Our data suggest that wild birds are potential disseminators of TBEV, TBEV-infected ixodid ticks, and possibly other tick-borne infections.

  16. Importation of exotic ticks and tick-borne spotted fever group rickettsiae into the United States by migrating songbirds.

    Science.gov (United States)

    Mukherjee, Nabanita; Beati, Lorenza; Sellers, Michael; Burton, Laquita; Adamson, Steven; Robbins, Richard G; Moore, Frank; Karim, Shahid

    2014-03-01

    Birds are capable of carrying ticks and, consequently, tick-transmitted microorganisms over long distances and across geographical barriers such as oceans and deserts. Ticks are hosts for several species of spotted fever group rickettsiae (SFGR), which can be transmitted to vertebrates during blood meals. In this study, the prevalence of this group of rickettsiae was examined in ticks infesting migratory songbirds by using polymerase chain reaction (PCR). During the 2009 and 2010 spring migration season, 2064 northward-migrating passerine songbirds were examined for ticks at Johnson Bayou, Louisiana. A total of 91 ticks was removed from 35 individual songbirds for tick species identification and spotted fever group rickettsia detection. Ticks were identified as Haemaphysalis juxtakochi (n=38, 42%), Amblyomma longirostre (n=22, 24%), Amblyomma nodosum (n=17, 19%), Amblyomma calcaratum (n=11, 12%), Amblyomma maculatum (n=2, 2%), and Haemaphysalis leporispalustris (n=1, 1%) by comparing their 12S rDNA gene sequence to homologous sequences in GenBank. Most of the identified ticks were exotic species originating outside of the United States. The phylogenetic analysis of the 71 ompA gene sequences of the rickettsial strains detected in the ticks revealed the occurrence of 6 distinct rickettsial genotypes. Two genotypes (corresponding to a total of 28 samples) were included in the Candidatus Rickettsia amblyommii clade (less than 1% divergence), 2 of them (corresponding to a total of 14 samples) clustered with Rickettsia sp. "Argentina" with less than 0.2% sequence divergence, and 2 of them (corresponding to a total of 27 samples), although closely related to the R. parkeri-R. africae lineage (2.50-3.41% divergence), exhibited sufficient genetic divergence from its members to possibly constitute a new rickettsial genotype. Overall, there does not seem to be a specific relationship between exotic tick species, the rickettsiae they harbor, or the reservoir competence of the

  17. Ticks Carrying Lyme Disease Confirmed in Eastern National Parks

    Science.gov (United States)

    ... html Ticks Carrying Lyme Disease Confirmed in Eastern National Parks U.S. National Park Service and CDC advise using insect repellents on ... Planning a hiking trip in an eastern U.S. national park? Better pack tick repellent -- a new study found ...

  18. Anaplasma marginale and Theileria annulata in questing ticks from Portugal.

    Science.gov (United States)

    Antunes, S; Ferrolho, J; Domingues, N; Santos, A S; Santos-Silva, M M; Domingos, A

    2016-09-01

    Ticks are ubiquitous arthropods and vectors of several pathogenic agents in animals and humans. Monitoring questing ticks is of great importance to ascertain the occurrence of pathogens and the potential vector species, offering an insight into the risk of disease transmission in a given area. In this study 428 host-seeking ticks, belonging to nine species of Ixodidae and collected from 17 of the 23 Portuguese mainland subregions, were screened for several tick-borne agents with veterinary relevance: Anaplasma marginale, Anaplasma ovis, Anaplasma centrale, Babesia spp., Coxiella burnetii and Theileria spp. Prevalence was assessed by PCR and amplified amplicons sequenced for validation of results. Twenty ticks, in a total of 428, were found positive: one Ixodes ventalloi for Theileria annulata and four Dermacentor marginatus, one Haemaphysalis punctata, five Ixodes ricinus, five I. ventalloi, and four Rhipicephalus sanguineus sensu lato for A. marginale. According to the reviewed literature, this is the first report of A. marginale and T. annulata detection in I. ventalloi. Furthermore, the amplification of A. marginale DNA in several tick species suggests a broad range for this agent in Portugal that might include other uncommon species as R. sanguineus s.l. This work provides new data towards a better understanding of tick-pathogen associations and also contributes to the surveillance of tick-borne agents in geographic areas with limited information.

  19. Wild carnivores (Mammalia) as hosts for ticks (Ixodida) in Panama

    NARCIS (Netherlands)

    Bermudez, S.E.; Esser, H.J.; Miranda, R.; Moreno, R.S.

    2015-01-01

    This study reports ticks collected from wild carnivores from different habitat types in Panama. We examined 94 individual wild carnivores and we found 87 parasitized by ticks: seven coyotes, six crab-eating foxes, 54 coatis, four raccoons, five ocelots, two pumas, two gray foxes, two skunks, and one

  20. Beware of Ticks (A Minute of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    2015-05-14

    Lyme disease is transmitted by the bite of blacklegged ticks and affects up to 300,000 Americans each year. This podcast discusses ways to prevent tick bites.  Created: 5/14/2015 by MMWR.   Date Released: 5/14/2015.

  1. 16 CFR 1632.6 - Ticking substitution procedure.

    Science.gov (United States)

    2010-01-01

    ... mattress pad prototype without conducting a prototype test as specified in § 1632.4 or § 1632.5. The procedure includes a ticking classification test that may be used by a ticking, mattress or mattress pad... specific construction, color, or combination of colors or color pattern, weave pattern design,...

  2. Evidence for the 'good genes' model: association of MHC class II DRB alleles with ectoparasitism and reproductive state in the neotropical lesser bulldog bat, Noctilio albiventris.

    Directory of Open Access Journals (Sweden)

    Julia Schad

    Full Text Available The adaptive immune system has a major impact on parasite resistance and life history strategies. Immunological defence is costly both in terms of immediate activation and long-term maintenance. The 'good genes' model predicts that males with genotypes that promote a good disease resistance have the ability to allocate more resources to reproductive effort which favours the transmission of good alleles into future generations. Our study shows a correlation between immune gene constitution (Major Histocompatibility Complex, MHC class II DRB, ectoparasite loads (ticks and bat flies and the reproductive state in a neotropical bat, Noctilio albiventris. Infestation rates with ectoparasites were linked to specific Noal-DRB alleles, differed among roosts, increased with body size and co-varied with reproductive state particularly in males. Non-reproductive adult males were more infested with ectoparasites than reproductively active males, and they had more often an allele (Noal-DRB*02 associated with a higher tick infestation than reproductively active males or subadults. We conclude that the individual immune gene constitution affects ectoparasite susceptibility, and contributes to fitness relevant trade-offs in male N. albiventris as suggested by the 'good genes' model.

  3. Evidence for the 'good genes' model: association of MHC class II DRB alleles with ectoparasitism and reproductive state in the neotropical lesser bulldog bat, Noctilio albiventris.

    Science.gov (United States)

    Schad, Julia; Dechmann, Dina K N; Voigt, Christian C; Sommer, Simone

    2012-01-01

    The adaptive immune system has a major impact on parasite resistance and life history strategies. Immunological defence is costly both in terms of immediate activation and long-term maintenance. The 'good genes' model predicts that males with genotypes that promote a good disease resistance have the ability to allocate more resources to reproductive effort which favours the transmission of good alleles into future generations. Our study shows a correlation between immune gene constitution (Major Histocompatibility Complex, MHC class II DRB), ectoparasite loads (ticks and bat flies) and the reproductive state in a neotropical bat, Noctilio albiventris. Infestation rates with ectoparasites were linked to specific Noal-DRB alleles, differed among roosts, increased with body size and co-varied with reproductive state particularly in males. Non-reproductive adult males were more infested with ectoparasites than reproductively active males, and they had more often an allele (Noal-DRB*02) associated with a higher tick infestation than reproductively active males or subadults. We conclude that the individual immune gene constitution affects ectoparasite susceptibility, and contributes to fitness relevant trade-offs in male N. albiventris as suggested by the 'good genes' model.

  4. Deciphering the bat virome catalog to better understand the ecological diversity of bat viruses and the bat origin of emerging infectious diseases.

    Science.gov (United States)

    Wu, Zhiqiang; Yang, Li; Ren, Xianwen; He, Guimei; Zhang, Junpeng; Yang, Jian; Qian, Zhaohui; Dong, Jie; Sun, Lilian; Zhu, Yafang; Du, Jiang; Yang, Fan; Zhang, Shuyi; Jin, Qi

    2016-03-01

    Studies have demonstrated that ~60%-80% of emerging infectious diseases (EIDs) in humans originated from wild life. Bats are natural reservoirs of a large variety of viruses, including many important zoonotic viruses that cause severe diseases in humans and domestic animals. However, the understanding of the viral population and the ecological diversity residing in bat populations is unclear, which complicates the determination of the origins of certain EIDs. Here, using bats as a typical wildlife reservoir model, virome analysis was conducted based on pharyngeal and anal swab samples of 4440 bat individuals of 40 major bat species throughout China. The purpose of this study was to survey the ecological and biological diversities of viruses residing in these bat species, to investigate the presence of potential bat-borne zoonotic viruses and to evaluate the impacts of these viruses on public health. The data obtained in this study revealed an overview of the viral community present in these bat samples. Many novel bat viruses were reported for the first time and some bat viruses closely related to known human or animal pathogens were identified. This genetic evidence provides new clues in the search for the origin or evolution pattern of certain viruses, such as coronaviruses and noroviruses. These data offer meaningful ecological information for predicting and tracing wildlife-originated EIDs.

  5. No evidence of African swine fever virus replication in hard ticks

    NARCIS (Netherlands)

    de Carvalho Ferreira, Helena C; Tudela Zúquete, Sara; Wijnveld, Michiel; Weesendorp, Eefke; Jongejan, Frans; Stegeman, Arjan; Loeffen, Willie L A

    2014-01-01

    African swine fever (ASF) is caused by African swine fever virus (ASFV), a tick-borne DNA virus. Soft ticks of the genus Ornithodoros are the only biological vectors of ASFV recognized so far. Although other hard ticks have been tested for vector competence, two commonly found tick species in Europe

  6. 9 CFR 72.6 - Interstate movement of cattle from quarantined areas not eradicating ticks.

    Science.gov (United States)

    2010-01-01

    ... quarantined areas not eradicating ticks. 72.6 Section 72.6 Animals and Animal Products ANIMAL AND PLANT HEALTH... areas not eradicating ticks. Cattle in quarantined areas where tick eradication is not being conducted 3... inspector just prior to final dipping, found to be apparently free of ticks, and be certified as such...

  7. Rickettsia spp. in seabird ticks from western Indian Ocean islands, 2011-2012.

    Science.gov (United States)

    Dietrich, Muriel; Lebarbenchon, Camille; Jaeger, Audrey; Le Rouzic, Céline; Bastien, Matthieu; Lagadec, Erwan; McCoy, Karen D; Pascalis, Hervé; Le Corre, Matthieu; Dellagi, Koussay; Tortosa, Pablo

    2014-05-01

    We found a diversity of Rickettsia spp. in seabird ticks from 6 tropical islands. The bacteria showed strong host specificity and sequence similarity with strains in other regions. Seabird ticks may be key reservoirs for pathogenic Rickettsia spp., and bird hosts may have a role in dispersing ticks and tick-associated infectious agents over large distances.

  8. 9 CFR 72.1 - Ticks [Boophilus annulatus (Margaropus annulatus), Boophilus microplus, or Rhipicephalus evertsi...

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Ticks ; interstate movement of... POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.1 Ticks ; interstate movement of infested or exposed animals prohibited. No animals infested with ticks or exposed to tick infestation...

  9. Identification and Characterization of Ixodes scapularis Antigens That Elicit Tick Immunity Using Yeast Surface Display

    NARCIS (Netherlands)

    T.J. Schuijt; S. Narasimhan; S. Daffre; K. Deponte; J.W.R. Hovius; C. van 't Veer; T. van der Poll; K. Bakhtiari; J.C.M. Meijers; E.T. Boder; A.P. van Dam; E. Fikrig

    2011-01-01

    Repeated exposure of rabbits and other animals to ticks results in acquired resistance or immunity to subsequent tick bites and is partially elicited by antibodies directed against tick antigens. In this study we demonstrate the utility of a yeast surface display approach to identify tick salivary a

  10. Identification of rickettsial pathogens in ixodid ticks in northern Senegal.

    Science.gov (United States)

    Sambou, Masse; Faye, Ngor; Bassène, Hubert; Diatta, Georges; Raoult, Didier; Mediannikov, Oleg

    2014-09-01

    The spotted fevers, caused by the Rickettsia bacteria, are a group of emerging diseases that are responsible for significant human morbidity. In Africa, the distribution of different species of Rickettsia in their tick vectors is poorly studied. We have collected 1169 hard ticks from 5 different species in the northern Senegal, close to the Saharan border. In a far northern collection site, corresponding to the Rickettsia africae distribution area, we collected three Amblyomma variegatum ticks infected by R. africae. Rickettsia africae was also identified in a Hyalomma marginatum rufipes tick, which may represent the secondary host for the pathogen. Rickettsia aeschlimannii was identified in H. m. rufipes, Rhipicephalus evertsi evertsi, and Hyalomma impeltatum ticks.

  11. Trials to control South American ticks with entomopathogenic fungi.

    Science.gov (United States)

    Bittencourt, V R

    2000-01-01

    Ticks are parasites of great importance to man, domestic, and wild animals. In spite of the progress of the science, thus far, ticks are controlled mainly by chemical acaricides and when this technique is used in an indiscriminate way it can lead to ambiental pollution and development of tick resistance to acarcides. The studies developed in the Universidade Federal Rural do Rio de Janeiro demonstrate that some isolates of the fungi Metarhizium anisopliae and Beauveria bassiana are pathogens for ticks and their action effects the mortality of ticks and reduces the populational levels in subsequent generations. In future, research needs to address the search of new pathogens; the association of biological with chemical products seeking an synergistic action; the search of formulations that propitiate increased stability, and careful studies on the safety of biological products for use in animals.

  12. Genetic identification of rickettsiae isolated from ticks in Japan.

    Science.gov (United States)

    Fournier, Pierre-Edouard; Fujita, Hiromi; Takada, Nobuhiro; Raoult, Didier

    2002-06-01

    Following the description in Japan of Japanese spotted fever, caused by Rickettsia japonica, a search for the vector of this disease led to the isolation of several rickettsiae from various tick species. Sixty-three rickettsial isolates were obtained from six different tick species, and six type strains were described by PCR and monoclonal antibody testing. We identified these six strains by amplification and sequencing of the genes encoding 16S rRNA and citrate synthase. We confirmed that the isolates from Dermacentor taiwanensis and Haemaphysalis flava ticks were R. japonica isolates. In Ixodes ovatus, Ixodes persulcatus, and Ixodes monospinosus, we identified a Rickettsia identical or closely related to Rickettsia helvetica, a species that is pathogenic for humans and that to date has only been found in Europe. Finally, we identified a new genotype of unknown pathogenicity, genotype AT, that was isolated from Amblyomma testudinarium ticks and that is closely related to a Slovakian genotype obtained from Ixodes ricinus ticks.

  13. Current Status and habitat associations of the endangered Indiana bat and three other bat species of special concern on the Cache River National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Interim NRPC report Indiana bat for Rafinesque's big-eared bat Southeastern myotis, Northern long-eared bat to determine status, habitat use & preference....

  14. Study on ticks and tick-borne zoonoses in public parks in Italy.

    Science.gov (United States)

    Corrain, R; Drigo, M; Fenati, M; Menandro, M L; Mondin, A; Pasotto, D; Martini, M

    2012-11-01

    A survey on tick density and on tick-borne zoonoses was carried out in four public parks in the outskirts of Imola (northern Italy) from June to October 2006. All stages of Ixodes ricinus and only larvae of Riphicephalus sanguineus were recovered by dragging, performed on 100-m transects. Almost all ticks (99%) were harvested in one park. I. ricinus density (nymphs/100 m(2) ) ranged from 0 in park L to 6.3 in park F. Nymphs and adults of I. ricinus were subjected to PCR for Anaplasma phagocytophilum, Bartonella spp., Borrelia burgdorferi s. l. and Rickettsia spp. The observed prevalences were 38.3% for Bartonella henselae, 5.2% for Bartonella clarridgeiae, 10.4% for B. burgdorferi s. l., 2.6% for Rickettsia helvetica and 13% for Rickettsia monacensis, respectively. No DNA of A. phagocytophilum was found. Acarological risks (AR) were calculated as probabilities of collecting at least one infected nymph per transect. The AR values calculated for the various zoonotic agents were 11.4% for R. helvetica, 27.7% for B. clarridgeiae, 49.7% for B. burgdorferi s. l., 57.2% for R. monacensis and 90.4% for B. henselae, respectively. In this study, B. clarridgeiae was for the first time identified in I. ricinus ticks.

  15. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris

    Science.gov (United States)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  16. Bats Use Geomagnetic Field: Behavior and Mechanism

    Science.gov (United States)

    Pan, Y.; Tian, L.; Zhang, B.; Zhu, R.

    2015-12-01

    It has been known that numerous animals can use the Earth's magnetic field for spatial orientation and long-distance navigation, nevertheless, how animals can respond to the magnetic field remain mostly ambiguous. The intensities of the global geomagnetic field varies between 23 and 66 μT, and the geomagnetic field intensity could drop to 10% during geomagnetic polarity reversals or geomagnetic excursions. Such dramatic changes of the geomagnetic field may pose a significant challenge for the evolution of magnetic compass in animals. For examples, it is vital whether the magnetic compass can still work in such very weak magnetic fields. Our previous experiment has demonstrated that a migratory bat (Nyctalus plancyi) uses a polarity compass for orientation during roosting when exposed to an artificial magnetic field (100 μT). Recently, we experimentally tested whether the N. plancyi can sense very weak magnetic fields that were even lower than those of the present-day geomagnetic field. Results showed: 1) the bats can sense the magnetic north in a field strength of present-day local geomagnetic field (51μT); 2) As the field intensity decreased to only 1/5th of the natural intensity (10 μT), the bats still responded by positioning themselves at the magnetic north. Notably, as the field polarity was artificially reversed, the bats still preferred the new magnetic north, even at the lowest field strength tested (10 μT). Hence, N. plancyi is able to detect the direction of a magnetic field with intensity range from twice to 1/5th of the present-day field strength. This allows them to orient themselves across the entire range of present-day global geomagnetic field strengths and sense very weak magnetic fields. We propose that this high sensitivity might have evolved in bats as the geomagnetic field strength varied and the polarity reversed tens of times over the past fifty million years since the origin of bats. The physiological mechanisms underlying

  17. Discovery of a Novel Bat Gammaherpesvirus

    OpenAIRE

    2016-01-01

    ABSTRACT Zoonosis is the leading cause of emerging infectious diseases. In a recent article, R. S. Shabman et al. (mSphere 1[1]:e00070-15, 2016, http://dx.doi.org/10.1128/mSphere.00070-15) report the identification of a novel gammaherpesvirus in a cell line derived from the microbat Myotis velifer incautus. This is the first report on a replicating, infectious gammaherpesvirus from bats. The new virus is named bat gammaherpesvirus 8 (BGHV8), also known as Myotis gammaherpesvirus 8, and is abl...

  18. Bat Algorithm for Multi-objective Optimisation

    CERN Document Server

    Yang, Xin-She

    2012-01-01

    Engineering optimization is typically multiobjective and multidisciplinary with complex constraints, and the solution of such complex problems requires efficient optimization algorithms. Recently, Xin-She Yang proposed a bat-inspired algorithm for solving nonlinear, global optimisation problems. In this paper, we extend this algorithm to solve multiobjective optimisation problems. The proposed multiobjective bat algorithm (MOBA) is first validated against a subset of test functions, and then applied to solve multiobjective design problems such as welded beam design. Simulation results suggest that the proposed algorithm works efficiently.

  19. Distribution of borreliae among ticks collected from eastern states.

    Science.gov (United States)

    Taft, Sarah C; Miller, Melissa K; Wright, Stephen M

    2005-01-01

    Lyme disease is the most commonly reported vector-borne disease in the United States and is transmitted by Borrelia burgdorferi-infected Ixodes species. The disease is typically characterized by an erythema migrans (EM) rash at the site of tick feeding. EM rashes have also been associated with feeding by Amblyomma americanum ticks despite evidence suggesting that they are incompetent vectors for Lyme disease. In 1996, a Borrelia organism only recently cultivated in the laboratory was described in A. americanum ticks and designated B. lonestari. This Borrelia is believed to be the etiologic agent of a novel Lyme-like disease, southern tick associated rash illness (STARI). This study examined ticks collected from eight eastern states to evaluate the epidemiology of B. lonestari, B. burgdorferi, and their tick hosts. Three hundred individual or small pool samples were evaluated from tick genera that included Amblyomma, Ixodes, and Dermacentor. DNA was extracted following tick homogenization and the polymerase chain reaction (PCR) was performed using primers derived from the flagellin gene that amplify sequences from both B. burgdorferi and B. lonestari. Species specific digoxigenin labeled probes were designed and used to differentiate between B. burgdorferi and B. lonestari. Borrelia DNA was detected in approximately 10% of the A. americanum and I. scapularis tick samples, but none was present in any of the Dermacentor samples tested. Positive samples were detected in ticks collected from Kentucky, Maryland, Massachusetts, New Jersey, New York, and Virginia. This is the first known report of B. lonestari from Massachusetts and New York and the first detection in I. scapularis. This suggests that B. lonestari and its putative association with STARI may be more widespread than previously thought.

  20. Identification of 24h Ixodes scapularis immunogenic tick saliva proteins.

    Science.gov (United States)

    Lewis, Lauren A; Radulović, Željko M; Kim, Tae K; Porter, Lindsay M; Mulenga, Albert

    2015-04-01

    Ixodes scapularis is arguably the most medically important tick species in the United States. This tick transmits 5 of the 14 human tick-borne disease (TBD) agents in the USA: Borrelia burgdorferi, Anaplasma phagocytophilum, B. miyamotoi, Babesia microti, and Powassan virus disease. Except for the Powassan virus disease, I. scapularis-vectored TBD agents require more than 24h post attachment to be transmitted. This study describes identification of 24h immunogenic I. scapularis tick saliva proteins, which could provide opportunities to develop strategies to stop tick feeding before transmission of the majority of pathogens. A 24h fed female I. scapularis phage display cDNA expression library was biopanned using rabbit antibodies to 24h fed I. scapularis female tick saliva proteins, subjected to next generation sequencing, de novo assembly, and bioinformatic analyses. A total of 182 contigs were assembled, of which ∼19% (35/182) are novel and did not show identity to any known proteins in GenBank. The remaining ∼81% (147/182) of contigs were provisionally identified based on matches in GenBank including ∼18% (27/147) that matched protein sequences previously annotated as hypothetical and putative tick saliva proteins. Others include proteases and protease inhibitors (∼3%, 5/147), transporters and/or ligand binding proteins (∼6%, 9/147), immunogenic tick saliva housekeeping enzyme-like (17%, 25/147), ribosomal protein-like (∼31%, 46/147), and those classified as miscellaneous (∼24%, 35/147). Notable among the miscellaneous class include antimicrobial peptides (microplusin and ricinusin), myosin-like proteins that have been previously found in tick saliva, and heat shock tick saliva protein. Data in this study provides the foundation for in-depth analysis of I. scapularis feeding during the first 24h, before the majority of TBD agents can be transmitted.

  1. Bat Predation by Cercopithecus Monkeys: Implications for Zoonotic Disease Transmission.

    Science.gov (United States)

    Tapanes, Elizabeth; Detwiler, Kate M; Cords, Marina

    2016-06-01

    The relationship between bats and primates, which may contribute to zoonotic disease transmission, is poorly documented. We provide the first behavioral accounts of predation on bats by Cercopithecus monkeys, both of which are known to harbor zoonotic disease. We witnessed 13 bat predation events over 6.5 years in two forests in Kenya and Tanzania. Monkeys sometimes had prolonged contact with the bat carcass, consuming it entirely. All predation events occurred in forest-edge or plantation habitat. Predator-prey relations between bats and primates are little considered by disease ecologists, but may contribute to transmission of zoonotic disease, including Ebolavirus.

  2. Adaptive vocal behavior drives perception by echolocation in bats

    DEFF Research Database (Denmark)

    Moss, Cynthia F; Chiu, Chen; Surlykke, Annemarie

    2011-01-01

    Echolocation operates through adaptive sensorimotor systems that collectively enable the bat to localize and track sonar objects as it flies. The features of sonar signals used by a bat to probe its surroundings determine the information available to its acoustic imaging system. In turn, the bat......'s perception of a complex scene guides its active adjustments in the features of subsequent sonar vocalizations. Here, we propose that the bat's active vocal-motor behaviors play directly into its representation of a dynamic auditory scene....

  3. Bats limit insects in a neotropical agroforestry system.

    Science.gov (United States)

    Williams-Guillén, Kimberly; Perfecto, Ivette; Vandermeer, John

    2008-04-04

    Exclosure experiments have demonstrated the effects of bird predation on arthropods. In a Mexican coffee plantation, we excluded foliage-gleaning bird and bat predators from coffee plants. Effects of bats and birds were additive. In the dry season, birds reduced arthropods in coffee plants by 30%; birds and bats together reduced arthropods by 46%. In the wet season, bats reduced arthropods by 84%, whereas birds reduced them by only 58%. We conclude that previous "bird" exclosure experiments may have systematically underestimated the effects of bats.

  4. Saccharomyces cerevisiae Bat1 and Bat2 aminotransferases have functionally diverged from the ancestral-like Kluyveromyces lactis orthologous enzyme.

    Directory of Open Access Journals (Sweden)

    Maritrini Colón

    Full Text Available BACKGROUND: Gene duplication is a key evolutionary mechanism providing material for the generation of genes with new or modified functions. The fate of duplicated gene copies has been amply discussed and several models have been put forward to account for duplicate conservation. The specialization model considers that duplication of a bifunctional ancestral gene could result in the preservation of both copies through subfunctionalization, resulting in the distribution of the two ancestral functions between the gene duplicates. Here we investigate whether the presumed bifunctional character displayed by the single branched chain amino acid aminotransferase present in K. lactis has been distributed in the two paralogous genes present in S. cerevisiae, and whether this conservation has impacted S. cerevisiae metabolism. PRINCIPAL FINDINGS: Our results show that the KlBat1 orthologous BCAT is a bifunctional enzyme, which participates in the biosynthesis and catabolism of branched chain aminoacids (BCAAs. This dual role has been distributed in S. cerevisiae Bat1 and Bat2 paralogous proteins, supporting the specialization model posed to explain the evolution of gene duplications. BAT1 is highly expressed under biosynthetic conditions, while BAT2 expression is highest under catabolic conditions. Bat1 and Bat2 differential relocalization has favored their physiological function, since biosynthetic precursors are generated in the mitochondria (Bat1, while catabolic substrates are accumulated in the cytosol (Bat2. Under respiratory conditions, in the presence of ammonium and BCAAs the batbat2Δ double mutant shows impaired growth, indicating that Bat1 and Bat2 could play redundant roles. In K. lactis wild type growth is independent of BCAA degradation, since a Klbat1Δ mutant grows under this condition. CONCLUSIONS: Our study shows that BAT1 and BAT2 differential expression and subcellular relocalization has resulted in the distribution of the

  5. Novel Bartonella Species in Insectivorous Bats, Northern China

    Science.gov (United States)

    Han, Hui-Ju; Wen, Hong-ling; Zhao, Li; Liu, Jian-wei; Luo, Li-Mei; Zhou, Chuan-Min; Qin, Xiang-Rong; Zhu, Ye-Lei; Zheng, Xue-Xing

    2017-01-01

    Bartonella species are emerging human pathogens. Bats are known to carry diverse Bartonella species, some of which are capable of infecting humans. However, as the second largest mammalian group by a number of species, the role of bats as the reservoirs of Bartonella species is not fully explored, in term of their species diversity and worldwide distribution. China, especially Northern China, harbors a number of endemic insectivorous bat species; however, to our knowledge, there are not yet studies about Bartonella in bats in China. The aim of the study was to investigate the prevalence and genetic diversity of Bartonella species in bats in Northern China. Bartonella species were detected by PCR amplification of gltA gene in 25.2% (27/107) bats in Mengyin County, Shandong Province of China, including 1/3 Rhinolophus ferrumequinum, 2/10 Rhinolophus pusillus, 9/16 Myotis fimbriatus, 1/5 Myotis ricketti, 14/58 Myotis pequinius. Phylogenetic analysis showed that Bartonella species detected in bats in this study clustered into ten groups, and some might be novel Bartonella species. An association between Bartonella species and bat species was demonstrated and co-infection with different Bartonella species in a single bat was also observed. Our findings expanded our knowledge on the genetic diversity of Bartonella in bats, and shed light on the ecology of bat-borne Bartonella species. PMID:28081122

  6. Education to Action: Improving Public Perception of Bats

    Directory of Open Access Journals (Sweden)

    Eric Hoffmaster

    2016-01-01

    Full Text Available Public perception of bats has historically been largely negative with bats often portrayed as carriers of disease. Bats are commonly associated with vampire lore and thus elicit largely fearful reactions despite the fact that they are a vital and valuable part of the ecosystem. Bats provide a variety of essential services from pest control to plant pollination. Despite the benefits of bats to the environment and the economy, bats are suffering at the hands of humans. They are victims of turbines, human encroachment, pesticides, and, most recently, white nose syndrome. Because of their critical importance to the environment, humans should do what they can to help protect bats. We propose that humans will be more likely to do so if their perceptions and attitudes toward bats can be significantly improved. In a preliminary study we found some support for the idea that people can be educated about bats through bat oriented events and exhibits, and that this greater knowledge can inspire humans to act to save bats.

  7. Evidence of Hantavirus Infection Among Bats in Brazil.

    Science.gov (United States)

    Sabino-Santos, Gilberto; Maia, Felipe Gonçalves Motta; Vieira, Thallyta Maria; de Lara Muylaert, Renata; Lima, Sabrina Miranda; Gonçalves, Cristieli Barros; Barroso, Patricia Doerl; Melo, Maria Norma; Jonsson, Colleen B; Goodin, Douglas; Salazar-Bravo, Jorge; Figueiredo, Luiz Tadeu Moraes

    2015-08-01

    Hantaviruses are zoonotic viruses harbored by rodents, bats, and shrews. At present, only rodent-borne hantaviruses are associated with severe illness in humans. New species of hantaviruses have been recently identified in bats and shrews greatly expanding the potential reservoirs and ranges of these viruses. Brazil has one of the highest incidences of hantavirus cardiopulmonary syndrome in South America, hence it is critical to know what is the prevalence of hantaviruses in Brazil. Although much is known about rodent reservoirs, little is known regarding bats. We captured 270 bats from February 2012 to April 2014. Serum was screened for the presence of antibodies against a recombinant nucleoprotein (rN) of Araraquara virus (ARAQV). The prevalence of antibody to hantavirus was 9/53 with an overall seroprevalence of 17%. Previous studies have shown only insectivorous bats to harbor hantavirus; however, in our study, of the nine seropositive bats, five were frugivorous, one was carnivorous, and three were sanguivorous phyllostomid bats.

  8. Negative regulators of brown adipose tissue (BAT)-mediated thermogenesis.

    Science.gov (United States)

    Sharma, Bal Krishan; Patil, Mallikarjun; Satyanarayana, Ande

    2014-12-01

    Brown adipose tissue (BAT) is specialized for energy expenditure, a process called adaptive thermogenesis. PET-CT scans recently demonstrated the existence of metabolically active BAT in adult humans, which revitalized our interest in BAT. Increasing the amount and/or activity of BAT holds tremendous promise for the treatment of obesity and its associated diseases. PGC1α is the master regulator of UCP1-mediated thermogenesis in BAT. A number of proteins have been identified to influence thermogenesis either positively or negatively through regulating the expression or transcriptional activity of PGC1α. Therefore, BAT activation can be achieved by either inducing the expression of positive regulators of PGC1α or by inhibiting the repressors of the PGC1α/UCP1 pathway. Here, we review the most important negative regulators of PGC1α/UCP1 signaling and their mechanism of action in BAT-mediated thermogenesis.

  9. Canine tooth wear in captive little brown bats

    Science.gov (United States)

    Clark, D.R.

    1980-01-01

    Upper canine teeth of little brown bats Myotis lucifugus lucifugus held in stainless steel wire mesh cages underwent severe wear which exceeded that observed previously in caged big brown bats, Eptesicus fuscus fuscus. This suggests a relationship between amount of wear and size of the caged bats with damage increasing as size decreases. Rapid wear of canine teeth by little brown bats resembled that observed in big brown bats in that it was limited to the first 2 weeks of captivity. This result indicates a universal interval for acclimation to cage conditions among vespertilionid bats. Dietary toxicants DDE and PCB did not affect the extent of wear. If bats are to be released to the wild, confinement in wire mesh cages should be avoided.

  10. Bats as reservoir hosts of human bacterial pathogen, Bartonella mayotimonensis.

    Science.gov (United States)

    Veikkolainen, Ville; Vesterinen, Eero J; Lilley, Thomas M; Pulliainen, Arto T

    2014-06-01

    A plethora of pathogenic viruses colonize bats. However, bat bacterial flora and its zoonotic threat remain ill defined. In a study initially conducted as a quantitative metagenomic analysis of the fecal bacterial flora of the Daubenton's bat in Finland, we unexpectedly detected DNA of several hemotrophic and ectoparasite-transmitted bacterial genera, including Bartonella. Bartonella spp. also were either detected or isolated from the peripheral blood of Daubenton's, northern, and whiskered bats and were detected in the ectoparasites of Daubenton's, northern, and Brandt's bats. The blood isolates belong to the Candidatus-status species B. mayotimonensis, a recently identified etiologic agent of endocarditis in humans, and a new Bartonella species (B. naantaliensis sp. nov.). Phylogenetic analysis of bat-colonizing Bartonella spp. throughout the world demonstrates a distinct B. mayotimonensis cluster in the Northern Hemisphere. The findings of this field study highlight bats as potent reservoirs of human bacterial pathogens.

  11. Bats avoid radar installations: could electromagnetic fields deter bats from colliding with wind turbines?

    Directory of Open Access Journals (Sweden)

    Barry Nicholls

    Full Text Available Large numbers of bats are killed by collisions with wind turbines, and there is at present no direct method of reducing or preventing this mortality. We therefore determine whether the electromagnetic radiation associated with radar installations can elicit an aversive behavioural response in foraging bats. Four civil air traffic control (ATC radar stations, three military ATC radars and three weather radars were selected, each surrounded by heterogeneous habitat. Three sampling points matched for habitat type and structure, dominant vegetation species, altitude and surrounding land class were located at increasing distances from each station. A portable electromagnetic field meter measured the field strength of the radar at three distances from the source: in close proximity (2 volts/metre, an intermediate point within line of sight of the radar (200-400 m and with an EMF strength 400 m and registering an EMF of zero v/m. At each radar station bat activity was recorded three times with three independent sampling points monitored on each occasion, resulting in a total of 90 samples, 30 of which were obtained within each field strength category. At these sampling points, bat activity was recorded using an automatic bat recording station, operated from sunset to sunrise. Bat activity was significantly reduced in habitats exposed to an EMF strength of greater than 2 v/m when compared to matched sites registering EMF levels of zero. The reduction in bat activity was not significantly different at lower levels of EMF strength within 400 m of the radar. We predict that the reduction in bat activity within habitats exposed to electromagnetic radiation may be a result of thermal induction and an increased risk of hyperthermia.

  12. Expression of Heat Shock and Other Stress Response Proteins in Ticks and Cultured Tick Cells in Response to Anaplasma spp. Infection and Heat Shock

    Directory of Open Access Journals (Sweden)

    Margarita Villar

    2010-01-01

    Full Text Available Ticks are ectoparasites of animals and humans that serve as vectors of Anaplasma and other pathogens that affect humans and animals worldwide. Ticks and the pathogens that they transmit have coevolved molecular interactions involving genetic traits of both the tick and the pathogen that mediate their development and survival. In this paper, the expression of heat shock proteins (HSPs and other stress response proteins (SRPs was characterized in ticks and cultured tick cells by proteomics and transcriptomics analyses in response to Anaplasma spp. infection and heat shock. The results of these studies demonstrated that the stress response was activated in ticks and cultured tick cells after Anaplasma spp. infection and heat shock. However, in the natural vector-pathogen relationship, HSPs and other SRPs were not strongly activated, which likely resulted from tick-pathogen coevolution. These results also demonstrated pathogen- and tick-specific differences in the expression of HSPs and other SRPs in ticks and cultured tick cells infected with Anaplasma spp. and suggested the existence of post-transcriptional mechanisms induced by Anaplasma spp. to control tick response to infection. These results illustrated the complexity of the stress response in ticks and suggested a function for the HSPs and other SRPs during Anaplasma spp. infection.

  13. Bat Accelerated Regions Identify a Bat Forelimb Specific Enhancer in the HoxD Locus.

    Directory of Open Access Journals (Sweden)

    Betty M Booker

    2016-03-01

    Full Text Available The molecular events leading to the development of the bat wing remain largely unknown, and are thought to be caused, in part, by changes in gene expression during limb development. These expression changes could be instigated by variations in gene regulatory enhancers. Here, we used a comparative genomics approach to identify regions that evolved rapidly in the bat ancestor, but are highly conserved in other vertebrates. We discovered 166 bat accelerated regions (BARs that overlap H3K27ac and p300 ChIP-seq peaks in developing mouse limbs. Using a mouse enhancer assay, we show that five Myotis lucifugus BARs drive gene expression in the developing mouse limb, with the majority showing differential enhancer activity compared to the mouse orthologous BAR sequences. These include BAR116, which is located telomeric to the HoxD cluster and had robust forelimb expression for the M. lucifugus sequence and no activity for the mouse sequence at embryonic day 12.5. Developing limb expression analysis of Hoxd10-Hoxd13 in Miniopterus natalensis bats showed a high-forelimb weak-hindlimb expression for Hoxd10-Hoxd11, similar to the expression trend observed for M. lucifugus BAR116 in mice, suggesting that it could be involved in the regulation of the bat HoxD complex. Combined, our results highlight novel regulatory regions that could be instrumental for the morphological differences leading to the development of the bat wing.

  14. Flying ticks: anciently evolved associations that constitute a risk of infectious disease spread.

    Science.gov (United States)

    de la Fuente, José; Estrada-Peña, Agustín; Cabezas-Cruz, Alejandro; Brey, Ricardo

    2015-10-15

    Ticks are important vectors of emerging zoonotic diseases affecting human and animal health worldwide. Ticks are often found on wild birds, which have been long recognized as a potential risk factor for dissemination of ticks and tick-borne pathogens (TBP), thus raising societal concerns and prompting research into their biology and ecology. To fully understand the role of birds in disseminating some ticks species and TBP, it is important to consider the evolutionary relationships between birds, ticks and transmitted pathogens. In this paper we reviewed the possible role of birds in the dissemination of TBP as a result of the evolution of host-tick-pathogen associations. Birds are central elements in the ecological networks of ticks, hosts and TBP. The study of host-tick-pathogen associations reveals a prominent role for birds in the dissemination of Borrelia spp. and Anaplasma phagocytophilum, with little contribution to the possible dissemination of other TBP. Birds have played a major role during tick evolution, which explains why they are by far the most important hosts supporting the ecological networks of ticks and several TBP. The immune response of birds to ticks and TBP has been largely overlooked. To implement effective measures for the control of tick-borne diseases, it is necessary to study bird-tick and bird-pathogen molecular interactions including the immune response of birds to tick infestation and pathogen infection.

  15. Experimental Transmission of Karshi (Mammalian Tick-Borne Flavivirus Group Virus by Ornithodoros Ticks >2,900 Days after Initial Virus Exposure Supports the Role of Soft Ticks as a Long-Term Maintenance Mechanism for Certain Flaviviruses.

    Directory of Open Access Journals (Sweden)

    Michael J Turell

    Full Text Available Members of the mammalian tick-borne flavivirus group, including tick-borne encephalitis virus, are responsible for at least 10,000 clinical cases of tick-borne encephalitis each year. To attempt to explain the long-term maintenance of members of this group, we followed Ornithodoros parkeri, O. sonrai, and O. tartakovskyi for >2,900 days after they had been exposed to Karshi virus, a member of the mammalian tick-borne flavivirus group.Ticks were exposed to Karshi virus either by allowing them to feed on viremic suckling mice or by intracoelomic inoculation. The ticks were then allowed to feed individually on suckling mice after various periods of extrinsic incubation to determine their ability to transmit virus by bite and to determine how long the ticks would remain infectious. The ticks remained efficient vectors of Karshi virus, even when tested >2,900 d after their initial exposure to virus, including those ticks exposed to Karshi virus either orally or by inoculation.Ornithodoros spp. ticks were able to transmit Karshi virus for >2,900 days (nearly 8 years after a single exposure to a viremic mouse. Therefore, these ticks may serve as a long-term maintenance mechanism for Karshi virus and potentially other members of the mammalian tick-borne flavivirus group.

  16. The distribution of bats in The Netherlands

    NARCIS (Netherlands)

    Braaksma, S.

    1970-01-01

    The Research Institute for Nature Management (R.I.N.) has compiled all available information on the distribution of bats in the Netherlands up till 1968. The data were derived from literature and museum specimens, as well as from numerous unpublished observations. Around 1960 much was known already

  17. Biaxial mechanical characterization of bat wing skin.

    Science.gov (United States)

    Skulborstad, A J; Swartz, S M; Goulbourne, N C

    2015-04-21

    The highly flexible and stretchable wing skin of bats, together with the skeletal structure and musculature, enables large changes in wing shape during flight. Such compliance distinguishes bat wings from those of all other flying animals. Although several studies have investigated the aerodynamics and kinematics of bats, few have examined the complex histology and mechanical response of the wing skin. This work presents the first biaxial characterization of the local deformation, mechanical properties, and fiber kinematics of bat wing skin. Analysis of these data has provided insight into the relationships among the structural morphology, mechanical properties, and functionality of wing skin. Large spatial variations in tissue deformation and non-negligible fiber strains in the cross-fiber direction for both chordwise and spanwise fibers indicate fibers should be modeled as two-dimensional elements. The macroscopic constitutive behavior was anisotropic and nonlinear, with very low spanwise and chordwise stiffness (hundreds of kilopascals) in the toe region of the stress-strain curve. The structural arrangement of the fibers and matrix facilitates a low energy mechanism for wing deployment and extension, and we fabricate examples of skins capturing this mechanism. We propose a comprehensive deformation map for the entire loading regime. The results of this work underscore the importance of biaxial field approaches for soft heterogeneous tissue, and provide a foundation for development of bio-inspired skins to probe the effects of the wing skin properties on aerodynamic performance.

  18. Analysis of bat wings for morphing

    Science.gov (United States)

    Leylek, Emily A.; Manzo, Justin E.; Garcia, Ephrahim

    2008-03-01

    The morphing of wings from three different bat species is studied using an extension of the Weissinger method. To understand how camber affects performance factors such as lift and lift to drag ratio, XFOIL is used to study thin (3% thickness to chord ratio) airfoils at a low Reynolds number of 100,000. The maximum camber of 9% yielded the largest lift coefficient, and a mid-range camber of 7% yielded the largest lift to drag ratio. Correlations between bat wing morphology and flight characteristics are covered, and the three bat wing planforms chosen represent various combinations of morphological components and different flight modes. The wings are studied using the extended Weissinger method in an "unmorphed" configuration using a thin, symmetric airfoil across the span of the wing through angles of attack of 0°-15°. The wings are then run in the Weissinger method at angles of attack of -2° to 12° in a "morphed" configuration modeled after bat wings seen in flight, where the camber of the airfoils comprising the wings is varied along the span and a twist distribution along the span is introduced. The morphed wing configurations increase the lift coefficient over 1000% from the unmorphed configuration and increase the lift to drag ratio over 175%. The results of the three different species correlate well with their flight in nature.

  19. Bat records from Malawi (Mammalia, Chiroptera)

    NARCIS (Netherlands)

    Bergmans, Wim; Jachmann, Hugo

    1983-01-01

    Five species of bats are recorded from Kasungu National Park, Malawi: Eidolon helvum (Kerr, 1792); Epomophorus anurus Heuglin, 1864; Epomophorus minor Dobson, 1880; Epomops dobsonii (Bocage, 1889); and Scotoecus hindei Thomas, 1901. Some other Malawian records of these species, based on literature a

  20. Bats respond to very weak magnetic fields.

    Directory of Open Access Journals (Sweden)

    Lan-Xiang Tian

    Full Text Available How animals, including mammals, can respond to and utilize the direction and intensity of the Earth's magnetic field for orientation and navigation is contentious. In this study, we experimentally tested whether the Chinese Noctule, Nyctalus plancyi (Vespertilionidae can sense magnetic field strengths that were even lower than those of the present-day geomagnetic field. Such field strengths occurred during geomagnetic excursions or polarity reversals and thus may have played an important role in the evolution of a magnetic sense. We found that in a present-day local geomagnetic field, the bats showed a clear preference for positioning themselves at the magnetic north. As the field intensity decreased to only 1/5th of the natural intensity (i.e., 10 μT; the lowest field strength tested here, the bats still responded by positioning themselves at the magnetic north. When the field polarity was artificially reversed, the bats still preferred the new magnetic north, even at the lowest field strength tested (10 μT, despite the fact that the artificial field orientation was opposite to the natural geomagnetic field (P<0.05. Hence, N. plancyi is able to detect the direction of a magnetic field even at 1/5th of the present-day field strength. This high sensitivity to magnetic fields may explain how magnetic orientation could have evolved in bats even as the Earth's magnetic field strength varied and the polarity reversed tens of times over the past fifty million years.

  1. The wake of hovering flight in bats

    Science.gov (United States)

    Håkansson, Jonas; Hedenström, Anders; Winter, York; Johansson, L. Christoffer

    2015-01-01

    Hovering means stationary flight at zero net forward speed, which can be achieved by animals through muscle powered flapping flight. Small bats capable of hovering typically do so with a downstroke in an inclined stroke plane, and with an aerodynamically active outer wing during the upstroke. The magnitude and time history of aerodynamic forces should be reflected by vorticity shed into the wake. We thus expect hovering bats to generate a characteristic wake, but this has until now never been studied. Here we trained nectar-feeding bats, Leptonycteris yerbabuenae, to hover at a feeder and using time-resolved stereoscopic particle image velocimetry in conjunction with high-speed kinematic analysis we show that hovering nectar-feeding bats produce a series of bilateral stacked vortex loops. Vortex visualizations suggest that the downstroke produces the majority of the weight support, but that the upstroke contributes positively to the lift production. However, the relative contributions from downstroke and upstroke could not be determined on the basis of the wake, because wake elements from down- and upstroke mix and interact. We also use a modified actuator disc model to estimate lift force, power and flap efficiency. Based on our quantitative wake-induced velocities, the model accounts for weight support well (108%). Estimates of aerodynamic efficiency suggest hovering flight is less efficient than forward flapping flight, while the overall energy conversion efficiency (mechanical power output/metabolic power) was estimated at 13%. PMID:26179990

  2. Personality variation in little brown bats.

    Directory of Open Access Journals (Sweden)

    Allyson K Menzies

    Full Text Available Animal personality or temperament refers to individual differences in behaviour that are repeatable over time and across contexts. Personality has been linked to life-history traits, energetic traits and fitness, with implications for the evolution of behaviour. Personality has been quantified for a range of taxa (e.g., fish, songbirds, small mammals but, so far, there has been little work on personality in bats, despite their diversity and potential as a model taxon for comparative studies. We used a novel environment test to quantify personality in little brown bats (Myotis lucifugus and assess the short-term repeatability of a range of behaviours. We tested the hypothesis that development influences values of personality traits and predicted that trait values associated with activity would increase between newly volant, pre-weaning young-of-the-year (YOY and more mature, self-sufficient YOY. We identified personality dimensions that were consistent with past studies of other taxa and found that these traits were repeatable over a 24-hour period. Consistent with our prediction, older YOY captured at a fall swarming site prior to hibernation had higher activity scores than younger YOY bats captured at a maternity colony, suggesting that personality traits vary as development progresses in YOY bats. Thus, we found evidence of short-term consistency of personality within individuals but with the potential for temporal flexibility of traits, depending on age.

  3. Ticks on humans in the Pantanal wetlands, Brazil.

    Science.gov (United States)

    Ramos, Vanessa N; Osava, Carolina F; Piovezan, Ubiratan; Szabó, Matias P J

    2014-09-01

    Information on ticks biting humans in Brazil is very restricted. In fact, many times when human tick-borne diseases are diagnosed, the involved vector tick is not identified, although this may be clinically helpful. Pantanal is one of the world's largest floodplains, has an exuberant wildlife, and is place of extensive cattle ranching, ecotourism, and fishing. We herein report tick species found on humans in a 13-month survey in a region with both cattle and wildlife handling in the Brazilian Pantanal. From February 2012 to February 2013, a total of 280 ticks was collected from humans (n=22), 121 of which were attached. Amblyomma cajennense sensu lato nymphs were the main tick species and stage found attached to humans (n=93) especially during the dry months (winter). In the wet season (summer), Amblyomma parvum adults were the main ticks found attached to humans (n=19) followed by A. cajennense s.l. adults (n=9). Only one unattached nymph of A. parvum was collected in this study. These results reinforce that A. cajennense s.l. nymphs are an important parasite of humans (and vectors) in Brazil and draw also attention to A. parvum adults as frequent human parasites as well.

  4. Tick-borne rickettsiae in Guinea and Liberia.

    Science.gov (United States)

    Mediannikov, Oleg; Diatta, Georges; Zolia, Yah; Balde, Mamadou Cellou; Kohar, Henry; Trape, Jean-François; Raoult, Didier

    2012-02-01

    While the high seroprevalence for the rickettsiae that cause spotted fevers and the multiple pathogenic rickettsiae is known, the data on the distribution of rickettsial diseases in Africa are often incomplete. We collected ticks from domestic or wild animals (generally a source of bushmeat) that were in contact with humans in 2 neighboring countries of tropical West Africa, Guinea and Liberia. In total, 382 ticks representing 6 species were collected in Liberia and 655 ticks representing 7 species were collected in Guinea. We found rickettsiae in 9 different species of ticks from both countries. Rickettsia africae was found in 93-100% of Amblyomma variegatum, in 14-93% of Rhipicephalus (B.) geigyi, Rh. (B.) annulatus, and Rh. (B.) decoloratus, and in several Hyalomma marginatum rufipes and Haemaphysalis paraleachi. A genetic variant of R. africae was found in Amblyomma compressum. R. massiliae was found in 10/61 (16%) of Rh. senegalensis ticks and in 2% of Haemaphysalis paraleachi ticks collected from dogs. We identified a new rickettsia in one of 44 (2%) Ixodes muniensis collected from a dog in Liberia. As this rickettsia is not yet isolated, we propose the provisional name "Candidatus Rickettsia liberiensis" (for the West African country where the host tick was collected).

  5. Human betacoronavirus 2c EMC/2012-related viruses in bats, Ghana and Europe.

    Science.gov (United States)

    Annan, Augustina; Baldwin, Heather J; Corman, Victor Max; Klose, Stefan M; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K V; Lina, Peter H C; Godlevska, Elena V; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix

    2013-03-01

    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats.

  6. Factors Associated with Tick Bite Preventive Practices among Farmworkers in Malaysia.

    Directory of Open Access Journals (Sweden)

    Masoumeh Ghane Kisomi

    Full Text Available Farmworkers are at high-risk for tick bites, which potentially transmit various tick-borne diseases. Previous studies show that personal prevention against tick bites is key, and certain factors namely, knowledge, experience of tick bites, and health beliefs influence compliance with tick bites preventive behaviour. This study aimed to assess these factors and their associations with tick bite preventive practices among Malaysian farmworkers.A total of eight cattle, goat and sheep farms in six states in Peninsular Malaysia participated in a cross-sectional survey between August and October 2013.A total of 151 (72.2% out of 209 farmworkers answered the questionnaire. More than half of the farmworkers (n = 91 reported an experience of tick bites. Farms with monthly acaricide treatment had significantly (P<0.05 a low report of tick bites. Tick bite exposure rates did not differ significantly among field workers and administrative workers. The mean total knowledge score of ticks for the overall farmworkers was 13.6 (SD±3.2 from 20. The mean total tick bite preventive practices score for all farmworkers was 8.3 (SD±3.1 from 15. Fixed effect model showed the effects of four factors on tick bite prevention: (1 farms, (2 job categories (administrative workers vs. field workers, (3 perceived severity of tick bites, and (4 perceived barriers to tick bite prevention.A high proportion of farmworkers, including administrative workers, reported an experience of tick bites. The effectiveness of monthly acaricide treatment was declared by low reports of tick bites on these farms. Tick bite preventive practices were insufficient, particularly in certain farms and for administrative workers. Our findings emphasise the need to have education programmes for all farmworkers and targeting farms with low prevention practices. Education and health programmes should increase the perception of the risk of tick bites and remove perceived barriers of tick bite prevention.

  7. Candidatus Neoehrlichia mikurensis in Ticks from Migrating Birds in Sweden.

    Science.gov (United States)

    Labbé Sandelin, Lisa; Tolf, Conny; Larsson, Sara; Wilhelmsson, Peter; Salaneck, Erik; Jaenson, Thomas G T; Lindgren, Per-Eric; Olsen, Björn; Waldenström, Jonas

    2015-01-01

    Candidatus Neoehrlichia mikurensis (CNM; family Anaplasmataceae) was recently recognized as a potential tick-borne human pathogen. The presence of CNM in mammals, in host-seeking Ixodes ticks and in ticks attached to mammals and birds has been reported recently. We investigated the presence of CNM in ornithophagous ticks from migrating birds. A total of 1,150 ticks (582 nymphs, 548 larvae, 18 undetermined ticks and two adult females) collected from 5,365 birds captured in south-eastern Sweden was screened for CNM by molecular methods. The birds represented 65 different species, of which 35 species were infested with one or more ticks. Based on a combination of morphological and molecular species identification, the majority of the ticks were identified as Ixodes ricinus. Samples were initially screened by real-time PCR targeting the CNM 16S rRNA gene, and confirmed by a second real-time PCR targeting the groEL gene. For positive samples, a 1260 base pair fragment of the 16S rRNA gene was sequenced. Based upon bacterial gene sequence identification, 2.1% (24/1150) of the analysed samples were CNM-positive. Twenty-two out of 24 CNM-positive ticks were molecularly identified as I. ricinus nymphs, and the remaining two were identified as I. ricinus based on morphology. The overall CNM prevalence in I. ricinus nymphs was 4.2%. None of the 548 tested larvae was positive. CNM-positive ticks were collected from 10 different bird species. The highest CNM-prevalences were recorded in nymphs collected from common redpoll (Carduelis flammea, 3/7), thrush nightingale (Luscinia luscinia, 2/29) and dunnock (Prunella modularis, 1/17). The 16S rRNA sequences obtained in this study were all identical to each other and to three previously reported European strains, two of which were obtained from humans. It is concluded that ornithophagous ticks may be infected with CNM and that birds most likely can disperse CNM-infected ticks over large geographical areas.

  8. Ticks and tick-borne novel bunyavirus collected from the natural environment and domestic animals in Jinan city, East China.

    Science.gov (United States)

    Wang, Dong; Wang, Yongming; Yang, Guoliang; Liu, Huiyuan; Xin, Zheng

    2016-02-01

    Since 2011, 73 cases of the severe fever with thrombocytopenia syndrome, a novel tick-borne disease, have been reported in Jinan city through information system for disease control and prevention. Therefore, this study aimed to investigate the species, distribution, host animals of ticks and tick-borne pathogens. A total of 722 ticks were collected from two types of natural environment and six kinds of domestic animal in Jinan city. All the sampled ticks belonged to the same species, namely Haemaphysalis longicornis, and 94.7% of them were adult. The density of free-living ticks in grassland was nearly six times that in shrub. The prevalence of the goat (53.3%) was highest among the domestic animals. The host body region most frequently parasitized by H. longicornis was the head (77.8%), especially ears and periocular region. Novel bunyavirus was detected on the free-ranging goats in Jinan city. Acaricide treatment with a higher concentration on the ears, periocular region and the groin of domestic animals should be recommended to control the ticks effectively.

  9. Mercury accumulation in bats near hydroelectric reservoirs in Peninsular Malaysia.

    Science.gov (United States)

    Syaripuddin, Khairunnisa; Kumar, Anjali; Sing, Kong-Wah; Halim, Muhammad-Rasul Abdullah; Nursyereen, Muhammad-Nasir; Wilson, John-James

    2014-09-01

    In large man-made reservoirs such as those resulting from hydroelectric dam construction, bacteria transform the relatively harmless inorganic mercury naturally present in soil and the submerged plant matter into toxic methylmercury. Methylmercury then enters food webs and can accumulate in organisms at higher trophic levels. Bats feeding on insects emerging from aquatic systems can show accumulation of mercury consumed through their insect prey. In this study, we investigated whether the concentration of mercury in the fur of insectivorous bat species was significantly higher than that in the fur of frugivorous bat species, sampled near hydroelectric reservoirs in Peninsular Malaysia. Bats were sampled at Temenggor Lake and Kenyir Lake and fur samples from the most abundant genera of the two feeding guilds-insectivorous (Hipposideros and Rhinolophus) and frugivorous (Cynopterus and Megaerops) were collected for mercury analysis. We found significantly higher concentrations of total mercury in the fur of insectivorous bats. Mercury concentrations also differed significantly between insectivorous bats sampled at the two sites, with bats from Kenyir Lake, the younger reservoir, showing higher mercury concentrations, and between the insectivorous genera, with Hipposideros bats showing higher mercury concentrations. Ten bats (H. cf. larvatus) sampled at Kenyir Lake had mercury concentrations approaching or exceeding 10 mg/kg, which is the threshold at which detrimental effects occur in humans, bats and mice.

  10. Timing matters: sonar call groups facilitate target localization in bats.

    Science.gov (United States)

    Kothari, Ninad B; Wohlgemuth, Melville J; Hulgard, Katrine; Surlykke, Annemarie; Moss, Cynthia F

    2014-01-01

    To successfully negotiate a cluttered environment, an echolocating bat must control the timing of motor behaviors in response to dynamic sensory information. Here we detail the big brown bat's adaptive temporal control over sonar call production for tracking prey, moving predictably or unpredictably, under different experimental conditions. We studied the adaptive control of vocal-motor behaviors in free-flying big brown bats, Eptesicus fuscus, as they captured tethered and free-flying insects, in open and cluttered environments. We also studied adaptive sonar behavior in bats trained to track moving targets from a resting position. In each of these experiments, bats adjusted the features of their calls to separate target and clutter. Under many task conditions, flying bats produced prominent sonar sound groups identified as clusters of echolocation pulses with relatively stable intervals, surrounded by longer pulse intervals. In experiments where bats tracked approaching targets from a resting position, bats also produced sonar sound groups, and the prevalence of these sonar sound groups increased when motion of the target was unpredictable. We hypothesize that sonar sound groups produced during flight, and the sonar call doublets produced by a bat tracking a target from a resting position, help the animal resolve dynamic target location and represent the echo scene in greater detail. Collectively, our data reveal adaptive temporal control over sonar call production that allows the bat to negotiate a complex and dynamic environment.

  11. A decade of U.S. Air Force bat strikes

    Science.gov (United States)

    Peurach, Suzanne C.; Dove, Carla J.; Stepko, Laura

    2009-01-01

    From 1997 through 2007, 821 bat strikes were reported to the U.S. Air Force (USAF) Safety Center by aircraft personnel or ground crew and sent to the National Museum of Natural History, Smithsonian Institution, for identification. Many samples were identified by macroscopic and or microscopic comparisons with bat specimens housed in the museum and augmented during the last 2 years by DNA analysis. Bat remains from USAF strikes during this period were received at the museum from 40 states in the United States and from 20 countries. We confirmed that 46% of the strikes were caused by bats, but we did not identify them further; we identified 5% only to the family or genus level, and 49% to the species level. Fifty-five of the 101 bat-strike samples submitted for DNA analysis have been identified to the species level. Twenty-five bat species have been recorded striking USAF planes worldwide. The Brazilian free-tailed bat (Tadarida brasiliensis; n = 173) is the species most commonly identified in USAF strike impacts, followed by the red bat (Lasiurus borealis; n = 83). Bat strikes peak during the spring and fall, with >57% occurring from August through October; 82% of the reports that included time of strike were recorded between 2100 and 0900 hours. More than 12% of the bat strikes were reported at >300 m above ground level (AGL). Although $825,000 and >50% of this sum was attributable to 5 bat-strike incidents. Only 5 bats from the 10 most damaging bat strikes were identified to the species level, either because we did not receive remains with the reports or the sample was insufficient for identification.

  12. Prevalence of tick-borne pathogens in Ixodes ricinus and Dermacentor reticulatus ticks from different geographical locations in Belarus.

    Science.gov (United States)

    Reye, Anna L; Stegniy, Valentina; Mishaeva, Nina P; Velhin, Sviataslau; Hübschen, Judith M; Ignatyev, George; Muller, Claude P

    2013-01-01

    Worldwide, ticks are important vectors of human and animal pathogens. Besides Lyme Borreliosis, a variety of other bacterial and protozoal tick-borne infections are of medical interest in Europe. In this study, 553 questing and feeding Ixodes ricinus (n = 327) and Dermacentor reticulatus ticks (n = 226) were analysed by PCR for Borrelia, Rickettsia, Anaplasma, Coxiella, Francisella and Babesia species. Overall, the pathogen prevalence in ticks was 30.6% for I. ricinus and 45.6% for D. reticulatus. The majority of infections were caused by members of the spotted-fever group rickettsiae (24.4%), 9.4% of ticks were positive for Borrelia burgdorferi sensu lato, with Borrelia afzelii being the most frequently detected species (40.4%). Pathogens with low prevalence rates in ticks were Anaplasma phagocytophilum (2.2%), Coxiella burnetii (0.9%), Francisella tularensis subspecies (0.7%), Bartonella henselae (0.7%), Babesia microti (0.5%) and Babesia venatorum (0.4%). On a regional level, hotspots of pathogens were identified for A. phagocytophilum (12.5-17.2%), F. tularensis ssp. (5.5%) and C. burnetii (9.1%), suggesting established zoonotic cycles of these pathogens at least at these sites. Our survey revealed a high burden of tick-borne pathogens in questing and feeding I. ricinus and D. reticulatus ticks collected in different regions in Belarus, indicating a potential risk for humans and animals. Identified hotspots of infected ticks should be included in future surveillance studies, especially when F. tularensis ssp. and C. burnetii are involved.

  13. Prevalence of Tick-Borne Pathogens in Ixodes ricinus and Dermacentor reticulatus Ticks from Different Geographical Locations in Belarus

    Science.gov (United States)

    Reye, Anna L.; Stegniy, Valentina; Mishaeva, Nina P.; Velhin, Sviataslau; Hübschen, Judith M.; Ignatyev, George; Muller, Claude P.

    2013-01-01

    Worldwide, ticks are important vectors of human and animal pathogens. Besides Lyme Borreliosis, a variety of other bacterial and protozoal tick-borne infections are of medical interest in Europe. In this study, 553 questing and feeding Ixodes ricinus (n = 327) and Dermacentor reticulatus ticks (n = 226) were analysed by PCR for Borrelia, Rickettsia, Anaplasma, Coxiella, Francisella and Babesia species. Overall, the pathogen prevalence in ticks was 30.6% for I. ricinus and 45.6% for D. reticulatus. The majority of infections were caused by members of the spotted-fever group rickettsiae (24.4%), 9.4% of ticks were positive for Borrelia burgdorferi sensu lato, with Borrelia afzelii being the most frequently detected species (40.4%). Pathogens with low prevalence rates in ticks were Anaplasma phagocytophilum (2.2%), Coxiella burnetii (0.9%), Francisella tularensis subspecies (0.7%), Bartonella henselae (0.7%), Babesia microti (0.5%) and Babesia venatorum (0.4%). On a regional level, hotspots of pathogens were identified for A. phagocytophilum (12.5–17.2%), F. tularensis ssp. (5.5%) and C. burnetii (9.1%), suggesting established zoonotic cycles of these pathogens at least at these sites. Our survey revealed a high burden of tick-borne pathogens in questing and feeding I. ricinus and D. reticulatus ticks collected in different regions in Belarus, indicating a potential risk for humans and animals. Identified hotspots of infected ticks should be included in future surveillance studies, especially when F. tularensis ssp. and C. burnetii are involved. PMID:23349900

  14. Prevalence of tick-borne pathogens in Ixodes ricinus and Dermacentor reticulatus ticks from different geographical locations in Belarus.

    Directory of Open Access Journals (Sweden)

    Anna L Reye

    Full Text Available Worldwide, ticks are important vectors of human and animal pathogens. Besides Lyme Borreliosis, a variety of other bacterial and protozoal tick-borne infections are of medical interest in Europe. In this study, 553 questing and feeding Ixodes ricinus (n = 327 and Dermacentor reticulatus ticks (n = 226 were analysed by PCR for Borrelia, Rickettsia, Anaplasma, Coxiella, Francisella and Babesia species. Overall, the pathogen prevalence in ticks was 30.6% for I. ricinus and 45.6% for D. reticulatus. The majority of infections were caused by members of the spotted-fever group rickettsiae (24.4%, 9.4% of ticks were positive for Borrelia burgdorferi sensu lato, with Borrelia afzelii being the most frequently detected species (40.4%. Pathogens with low prevalence rates in ticks were Anaplasma phagocytophilum (2.2%, Coxiella burnetii (0.9%, Francisella tularensis subspecies (0.7%, Bartonella henselae (0.7%, Babesia microti (0.5% and Babesia venatorum (0.4%. On a regional level, hotspots of pathogens were identified for A. phagocytophilum (12.5-17.2%, F. tularensis ssp. (5.5% and C. burnetii (9.1%, suggesting established zoonotic cycles of these pathogens at least at these sites. Our survey revealed a high burden of tick-borne pathogens in questing and feeding I. ricinus and D. reticulatus ticks collected in different regions in Belarus, indicating a potential risk for humans and animals. Identified hotspots of infected ticks should be included in future surveillance studies, especially when F. tularensis ssp. and C. burnetii are involved.

  15. Efficacy of orally administered powdered aloe juice (Aloe ferox against ticks on cattle and ticks and fleas on dogs

    Directory of Open Access Journals (Sweden)

    J.J. Fourie

    2005-06-01

    Full Text Available The efficacy of orally administered powdered aloe juice (Aloe ferox was evaluated against ticks on cattle and against ticks and fleas on dogs. Twelve calves were each infested over a 25-day period with approximately 4000 larvae of Rhipicephalus (Boophilus decoloratus and allocated to 3 groups of 4 calves each. Three days after the last larval infestation and daily for 22 days thereafter, the calves in 1 group were fed 5 mg / kg body weight and those in another 25 mg / kg body weight of powdered aloe juice incorporated in game maintenance pellets, while the animals in the 3rd group received only pellets. Detached female ticks were collected daily and counted and the weights and the fertility of groups of 50 engorged female ticks collected from the animals were ascertained. The powdered aloe juice in the game maintenance pellets had no effect on the tick burdens of the calves or on the fertility of the ticks. Six dogs, in each of 2 groups, were treated daily for 15 consecutive days, commencing on Day -5 before the 1st tick infestation, with either 0.39 g or 0.74 g of powdered aloe juice, administered orally in gelatin capsules, while a 3rd group of 6 dogs served as untreated controls. All the dogs were challenged with Haemaphysalis leachi on Days 0 and +7, and with Ctenocephalides felis on Days+1and +8, and efficacy assessments were made 1 day after flea and 2 days after tick challenge, respectively. Treatment was not effective against ticks or fleas on the dogs.

  16. Migration of bats past a remote island offers clues toward the problem of bat fatalities at wind turbines

    Science.gov (United States)

    Cryan, P.M.; Brown, A.C.

    2007-01-01

    Wind energy is rapidly becoming a viable source of alternative energy, but wind turbines are killing bats in many areas of North America. Most of the bats killed by turbines thus far have been migratory species that roost in trees throughout the year, and the highest fatality events appear to coincide with autumn migration. Hoary bats (Lasiurus cinereus) are highly migratory and one of the most frequently killed species at wind turbines. We analyzed a long-term data set to investigate how weather and moonlight influenced the occurrence of hoary bats at an island stopover point along their migration route. We then related our results to the problem of bat fatalities at wind turbines. We found that relatively low wind speeds, low moon illumination, and relatively high degrees of cloud cover were important predictors of bat arrivals and departures, and that low barometric pressure was an additional variable that helped predict arrivals. Slight differences in the conditions under which bats arrived and departed from the island suggest that hoary bats may be more likely to arrive on the island with passing storm fronts in autumn. These results also indicate that fatalities of hoary bats at wind turbines may be predictable events, that the species may be drawn to prominent landmarks that they see during migration, and that they regularly migrate over the ocean. Additional observations from this and other studies suggest that the problem of bat fatalities at wind turbines may be associated with flocking and autumn mating behaviors.

  17. Investigation of tick-borne bacteria (Rickettsia spp., Anaplasma spp., Ehrlichia spp. and Borrelia spp.) in ticks collected from Andean tapirs, cattle and vegetation from a protected area in Ecuador

    OpenAIRE

    Pesquera, Cristina; Portillo, Aránzazu; Palomar, Ana M.; Oteo, José A.

    2015-01-01

    Background Ixodid ticks play an important role in the transmission and ecology of infectious diseases. Information about the circulation of tick-borne bacteria in ticks is lacking in Ecuador. Our aims were to investigate the tick species that parasitize Andean tapirs and cattle, and those present in the vegetation from the buffer zone of the Antisana Ecological Reserve and Cayambe-Coca National Park (Ecuador), and to investigate the presence of tick-borne bacteria. Methods Tick species were i...

  18. Monitoring Sensitive Bat Species at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Schoenberg, Kari M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-01-15

    Bats play a critical role in ecosystems and are vulnerable to disturbance and disruption by human activities. In recent decades, bat populations in the United States and elsewhere have decreased tremendously. There are 47 different species of bat in the United States and 28 of these occur in New Mexico with 15 different species documented at the Los Alamos National Laboratory (LANL) and surrounding areas. Euderma maculatum(the spotted bat) is listed as “threatened” by the state of New Mexico and is known to occur at LANL. Four other species of bats are listed as “sensitive” and also occur here. In 1995, a four year study was initiated at LANL to assess the status of bat species of concern, elucidate distribution and relative abundance, and obtain information on roosting sites. There have been no definitive studies since then. Biologists in the Environmental Protection Division at LANL initiated a multi-year monitoring program for bats in May 2013 to implement the Biological Resources Management Plan. The objective of this ongoing study is to monitor bat species diversity and seasonal activity over time at LANL. Bat species diversity and seasonal activity were measured using an acoustic bat detector, the Pettersson D500X. This ultrasound recording unit is intended for long-term, unattended recording of bat and other high frequency animal calls. During 2013, the detector was deployed at two locations around LANL. Study sites were selected based on proximity to water where bats may be foraging. Recorded bat calls were analyzed using Sonobat, software that can help determine specific species of bat through their calls. A list of bat species at the two sites was developed and compared to lists from previous studies. Species diversity and seasonal activity, measured as the number of call sequences recorded each month, were compared between sites and among months. A total of 17,923 bat calls were recorded representing 15 species. Results indicate that there is a

  19. Small mammals as hosts of immature ixodid ticks

    Directory of Open Access Journals (Sweden)

    I.G. Horak

    2005-09-01

    Full Text Available Two hundred and twenty-five small mammals belonging to 16 species were examined for ticks in Free State, Mpumalanga and Limpopo Provinces, South Africa, and 18 ixodid tick species, of which two could only be identified to genus level, were recovered. Scrub hares, Lepus saxatilis, and Cape hares, Lepus capensis, harboured the largest number of tick species. In Free State Province Namaqua rock mice, Aethomys namaquensis, and four-striped grass mice, Rhabdomys pumilio, were good hosts of the immature stages of Haemaphysalis leachi and Rhipicephalus gertrudae, while in Mpumalanga and Limpopo Provinces red veld rats, Aethomys chrysophilus, Namaqua rock mice and Natal multimammate mice, Mastomys natalensis were good hosts of H. leachi and Rhipicephalus simus. Haemaphysalis leachi was the only tick recovered from animals in all three provinces.

  20. Small mammals as hosts of immature ixodid ticks.

    Science.gov (United States)

    Horak, I G; Fourie, L J; Braack, L E O

    2005-09-01

    Two hundred and twenty-five small mammals belonging to 16 species were examined for ticks in Free State, Mpumalanga and Limpopo Provinces, South Africa, and 18 ixodid tick species, of which two could only be identified to genus level, were recovered. Scrub hares, Lepus saxatilis, and Cape hares, Lepus capensis, harboured the largest number of tick species. In Free State Province Namaqua rock mice, Aethomys namaquensis, and four-striped grass mice, Rhabdomys pumilio, were good hosts of the immature stages of Haemaphysalis leachi and Rhipicephalus gertrudae, while in Mpumalanga and Limpopo Provinces red veld rats, Aethomys chrysophilus, Namaqua rock mice and Natal multimammate mice, Mastomys natalensis were good hosts of H. leachi and Rhipicephalus simus. Haemaphysalis leachi was the only tick recovered from animals in all three provinces.

  1. The extensible alloscutal cuticle of the tick, Ixodes ricinus

    DEFF Research Database (Denmark)

    Andersen, Svend Olav; Roepstorff, Peter

    2005-01-01

    The proteins in the distensible alloscutal cuticle of the blood-feeding tick, Ixodes ricinus, have been characterized by electrophoresis and chromatography, two of the proteins were purified and their total amino acid sequence determined. They show sequence similarity to cuticular proteins from...... of the insoluble fraction are fluorescent when exposed to ultraviolet light, and the fluorescence corresponds in excitation and emission maxima to the fluorescence of the rubber-like arthropodan protein, resilin, and to the amino acid dityrosine. Small amounts of dityrosine were obtained from ticks in the early....... Cuticle from fully distended ticks contains about 60-80 nmole dityrosine per tick, corresponding to 2-3 microg/mg cuticle. It is suggested that the major part of the cuticular proteins is made inextractable by cross-linking by dityrosine residues, and that dityrosine plays a role in stabilizing...

  2. [The species composition of mosquitoes and ticks in Armenia].

    Science.gov (United States)

    Manukian, D V; Oganesian, A S; Shakhnazarian, S A; Aleksanian, Iu T

    2006-01-01

    Comprehensive epidemiological, entomological, virological, and parasitological studies were conducted to examine the species composition and size of bloodsucking arthropoda (mosquitoes and ticks). A total of 64,567 mosquitoes and 45,180 Ixodes ticks were collected. Among the mosquitoes, Anopheles maculipennis was a prevalent species (81.6%). In all climatic zones, Dermacentor marginatus was the largest in number and most abundant during flag collections from cattle and plants (62.5% and 95.5%, respectively). Virological studies of the collected field material identified 125 strains of arboviruses belonging to 10 viruses: Tyaginya, Sindbis, Batai, Dkhori, tick-borne encephalitis, West Nile fever, Tamdy, KGL, Geta, and Bkhandzha. The identified arboviruses are environmentally associated with both mosquitoes and ticks. The larger number and diversity of bloodsucking artropoda present a potential risk of outbursts of arbovirus infections on the territory of the republic.

  3. Isolation of aerobic bacteria from ticks infested sheep in Iraq

    Directory of Open Access Journals (Sweden)

    Waleed Ibrahem Jalil

    2016-01-01

    Conclusions: The high isolation rate of aerobic pathogens from ticks might reflect the active contribution of this arthropod in environmental contamination and increase the probability of transmitting bacterial pathogens to their hosts.

  4. Efficacy of afoxolaner against Dermacentor variabilis ticks in dogs.

    Science.gov (United States)

    Mitchell, Elizabeth B; Dorr, Paul; Everett, William R; Chester, Theodore S; Larsen, Diane

    2014-04-02

    Efficacy of afoxolaner, a novel isoxazoline insecticide/acaricide, against Dermacentor variabilis ticks was confirmed in two laboratory studies. Each study utilized a controlled, randomized block design. One day prior to treatment, beagle dogs were infested with 50 unfed adult ticks. Repeat infestations were performed weekly for four weeks. The number of live ticks remaining on each dog was determined 48 h after treatment and after each subsequent infestation. A single oral treatment with a dose approaching the minimum effective dose of afoxolaner (2.5mg/kg) eliminated the pre-existing infestations by D. variabilis ticks and controlled weekly re-infestations with 99.7-100% efficacy up to Day 23 and >97% efficacy at Day 30.

  5. Scaling of wingbeat frequency with body mass in bats and limits to maximum bat size.

    Science.gov (United States)

    Norberg, Ulla M Lindhe; Norberg, R Åke

    2012-03-01

    The ability to fly opens up ecological opportunities but flight mechanics and muscle energetics impose constraints, one of which is that the maximum body size must be kept below a rather low limit. The muscle power available for flight increases in proportion to flight muscle mass and wingbeat frequency. The maximum wingbeat frequency attainable among increasingly large animals decreases faster than the minimum frequency required, so eventually they coincide, thereby defining the maximum body mass at which the available power just matches up to the power required for sustained aerobic flight. Here, we report new wingbeat frequency data for 27 morphologically diverse bat species representing nine families, and additional data from the literature for another 38 species, together spanning a range from 2.0 to 870 g. For these species, wingbeat frequency decreases with increasing body mass as M(b)(-0.26). We filmed 25 of our 27 species in free flight outdoors, and for these the wingbeat frequency varies as M(b)(-0.30). These exponents are strikingly similar to the body mass dependency M(b)(-0.27) among birds, but the wingbeat frequency is higher in birds than in bats for any given body mass. The downstroke muscle mass is also a larger proportion of the body mass in birds. We applied these empirically based scaling functions for wingbeat frequency in bats to biomechanical theories about how the power required for flight and the power available converge as animal size increases. To this end we estimated the muscle mass-specific power required for the largest flying extant bird (12-16 kg) and assumed that the largest potential bat would exert similar muscle mass-specific power. Given the observed scaling of wingbeat frequency and the proportion of the body mass that is made up by flight muscles in birds and bats, we estimated the maximum potential body mass for bats to be 1.1-2.3 kg. The largest bats, extinct or extant, weigh 1.6 kg. This is within the range expected if it

  6. Great tits search for, capture, kill and eat hibernating bats.

    Science.gov (United States)

    Estók, Péter; Zsebok, Sándor; Siemers, Björn M

    2010-02-23

    Ecological pressure paired with opportunism can lead to surprising innovations in animal behaviour. Here, we report predation of great tits (Parus major) on hibernating pipistrelle bats (Pipistrellus pipistrellus) at a Hungarian cave. Over two winters, we directly observed 18 predation events. The tits specifically and systematically searched for and killed bats for food. A substantial decrease in predation on bats after experimental provisioning of food to the tits further supports the hypothesis that bat-killing serves a foraging purpose in times of food scarcity. We finally conducted a playback experiment to test whether tits would eavesdrop on calls of awakening bats to find them in rock crevices. The tits could clearly hear the calls and were attracted to the loudspeaker. Records for tit predation on bats at this cave now span more than ten years and thus raise the question of whether cultural transmission plays a role for the spread of this foraging innovation.

  7. Electrolyte depletion in white-nose syndrome bats

    Science.gov (United States)

    Cryan, Paul M.; Meteyer, Carol Uphoff; Blehert, David S.; Lorch, Jeffrey M.; Reeder, DeeAnn M.; Turner, Gregory G.; Webb, Julie; Behr, Melissa; Verant, Michelle L.; Russell, Robin E.; Castle, Kevin T.

    2013-01-01

    The emerging wildlife disease white-nose syndrome is causing widespread mortality in hibernating North American bats. White-nose syndrome occurs when the fungus Geomyces destructans infects the living skin of bats during hibernation, but links between infection and mortality are underexplored. We analyzed blood from hibernating bats and compared blood electrolyte levels to wing damage caused by the fungus. Sodium and chloride tended to decrease as wing damage increased in severity. Depletion of these electrolytes suggests that infected bats may become hypotonically dehydrated during winter. Although bats regularly arouse from hibernation to drink during winter, water available in hibernacula may not contain sufficient electrolytes to offset winter losses caused by disease. Damage to bat wings from G. destructans may cause life-threatening electrolyte imbalances.

  8. Bartonella species in bat flies (Diptera: Nycteribiidae) from western Africa.

    Science.gov (United States)

    Billeter, S A; Hayman, D T S; Peel, A J; Baker, K; Wood, J L N; Cunningham, A; Suu-Ire, R; Dittmar, K; Kosoy, M Y

    2012-03-01

    Bat flies are obligate ectoparasites of bats and it has been hypothesized that they may be involved in the transmission of Bartonella species between bats. A survey was conducted to identify whether Cyclopodia greefi greefi (Diptera: Nycteribiidae) collected from Ghana and 2 islands in the Gulf of Guinea harbour Bartonella. In total, 137 adult flies removed from Eidolon helvum, the straw-coloured fruit bat, were screened for the presence of Bartonella by culture and PCR analysis. Bartonella DNA was detected in 91 (66·4%) of the specimens examined and 1 strain of a Bartonella sp., initially identified in E. helvum blood from Kenya, was obtained from a bat fly collected in Ghana. This is the first study, to our knowledge, to report the identification and isolation of Bartonella in bat flies from western Africa.

  9. Ticks (Acari: Ixodida) on wild carnivores in Brazil.

    Science.gov (United States)

    Labruna, Marcelo B; Jorge, Rodrigo S P; Sana, Dênis A; Jácomo, Anah Tereza A; Kashivakura, Cyntia K; Furtado, Mariana M; Ferro, Claudia; Perez, Samuel A; Silveira, Leandro; Santos, Tarcísio S; Marques, Samuel R; Morato, Ronaldo G; Nava, Alessandra; Adania, Cristina H; Teixeira, Rodrigo H F; Gomes, Albério A B; Conforti, Valéria A; Azevedo, Fernando C C; Prada, Cristiana S; Silva, Jean C R; Batista, Adriana F; Marvulo, Maria Fernanda V; Morato, Rose L G; Alho, Cleber J R; Pinter, Adriano; Ferreira, Patrícia M; Ferreira, Fernado; Barros-Battesti, Darci M

    2005-01-01

    The present study reports field data of ticks infesting wild carnivores captured from July 1998 to September 2004 in Brazil. Additional data were obtained from one tick collection and from previous published data of ticks on carnivores in Brazil. During field work, a total of 3437 ticks were collected from 89 Cerdocyon thous (crab-eating fox), 58 Chrysocyon brachyurus (maned wolf), 30 Puma concolor (puma), 26 Panthera onca (jaguar), 12 Procyon cancrivorus (crab-eating raccoon), 4 Speothos venaticus (bush dog), 6 Pseudalopex vetulus (hoary fox), 6 Nasua nasua (coati), 6 Leopardus pardalis (ocelot), 2 Leopardus tigrinus (oncilla), 1 Leopardus wiedii (margay), 1 Herpailurus yagouaroundi (jaguarundi), 1 Oncifelis colocolo (pampas cat), 1 Eira barbara (tayara), 1 Galictis vittata (grison), 1 Lontra longicaudis (neotropical otter), and 1 Potus flavus (kinkajou). Data obtained from the Acari Collection IBSP included a total of 381 tick specimens collected on 13 C. thous, 8 C. brachyurus, 3 P. concolor, 10 P. onca, 3 P. cancrivorus, 4 N. nasua, 1 L. pardalis, 1 L. wiedii, 4 H. yagouaroundi, 1 Galictis cuja (lesser grison), and 1 L. longicaudis. The only tick-infested carnivore species previously reported in Brazil, for which we do not present any field data are Pseudalopex gymnocercus (pampas fox), Conepatus chinga (Molina's hog-nosed skunk), and Conepatus semistriatus (striped hog-nosed skunk). We report the first tick records in Brazil on two Felidae species (O. colocolo, H. yagouaroundi), two Canidae species (P. vetulus, S. venaticus), one Procyonidae species (P. flavus) and one Mustelidae (E. barbara). Tick infestation remains unreported for 5 of the 26 Carnivora species native in Brazil: Oncifelis geoffroyi (Geoffroy's cat), Atelocynus microtis (short-eared dog), Pteronura brasiliensis (giant otter), Mustela africana (Amazon weasel), and Bassaricyon gabbii (olingo). Our field data comprise 16 tick species represented by the genera Amblyomma (12 species), Ixodes (1

  10. Investigation of tick vectors of Hepatozoon canis in Brazil.

    Science.gov (United States)

    Demoner, Larissa de Castro; Rubini, Adriano Stefani; Paduan, Karina dos Santos; Metzger, Betina; de Paula Antunes, João Marcelo Azevedo; Martins, Thiago Fenandes; Mathias, Maria Izabel Camargo; O'Dwyer, Lucia Helena

    2013-12-01

    Hepatozoon canis is a common apicomplexan parasite of dogs. In Brazil, in addition to Rhipicephalus sanguineus, Amblyomma ovale, Amblyomma cajennense, and Rhipicephalus (Boophilus) microplus have been suggested to act as vectors. The present study aimed to evaluate, under controlled conditions, the acquisition of H. canis by A. ovale, R. sanguineus, and A. cajennense after feeding on naturally infected dogs. Cytological and histophatological examinations were performed to recover oocysts and other sporogonic stages of the protozoan from the experimentally infected nymphs and adults. None of the R. sanguineus (n=30) or A. cajennense nymphs (n=15) that were dissected after feeding on H. canis naturally infected dogs became infected by the hemoparasite. Likewise, none of the R. sanguineus (n=165) and A. cajennense (n=114) adult ticks that were fed as nymphs on dogs demonstrated infection. Additionally, A. cajennense adult ticks were incapable of acquiring the infection, since no parasite was found in 62 adults that fed on H. canis-infected dogs. With regard to A. ovale ticks, 2 different infestations were carried out. Firstly, a dog with naturally occurring hepatozoonosis was infested with A. ovale adults originating from Rondônia, Brazil. Ticks fed to full engorgement. A total of 31 adults was collected from the dog and dissected on the third day after natural detachment. Oocysts were detected in 13 (42%) of the ticks. The second experimental infestation was carried out using adult ticks originating from São Paulo, Brazil. Surprisingly, of the 103 dissected ticks, only one (1%) contained oocysts in the hemocoel. No other sporogonic stage was found. Results indicate that different strains of A. ovale ticks may exist in Brazil with different susceptibilities to pathogens. Furthermore, it is possible that R. sanguineus and A. cajennense have little or no importance in the transmission of H. canis in rural areas of Brazil.

  11. Hormonal-Pheromonal Interrelationships in Ticks and Parasitic Mites.

    Science.gov (United States)

    1986-12-01

    chromosomes. Spermatogenesis is slightly delayed in this reptile feeding tick when compared to other Amblyomma that feed on mammals. A. aissimile normally...stages and the pro- cesses of spermatogenesis and spermiogenesis..-The number of chromosomes, auto- somes vs. sex chromosomes, and the genetics...have discovered another regu- latory role of 20-OH ecdysone. Evidence to be presented later suggests that ~5 it triggers spermatogenesis in ticks

  12. Causes of bat fatalities at wind turbines: Hypotheses and predictions

    Science.gov (United States)

    Cryan, P.M.; Barclay, R.M.R.

    2009-01-01

    Thousands of industrial-scale wind turbines are being built across the world each year to meet the growing demand for sustainable energy. Bats of certain species are dying at wind turbines in unprecedented numbers. Species of bats consistently affected by turbines tend to be those that rely on trees as roosts and most migrate long distances. Although considerable progress has been made in recent years toward better understanding the problem, the causes of bat fatalities at turbines remain unclear. In this synthesis, we review hypothesized causes of bat fatalities at turbines. Hypotheses of cause fall into 2 general categoriesproximate and ultimate. Proximate causes explain the direct means by which bats die at turbines and include collision with towers and rotating blades, and barotrauma. Ultimate causes explain why bats come close to turbines and include 3 general types: random collisions, coincidental collisions, and collisions that result from attraction of bats to turbines. The random collision hypothesis posits that interactions between bats and turbines are random events and that fatalities are representative of the bats present at a site. Coincidental hypotheses posit that certain aspects of bat distribution or behavior put them at risk of collision and include aggregation during migration and seasonal increases in flight activity associated with feeding or mating. A surprising number of attraction hypotheses suggest that bats might be attracted to turbines out of curiosity, misperception, or as potential feeding, roosting, flocking, and mating opportunities. Identifying, prioritizing, and testing hypothesized causes of bat collisions with wind turbines are vital steps toward developing practical solutions to the problem. ?? 2009 American Society of Mammalogists.

  13. Diseases in free-ranging bats from Germany

    Directory of Open Access Journals (Sweden)

    Wibbelt Gudrun

    2011-10-01

    Full Text Available Abstract Background The emergence of important viral diseases and their potential threat to humans has increased the interest in bats as potential reservoir species. Whereas the majority of studies determined the occurrence of specific zoonotic agents in chiropteran species, little is known about actual bat pathogens and impacts of disease on bat mortality. Combined pathological and microbiological investigations in free-ranging bats are sparse and often limited by small sample sizes. In the present study about 500 deceased bats of 19 European species (family Vespertilionidae were subjected to a post-mortem examination followed by histo-pathological and bacteriological investigations. The bat carcasses originated from different geographical regions in Germany and were collected by bat researchers and bat rehabilitation centers. Results Pathological examination revealed inflammatory lesions in more than half of the investigated bats. Lung was the predominantly affected organ (40% irrespective of bat species, sex and age. To a lesser extent non-inflammatory organ tissue changes were observed. Comparative analysis of histo-pathology and bacteriology results identified 22 different bacterial species that were clearly associated with pathological lesions. Besides disease-related mortality, traumatic injuries represented an additional major cause of death. Here, attacks by domestic cats accounted for almost a half of these cases. Conclusions The present study shows that free-ranging bats not only serve as a reservoir of infectious agents, they are also vulnerable to various infectious diseases. Some of these microbial agents have zoonotic potential, but there is no evidence that European bats would pose a higher health hazard risk to humans in comparison to other wildlife.

  14. Leishmania (L.) mexicana Infected Bats in Mexico: Novel Potential Reservoirs

    Science.gov (United States)

    Berzunza-Cruz, Miriam; Rodríguez-Moreno, Ángel; Gutiérrez-Granados, Gabriel; González-Salazar, Constantino; Stephens, Christopher R.; Hidalgo-Mihart, Mircea; Marina, Carlos F.; Rebollar-Téllez, Eduardo A.; Bailón-Martínez, Dulce; Balcells, Cristina Domingo; Ibarra-Cerdeña, Carlos N.; Sánchez-Cordero, Víctor; Becker, Ingeborg

    2015-01-01

    Leishmania (Leishmania) mexicana causes cutaneous leishmaniasis, an endemic zoonosis affecting a growing number of patients in the southeastern states of Mexico. Some foci are found in shade-grown cocoa and coffee plantations, or near perennial forests that provide rich breeding grounds for the sand fly vectors, but also harbor a variety of bat species that live off the abundant fruits provided by these shade-giving trees. The close proximity between sand flies and bats makes their interaction feasible, yet bats infected with Leishmania (L.) mexicana have not been reported. Here we analyzed 420 bats from six states of Mexico that had reported patients with leishmaniasis. Tissues of bats, including skin, heart, liver and/or spleen were screened by PCR for Leishmania (L.) mexicana DNA. We found that 41 bats (9.77%), belonging to 13 species, showed positive PCR results in various tissues. The infected tissues showed no evidence of macroscopic lesions. Of the infected bats, 12 species were frugivorous, insectivorous or nectarivorous, and only one species was sanguivorous (Desmodus rotundus), and most of them belonged to the family Phyllostomidae. The eco-region where most of the infected bats were caught is the Gulf Coastal Plain of Chiapas and Tabasco. Through experimental infections of two Tadarida brasiliensis bats in captivity, we show that this species can harbor viable, infective Leishmania (L.) mexicana parasites that are capable of infecting BALB/c mice. We conclude that various species of bats belonging to the family Phyllostomidae are possible reservoir hosts for Leishmania (L.) mexicana, if it can be shown that such bats are infective for the sand fly vector. Further studies are needed to determine how these bats become infected, how long the parasite remains viable inside these potential hosts and whether they are infective to sand flies to fully evaluate their impact on disease epidemiology. PMID:25629729

  15. Leishmania (L. mexicana infected bats in Mexico: novel potential reservoirs.

    Directory of Open Access Journals (Sweden)

    Miriam Berzunza-Cruz

    2015-01-01

    Full Text Available Leishmania (Leishmania mexicana causes cutaneous leishmaniasis, an endemic zoonosis affecting a growing number of patients in the southeastern states of Mexico. Some foci are found in shade-grown cocoa and coffee plantations, or near perennial forests that provide rich breeding grounds for the sand fly vectors, but also harbor a variety of bat species that live off the abundant fruits provided by these shade-giving trees. The close proximity between sand flies and bats makes their interaction feasible, yet bats infected with Leishmania (L. mexicana have not been reported. Here we analyzed 420 bats from six states of Mexico that had reported patients with leishmaniasis. Tissues of bats, including skin, heart, liver and/or spleen were screened by PCR for Leishmania (L. mexicana DNA. We found that 41 bats (9.77%, belonging to 13 species, showed positive PCR results in various tissues. The infected tissues showed no evidence of macroscopic lesions. Of the infected bats, 12 species were frugivorous, insectivorous or nectarivorous, and only one species was sanguivorous (Desmodus rotundus, and most of them belonged to the family Phyllostomidae. The eco-region where most of the infected bats were caught is the Gulf Coastal Plain of Chiapas and Tabasco. Through experimental infections of two Tadarida brasiliensis bats in captivity, we show that this species can harbor viable, infective Leishmania (L. mexicana parasites that are capable of infecting BALB/c mice. We conclude that various species of bats belonging to the family Phyllostomidae are possible reservoir hosts for Leishmania (L. mexicana, if it can be shown that such bats are infective for the sand fly vector. Further studies are needed to determine how these bats become infected, how long the parasite remains viable inside these potential hosts and whether they are infective to sand flies to fully evaluate their impact on disease epidemiology.

  16. Prevalence of Tick Infestation and Theileriosis in Sheep and Goats

    Directory of Open Access Journals (Sweden)

    Nausheen Irshad, M. Qayyum, M. Hussain1 and M. Qasim Khan1*

    2010-07-01

    Full Text Available The present study was carried out to determine the prevalence of tick infestation and theileriosis in small ruminants maintained at National Agricultural Research Centre (NARC Islamabad and Barani Livestock Production Research Institute (BLPRI Kherimurat district Attock, Pakistan. A total of 662 animals (219 sheep and 443 goats were screened for the presence of ticks. Of these, 95(43.37% sheep and 184(41.53% goats were found infested with different species of ticks. The difference in prevalence of ticks between two farms in sheep and goats (combined was statistically significant (P≤0.01. Difference in the prevalence during different months of study at NARC was non significant (χ2=0.95596, whereas at BLPRI this difference was significant (P≤ 0.01. Ticks were identified on the basis of their morphological features. Rhipicephalus spp was found to be the most abundant tick infesting both in sheep and goats. Prevalence of theileriosis in sheep was 7.36% (7/95, while in goats it was 3.8% (7/184, the difference being statistically non significant (χ2=0.6427.

  17. Accelerated phenology of blacklegged ticks under climate warming

    Science.gov (United States)

    Levi, Taal; Keesing, Felicia; Oggenfuss, Kelly; Ostfeld, Richard S.

    2015-01-01

    The phenology of tick emergence has important implications for the transmission of tick-borne pathogens. A long lag between the emergence of tick nymphs in spring and larvae in summer should increase transmission of persistent pathogens by allowing infected nymphs to inoculate the population of naive hosts that can subsequently transmit the pathogen to larvae to complete the transmission cycle. In contrast, greater synchrony between nymphs and larvae should facilitate transmission of pathogens that do not produce long-lasting infections in hosts. Here, we use 19 years of data on blacklegged ticks attached to small-mammal hosts to quantify the relationship between climate warming and tick phenology. Warmer years through May and August were associated with a nearly three-week advance in the phenology of nymphal and larval ticks relative to colder years, with little evidence of increased synchrony. Warmer Octobers were associated with fewer larvae feeding concurrently with nymphs during the following spring. Projected warming by the 2050s is expected to advance the timing of average nymph and larva activity by 8–11 and 10–14 days, respectively. If these trends continue, climate warming should maintain or increase transmission of persistent pathogens, while it might inhibit pathogens that do not produce long-lasting infections. PMID:25688016

  18. Ixodid Ticks (Acari, Ixodidae in Urban Landscapes. A review

    Directory of Open Access Journals (Sweden)

    Akimov I. А.

    2016-04-01

    Full Text Available This study presents the results of content analysis of published works on ixodid ticks in urban conditions in order to determine the species diversity, the vectors of research interests at various stages. Information about ticks in the cities up to the 1980s is incidental, to the point of exclusive, after this point there is targeted research in urban landscapes. There are 106 or 15 % of hard ticks of the world fauna registered in the urban territory, 26 species or 3.7 % being the most abundant. Of the urban hard tick species, 23 (88.5 % can attack humans, and 12 species are the most adapted to the urban landscape: Ixodes ricinus, I. persulcatus, Dermacentor reticulatus, D. marginatus, I. pavlovskyi, I. scapularis (dammini, Amblyomma cajennense, Haemaphysalis longicornis, I. hexagonus, Hyalomma marginatum, Am. americanum, and Rhipicephalus sanguineus. It was determined that the most likely causes of the growing number of publications on ixodids urban landscapes are: global accelerating urbanization, the development of recreational areas, the development of green tourism, the growth of the prestige of outdoor recreation, the creation of new, especially of the landscape parks and a tendency to preserve the native landscape in the cities, a significant increase in the density of populations of common species of hard ticks adapted to living in urban environment. The vectors of further work in urban landscapes will be directed to exact planning of monitoring studies of ixodids and associated tick-borne infections.

  19. Transstadial transmission of Borrelia turcica in Hyalomma aegyptium ticks.

    Science.gov (United States)

    Kalmár, Zsuzsa; Cozma, Vasile; Sprong, Hein; Jahfari, Setareh; D'Amico, Gianluca; Mărcuțan, Daniel I; Ionică, Angela M; Magdaş, Cristian; Modrý, David; Mihalca, Andrei D

    2015-01-01

    Borrelia turcica comprises the third major group of arthropod-transmitted borreliae and is phylogenetically divergent from other Borrelia groups. The novel group of Borrelia was initially isolated from Hyalomma aegyptium ticks in Turkey and it was recently found in blood and multiple organs of tortoises exported from Jordan to Japan. However, the ecology of these spirochetes and their development in ticks or the vertebrate hosts were not investigated in detail; our aims were to isolate the pathogen and to evaluate the possibility of transstadial transmission of Borrelia turcica by H. aegyptium ticks. Ticks were collected from Testudo graeca tortoises during the summer of 2013 from southeastern Romania. Engorged nymphs were successfully molted to the adult stage. Alive B. turcica was isolated from molted ticks by using Barbour-Stoenner-Kelly (BSK) II medium. Four pure cultures of spirochetes were obtained and analyzed by PCR and sequencing. Sequence analysis of glpQ, gyrB and flaB revealed 98%-100% similarities with B. turcica. H. aegyptium ticks collected from T. graeca tortoises were able to pass the infection with B. turcica via transstadial route, suggesting its vectorial capacity.

  20. Molecular detection of Babesia spp. in ticks in northern Serbia

    Directory of Open Access Journals (Sweden)

    Mihaljica D.

    2012-01-01

    Full Text Available In order to evaluate the prevalence rate of Babesia spp. in ticks collected from vegetation at seven localities in northern Serbia, tick samples were subjected to molecular analysis. A total of 132 unfed adult ticks of five different species (Dermacentor marginatus, Dermacentor reticulatus, Ixodes ricinus, Haemaphysalis concinna and Haemaphysalis punctata, were examined by PCR for the presence of Babesia spp. Out of the analyzed ticks, 10.61% (14/132 were positive for babesial DNA. The presence of babesiae was found at the localities Pančevački Rit, Titov Gaj, Makiš, PKB and Kljajićevo. Prevalence in D. reticulatus ticks was 21.57% (11/51 and in H. concinna ticks, 8.57% (3/35. Sequencing and phylogenetic analysis showed a clustering of the obtained sequences with those of B. canis from the GenBank database. These results add to the knowledge of the distribution of babesial pathogens and their vectors in Serbia. [Projekat Ministarstva nauke Republike Srbije, br. ON 173006

  1. An Immunosuppressant Peptide from the Hard Tick Amblyomma variegatum

    Directory of Open Access Journals (Sweden)

    Yufeng Tian

    2016-05-01

    Full Text Available Ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1–2 weeks to obtain blood meals. Thus, they must secrete many immunosuppressant factors to combat the hosts’ immune system. In the present work, we investigated an immunosuppressant peptide of the hard tick Amblyomma variegatum. This peptide, named amregulin, is composed of 40 residues with an amino acid sequence of HLHMHGNGATQVFKPRLVLKCPNAAQLIQPGKLQRQLLLQ. A cDNA of the precursor peptide was obtained from the National Center for Biotechnology Information (NCBI, Bethesda, MD, USA. In rat splenocytes, amregulin exerts significant anti-inflammatory effects by inhibiting the secretion of inflammatory factors in vitro, such as tumor necrosis factor-alpha (TNF-α, interleukin-1 (IL-1, interleukin-8 (IL-8 and interferon-gamma (IFN-γ. In rat splenocytes, treated with amregulin, compared to lipopolysaccharide (LPS alone, the inhibition of the above inflammatory factors was significant at all tested concentrations (2, 4 and 8 µg/mL. Amregulin shows strong free radical scavenging and antioxidant activities (5, 10 and 20 µg/mL in vitro. Amregulin also significantly inhibits adjuvant-induced paw inflammation in mouse models in vivo. This peptide may facilitate the ticks’ successful blood feeding and may lead to host immunotolerance of the tick. These findings have important implications for the understanding of tick-host interactions and the co-evolution between ticks and the viruses that they bear.

  2. Accelerated phenology of blacklegged ticks under climate warming.

    Science.gov (United States)

    Levi, Taal; Keesing, Felicia; Oggenfuss, Kelly; Ostfeld, Richard S

    2015-04-01

    The phenology of tick emergence has important implications for the transmission of tick-borne pathogens. A long lag between the emergence of tick nymphs in spring and larvae in summer should increase transmission of persistent pathogens by allowing infected nymphs to inoculate the population of naive hosts that can subsequently transmit the pathogen to larvae to complete the transmission cycle. In contrast, greater synchrony between nymphs and larvae should facilitate transmission of pathogens that do not produce long-lasting infections in hosts. Here, we use 19 years of data on blacklegged ticks attached to small-mammal hosts to quantify the relationship between climate warming and tick phenology. Warmer years through May and August were associated with a nearly three-week advance in the phenology of nymphal and larval ticks relative to colder years, with little evidence of increased synchrony. Warmer Octobers were associated with fewer larvae feeding concurrently with nymphs during the following spring. Projected warming by the 2050s is expected to advance the timing of average nymph and larva activity by 8-11 and 10-14 days, respectively. If these trends continue, climate warming should maintain or increase transmission of persistent pathogens, while it might inhibit pathogens that do not produce long-lasting infections.

  3. Biological and ecological characteristics of soft ticks (Ixodida: Argasidae and their impact for predicting tick and associated disease distribution

    Directory of Open Access Journals (Sweden)

    Vial L.

    2009-09-01

    Full Text Available As evidence of global changes is accumulating, scientists are challenged to detect distribution changes of vectors, reservoirs and pathogens caused by anthropogenic and/or environmental changes. Statistical and mathematical distribution models are emerging for ixodid hard ticks whereas no prediction has ever been developed for argasid ones. These last organisms remain unknown and under-reported; they differ from hard ticks by many structural, biological and ecological properties, which complicate direct adaptation of hard tick models. However, investigations on bibliographic resources concerning these ticks suggest that distribution modelling based on natural niche concept and using environmental factors especially climate is also possible, bearing in mind the scale of prediction and their specificities including their nidicolous lifestyle, an indiscriminate host feeding and a short bloodmeal duration, as well as a flexible development cycle through diapause periods.

  4. Sensorimotor Model of Obstacle Avoidance in Echolocating Bats.

    Directory of Open Access Journals (Sweden)

    Dieter Vanderelst

    2015-10-01

    Full Text Available Bat echolocation is an ability consisting of many subtasks such as navigation, prey detection and object recognition. Understanding the echolocation capabilities of bats comes down to isolating the minimal set of acoustic cues needed to complete each task. For some tasks, the minimal cues have already been identified. However, while a number of possible cues have been suggested, little is known about the minimal cues supporting obstacle avoidance in echolocating bats. In this paper, we propose that the Interaural Intensity Difference (IID and travel time of the first millisecond of the echo train are sufficient cues for obstacle avoidance. We describe a simple control algorithm based on the use of these cues in combination with alternating ear positions modeled after the constant frequency bat Rhinolophus rouxii. Using spatial simulations (2D and 3D, we show that simple phonotaxis can steer a bat clear from obstacles without performing a reconstruction of the 3D layout of the scene. As such, this paper presents the first computationally explicit explanation for obstacle avoidance validated in complex simulated environments. Based on additional simulations modelling the FM bat Phyllostomus discolor, we conjecture that the proposed cues can be exploited by constant frequency (CF bats and frequency modulated (FM bats alike. We hypothesize that using a low level yet robust cue for obstacle avoidance allows bats to comply with the hard real-time constraints of this basic behaviour.

  5. Bat white-nose syndrome: An emerging fungal pathogen?

    Science.gov (United States)

    Blehert, D.S.; Hicks, A.C.; Behr, M.; Meteyer, C.U.; Berlowski-Zier, B. M.; Buckles, E.L.; Coleman, J.T.H.; Darling, S.R.; Gargas, A.; Niver, R.; Okoniewski, J.C.; Rudd, R.J.; Stone, W.B.

    2009-01-01

    White-nose syndrome (WNS) is a condition associated with an unprecedented bat mortality event in the northeastern United States. Since the winter of 2006*2007, bat declines exceeding 75% have been observed at surveyed hibernacula. Affected bats often present with visually striking white fungal growth on their muzzles, ears, and/or wing membranes. Direct microscopy and culture analyses demonstrated that the skin of WNS-affected bats is colonized by a psychro-philic fungus that is phylogenetically related to Geomyces spp. but with a conidial morphology distinct from characterized members of this genus. This report characterizes the cutaneous fungal infection associated with WNS.

  6. Evolutionary change in the brain size of bats.

    Science.gov (United States)

    Yao, Lu; Brown, J-P; Stampanoni, Marco; Marone, Federica; Isler, Karin; Martin, Robert D

    2012-01-01

    It has been widely recognized that mammal brain size predominantly increases over evolutionary time. Safi et al. [Biol Lett 2005;1:283-286] questioned the generality of this trend, arguing that brain size evolution among bats involved reduction in multiple lineages as well as enlargement in others. Our study explored the direction of change in the evolution of bat brain size by estimating brain volume in fossil bats, using synchrotron radiation X-ray tomographic microscopy. Virtual endocasts were generated from 2 Hipposideros species: 3 specimens of Oligocene Hipposideros schlosseri (∼35 Ma) and 3 of Miocene Hipposideros bouziguensis (∼20 Ma). Upper molar tooth dimensions (M(2) length × width) collected for 43 extant insectivorous bat species were used to derive empirical formulae to estimate body mass in the fossil bats. Brain size was found to be relatively smaller in the fossil bats than in the average extant bat both with raw data and after allowing for phylogenetic inertia. Phylogenetic modeling of ancestral relative brain size with and without fossil bats confirmed a general trend towards evolutionary increase in this bat lineage.

  7. Bat white-nose syndrome: an emerging fungal pathogen?

    Science.gov (United States)

    Blehert, David S; Hicks, Alan C; Behr, Melissa; Meteyer, Carol U; Berlowski-Zier, Brenda M; Buckles, Elizabeth L; Coleman, Jeremy T H; Darling, Scott R; Gargas, Andrea; Niver, Robyn; Okoniewski, Joseph C; Rudd, Robert J; Stone, Ward B

    2009-01-09

    White-nose syndrome (WNS) is a condition associated with an unprecedented bat mortality event in the northeastern United States. Since the winter of 2006*2007, bat declines exceeding 75% have been observed at surveyed hibernacula. Affected bats often present with visually striking white fungal growth on their muzzles, ears, and/or wing membranes. Direct microscopy and culture analyses demonstrated that the skin of WNS-affected bats is colonized by a psychrophilic fungus that is phylogenetically related to Geomyces spp. but with a conidial morphology distinct from characterized members of this genus. This report characterizes the cutaneous fungal infection associated with WNS.

  8. Suppression of emission rates improves sonar performance by flying bats.

    Science.gov (United States)

    Adams, Amanda M; Davis, Kaylee; Smotherman, Michael

    2017-01-31

    Echolocating bats face the challenge of actively sensing their environment through their own emissions, while also hearing calls and echoes of nearby conspecifics. How bats mitigate interference is a long-standing question that has both ecological and technological implications, as biosonar systems continue to outperform man-made sonar systems in noisy, cluttered environments. We recently showed that perched bats decreased calling rates in groups, displaying a behavioral strategy resembling the back-off algorithms used in artificial communication networks to optimize information throughput at the group level. We tested whether free-tailed bats (Tadarida brasiliensis) would employ such a coordinated strategy while performing challenging flight maneuvers, and report here that bats navigating obstacles lowered emission rates when hearing artificial playback of another bat's calls. We measured the impact of acoustic interference on navigation performance and show that the calculated reductions in interference rates are sufficient to reduce interference and improve obstacle avoidance. When bats flew in pairs, each bat responded to the presence of the other as an obstacle by increasing emissions, but hearing the sonar emissions of the nearby bat partially suppressed this response. This behavior supports social cohesion by providing a key mechanism for minimizing mutual interference.

  9. Bats and Emerging Infections: An Ecological and Virological Puzzle.

    Science.gov (United States)

    Serra-Cobo, Jordi; López-Roig, Marc

    2016-10-09

    More than 200 viruses have been detected in bats. Some unique bat characteristics can explain the roles played in the maintenance and transmission of viruses: long phylogenetic history can have originated coevolution processes, great number of species are adapted to live in different environments, big mobility, long lifespan and gregarious behaviour of many species.To analyse zoonoses long longitudinal studies are needed with a multidisciplinary approximation to obtain the following eco-epidemiological data: colony size, number of bats per species, population structure, behaviour of each species, degree of contact between bats, social structure, remaining time of bats in the colony, colony type, foraging area, turnover rate of individuals, shelter temperature, relationship with other colonies and co-infection processes. These data allows assessing the epidemiological risk and which preventive measures are necessary to take.The structure and functionality of ecosystems are changing worldwide at an unprecedented rate and can modify the interactions between humans and infected bats. There are more or less local factors that can affect the emergence and spread of diseases (environmental alterations, changes in land use, human population growth, changes in human socioeconomic behavior or social structure, people mobility increase, trade increase, forest fires, extreme weather events, wars, breakdown in public health infrastructure, etc.).Twenty-three percent of all bat species in the world are decreasing. How does the regression of bat species affect the dynamic of viruses? The dichotomy between health risk and bat preservation is compatible with a preventive task based on more information and training.

  10. Neotropical Bats from Costa Rica harbour Diverse Coronaviruses.

    Science.gov (United States)

    Moreira-Soto, A; Taylor-Castillo, L; Vargas-Vargas, N; Rodríguez-Herrera, B; Jiménez, C; Corrales-Aguilar, E

    2015-11-01

    Bats are hosts of diverse coronaviruses (CoVs) known to potentially cross the host-species barrier. For analysing coronavirus diversity in a bat species-rich country, a total of 421 anal swabs/faecal samples from Costa Rican bats were screened for CoV RNA-dependent RNA polymerase (RdRp) gene sequences by a pancoronavirus PCR. Six families, 24 genera and 41 species of bats were analysed. The detection rate for CoV was 1%. Individuals (n = 4) from four different species of frugivorous (Artibeus jamaicensis, Carollia perspicillata and Carollia castanea) and nectivorous (Glossophaga soricina) bats were positive for coronavirus-derived nucleic acids. Analysis of 440 nt. RdRp sequences allocated all Costa Rican bat CoVs to the α-CoV group. Several CoVs sequences clustered near previously described CoVs from the same species of bat, but were phylogenetically distant from the human CoV sequences identified to date, suggesting no recent spillover events. The Glossophaga soricina CoV sequence is sufficiently dissimilar (26% homology to the closest known bat CoVs) to represent a unique coronavirus not clustering near other CoVs found in the same bat species so far, implying an even higher CoV diversity than previously suspected.

  11. Host and viral ecology determine bat rabies seasonality and maintenance.

    Science.gov (United States)

    George, Dylan B; Webb, Colleen T; Farnsworth, Matthew L; O'Shea, Thomas J; Bowen, Richard A; Smith, David L; Stanley, Thomas R; Ellison, Laura E; Rupprecht, Charles E

    2011-06-21

    Rabies is an acute viral infection that is typically fatal. Most rabies modeling has focused on disease dynamics and control within terrestrial mammals (e.g., raccoons and foxes). As such, rabies in bats has been largely neglected until recently. Because bats have been implicated as natural reservoirs for several emerging zoonotic viruses, including SARS-like corona viruses, henipaviruses, and lyssaviruses, understanding how pathogens are maintained within a population becomes vital. Unfortunately, little is known about maintenance mechanisms for any pathogen in bat populations. We present a mathematical model parameterized with unique data from an extensive study of rabies in a Colorado population of big brown bats (Eptesicus fuscus) to elucidate general maintenance mechanisms. We propose that life history patterns of many species of temperate-zone bats, coupled with sufficiently long incubation periods, allows for rabies virus maintenance. Seasonal variability in bat mortality rates, specifically low mortality during hibernation, allows long-term bat population viability. Within viable bat populations, sufficiently long incubation periods allow enough infected individuals to enter hibernation and survive until the following year, and hence avoid an epizootic fadeout of rabies virus. We hypothesize that the slowing effects of hibernation on metabolic and viral activity maintains infected individuals and their pathogens until susceptibles from the annual birth pulse become infected and continue the cycle. This research provides a context to explore similar host ecology and viral dynamics that may explain seasonal patterns and maintenance of other bat-borne diseases.

  12. Communal farmers' perceptions of tick-borne diseases affecting cattle and investigation of tick control methods practiced in Zimbabwe.

    Science.gov (United States)

    Sungirai, Marvelous; Moyo, Doreen Zandile; De Clercq, Patrick; Madder, Maxime

    2016-02-01

    Tick borne diseases (TBDs) are responsible for huge economic losses in cattle production in most African countries where the majority of cattle owners are the resource poor communal farmers. Governments have initiated and co-ordinate tick control programs with farmers required to contribute funds for their sustenance. The success of these programs will hinge upon the involvement of communal farmers in their design, implementation and evaluation. To this end, 313 communal farmers (approximately 8.4% response rate) were interviewed and 3 focus group discussions were carried out in the southern low-veld part of Zimbabwe with the objectives of investigating communal farmers' perceptions on TBDs affecting cattle, level of participation in government initiated tick control programs, other tick control methods practiced, types of acaricides used and their perceived effectiveness. There was a general awareness of TBDs with 67.7% (n=212) farmers being able to describe tick diseases with names or clinical and post-mortem signs. The diseases or problems frequently associated with ticks were cowdriosis (38%, n=119), mastitis (36.7%, n=115), anaplasmosis (36.1%, n=113), body damage (28.4%, n=89), babesiosis (24.6%, n=77) and poor body condition (16.6%, n=52). Cattle mortalities due to TBDs were reported by 23.8% (n=74) of the farmers. The plunge dip was consistently used by farmers (70.3%, n=220) to control ticks. Other tick control methods practiced were the hand spraying (67.4%, n=211), hand dressing (16.6%, n=52), traditional methods (5.4%, n=17), use of pour-ons (4.5%, n=14) and smearing (2.2%, n=7). The formamidines were the most common class of acaricide used (59.4%, n=186), followed by synthetic pyrethroids (29.1%, n=91), macro cyclic lactones (12.8%, n=40) and organophosphates (4.5%, n=14). Most farmers (75.2%, n=231) perceived these acaricides to be effective in controlling ticks. The results of focus group discussions showed that a number of factors influenced the

  13. Identifying Hendra virus diversity in pteropid bats.

    Directory of Open Access Journals (Sweden)

    Ina Smith

    Full Text Available Hendra virus (HeV causes a zoonotic disease with high mortality that is transmitted to humans from bats of the genus Pteropus (flying foxes via an intermediary equine host. Factors promoting spillover from bats to horses are uncertain at this time, but plausibly encompass host and/or agent and/or environmental factors. There is a lack of HeV sequence information derived from the natural bat host, as previously sequences have only been obtained from horses or humans following spillover events. In order to obtain an insight into possible variants of HeV circulating in flying foxes, collection of urine was undertaken in multiple flying fox roosts in Queensland, Australia. HeV was found to be geographically widespread in flying foxes with a number of HeV variants circulating at the one time at multiple locations, while at times the same variant was found circulating at disparate locations. Sequence diversity within variants allowed differentiation on the basis of nucleotide changes, and hypervariable regions in the genome were identified that could be used to differentiate circulating variants. Further, during the study, HeV was isolated from the urine of flying foxes on four occasions from three different locations. The data indicates that spillover events do not correlate with particular HeV isolates, suggesting that host and/or environmental factors are the primary determinants of bat-horse spillover. Thus future spillover events are likely to occur, and there is an on-going need for effective risk management strategies for both human and animal health.

  14. Bats of the Western Indian Ocean Islands

    Directory of Open Access Journals (Sweden)

    John O’Brien

    2011-08-01

    Full Text Available The natural colonisation of many remote oceanic islands by bats, including those of the western Indian Ocean, has been facilitated by their unique capability among mammals for powered flight. In the western Indian Ocean region, only the Malagasy islands of Madagascar and the Comoros archipelago have been naturally colonised by non-volant mammals. Despite their greater potential for inter-island dispersal, and thus gene transfer, endemicity of Chiroptera in the western Indian Ocean islands is high. Given their vulnerability to stochastic and anthropogenic disturbances, greater focus needs to be placed on investigating the demographic and ecological history of bats on Western Indian Ocean islands to safeguard not only their future, but also the ecosystem functioning on these islands, for which they are undoubtedly such an integral part. Here, I summarise the taxonomic and life history information available on bats from Western Indian Ocean islands and highlight knowledge gaps and conservation issues that threaten the continued persistence of some species.

  15. An autocorrelation model of bat sonar.

    Science.gov (United States)

    Wiegrebe, Lutz

    2008-06-01

    Their sonar system allows echolocating bats to navigate with high skill through a complex, three- dimensional environment at high speed and low light. The auditory analysis of the echoes of their ultrasonic sounds requires a detailed comparison of the emission and echoes. Here an auditory model of bat sonar is introduced and evaluated against a set of psychophysical phantom-target, echo-acoustic experiments. The model consists of a relatively detailed simulation of auditory peripheral processing in the bat, Phyllostomus discolor, followed by a functional module consisting of a strobed, normalised, autocorrelation in each frequency channel. The model output is accumulated in a sonar image buffer. The model evaluation is based on the comparison of the image-buffer contents generated in individually simulated psychophysical trials. The model provides reasonably good predictions for both temporal and spectral behavioural sonar processing in terms of sonar delay-, roughness, and phase sensitivity and in terms of sensitivity to the temporal separations in two-front targets and the classification of spectrally divergent phantom targets.

  16. [Geographic data for Neotropical bats (Chiroptera)].

    Science.gov (United States)

    Noguera-Urbano, Elkin A; Escalante, Tania

    2014-03-01

    The global effort to digitize biodiversity occurrence data from collections, museums and other institutions has stimulated the development of important tools to improve the knowledge and conservation of biodiversity. The Global Biodiversity Information Facility (GBIF) enables and opens access to biodiversity data of 321 million of records, from 379 host institutions. Neotropical bats are a highly diverse and specialized group, and the geographic information about them is increasing since few years ago, but there are a few reports about this topic. The aim of this study was to analyze the number of digital records in GBIF of Neotropical bats with distribution in 21 American countries, evaluating their nomenclatural and geographical consistence at scale of country. Moreover, we evaluated the gaps of information on 1 degrees latitude x 1 degrees longitude grids cells. There were over 1/2 million records, but 58% of them have no latitude and longitude data; and 52% full fit nomenclatural and geographic evaluation. We estimated that there are no records in 54% of the analyzed area; the principal gaps are in biodiversity hotspots like the Colombian and Brazilian Amazonia and Southern Venezuela. In conclusion, our study suggests that available data on GBIF have nomenclatural and geographic biases. GBIF data represent partially the bat species richness and the main gaps in information are in South America.

  17. Visual-Motor Control in Baseball Batting

    Directory of Open Access Journals (Sweden)

    Rob Gray

    2011-05-01

    Full Text Available With margins for error of a few milliseconds and fractions of an inch it is not surprising that hitting a baseball is considered to be one of the most difficult acts in all of sports. We have been investigating this challenging behavior using a virtual baseball batting setup in which simulations of an approaching ball, pitcher, and field are combined with real-time recording of bat and limb movements. I will present evidence that baseball batting involves variable pre-programmed control in which the swing direction and movement time (MT are set prior to the initiation of the action but can take different values from swing-to-swing. This programming process utilizes both advance information (pitch history and count and optical information picked-up very early in the ball's flight (ball time to contact TTC and rotation direction. The pre-programmed value of MT is used to determine a critical value of TTC for swing initiation. Finally, because a baseball swing is an action that is occasionally interrupted online (i.e., a “check swing”, I will discuss experiments that examine when this pre-programmed action can be stopped and the sources of optical information that trigger stopping.

  18. Ecological preferences of exophilic and endophilic ticks (Acari: Ixodidae) parasitizing wild carnivores in the Iberian Peninsula.

    Science.gov (United States)

    Sobrino, Raquel; Millán, Javier; Oleaga, Alvaro; Gortázar, Christian; de la Fuente, José; Ruiz-Fons, Francisco

    2012-03-23

    Ticks parasitizing wild carnivores and the tick-borne pathogens (TBPs) that they transmit may affect domestic carnivores and humans. Thus, investigating the role of wild carnivores as tick hosts is of relevance for understanding the life cycle of ticks in natural foci and the epidemiology of TBPs shared with domestic animals and humans. Therefore, the main objective of this study was to determine the ixodid tick fauna of wild carnivores in Peninsular Spain and the environmental factors driving the risk of wild carnivores to be parasitized by ixodid ticks. We hypothesized that the adaptation of tick species to differing climatic conditions may be reflected in a similar parasitization risk of wild carnivores by ticks between bioclimatic regions in our study area. To test this, we surveyed ixodid ticks in wild carnivores in oceanic, continental-Mediterranean, and thermo-Mediterranean bioclimatic regions of Peninsular Spain. We analyzed the influence of environmental factors on the risk of wild carnivores to be parasitized by ticks by performing logistic regression models. Models were separately performed for exophilic and endophilic ticks under the expected differing influence of environmental conditions on their life cycle. We found differences in the composition of the tick community parasitizing wild carnivores from different bioclimatic regions. Modelling results partially confirmed our null hypothesis because bioclimatic region was not a relevant factor influencing the risk of wild carnivores to be parasitized by exophilic ticks. Bioclimatic region was however a factor driving the risk of wild carnivores to be parasitized by endophilic ticks. Spanish wild carnivores are hosts to a relevant number of tick species, some of them being potential vectors of pathogens causing serious animal and human diseases. Information provided herein can be of help to understand tick ecology in Spanish wildlife, the epidemiology of tick-borne diseases, and to prevent the risks of

  19. Haemaphysalis longicornis Ticks as Reservoir and Vector of Severe Fever with Thrombocytopenia Syndrome Virus in China.

    Science.gov (United States)

    Luo, Li-Mei; Zhao, Li; Wen, Hong-Ling; Zhang, Zhen-Tang; Liu, Jian-Wei; Fang, Li-Zhu; Xue, Zai-Feng; Ma, Dong-Qiang; Zhang, Xiao-Shuang; Ding, Shu-Jun; Lei, Xiao-Ying; Yu, Xue-jie

    2015-10-01

    Severe fever with thrombocytopenia syndrome (SFTS) is an emerging hemorrhagic fever in East Asia caused by SFTS virus (SFTSV), a newly discovered phlebovirus. The Haemaphysalis longicornis tick has been suspected to be the vector of SFTSV. To determine whether SFTSV can be transmitted among ticks, from ticks to animals, and from animals to ticks, we conducted transmission studies between developmental stages of H. longicornis ticks and between ticks and mice. Using reverse transcription PCR, we also analyzed the prevalence of SFTSV infection among H. longicornis ticks collected from vegetation in Shandong Province, China. Our results showed a low prevalence of SFTSV among collected ticks (0.2%, 8/3,300 ticks), and we showed that ticks fed on SFTSV-infected mice could acquire the virus and transstadially and transovarially transmit it to other developmental stages of ticks. Furthermore, SFTSV-infected ticks could transmit the virus to mice during feeding. Our findings indicate ticks could serve as a vector and reservoir of SFTSV.

  20. Anaplasma phagocytophilum and Anaplasma marginale Elicit Different Gene Expression Responses in Cultured Tick Cells

    Directory of Open Access Journals (Sweden)

    Zorica Zivkovic

    2009-01-01

    Full Text Available The genus Anaplasma (Rickettsiales: Anaplasmataceae includes obligate tick-transmitted intracellular organisms, Anaplasma phagocytophilum and Anaplasma marginale that multiply in both vertebrate and tick host cells. Recently, we showed that A. marginale affects the expression of tick genes that are involved in tick survival and pathogen infection and multiplication. However, the gene expression profile in A. phagocytophilum-infected tick cells is currently poorly characterized. The objectives of this study were to characterize tick gene expression profile in Ixodes scapularis ticks and cultured ISE6 cells in response to infection with A. phagocypthilum and to compare tick gene expression responses in A. phagocytophilum- and A. marginale-infected tick cells by microarray and real-time RT-PCR analyses. The results of these studies demonstrated modulation of tick gene expression by A. phagocytophilum and provided evidence of different gene expression responses in tick cells infected with A. phagocytophilum and A. marginale. These differences in Anaplasma-tick interactions may reflect differences in pathogen life cycle in the tick cells.

  1. Ticks infesting wild and domestic animals and humans of Sri Lanka with new host records.

    Science.gov (United States)

    Liyanaarachchi, D R; Rajakaruna, R S; Dikkumbura, A W; Rajapakse, R P V J

    2015-02-01

    An island-wide collection of tick species infesting humans, domesticated and wild animals and questing ticks in domestic and peridomestic environments was carried out during 2009-2011. A total of 30,461 ticks were collected from 30 different hosts and free living stages from the ground. The collection consisted of 22 tick species from 30 different hosts recording 12 tick species from humans, 19 from domesticated animals and 21 from wild animals, with a total of 97 new host records. The most common tick species on humans were Dermacentor auratus and Amblyomma testudinairum, while Haemaphysalis intermedia, Rhipicephalus microplus and Rhipicephalus sanguineus were common in domesticated and wild animals sharing 20 host species. Among the questing ticks, immature D. auratus was the most abundant. Humans and domesticated animals were mostly infested by the nymphal stages while adult ticks were found on wild animals. High number of new host records could be due to domestic animals picking tick species from wildlife and vise versa at the human/animal interface. Habitat destruction due to forest fragmentation has lead to wild animals roaming in urban and semi-urban neighbourhoods increasing the interactions of wild animals with domesticated animals. Wild animals play a significant role as a reservoir of many tick borne infections which can easily be spread to domesticated animals and then to humans via tick infestations. Data in this paper are useful for those interested in tick infesting wild and domestic animals and humans in describing the zoonotic potential of tick borne infections.

  2. Tick-Borne Encephalitis Virus Habitats in North East Germany: Reemergence of TBEV in Ticks after 15 Years of Inactivity

    Directory of Open Access Journals (Sweden)

    Silvius Frimmel

    2014-01-01

    Full Text Available The incidence of tick-borne encephalitis has risen in Europe since 1990 and the tick-borne encephalitis virus (TBEV has been documented to be spreading into regions where it was not previously endemic. In Mecklenburg-West Pomerania, a federal state in Northern Germany, TBEV was not detectable in over 16,000 collected ticks between 1992 and 2004. Until 2004, the last human case of TBE in the region was reported in 1985. Following the occurrence of three autochthonous human cases of TBE after 2004, however, we collected ticks from the areas in which the infections were contracted. To increase the chance of detecting TBEV-RNA, some of the ticks were fed on mice. Using nested RT-PCR, we were able to confirm the presence of TBEV in ticks for the first time after 15 years. A phylogenetic analysis revealed a close relationship between the sequences we obtained and a TBEV sequence from Mecklenburg-East Pomerania published in 1992 and pointed to the reemergence of a natural focus of TBEV after years of low activity. Our results imply that natural foci of TBEV may either persist at low levels of activity for years or reemerge through the agency of migrating birds.

  3. ECOLOGICAL AND EPIDEMIOLOGICAL CHARACTERISTICS OF TICK-BORN ENCEPHALITIS AND TICK BORRELIOSIS (THE LIME DISEASE IN KALININGRAD OBLAST

    Directory of Open Access Journals (Sweden)

    N. K. Tokarevich

    2011-01-01

    Full Text Available Abstract. Results of monitoring of tick-borne encephalitis (TBE and tick borreliosis (TB in the western enclave of Russia in Kaliningrad oblast in 1999-2008 are presented in the article. The number of basic vector of the agents of these infections — I. ricinus during the analyzing period in the territory of Kurshskaya spit increased. The number of tick attacked persons in the oblast also increased. Despite these events the TBE incidence rates remained not so high and have tendency to decrease. At the same time the TB morbidity has moderate trend to increase. The link between increase of average annual air temperature and incidence of "tick" infections was not proved for the studying period of time. The people of pre-pension and pension ages living in cities more often suffer from TBE and TB. The most part of patients are exposed to tick attack during visiting of rest places. It was determined that eastern districts of Kaliningrad oblast are more problematic on "tick" infections.

  4. Photographic estimation of roosting density of Geoffroys Rousette Fruit Bat Rousettus amplexicaudatus (Chiroptera: Pteropodidae at Monfort Bat Cave, Philippines

    Directory of Open Access Journals (Sweden)

    E. Carpenter

    2014-06-01

    Full Text Available Conservation and management of bats requires reliable and repeatable data regarding the size and patterns of variation in size of bat colonies. Counts and densities calculated via photography have proven more accurate and repeatable than visual counts and ocular estimates. Unfortunately, the potential of photography to investigate the size of a bat colony and roost density has rarely been explored. In the summer of 2006, a colony of Geoffroys Rousette Fruit Bat, Rousettus amplexicaudatus, was photo-documented in the Monfort Bat Cave, in the Island Garden City of Samal, Davao del Norte, Mindanao, Philippines. We selected 39 images to develop roost density estimates. Mean (+or-SE roosting density was 403+or-167.1 bats/m2 and 452.3+or-168.8 bats/m2 on the walls and ceiling of the cave, respectively; densities were not significantly different from each other (P=0.38. Based on these standardized data, we estimate that the initial 100m of the cave contained 883,526 bats. Ultimately, this photographic technique can be used to develop a statistical approach which involves repeatable estimates of colony size for Geoffroys Rousette Fruit Bats at Monfort Cave and will enhance ongoing monitoring activities throughout this species range.

  5. The role of ultrasonic bat detectors in improving inventory and monitoring surveys in Vietnamese karst bat assemblages

    Institute of Scientific and Technical Information of China (English)

    Neil M. FUREY; Iain J. MACKIE; Paul A. RACEY

    2009-01-01

    Bats account for 30% of mammal diversity in SE Asia and are potential bioindieators of wider biodiversity impacts resulting from habitat loss and climate change. As existing sampling techniques in the region typically fall to record bats that habitually fly in open areas and at higher altitudes, current inventory efforts are less than comprehensive. Acoustic sampling with bat detectors may help to overcome these limitations for insectivorous bats, but has yet to be tested in mainland SE Asia. To do so, we sampled bats while simultaneously recording the echolocation calls of insectivorous species commuting and foraging in a variety of karst habitats in north Vietnam. Monitoring of cave-dwelling bats was also undertaken. Discriminant function analysis of 367 echolocation calls produced by 30 insectivorous species showed that acoustic identification was feasible by correctly classifying 89. 1% of caLls. In all habitats, acoustic sampling and capture methods recorded significantly more species each night than capture methods alone. Capture methods consequently failed to record 29% (ten spp. of aerial insectivores) of the bat fauna in commuting and foraging habitats and 11% ( two spp. ) of that in our cave sample. Only four of these species were subsequently captured following significantly greater sampling effort. This strongly suggests that acoustic methods axe indispensable for maximizing bat inventory completeness in SE Asia. As accurate inventories and monitoring are essential for effective species conservation, we recommend the inclusion of acoustic sampling in future studies of bat assemblages across the region [Current Zoology 55 (5) : 327 - 341, 2009].

  6. Bat Acoustic Survey Report for ORNL: Bat Species Distribution on the Oak Ridge Reservation

    Energy Technology Data Exchange (ETDEWEB)

    McCracken, Kitty [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Giffen, Neil R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Haines, Angelina [XCEL Engineering Inc., Oak Ridge, TN (United States); Guge, B. J. [Tennessee Technological Univ., Cookeville, TN (United States); Evans, James W. [Tennessee Wildlife Resources Agency (TWRA), Nashville, TN (United States)

    2015-10-01

    This report summarizes results of a three-year acoustic survey of bat species on the US Department of Energy (DOE) Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The survey was implemented through the Oak Ridge National Laboratory (ORNL) Natural Resources Management Program and included researchers from the ORNL Environmental Sciences Division and ORNL Facilities and Operations Directorate, Tennessee Wildlife Resources Agency’s ORR wildlife manager, a student from Tennessee Technological University, and a technician contracted through Excel Corp. One hundred and twenty-six sites were surveyed reservation-wide using Wildlife Acoustics SM2+ Acoustic Bat Detectors.

  7. The phenology of ticks and the effects of long-term prescribed burning on tick population dynamics in southwestern Georgia and northwestern Florida.

    Directory of Open Access Journals (Sweden)

    Elizabeth R Gleim

    Full Text Available Some tick populations have increased dramatically in the past several decades leading to an increase in the incidence and emergence of tick-borne diseases. Management strategies that can effectively reduce tick populations while better understanding regional tick phenology is needed. One promising management strategy is prescribed burning. However, the efficacy of prescribed burning as a mechanism for tick control is unclear because past studies have provided conflicting data, likely due to a failure of some studies to simulate operational management scenarios and/or account for other predictors of tick abundance. Therefore, our study was conducted to increase knowledge of tick population dynamics relative to long-term prescribed fire management. Furthermore, we targeted a region, southwestern Georgia and northwestern Florida (USA, in which little is known regarding tick dynamics so that basic phenology could be determined. Twenty-one plots with varying burn regimes (burned surrounded by burned [BB], burned surrounded by unburned [BUB], unburned surrounded by burned [UBB], and unburned surrounded by unburned [UBUB] were sampled monthly for two years while simultaneously collecting data on variables that can affect tick abundance (e.g., host abundance, vegetation structure, and micro- and macro-climatic conditions. In total, 47,185 ticks were collected, of which, 99% were Amblyomma americanum, 0.7% were Ixodes scapularis, and fewer numbers of Amblyomma maculatum, Ixodes brunneus, and Dermacentor variabilis. Monthly seasonality trends were similar between 2010 and 2011. Long-term prescribed burning consistently and significantly reduced tick counts (overall and specifically for A. americanum and I. scapularis regardless of the burn regimes and variables evaluated. Tick species composition varied according to burn regime with A. americanum dominating at UBUB, A. maculatum at BB, I. scapularis at UBB, and a more even composition at BUB. These data

  8. Population-based passive tick surveillance and detection of expanding foci of blacklegged ticks Ixodes scapularis and the Lyme disease agent Borrelia burgdorferi in Ontario, Canada.

    Science.gov (United States)

    Nelder, Mark P; Russell, Curtis; Lindsay, L Robbin; Dhar, Badal; Patel, Samir N; Johnson, Steven; Moore, Stephen; Kristjanson, Erik; Li, Ye; Ralevski, Filip

    2014-01-01

    We identified ticks submitted by the public from 2008 through 2012 in Ontario, Canada, and tested blacklegged ticks Ixodes scapularis for Borrelia burgdorferi and Anaplasma phagocytophilum. Among the 18 species of ticks identified, I. scapularis, Dermacentor variabilis, Ixodes cookei and Amblyomma americanum represented 98.1% of the 14,369 ticks submitted. Rates of blacklegged tick submission per 100,000 population were highest in Ontario's Eastern region; D. variabilis in Central West and Eastern regions; I. cookei in Eastern and South West regions; and A. americanum had a scattered distribution. Rates of blacklegged tick submission per 100,000 population were highest from children (0-9 years old) and older adults (55-74 years old). In two health units in the Eastern region (i.e., Leeds, Grenville & Lanark District and Kingston-Frontenac and Lennox & Addington), the rate of submission for engorged and B. burgdorferi-positive blacklegged ticks was 47× higher than the rest of Ontario. Rate of spread for blacklegged ticks was relatively faster and across a larger geographic area along the northern shore of Lake Ontario/St. Lawrence River, compared with slower spread from isolated populations along the northern shore of Lake Erie. The infection prevalence of B. burgdorferi in blacklegged ticks increased in Ontario over the study period from 8.4% in 2008 to 19.1% in 2012. The prevalence of B. burgdorferi-positive blacklegged ticks increased yearly during the surveillance period and, while increases were not uniform across all regions, increases were greatest in the Central West region, followed by Eastern and South West regions. The overall infection prevalence of A. phagocytophilum in blacklegged ticks was 0.3%. This study provides essential information on ticks of medical importance in Ontario, and identifies demographic and geographic areas for focused public education on the prevention of tick bites and tick-borne diseases.

  9. Win(d)-Win(d) Solutions for wind developers and bats

    Energy Technology Data Exchange (ETDEWEB)

    Hein, Cris; Schirmacher, Michael; Arnett, Ed; Huso, Manuela

    2011-10-31

    Bat Conservation International initiated a multi-year, pre-construction study in mid-summer 2009 to investigate patterns of bat activity and evaluate the use of acoustic monitoring to predict mortality of bats at the proposed Resolute Wind Energy Project (RWEP) in east-central Wyoming. The primary objectives of this study were to: (1) determine levels and patterns of activity for three phonic groups of bats (high-frequency emitting bats, low-frequency emitting bats, and hoary bats) using the proposed wind facility prior to construction of turbines; (2) determine if bat activity can be predicted based on weather patterns; correlate bat activity with weather variables; and (3) combine results from this study with those from similar efforts to determine if indices of pre-construction bat activity can be used to predict post-construction bat fatalities at proposed wind facilities. We report results from two years of pre-construction data collection.

  10. One-Humped Camels (Camelus dromedaries Hard Ticks Infestation in Qeshm Island, Iran

    Directory of Open Access Journals (Sweden)

    Saeed Nazifi

    2011-06-01

    Full Text Available The economic importance of tick infestation on camels are important as they are important meat and milk producer animals in the less vegetation area of Iran and their health and production are greatly affected by the high tick infestation. In this investigation, tick infestations on camels (Camelus dromedarius were determined in Qeshm Island, Iran. A total number of 912 adult ticks (472 males and 440 females were collected and identified. Hyalomma dromedarii was the predominant tick specie and accounted for 61.9% of the adult ticks. Other hard ticks were H. anatolicum excavatum (22 %, H. asiaticum asiaticum (14.2 %, H. marginatum (1.9 %, H. impeltatum (0.4 % and Ripicephalus bursa (0.4 %. In conclusion, The provision of tick control programs in the Qeshm Island would seem a prerequisite for improving camel meat and milk production.

  11. Cold storage and cryopreservation of tick cell lines

    Directory of Open Access Journals (Sweden)

    Lallinger Gertrud

    2010-04-01

    Full Text Available Abstract Background Tick cell lines are now available from fifteen ixodid and argasid species of medical and veterinary importance. However, some tick cell lines can be difficult to cryopreserve, and improved protocols for short- and long-term low temperature storage will greatly enhance their use as tools in tick and tick-borne pathogen research. In the present study, different protocols were evaluated for cold storage and cryopreservation of tick cell lines derived from Rhipicephalus (Boophilus decoloratus, Rhipicephalus (Boophilus microplus, Ixodes ricinus and Ixodes scapularis. For short-term cold storage, cells were kept under refrigeration at 6°C for 15, 30 and 45 days. For cryopreservation in liquid nitrogen, use of a sucrose-phosphate-glutamate freezing buffer (SPG as cryoprotectant was compared with dimethylsulfoxide (DMSO supplemented with sucrose. Cell viability was determined by the trypan blue exclusion test and cell morphology was evaluated in Giemsa-stained cytocentrifuge smears. Results Cold storage at 6°C for up to 30 days was successful in preserving R. (B. microplus, R. (B. decoloratus, I. ricinus and I. scapularis cell lines; lines from the latter three species could be easily re-cultivated after 45 days under refrigeration. While cell lines from all four tick species cryopreserved with 6% DMSO were successfully resuscitated, the R. (B. decoloratus cells did not survive freezing in SPG and of the other three species, only the R. (B. microplus cells resumed growth during the observation period. Conclusions This constitutes the first report on successful short-term refrigeration of cells derived from R. (B. decoloratus, R. (B. microplus, and I. ricinus, and use of SPG as an alternative to DMSO for cryopreservation, thus making an important contribution to more reliable and convenient tick cell culture maintenance.

  12. Molecular characterization of novel sulfotransferases from the tick, Ixodes scapularis

    Directory of Open Access Journals (Sweden)

    King Roberta S

    2011-06-01

    Full Text Available Abstract Background Ixodes scapularis, commonly known as the blacklegged or deer tick, is the main vector of Lyme disease in the United States. Recent progress in transcriptome research has uncovered hundreds of different proteins expressed in the salivary glands of hard ticks, the majority of which have no known function, and include many novel protein families. We recently identified transcripts coding for two putative cytosolic sulfotransferases in these ticks which recognized phenolic monoamines as their substrates. In this current study, we characterize the genetic expression of these two cytosolic sulfotransferases throughout the tick life cycle as well as the enzymatic properties of the corresponding recombinant proteins. Interestingly, the resultant recombinant proteins showed sulfotransferase activity against both neurotransmitters dopamine and octopamine. Results The two sulfotransferase genes were coded as Ixosc SULT 1 & 2 and corresponding proteins were referred as Ixosc Sult 1 and 2. Using gene-specific primers, the sulfotransferase transcripts were detected throughout the blacklegged tick life cycle, including eggs, larvae, nymphs, adult salivary glands and adult midgut. Notably, the mRNA and protein levels were altered upon feeding during both the larval and nymphal life stages. Quantitative PCR results confirm that Ixosc SULT1 was statistically increased upon blood feeding while Ixosc SULT 2 was decreased. This altered expression led us to further characterize the function of these proteins in the Ixodid tick. The sulfotransferase genes were cloned and expressed in a bacterial expression system, and purified recombinant proteins Ixosc Sult 1(R and 2(R showed sulfotransferase activity against neurotransmitters dopamine and octopamine as well as the common sulfotransferase substrate p-nitrophenol. Thus, dopamine- or octopamine-sulfonation may be involved in altering the biological signal for salivary secretion in I. scapularis

  13. Host body size and the diversity of tick assemblages on Neotropical vertebrates

    Directory of Open Access Journals (Sweden)

    Helen J. Esser

    2016-12-01

    Full Text Available Identifying the factors that influence the species diversity and distribution of ticks (Acari: Ixodida across vertebrate host taxa is of fundamental ecological and medical importance. Host body size is considered one of the most important determinants of tick abundance, with larger hosts having higher tick burdens. The species diversity of tick assemblages should also be greater on larger-bodied host species, but empirical studies testing this hypothesis are lacking. Here, we evaluate this relationship using a comparative dataset of feeding associations from Panama between 45 tick species and 171 host species that range in body size by three orders of magnitude. We found that tick species diversity increased with host body size for adult ticks but not for immature ticks. We also found that closely related host species tended to have similar tick species diversity, but correcting for host phylogeny did not alter the relationships between host body size and tick species diversity. The distribution of tick species was highly aggregated, with approximately 20% of the host species harboring 80% of all tick species, following the Pareto principle or 20/80 Rule. Thus, the aggregated pattern commonly observed for tick burdens and disease transmission also holds for patterns of tick species richness. Our finding that the adult ticks in this system preferentially parasitize large-bodied host species suggests that the ongoing anthropogenic loss of large-bodied vertebrates is likely to result in host-tick coextinction events, even when immature stages feed opportunistically. As parasites play critical roles in ecological and evolutionary processes, such losses may profoundly affect ecosystem functioning and services.

  14. European Bats as Carriers of Viruses with Zoonotic Potential

    Directory of Open Access Journals (Sweden)

    Claudia Kohl

    2014-08-01

    Full Text Available Bats are being increasingly recognized as reservoir hosts of highly pathogenic and zoonotic emerging viruses (Marburg virus, Nipah virus, Hendra virus, Rabies virus, and coronaviruses. While numerous studies have focused on the mentioned highly human-pathogenic bat viruses in tropical regions, little is known on similar human-pathogenic viruses that may be present in European bats. Although novel viruses are being detected, their zoonotic potential remains unclear unless further studies are conducted. At present, it is assumed that the risk posed by bats to the general public is rather low. In this review, selected viruses detected and isolated in Europe are discussed from our point of view in regard to their human-pathogenic potential. All European bat species and their roosts are legally protected and some European species are even endangered. Nevertheless, the increasing public fear of bats and their viruses is an obstacle to their protection. Educating the public regarding bat lyssaviruses might result in reduced threats to both the public and the bats.

  15. The use of edge habitats by commuting and foraging bats.

    NARCIS (Netherlands)

    Verboom, B.

    1998-01-01

    Travelling routes and foraging areas of many bat species are mainly along edge habitats, such as treelines, hedgerows, forest edges, and canal banks. This thesis deals with the effects of density, configuration, and structural features of edge habitats on the occurrence of bats. Four hypothetical fu

  16. The distribution of bats on the Adriatic islands

    NARCIS (Netherlands)

    Dulić, Beatrica; Tvrtković, Nikola

    1970-01-01

    The bat fauna of the Adriatic islands is very poorly known in comparison with that of the coastal continental regions (Kolombatović, 1882, 1884; Dulić, 1959). Although ten species of bats are recorded, the data for most of the islands except the island of Lastovo (Dulić, 1968) are scarce, and of an

  17. On a collection of Bats from the West-Indies

    NARCIS (Netherlands)

    Jentink, F.A.

    1893-01-01

    The collection of Bats hereafter described has been presented to the Leyden Museum by our well known correspondent Dr. C. G. Young from Berbice, New Amsterdam, British Guyana. This collection tells us that, although our knowledge about the Bats may have increased during the latest years, much remain

  18. Echolocating bats cry out loud to detect their prey

    DEFF Research Database (Denmark)

    Surlykke, Annemarie; Kalko, Elisabeth K V

    2008-01-01

    Echolocating bats have successfully exploited a broad range of habitats and prey. Much research has demonstrated how time-frequency structure of echolocation calls of different species is adapted to acoustic constraints of habitats and foraging behaviors. However, the intensity of bat calls has b...

  19. [NEW FINDINGS OF BAT ECTOPARASITES (CHIROPTERA: VESPERTILIONIDAE) IN SOUTHERN SIBERIA].

    Science.gov (United States)

    Orlova, M V; Zhigalin, A V; Khritankov, A M

    2015-01-01

    The data on new findings of ectoparasites (mites and insects) of bats (Chiroptera: Vespertilionidae) in the Western Sayan and Tuva are represented. The bat fly Basilia mongolensis mongolensis Theodor, 1966 was discovered in the territory of Russia for the first time. Gamasid mite Spinturnix bregetovae Stanyukovich, 1995 is new for the region. New hosts were described for some ectoparasites.

  20. Emergence time in forest bats: the influence of canopy closure

    Science.gov (United States)

    Russo, Danilo; Cistrone, Luca; Jones, Gareth

    2007-01-01

    The role of the forest canopy in protecting bats roosting in forest from predators is poorly known. We analysed the effect of canopy closure on emergence time in Barbastella barbastellus in a mountainous area of central Italy. We used radio-tracking to locate roosts and filmed evening emergence. Comparisons were made between roosts in open areas and those in dense forest. Median emergence time and illuminance were correlated. Moreover, from pregnancy to late lactation bats emerged progressively earlier, probably because of the exceptionally high wing loading affecting pregnant bats and the high energy demand of lactation. A significant influence of canopy closure on median emergence time was revealed after adjusting for the effects of light and reproductive state. Bats in open habitat emerged later than those roosting beneath closed canopy. In cluttered habitats, predators relying on vision may find it more difficult to detect and catch bats at light levels which would offer more chances of success when attacking prey in open habitats. Bats in dense forest are less vulnerable to predators and may take advantage of an earlier emergence by prolonging foraging. Although more vulnerable, lactating females roosting at open sites may benefit from warmer roosting conditions. Roosts in dense forest may be preferred under intense predation pressure. Forest management should favour canopy heterogeneity to provide bats with a range of roosting conditions. Our work emphasises the role of a fine-grained spatial scale in the roosting ecology of forest bats.

  1. Going, Going, Gone! The Making of a Baseball Bat

    Science.gov (United States)

    Cantu, Diana

    2012-01-01

    From little league players to professional athletes, baseball has become a sport that is not only fun to play and watch, but also a sport driven by innovation and technology. One particular piece of baseball equipment that has undergone many changes is the baseball bat. Prior to the early 1970s, wooden bats were the only choice available. Today,…

  2. Bat Dynamics of Female Fast Pitch Softball Batters.

    Science.gov (United States)

    Messier, Stephen P.; Owen, Marjorie G.

    1984-01-01

    Female fast pitch softball batters served in an examination of the dynamic characteristics of the bat during the swing through the use of three-dimensional cinematographic analysis techniques. These results were compared with those from previous studies of baseball batting. Findings are listed. (Author/DF)

  3. Novel Waddlia Intracellular Bacterium in Artibeus intermedius Fruit Bats, Mexico.

    Science.gov (United States)

    Pierlé, Sebastián Aguilar; Morales, Cirani Obregón; Martínez, Leonardo Perea; Ceballos, Nidia Aréchiga; Rivero, Juan José Pérez; Díaz, Osvaldo López; Brayton, Kelly A; Setién, Alvaro Aguilar

    2015-12-01

    An intracellular bacterium was isolated from fruit bats (Artibeus intermedius) in Cocoyoc, Mexico. The bacterium caused severe lesions in the lungs and spleens of bats and intracytoplasmic vacuoles in cell cultures. Sequence analyses showed it is related to Waddlia spp. (order Chlamydiales). We propose to call this bacterium Waddlia cocoyoc.

  4. Bats track and exploit changes in insect pest populations

    Science.gov (United States)

    The role of bats or any generalist predator in suppressing prey populations depends on the predator’s ability to exploit available prey in space and time. Using a qPCR faecal DNA assay, we document significant association between numbers of Brazilian free-tailed bats (Tadarida brasiliensis) consumin...

  5. European bats as carriers of viruses with zoonotic potential.

    Science.gov (United States)

    Kohl, Claudia; Kurth, Andreas

    2014-08-13

    Bats are being increasingly recognized as reservoir hosts of highly pathogenic and zoonotic emerging viruses (Marburg virus, Nipah virus, Hendra virus, Rabies virus, and coronaviruses). While numerous studies have focused on the mentioned highly human-pathogenic bat viruses in tropical regions, little is known on similar human-pathogenic viruses that may be present in European bats. Although novel viruses are being detected, their zoonotic potential remains unclear unless further studies are conducted. At present, it is assumed that the risk posed by bats to the general public is rather low. In this review, selected viruses detected and isolated in Europe are discussed from our point of view in regard to their human-pathogenic potential. All European bat species and their roosts are legally protected and some European species are even endangered. Nevertheless, the increasing public fear of bats and their viruses is an obstacle to their protection. Educating the public regarding bat lyssaviruses might result in reduced threats to both the public and the bats.

  6. Convergent acoustic field of view in echolocating bats

    DEFF Research Database (Denmark)

    Jakobsen, Lasse; Ratcliffe, John M; Surlykke, Annemarie

    2013-01-01

    into more directional sound beams. Therefore, bats that emit their calls through their mouths should show a relationship between mouth size and wavelength, driving smaller bats to signals of higher frequency. We found that in a flight room mimicking a closed habitat, six aerial hawking vespertilionid...

  7. Social calls of flying big brown bats (Eptesicus fuscus

    Directory of Open Access Journals (Sweden)

    Genevieve Spanjer Wright

    2013-08-01

    Full Text Available Vocalizations serving a variety of social functions have been reported in many bat species (Order Chiroptera. While echolocation by big brown bats (Eptesicus fuscus has been the subject of extensive study, calls used by this species for communication have received comparatively little research attention. Here, we report on a rich repertoire of vocalizations produced by big brown bats in a large flight room equipped with synchronized high speed stereo video and audio recording equipment. Bats were studied individually and in pairs, while sex, age, and experience with a novel foraging task were varied. We used Discriminant Function Analysis to classify six different vocalizations that were recorded when two bats were present. Contingency table analyses revealed a higher prevalence of social calls when males were present, and some call types varied in frequency of emission based on trial type or bat age. Bats flew closer together around the time some social calls were emitted, indicating that communicative calls may be selectively produced when conspecifics fly near one another. These findings are the first reports of social calls from flying big brown bats and provide insight into the function of communicative vocalizations emitted by this species.

  8. Suppression of emission rates improves sonar performance by flying bats

    Science.gov (United States)

    Adams, Amanda M.; Davis, Kaylee; Smotherman, Michael

    2017-01-01

    Echolocating bats face the challenge of actively sensing their environment through their own emissions, while also hearing calls and echoes of nearby conspecifics. How bats mitigate interference is a long-standing question that has both ecological and technological implications, as biosonar systems continue to outperform man-made sonar systems in noisy, cluttered environments. We recently showed that perched bats decreased calling rates in groups, displaying a behavioral strategy resembling the back-off algorithms used in artificial communication networks to optimize information throughput at the group level. We tested whether free-tailed bats (Tadarida brasiliensis) would employ such a coordinated strategy while performing challenging flight maneuvers, and report here that bats navigating obstacles lowered emission rates when hearing artificial playback of another bat’s calls. We measured the impact of acoustic interference on navigation performance and show that the calculated reductions in interference rates are sufficient to reduce interference and improve obstacle avoidance. When bats flew in pairs, each bat responded to the presence of the other as an obstacle by increasing emissions, but hearing the sonar emissions of the nearby bat partially suppressed this response. This behavior supports social cohesion by providing a key mechanism for minimizing mutual interference. PMID:28139707

  9. Passive tick surveillance, dog seropositivity, and incidence of human Lyme disease

    Science.gov (United States)

    Johnson, J.L.; Ginsberg, H.S.; Zhioua, E.; Whitworth, U.G.; Markowski, D.; Hyland, K.E.; Hu, R.

    2004-01-01

    Data on nymphal Ixodes scapularis ticks submitted by the public to the University of Rhode Island Tick Research Laboratory for testing from 1991 to 2000 were compared with human case data from the Rhode Island Department of Health to determine the efficacy of passive tick surveillance at assessing human risk of Lyme disease. Numbers of ticks submitted were highly correlated with human cases by county (r = 0.998, n = 5 counties) and by town (r = 0.916, n = 37 towns), as were the numbers of positive ticks submitted (r = 0.989 by county, r = 0.787 by town). Human cases were correlated with ticks submitted by town each year, and with positive ticks in all but 2 years. Thus, passive tick surveillance effectively assessed geographical risk of human Lyme disease. In contrast, tick submissions through time were not correlated with human cases from year to year. Dog seropositivity was significantly correlated with human cases by county in both years tested, but by town in only one of two years. Numbers of ticks submitted were correlated with dog seropositivity by county but not by town, apparently because of high variability among towns with small sample sizes. Our results suggest that passive tick surveillance, using ticks submitted by the public for Lyme spirochete testing, can be used to assess the geographical distribution of Lyme disease risk, but cannot reliably predict Lyme incidence from year to year.

  10. First detection of tick-borne "Candidatus Neoehrlichia mikurensis" in Denmark 2011

    DEFF Research Database (Denmark)

    Fertner, Mette Ely; Mølbak, Lars; Pihl, Thomas Peter Boye;

    2012-01-01

    This is the first reporting of the tick-borne zoonotic bacterium "Candidatus Neoehrlichia mikurensis" in Denmark. A total of 2,625 Ixodes ricinus ticks from 58 locations in Denmark were collected and analysed for "Ca. Neoehrlichia mikurensis". A nested PCR revealed the presence of the bacterium...... at three geographically separate locations, which indicates that it is widely established in ticks....

  11. Detection of rickettsial DNA in ticks and wild boars in Kyoto City, Japan.

    Science.gov (United States)

    Someya, Azusa; Ito, Ryuki; Maeda, Akihiko; Ikenaga, Mitsuhiro

    2015-01-01

    The tick is a well-known vector for arthropod-borne pathogens, such as tick-borne encephalitis, Lyme disease, Japanese spotted fever and severe fever with thrombocytopenia syndrome. It is therefore important to know the tick population and distribution in our environment and wild animals in order to prevent tick-borne diseases. Here, we report the results of tick surveillance from May to September 2011 at 14 geographical points and in 5 wild boars in Kyoto City, Kyoto prefecture, Japan. We collected 3,198 ticks comprising 5 tick species, Haemaphysalis (H.) longicornis, H. flava, H. kitaokai, Amblyomma testudinarium and Dermacentor taiwanensis. Interestingly, the proportion of tick species varied according to geographical region within the city. The ticks collected in the city were reported as potential vectors of pathogens, such as rickettsiosis. We detected rickettsial DNA by PCR in 71.1% of 201 ticks investigated. The ticks that carried rickettsiae were distributed across the whole the city. The sequences of PCR-amplified DNA fragments were determined and showed similarities to spotted fever group rickettsiae. Although their pathogenicity for animals including humans is still unclear, it is important to stay alert and pay attention to tick-borne diseases in order to ensure the safety of the citizens of the city as well as that of visitors.

  12. Evaluation of four bed bug traps for surveillances of brown dog ticks (Acari: Ixodidae)

    Science.gov (United States)

    The brown dog tick can be a serious residential pest due to its unique ability, among ticks, to complete its lifecycle indoors. A single engorged and fertilized female tick can oviposit around 4,000 eggs, allowing indoor establishment to be rapid and easy to miss in early-stage infestations. Acari...

  13. Serotonin-like immunoreactivity in the central nervous system of two Ixodid tick species

    Science.gov (United States)

    Immunocytochemistry was used to detect the presence of serotonin-like immunoreactive (5HT-IR) neurons and neuronal processes in the central nervous system (CNS), the synganglion, of two Ixodid tick species; the winter tick, Dermacentor albipictus and the lone star tick, Amblyomma americanum. Seroto...

  14. Severe fever with thrombocytopenia syndrome virus in ticks collected from humans, South Korea, 2013.

    Science.gov (United States)

    Yun, Seok-Min; Lee, Wook-Gyo; Ryou, Jungsang; Yang, Sung-Chan; Park, Sun-Whan; Roh, Jong Yeol; Lee, Ye-Ji; Park, Chan; Han, Myung Guk

    2014-08-01

    We investigated the infection rate for severe fever with thrombocytopenia syndrome virus (SFTSV) among ticks collected from humans during May-October 2013 in South Korea. Haemaphysalis longicornis ticks have been considered the SFTSV vector. However, we detected the virus in H. longicornis, Amblyomma testudinarium, and Ixodes nipponensis ticks, indicating additional potential SFTSV vectors.

  15. Detection of Rickettsia helvetica in Ixodes ricinus ticks collected from Pyrenean chamois in France.

    Science.gov (United States)

    Davoust, Bernard; Socolovschi, Cristina; Revelli, Paul; Gibert, Philippe; Marié, Jean-Lou; Raoult, Didier; Parola, Philippe

    2012-12-01

    Seventy-one Ixodes ricinus ticks collected from Pyrenean chamois (Rupicapra pyrenaica) in the French Pyrenees were tested by real-time polymerase chain reaction to detect the presence of Rickettsia and Bartonella. Four ticks (6%) were positive for R. helvetica. The chamois carries infected ticks, and this enables the dissemination throughout the environment with this bacterium, a potential human pathogen.

  16. Seasonal feeding activity of the tree-hole tick, Ixodes arboricola.

    Science.gov (United States)

    Heylen, D J A; Van Oosten, A R; Devriendt, N; Elst, J; De Bruyn, L; Matthysen, E

    2014-07-01

    Bird-specific ticks do not infest humans and livestock, but these ticks often share their avian hosts with generalist ticks that do. Therefore, their feeding activity may have an impact on the transmission of pathogens outside bird-tick transmission cycles. Here we examined the seasonal feeding activity of the tree-hole tick (Ixodes arboricola) in relation to the activity of its hole-breeding hosts (Parus major and Cyanistes caeruleus). We analysed data on ticks derived from birds, on the abundance of engorged ticks inside nest boxes, and on bird nests that were experimentally exposed to ticks. We observed a non-random pattern of feeding associated with the tick instar and host age. The majority of adult ticks fed on nestlings, while nymphs and larvae fed on both free-flying birds and nestlings. Due to their fast development, some ticks were able to feed twice within the same breeding season. The highest infestation rates in free-flying birds were found during the pre-breeding period and during autumn and winter when birds roost inside cavities. Except during winter, feeding of I. arboricola overlapped in time with the generalist Ixodes ricinus, implying that tick-borne microorganisms that are maintained by I. arboricola and birds could be bridged by I. ricinus to other hosts.

  17. Ticks (Acari: Ixodidae) associated with wildlife and vegetation of Haller park along the Kenyan coastline.

    Science.gov (United States)

    Wanzala, W; Okanga, S

    2006-09-01

    This artcile describes the results obtained from a tick survey conducted in Haller park along the Kenyan coastline. The survey aimed at evaluating tick-host associations, assessing tick population density, and providing baseline information for planning future tick control and management in the park. Ticks (2,968) were collected by handpicking from eight species of wildlife and by dragging in 14 selected sites within the park. A considerable proportion of ticks were also collected from leaves, stems, and bark of most dominant trees, namely, Casuarina equisetifolia L. (Forst. and Forst.), Cocos nucifera L., Adansonia digitata L., Musa paradisiaca L., and Azadiracta indica Adr. Juss. Dragging was conducted in sites predominantly occupied by Cynodon dactylon L. (Pers.), Cenchrus ciliaris L., Stenotaphrum dimidiatum L. (Kuntze.) Brongn., and Brachiaria xantholeuca Hack. Ex Schinz Stapf. and Loudetia kagerensis K. Schum. Hutch. Eight tick species were identified, and the collection included Rhipicephalus pravus Dönitz 1910, Rhipicephalus pulchellus Gerstäcker 1873, Hyalomma marginatum rufipes Koch 1844, Amblyomma gemma Dönitz 1910, Amblyomma hebraeum Koch 1844, Amblyomma sparsum Neumann 1899, Amblyomma nuttalli Dönitz 1909, and Boophilus decoloratus Koch 1844. Given that the identified tick species are known to parasitize humans as well as livestock, there exist risks of emergence of zoonotic infections mediated by tick vectors. In the recreational environment of Haller park, where tick vectors share habitats with hosts, there is a need to develop sustainable and effective tick control and management strategies to minimize economic losses that tick infestation may cause.

  18. Evaluation of Basophil Infiltration into the Skin Lesions of Tick Bites

    Directory of Open Access Journals (Sweden)

    Kyoko Nakahigashi

    2013-02-01

    Full Text Available Recently, it has been described that basophils play an essential role in antibody-mediated acquired immunity against ticks in mice. However, it is still unknown whether basophil infiltration has any significance in the infestation with ticks in humans. In this report, we have evaluated the infiltration of basophils into human skin lesions of tick bites.

  19. First report of Rickettsia raoultii in field collected Dermacentor reticulatus ticks from Austria.

    Science.gov (United States)

    Duscher, Georg G; Hodžić, Adnan; Weiler, Martin; Vaux, Alexander G C; Rudolf, Ivo; Sixl, Wolfdieter; Medlock, Jolyon M; Versteirt, Veerle; Hubálek, Zdenek

    2016-07-01

    In a set of pooled field collected Dermacentor reticulatus ticks, Rickettsia raoultii, the causative agent of Tick-borne lymphadenopathy/Dermacentor-borne necrosis erythema and lymphadenopathy, was found for the first time in Austria. The coordinates of the positive locations for tick and pathogen abundance are given and shown in a map.

  20. Antialarmin effect of tick saliva during the transmission of Lyme disease

    NARCIS (Netherlands)

    C. Marchal; F. Schramm; A. Kern; B.J. Luft; X. Yang; T.J. Schuijt; T. Schuijt; J.W. Hovius; J. Hovius; B. Jaulhac; N. Boulanger

    2011-01-01

    Tick saliva has potent immunomodulatory properties. In arthropod-borne diseases, this effect is largely used by microorganisms to increase their pathogenicity and to evade host immune responses. We show that in Lyme borreliosis, tick salivary gland extract and a tick saliva protein, Salp15, inhibit

  1. A plan for the North American Bat Monitoring Program (NABat)

    Science.gov (United States)

    Loeb, Susan C.; Rodhouse, Thomas J.; Ellison, Laura E.; Lausen, Cori L.; Reichard, Jonathan D.; Irvine, Kathryn M.; Ingersoll, Thomas E.; Coleman, Jeremy; Thogmartin, Wayne E.; Sauer, John R.; Francis, Charles M.; Bayless, Mylea L.; Stanley, Thomas R.; Johnson, Douglas H.

    2015-01-01

    The purpose of the North American Bat Monitoring Program (NABat) is to create a continent-wide program to monitor bats at local to rangewide scales that will provide reliable data to promote effective conservation decisionmaking and the long-term viability of bat populations across the continent. This is an international, multiagency program. Four approaches will be used to gather monitoring data to assess changes in bat distributions and abundances: winter hibernaculum counts, maternity colony counts, mobile acoustic surveys along road transects, and acoustic surveys at stationary points. These monitoring approaches are described along with methods for identifying species recorded by acoustic detectors. Other chapters describe the sampling design, the database management system (Bat Population Database), and statistical approaches that can be used to analyze data collected through this program.

  2. Echo-acoustic flow affects flight in bats.

    Science.gov (United States)

    Kugler, Kathrin; Greiter, Wolfgang; Luksch, Harald; Firzlaff, Uwe; Wiegrebe, Lutz

    2016-06-15

    Flying animals need to react fast to rapid changes in their environment. Visually guided animals use optic flow, generated by their movement through structured environments. Nocturnal bats cannot make use of optic flow, but rely mostly on echolocation. Here, we show that bats exploit echo-acoustic flow to negotiate flight through narrow passages. Specifically, bats' flight between lateral structures is significantly affected by the echo-acoustic salience of those structures, independent of their physical distance. This is true even though echolocation, unlike vision, provides explicit distance cues. Moreover, the bats reduced the echolocation sound levels in stronger flow, probably to compensate for the increased summary target strength of the lateral reflectors. However, bats did not reduce flight velocity under stronger echo-acoustic flow. Our results demonstrate that sensory flow is a ubiquitous principle for flight guidance, independent of the fundamentally different peripheral representation of flow across the senses of vision and echolocation.

  3. Watching the dark: new surveillance cameras are changing bat research

    Science.gov (United States)

    Cryan, Paul M.; Gorresen, P. Marcos

    2014-01-01

    It is, according to an old proverb, “better to light a candle than to curse the darkness.” And those of us trying to discover new insights into the mysterious lives of bats often do a lot of cursing in the darkness. Bats do most things under cover of night, and often in places where humans and most other animals can’t go. This dark inaccessibility is great for bats, but not so great for those of us trying to study them. Successful conservation hinges on understanding bat behaviors and needs, as well as identifying and addressing the things that threaten them in the darkness. But how do we light a candle without scaring the bats away or altering their behavior?

  4. Bats as 'special' reservoirs for emerging zoonotic pathogens.

    Science.gov (United States)

    Brook, Cara E; Dobson, Andrew P

    2015-03-01

    The ongoing West African Ebola epidemic highlights a recurring trend in the zoonotic emergence of virulent pathogens likely to come from bat reservoirs that has caused epidemiologists to ask 'Are bats special reservoirs for emerging zoonotic pathogens?' We collate evidence from the past decade to delineate mitochondrial mechanisms of bat physiology that have evolved to mitigate oxidative stress incurred during metabolically costly activities such as flight. We further describe how such mechanisms might have generated pleiotropic effects responsible for tumor mitigation and pathogen control in bat hosts. These synergisms may enable 'special' tolerance of intracellular pathogens in bat hosts; paradoxically, this may leave them more susceptible to immunopathological morbidity when attempting to clear extracellular infections such as 'white-nose syndrome' (WNS).

  5. Rickettsial infections in ticks from wild birds in Paraguay.

    Science.gov (United States)

    Ogrzewalska, Maria; Literak, Ivan; Martins, Thiago F; Labruna, Marcelo B

    2014-03-01

    Ticks were collected from wild birds at 3 locations in Paraguay during the South American winter in August and September 2012. In total, 480 birds belonging to 106 species were examined. Overall, 31 (6.5%) birds representing 21 species were found parasitized by ticks which were identified as Amblyomma calcaratum Neumann (2 larvae, 20 nymphs), Amblyomma longirostre (Koch) (17 larvae, 3 nymphs), Amblyomma parvum Aragão (7 nymphs), Amblyomma aureolatum (Pallas) (1 nymph), Amblyomma ovale Koch (1 nymph), Amblyomma tigrinum Koch (1 larva), and Amblyomma spp. (4 larvae). Ticks collected accidentally on humans at the study locations during field work included 1 nymph of Amblyomma coelebs Neumann and 54 nymphs of Amblyomma cajennense (Fabricius). Most ticks were individually tested for the presence of Rickettsia species by polymerase chain reaction targeting rickettsial genes gltA and ompA and by amplicon sequencing. Two (12%) out of 17 A. longirostre larvae were found infected with Candidatus 'Rickettsia amblyommii', and 2 (33%) out of 6 A. parvum nymphs were infected with Candidatus 'Rickettsia andeanae'. This study provides the first report of rickettsial infections in Paraguayan ticks.

  6. Francisella species in ticks and animals, Iberian Peninsula.

    Science.gov (United States)

    Lopes de Carvalho, I; Toledo, A; Carvalho, C L; Barandika, J F; Respicio-Kingry, L B; Garcia-Amil, C; García-Pérez, A L; Olmeda, A S; Zé-Zé, L; Petersen, J M; Anda, P; Núncio, M S; Escudero, R

    2016-02-01

    The presence of Francisella species in 2134 ticks, 93 lagomorphs and 280 small mammals from the Iberian Peninsula was studied. Overall, 19 ticks and 6 lagomorphs were positive for Francisella tularensis subsp. holarctica, suggesting, as described for other regions, that lagomorphs may have an important role in the maintenance of F. tularensis in nature. Of the 6 positive lagomorphs, 4 were identified as the European rabbit, Oryctogalus cuniculus. Additionally, 353 ticks and 3 small mammals were PCR positive for Francisella-like endosymbionts (FLEs) and one small mammal was also positive for Francisella hispaniensis-like DNA sequences. Among FLE positive specimens, a variety of sequence types were detected: ticks were associated with 5 lpnA sequence types, with only one type identified per tick, in contrast to 2 lpnA sequence types detected in a single wood mouse (Apodemus sylvaticus). To our knowledge, this is the first report of FLEs in free-living small mammals as well as the first detection of F. hispaniensis-like sequences in a natural setting.

  7. Anaplasma phagocytophilum in questing Ixodes ricinus ticks in southwestern Finland.

    Science.gov (United States)

    Sormunen, Jani J; Penttinen, Ritva; Klemola, Tero; Vesterinen, Eero J; Hänninen, Jari

    2016-12-01

    Anaplasma phagocytophilum is the causative agent of an emerging tick-borne disease, human granulocytic anaplasmosis. While the bacterium has been reported from questing ticks in neighboring Sweden, Norway and Russia, the few surveys regarding questing ticks in Finland have thus far been negative. In the current study, the prevalence of A. phagocytophilum in Ixodes ricinus populations was evaluated in several study localities around southwestern Finland during 2013-2014. Some of these populations were previously screened and found negative for A. phagocytophilum in 2000. A total of 3158 I. ricinus collected by blanket dragging were screened for Anaplasma spp. using qPCR. Anaplasma were detected in 9.2% of adult ticks (n = 87) and 3.1% of nymphs (n = 979). All larval samples were negative for infection. All Anaplasma-positive samples were identified as A. phagocytophilum by sequencing. This is, to the best of our knowledge, the first report of the pathogen from questing ticks in Finland. Furthermore, the pathogen was detected from several localities found negative during the previous screening 13 years earlier.

  8. Evidence of the role of tick subolesin in gene expression

    Directory of Open Access Journals (Sweden)

    Blouin Edmour F

    2008-08-01

    Full Text Available Abstract Background Subolesin is an evolutionary conserved protein that was discovered recently in Ixodes scapularis as a tick protective antigen and has a role in tick blood digestion, reproduction and development. In other organisms, subolesin orthologs may be involved in the control of developmental processes. Because of the profound effect of subolesin knockdown in ticks and other organisms, we hypothesized that subolesin plays a role in gene expression, and therefore affects multiple cellular processes. The objective of this study was to provide evidence for the role of subolesin in gene expression. Results Two subolesin-interacting proteins were identified and characterized by yeast two-hybrid screen, co-affinity purification and RNA interference (RNAi. The effect of subolesin knockdown on the tick gene expression pattern was characterized by microarray analysis and demonstrated that subolesin RNAi affects the expression of genes involved in multiple cellular pathways. The analysis of subolesin and interacting protein sequences identified regulatory motifs and predicted the presence of conserved protein kinase C (PKC phosphorylation sites. Conclusion Collectively, these results provide evidence that subolesin plays a role in gene expression in ticks.

  9. Tick-borne infections in human and animal population worldwide

    Directory of Open Access Journals (Sweden)

    José Brites-Neto

    2015-03-01

    Full Text Available The abundance and activity of ectoparasites and its hosts are affected by various abiotic factors, such as climate and other organisms (predators, pathogens and competitors presenting thus multiples forms of association (obligate to facultative, permanent to intermittent and superficial to subcutaneous developed during long co-evolving processes. Ticks are ectoparasites widespread globally and its eco epidemiology are closely related to the environmental conditions. They are obligatory hematophagous ectoparasites and responsible as vectors or reservoirs at the transmission of pathogenic fungi, protozoa, viruses, rickettsia and others bacteria during their feeding process on the hosts. Ticks constitute the second vector group that transmit the major number of pathogens to humans and play a role primary for animals in the process of diseases transmission. Many studies on bioecology of ticks, considering the information related to their population dynamics, to the host and the environment, comes possible the application and efficiency of tick control measures in the prevention programs of vector-borne diseases. In this review were considered some taxonomic, morphological, epidemiological and clinical fundamental aspects related to the tick-borne infections that affect human and animal populations.

  10. On the search for markers of tick resistance in bovines.

    Science.gov (United States)

    Regitano, L C A; Ibelli, A M G; Gasparin, G; Miyata, M; Azevedo, A L S; Coutinho, L L; Teodoro, R L; Machado, M A; Silva, M V G B; Nakata, L C; Zaros, L G; Sonstegard, T S; Silva, A M; Alencar, M M; Oliveira, M C S

    2008-01-01

    Genetic differences in susceptibility to ticks (Rhipicephalus (Boophilus) microplus) are considerable in bovines. Here, mapping, association and gene expression approaches were employed to further advance our understanding of the molecular basis of tick resistance. A B. taurus x B. indicus F2 population was developed by Embrapa and 382 individuals were measured for parasitic load. Scanning of all chromosomes is in progress. Quantitative trait loci (QTL) for tick load were mapped to chromosomes 4, 5, 7, 10, 14, 18 and 23 out of the 20 chromosomes scanned and were dependent on the season in which the phenotype was scored. In the candidate gene approach, females from the genetic groups Nelore (NE--184), Canchim x Nelore (CN--153), Aberdeen Angus x Nelore (AN--123) and Simmental x Nelore (SN--120) were evaluated under natural infestation. Microsatellite markers close to the genes for interleukin 2 (IL2), interleukin 4 (IL4) and interferon gamma (IFNG) were analysed. Tick counts were associated with the marker for interleukin 4 (P Nelore calves as well as between resistant versus susceptible cows from NE, CN and AN genetic groups were also investigated. Comparison of cytokines from infested and naïve animals showed downregulation of IL2. When resistant cows were compared to susceptible animals, IL8 was downregulated. These results reinforce the multiloci nature of tick resistance and the need to consider QTL and environment interactions.

  11. Novel paramyxoviruses in free-ranging European bats.

    Directory of Open Access Journals (Sweden)

    Andreas Kurth

    Full Text Available The zoonotic potential of paramyxoviruses is particularly demonstrated by their broad host range like the highly pathogenic Hendra and Nipah viruses originating from bats. But while so far all bat-borne paramyxoviruses have been identified in fruit bats across Africa, Australia, South America, and Asia, we describe the detection and characterization of the first paramyxoviruses in free-ranging European bats. Moreover, we examined the possible impact of paramyxovirus infection on individual animals by comparing histo-pathological findings and virological results. Organs from deceased insectivorous bats of various species were sampled in Germany and tested for paramyxovirus RNA in parallel to a histo-pathological examination. Nucleic acids of three novel paramyxoviruses were detected, two viruses in phylogenetic relationship to the recently proposed genus Jeilongvirus and one closely related to the genus Rubulavirus. Two infected animals revealed subclinical pathological changes within their kidneys, suggestive of a similar pathogenesis as the one described in fruit bats experimentally infected with Hendra virus.Our findings indicate the presence of bat-born paramyxoviruses in geographic areas free of fruit bat species and therefore emphasize a possible virus-host co-evolution in European bats. Since these novel viruses are related to the very distinct genera Rubulavirus and Jeilongvirus, a similarly broad genetic diversity among paramyxoviruses in other Microchiroptera compared to Megachiroptera can be assumed. Given that the infected bats were either found in close proximity to heavily populated human habitation or areas of intensive agricultural use, a potential risk of the emergence of zoonotic paramyxoviruses in Europe needs to be considered.

  12. Wind turbines and bat mortality: Doppler shift profiles and ultrasonic bat-like pulse reflection from moving turbine blades.

    Science.gov (United States)

    Long, Chloe V; Flint, James A; Lepper, Paul A

    2010-10-01

    Bat mortality resulting from actual or near-collision with operational wind turbine rotors is a phenomenon that is widespread but not well understood. Because bats rely on information contained in high-frequency echoes to determine the nature and movement of a target, it is important to consider how ultrasonic pulses similar to those used by bats for echolocation may be interacting with operational turbine rotor blades. By assessing the characteristics of reflected ultrasonic echoes, moving turbine blades operating under low wind speed conditions (<6 m s(-1)) were found to produce distinct Doppler shift profiles at different angles to the rotor. Frequency shifts of up to ±700-800 Hz were produced, which may not be perceptible by some bat species. Monte Carlo simulation of bat-like sampling by echolocation revealed that over 50 rotor echoes could be required by species such as Pipistrellus pipistrellus for accurate interpretation of blade movement, which may not be achieved in the bat's approach time-window. In summary, it was found that echoes returned from moving blades had features which could render them attractive to bats or which might make it difficult for the bat to accurately detect and locate blades in sufficient time to avoid a collision.

  13. Microsatellite instability detection using BAT-25 and BAT-26 by Real Time PCR and HPLC in colorectal cancer

    Directory of Open Access Journals (Sweden)

    Marjan Rismanchi

    2014-03-01

    Conclusion: The sensitivity and specificity of real time PCR in MSI detection is the same as sequencing method and more than HPLC. BAT-26 marker is more sensitive than BAT-25 and MSI detection with Real time PCR could be considered as an accu-rate method to diagnose MSI in CRC tissues not sera.

  14. Session: Bat ecology related to wind development and lessons learned about impacts on bats from wind development

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Greg; Kunz, Thomas

    2004-09-01

    This session at the Wind Energy and Birds/Bats workshop consisted of two paper presentations followed by a discussion/question and answer period. It was the first of the sessions to shift the focus to the issue of wind energy development's impacts specifically to bats. The presentations discussed lessons that have been learned regarding direct and indirect impacts on bats and strategies planned to address such issues. Presenters addressed what the existing science demonstrates about land-based wind turbine impacts on bats, including: mortality, avoidance, direct habitat impacts, species and numbers killed, per turbine rates/per MW generated, and impacts on threatened and endangered species. They discussed whether there is sufficient data for wind turbines and bat impacts for projects in the eastern US, especially on ridge tops. Finally, the subject of offshore impacts on bats was briefly addressed, including what lessons have been learned in Europe and how these can be applied in the U S. Paper one, by Greg Johnson, was titled ''A Review of Bat Impacts at Wind Farms in the US''. Paper two, by Thomas Kunz, was titled ''Wind Power: Bats and Wind Turbines''.

  15. 75 FR 57097 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-09-17

    ... of Proposed Rule Change To Adopt BATS Rule 2.12, Entitled ``BATS Trading, Inc. as Inbound Router... new BATS Rule 2.12, entitled ``BATS Trading, Inc. as Inbound Router'' and to make other related... router in its capacity as a routing facility of the Exchange. The Exchange is proposing to adopt the...

  16. 78 FR 37644 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-06-21

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. June 17, 2013. Pursuant to...\\ notice is hereby given that on June 4, 2013, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  17. 78 FR 51235 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-08-20

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. August 14, 2013. Pursuant to...\\ notice is hereby given that on August 7, 2013, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  18. Diet of spotted bats (Euderma maculatum) in Arizona as indicated by fecal analysis and stable isotopes

    Science.gov (United States)

    We assessed diet of spotted bats (Euderma maculatum (J.A. Allen, 1891)) by visual analysis of bat feces and stable carbon (δ13C) and nitrogen (δ15N) isotope analysis of bat feces, wing, hair, and insect prey. We collected 33 fecal samples from spotted bats and trapped 3755 insect...

  19. 78 FR 62804 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-10-22

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. October 11, 2013. Pursuant to...\\ notice is hereby given that on October 1, 2013, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  20. 75 FR 66170 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-10-27

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. October 21, 2010. Pursuant to...\\ notice is hereby given that on October 14, 2010, BATS Exchange, Inc. (``BATS'' or the ``Exchange'')...

  1. 77 FR 35735 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2012-06-14

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. June 8, 2012. Pursuant to... is hereby given that on May 31, 2012, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'') filed...

  2. 78 FR 16306 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-03-14

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. March 8, 2013. Pursuant to...\\ notice is hereby given that on March 1, 2013, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  3. 78 FR 51261 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-08-20

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. August 14, 2013. Pursuant to...\\ notice is hereby given that on August 1, 2013, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  4. 77 FR 23307 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2012-04-18

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. April 12, 2012. Pursuant to... is hereby given that on April 2, 2012, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'') filed...

  5. 75 FR 66183 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-10-27

    ...), 75 FR 51295 (August 19, 2010) (order approving application of BATS Y-Exchange, Inc. for registration... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change by BATS Exchange, Inc. To Amend BATS Rule 11.13, Entitled ``Order...

  6. 76 FR 50803 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2011-08-16

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. August 10, 2011. Pursuant to...\\ notice is hereby given that on July 29, 2011, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  7. 75 FR 20418 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-04-19

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. April 9, 2010. Pursuant to...\\ notice is hereby given that on March 31, 2010, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  8. 75 FR 27847 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-05-18

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. May 11, 2010. Pursuant to...\\ notice is hereby given that on May 4, 2010, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'') filed...

  9. 77 FR 31059 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2012-05-24

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. May 18, 2012. Pursuant to...\\ notice is hereby given that on May 11, 2012, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  10. 78 FR 51257 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-08-20

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. August 14, 2013. Pursuant to...\\ notice is hereby given that on August 2, 2013, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  11. 76 FR 20414 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2011-04-12

    ... COMMISSION Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. April 6, 2011. Pursuant to...\\ notice is hereby given that, on April 1, 2011, BATS Exchange, Inc. (the ``Exchange'' or ``BATS'')...

  12. 49 CFR 40.213 - What training requirements must STTs and BATs meet?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What training requirements must STTs and BATs meet... requirements must STTs and BATs meet? To be permitted to act as a BAT or STT in the DOT alcohol testing program...). (1) Qualification training must be in accordance with the DOT Model BAT or STT Course, as...

  13. Comparative population genetics of two invading ticks: Evidence of the ecological mechanisms underlying tick range expansions.

    Science.gov (United States)

    Nadolny, Robyn; Gaff, Holly; Carlsson, Jens; Gauthier, David

    2015-10-01

    Two species of ixodid tick, Ixodes affinis Neumann and Amblyomma maculatum Koch, are simultaneously expanding their ranges throughout the mid-Atlantic region of the US. Although we have some understanding of the ecology and life history of these species, the ecological mechanisms governing where and how new populations establish and persist are unclear. To assess population connectivity and ancestry, we sequenced a fragment of the 16S mitochondrial rRNA gene from a representative sample of individuals of both species from populations throughout the eastern US. We found that despite overlapping host preferences throughout ontogeny, each species exhibited very different genetic and geographic patterns of population establishment and connectivity. I. affinis was of two distinct mitochondrial clades, with a clear geographic break separating northern and southern populations. Both I. affinis populations showed evidence of recent expansion, although the southern population was more genetically diverse, indicating a longer history of establishment. A. maculatum exhibited diverse haplotypes that showed no significant relationship with geographic patterns and little apparent connectivity between sites. Heteroplasmy was also observed in the 16S mitochondrial rRNA gene in 3.5% of A. maculatum individuals. Genetic evidence suggests that these species rely on different key life stages to successfully disperse into novel environments, and that host vagility, habitat stability and habitat connectivity all play critical roles in the establishment of new tick populations.

  14. Management of tick infestation in dogs

    Directory of Open Access Journals (Sweden)

    Somasani Ayodhya

    2014-09-01

    Full Text Available The present study was carried out during the month of January 2014 when a total of 148 dogs with history of various diseases were presented to the Campus Veterinary Hospital, Teaching Veterinary Clinical Complex, College of Veterinary Science, Rajendranagar, Hyderabad, India. Out of 148 dogs that were presented to the hospital, 48 dogs had the clinical signs of loss of hair, itching, and reduced food intake. The dogs were restless and continuously rubbed their bodies against the walls in the houses, and scratching with their legs. Clinical examination of the dogs revealed presence of alopecia, pruritus, and the formation of small crusts. All 48 dogs were treated with ivermectin by subcutaneous injection dosed at 0.02 mL/kg body weight at a weekly interval for 2 to 3 weeks. All dogs were bathed with cypermethrin shampoo weekly once for 2-3 weeks. In the present study, it was observed that ivermectin/cypermethrin combination therapy was effective for the management of tick infestation in dogs.

  15. Bats, Blood-Feeders and Biodiversity

    DEFF Research Database (Denmark)

    Bohmann, Kristine

    DNA metabarcoding of environmental samples has rapidly become a valuable tool for ecological studies such as biodiversity and diet studies. To reveal the diversity in environmental samples such as soil, water, and faeces, this approach principally employs PCR amplification of environmental DNA...... minimising the occurrence of errors. Centered around metabarcoding dietary studies of bat droppings and leech gut contents, this continuous exploration and refinement is reflected in both the work and structure of this thesis. After a thesis introduction and two chapters on environmental DNA and biodiversity...

  16. 9 CFR 72.21 - Animals infested with or exposed to ticks subject to same restrictions as cattle.

    Science.gov (United States)

    2010-01-01

    ... ticks subject to same restrictions as cattle. 72.21 Section 72.21 Animals and Animal Products ANIMAL AND... exposed to ticks subject to same restrictions as cattle. Animals other than cattle which are infested with ticks or exposed to tick infestation shall not be moved interstate unless they are treated, handled,...

  17. Ticks collected from migratory birds, including a new record of Haemaphysalis formosensis, on Jeju Island, Korea.

    Science.gov (United States)

    Choi, Chang-Yong; Kang, Chang-Wan; Kim, Eun-Mi; Lee, Sang; Moon, Kyoung-Ha; Oh, Mi-Rae; Yamauchi, Takeo; Yun, Young-Min

    2014-04-01

    Migratory birds may disperse parasites across ecological barriers, and recent climate change may alter the pattern of ectoparasite dispersal via changed patterns of bird migration. In order to document the parasitization of migratory birds by Ixodidae ticks on Jeju Island in Korea, we examined 934 migratory birds comprising 75 species for ticks from 2010 to 2012. In total, 313 ticks were collected from 74 migratory birds across 17 avian species and identified based on morphological keys. These ticks represented six species: Haemaphysalis flava, H. formosensis, H. longicornis, H. concinna, Ixodes turdus and I. nipponensis. Of particular note was the presence of H. formosensis, a species not previously reported to have been found in Korea, and H. concinna, which had not been previously reported on Jeju Island. The dominant tick species found were H. flava (226 ticks, 72.2 %) and I. turdus (54 ticks, 17.3 %), and ground-dwelling thrushes such as Pale thrushes (Turdus pallidus; 39 birds, 52.7 %) were the most important hosts. Although H. longicornis is the most abundant and prevalent terrestrial tick on Jeju Island, the species accounted for only 3.8 % of the total ticks collected in this study, suggesting that ticks on migratory birds may differ from the local tick fauna and that exotic ticks may be introduced via migratory birds. Therefore, long-term programs for tick and tick-borne disease surveillance are recommended to understand the role of migratory animals in the introduction of exotic species and associated pathogens and in life cycles of ticks at different stages in this region.

  18. Tick pests and vectors (Acari: Ixodoidea) in European towns: Introduction, persistence and management.

    Science.gov (United States)

    Uspensky, Igor

    2014-02-01

    Ticks have always been a part of fauna in and around human settlements, and their significance changed concurrently with the enlargement of settlements and their transformation into towns. The increased rate of urbanization during the last decades has created a new reality for tick existence. Two groups of ticks are of major concern for modern towns: those living under natural conditions of urban surroundings and those well-adapted to urban conditions. During the process of urbanization, encroachment into forested and uncultivated areas as well as protection of existing green spaces create opportunities for ticks living in nature to also exist under urban and suburban conditions. Conditions of modern urban and especially suburban environment in developed European countries adequately meet tick requirements. Tick species having an advantage in urban areas are those that can use one and the same host at all parasitic stages, can starve for a prolonged time, can use either urban pests or domesticated animals as hosts, and can live in man-made buildings. The ticks of the Argas reflexus group (Argasidae) and the brown dog tick Rhipicephalus sanguineus (Ixodidae) comply with practically all conditions necessary for successful survival in urban areas. The ability of ticks to transmit numerous human and animal pathogens and the presence of many reservoir hosts in urban and suburban areas create persistent danger for human populations and domestic animals. Impact on urban ticks should be directed against the two major requirements of tick existence: reducing populations of potential tick hosts (feral pigeons, stray dogs and cats, and urban rodents), and changing other environmental conditions to make them less suitable for ticks. It is especially important that urban inhabitants be properly informed about the danger posed by ticks, the sites of possible tick attacks, and basic self-protection techniques.

  19. Using sutures to attach miniature tracking tags to small bats for multimonth movement and behavioral studies

    Science.gov (United States)

    Castle, Kevin T.; Weller, Theodore J.; Cryan, Paul M.; Hein, Cris D.; Schirmacher, Michael R.

    2015-01-01

    1. Determining the detailed movements of individual animals often requires them to carry tracking devices, but tracking broad-scale movement of small bats (brown bats (Eptesicus fuscus) in Colorado and hoary bats (Lasiurus cinereus) in California. 3. GPS tags and data loggers were sutured to 17 bats in this study. Three tagged bats were recaptured seven months after initial deployment, with tags still attached; none of these bats showed ill effects from the tag. No severe injuries were apparent upon recapture of 6 additional bats that carried tags up to 26 days after attachment, however one of the bats exhibited skin chafing. 4. Use of absorbable sutures to affix small tracking devices seems to be a safe, effective method for studying movements of bats over multiple months, although additional testing is warranted. This new attachment method has the potential to quickly advance our understanding of small bats, particularly as more-sophisticated miniature tracking devices (e.g., satellite tags) become available.

  20. Cloning and molecular evolution of the aldehyde dehydrogenase 2 gene (Aldh2) in bats (Chiroptera).

    Science.gov (United States)

    Chen, Yao; Shen, Bin; Zhang, Junpeng; Jones, Gareth; He, Guimei

    2013-02-01

    Old World fruit bats (Pteropodidae) and New World fruit bats (Phyllostomidae) ingest significant quantities of ethanol while foraging. Mitochondrial aldehyde dehydrogenase (ALDH2, encoded by the Aldh2 gene) plays an important role in ethanol metabolism. To test whether the Aldh2 gene has undergone adaptive evolution in frugivorous and nectarivorous bats in relation to ethanol elimination, we sequenced part of the coding region of the gene (1,143 bp, ~73 % coverage) in 14 bat species, including three Old World fruit bats and two New World fruit bats. Our results showed that the Aldh2 coding sequences are highly conserved across all bat species we examined, and no evidence of positive selection was detected in the ancestral branches leading to Old World fruit bats and New World fruit bats. Further research is needed to determine whether other genes involved in ethanol metabolism have been the targets of positive selection in frugivorous and nectarivorous bats.

  1. Erythema chronicum migrans and lyme arthritis: field study of ticks.

    Science.gov (United States)

    Wallis, R C; Brown, S E; Kloter, K O; Main, A J

    1978-10-01

    Ticks were collected during 1977 in communities east of the Connecticut River where there was a high incidence of erythema chronicum migrans and Lyme arthritis and were compared with collections from a similar area 20 km west of the river where cases of the disease were rare. Ixodes scapularis was much more abundant on the east side than on the west. Immature I. scapularis were 13 times more abundant on white-footed mice (Peromyscus leucopus), and adult I. scapularis 16 times more abundant on white-tailed deer (Odocoileus virginianus) in the east than in the west communities. In addition, all active stages in the life cycle of this tick--larvae, nymphs, and adults--both males and females, were found on humans (mostly patients) in the east communities. Both nymphs and adults were abundant on dogs and cats in this area. Attempts to recover an etiologic agent from ticks were unsuccessful.

  2. Rickettsia africae and Candidatus Rickettsia barbariae in ticks in Israel.

    Science.gov (United States)

    Waner, Trevor; Keysary, Avi; Eremeeva, Marina E; Din, Adi Beth; Mumcuoglu, Kosta Y; King, Roni; Atiya-Nasagi, Yafit

    2014-05-01

    DNA of several spotted fever group rickettsiae was found in ticks in Israel. The findings include evidence for the existence of Rickettsia africae and Candidatus Rickettsia barbariae in ticks in Israel. The DNA of R. africae was detected in a Hyalomma detritum tick from a wild boar and DNA of C. Rickettsia barbariae was detected in Rhipicephalus turanicus and Rhipicephalus sanguineus collected from vegetation. The DNA of Rickettsia massiliae was found in Rh. sanguineus and Haemaphysalis erinacei, whereas DNA of Rickettsia sibirica mongolitimonae was detected in a Rhipicephalus (Boophilus) annulatus. Clinicians should be aware that diseases caused by a variety of rickettsiae previously thought to be present only in other countries outside of the Middle East may infect residents of Israel who have not necessarily traveled overseas. Furthermore, this study reveals again that the epidemiology of the spotted fever group rickettsiae may not only involve Rickettsia conorii but may include other rickettsiae.

  3. Efficacy of afoxolaner against Ixodes scapularis ticks in dogs.

    Science.gov (United States)

    Mitchell, Elizabeth B; McCall, John W; Theodore Chester, S; Larsen, Diane

    2014-04-02

    Efficacy of afoxolaner, a novel isoxazoline insecticide/acaricide, against Ixodes scapularis was evaluated in a laboratory study. One day prior to treatment, beagle dogs (n=16) were infested with 50 unfed wild adult ticks. Repeat infestations were performed weekly for four additional weeks. The number of live ticks remaining on each dog was determined 48 h after treatment and after each subsequent infestation. A single oral treatment with a dose approaching the minimum effective dose of afoxolaner (2.5mg/kg) eliminated the pre-existing infestations of I. scapularis ticks and controlled weekly re-infestations, with efficacy between 98% and 100% recorded until Day 23 and 94% at Day 30.

  4. Clinico-epidemiologichesky aspects of the mixed tick-borne infections in the endemic region

    Directory of Open Access Journals (Sweden)

    E. S. Aleshkovskaya

    2013-01-01

    Full Text Available Detection of clinico-epidemiological features of the mixed tick-borne infections – tick-borne Lyme disease and a human granulocytic anaplasmosis was the purpose of the conducted research. During the spring – summer period 146 patients with tick-borne borreliosis were surveyed. As a result at 45 (30,82% patients authentically diagnosed the mixed tick-borne infection. Features of clinical manifestations of a mixed tick-borne infection revealed: catarrhal phenomena (20%, liver defeats (33%, nephros (31, 7%, frequent secondary erythems (20%. Changes in haemogram defined: thrombocytopenia (42,2%, anemia (20%, leukopenia (13,3%.

  5. Driving forces for changes in geographical distribution of Ixodes ricinus ticks in Europe

    DEFF Research Database (Denmark)

    Medlock, Jolyon M.; Hansford, Kayleigh M.; Bormane, Antra;

    2013-01-01

    , and the changes in the distribution and abundance of tick hosts are important considerations during our assessment and management of the public health risks associated with ticks and tick-borne disease issues in 21st century Europe. Better understanding and mapping of the spread of I. ricinus (and changes in its...... abundance) is, however, essential to assess the risk of the spread of infections transmitted by this vector species. Enhanced tick surveillance with harmonized approaches for comparison of data enabling the follow-up of trends at EU level will improve the messages on risk related to tick-borne diseases...

  6. The effect of tick size on trading volume share in three competing stock markets

    Science.gov (United States)

    Nagumo, Shota; Shimada, Takashi; Ito, Nobuyasu

    2016-09-01

    The relationship between tick sizes and trading volume share in two and three competing markets is studied theoretically. By introducing a simple model which is equipped with multiple markets and non-strategic traders, we analytically calculate the share. It is shown that share is shifted from a market with a larger tick size to a market with a smaller tick size, and the size of share-shift is determined by difference between tick sizes not by ratio between tick sizes in both cases of two markets and three markets.

  7. Rickettsia bellii in Amblyomma rotundatum ticks parasitizing Rhinella jimi from northeastern Brazil.

    Science.gov (United States)

    Horta, Mauricio C; Saraiva, Danilo G; Oliveira, Glauber M B; Martins, Thiago F; Labruna, Marcelo B

    2015-01-01

    This study evaluated rickettsial infection in Amblyomma rotundatum ticks collected from toads (Rhinella jimi) in the Brazilian Caatinga biome, an unique semiarid region of South America. Tick infestations were observed in 57.8% toads (26/45); mean infestation: 1.6 ticks/toad. DNA extraction from 42 ticks (6 larvae, 22 nymphs and 11 female adults) was tested by polymerase chain reaction (PCR) targeting Rickettsia organisms, which were detected in 100% of the ticks. Amplicons' DNA sequences were identical to each other and 99% identical to Rickettsia bellii from GenBank. DNA samples extracted from the blood of the 45 toads were negative by rickettsia-PCR protocols.

  8. Isolation of aerobic bacteria from ticks infested sheep in Iraq

    Institute of Scientific and Technical Information of China (English)

    Waleed Ibrahem Jalil; Mohammad Mushgil Zenad

    2016-01-01

    Objective:To highlight the presence of aerobic bacteria in live ticks infested sheep,in Diyala Governorate,Iraq.Methods:One hundred and thirty adult alive ticks were picked up from sheep which were reared in different farms in Diyala Governorate,Iraq,during the period from November 2012 to May 2013.Ticks were classified in the Natural History Museum in Baghdad.They were dissected aseptically for extraction of the salivary gland and midgut.The removed tissue from each organ was inoculated in buffer peptone water(1%)and incubated for 2 h at 37 °C,to maintain weak and/or injured bacterial cells,then transmitted to nutrient broth incubated at 37 °C for 18 h.Culturing was done on three solid bacteriological media(nutrient,blood and McConkey agars),and then incubated at37 ℃ for 24 h.Bacterial identification was performed by using multiple biochemical tests and API-20 strips.Data were analyzed by using Statistical Analysis System version 9.1,2010.Chi-square test was used for comparison at significant level of P ≤ 0.05.Results:Two species of ticks were identified[Rhipicephalus(Boophilus) annulatus and Hyalomma turanicum].High bacterial isolation rate was observed(483 isolates).A significant high isolation rate was recorded from Rhipicephalus annulatus(63.14%).Six bacterial species were identified[Escherichia coli(28.36%),Pseudomonas aeruginosa(18.01%),Bacillus cereus(14.69%),Staphylococcus aureus(13.66%),Citrobacter freundii(13.04%),and Enterobacter species(12.21%)].Also the high bacterial isolation rates were recorded in the temperate months(November,March and April);these coincided with high reproductive performance of ticks.Conclusions:The high isolation rate of aerobic pathogens from ticks might reflect the active contribution of this arthropod in environmental contamination and increase the probability of transmitting bacterial pathogens to their hosts.

  9. Isolation of aerobic bacteria from ticks infested sheep in Iraq

    Institute of Scientific and Technical Information of China (English)

    Waleed Ibrahem Jalil; Mohammad Mushgil Zenad

    2016-01-01

    Objective: To highlight the presence of aerobic bacteria in live ticks infested sheep, in Diyala Governorate, Iraq. Methods: One hundred and thirty adult alive ticks were picked up from sheep which were reared in different farms in Diyala Governorate, Iraq, during the period from November 2012 to May 2013. Ticks were classified in the Natural History Museum in Baghdad. They were dissected aseptically for extraction of the salivary gland and mid-gut. The removed tissue from each organ was inoculated in buffer peptone water (1%) and incubated for 2 h at 37℃, to maintain weak and/or injured bacterial cells, then transmitted to nutrient broth incubated at 37℃ for 18 h. Culturing was done on three solid bacteriological media (nutrient, blood and McConkey agars), and then incubated at 37℃ for 24 h. Bacterial identification was performed by using multiple biochemical tests and API-20 strips. Data were analyzed by using Statistical Analysis System version 9.1, 2010. Chi-square test was used for comparison at significant level of P ≤0.05. Results: Two species of ticks were identified [Rhipicephalus (Boophilus) annulatus and Hyalomma turanicum]. High bacterial isolation rate was observed (483 isolates). A significant high isolation rate was recorded from Rhipicephalus annulatus (63.14%). Six bacterial species were identified [Escherichia coli (28.36%), Pseudomonas aeruginosa (18.01%), Bacillus cereus (14.69%), Staphylococcus aureus (13.66%), Citrobacter freundii (13.04%), and Enterobacter species (12.21%)]. Also the high bacterial isolation rates were recorded in the temperate months (November, March and April); these coin-cided with high reproductive performance of ticks. Conclusions: The high isolation rate of aerobic pathogens from ticks might reflect the active contribution of this arthropod in environmental contamination and increase the probability of transmitting bacterial pathogens to their hosts.

  10. Acetylcholinesterases of blood-feeding flies and ticks.

    Science.gov (United States)

    Temeyer, Kevin B; Tuckow, Alexander P; Brake, Danett K; Li, Andrew Y; Pérez de León, Adalberto A

    2013-03-25

    Acetylcholinesterase (AChE) is the biochemical target of organophosphate (OP) and carbamate pesticides for invertebrates, vertebrate nerve agents, and AChE inhibitors used to reduce effects of Alzheimer's disease. Organophosphate pesticides (OPs) are widely used to control blood-feeding arthropods, including biting flies and ticks. However, resistance to OPs in pests affecting animal and human health has compromised control efficacy. OP resistance often results from mutations producing an OP-insensitive AChE. Our studies have demonstrated production of OP-insensitive AChEs in biting flies and ticks. Complementary DNA (cDNA) sequences encoding AChEs were obtained for the horn fly, stable fly, sand fly, and the southern cattle tick. The availability of cDNA sequences enables the identification of mutations, expression and characterization of recombinant proteins, gene silencing for functional studies, as well as in vitro screening of novel inhibitors. The southern cattle tick expresses at least three different genes encoding AChE in their synganglion, i.e. brain. Gene amplification for each of the three known cattle tick AChE genes and expression of multiple alleles for each gene may reduce fitness cost associated with OP-resistance. AChE hydrolyzes the neurotransmitter, acetylcholine, but may have additional roles in physiology and development. The three cattle tick AChEs possess significantly different biochemical properties, and are expressed in neural and non-neural tissues, which suggest separation of structure and function. The remarkable complexity of AChEs in ticks suggested by combining genomic data from Ixodes scapularis with our genetic and biochemical data from Rhipicephalus microplus is suggestive of previously unknown gene duplication and diversification. Comparative studies between invertebrate and vertebrate AChEs could enhance our understanding of structure-activity relationships. Research with ticks as a model system offers the opportunity to

  11. [Ixodid ticks in the mountainous part of the Crimea].

    Science.gov (United States)

    Markeshin, S Ia; Evstaf'ev, I L; Kovin, V V; Evstratov, Iu V

    1992-01-01

    About a hundred of patients with tick-borne encephalitis (TBE) were recorded over the latest decade in the Crimea, and 60 TBE virus strains were isolated from the ticks collected on the peninsula. The results of studies carried out in 1986-1990 helped define the borders of 4 local natural foci of TBE, study their acarifauna, detect the principal TBE vector--Ixodes ricinus (with a mean virophority of 0.6%), and distinguish two foci with a combination of TBE and Crimean-Congo hemorrhagic fever.

  12. Scavenger Receptor Mediates Systemic RNA Interference in Ticks

    OpenAIRE

    Kyaw Min Aung; Damdinsuren Boldbaatar; Rika Umemiya-Shirafuji; Min Liao; Xuan Xuenan; Hiroshi Suzuki; Remil Linggatong Galay; Tetsuya Tanaka; Kozo Fujisaki

    2011-01-01

    RNA interference is an efficient method to silence gene and protein expressions. Here, the class B scavenger receptor CD36 (SRB) mediated the uptake of exogenous dsRNAs in the induction of the RNAi responses in ticks. Unfed female Haemaphysalis longicornis ticks were injected with a single or a combination of H. longicornis SRB (HlSRB) dsRNA, vitellogenin-1 (HlVg-1) dsRNA, and vitellogenin receptor (HlVgR) dsRNA. We found that specific and systemic silencing of the HlSRB, HlVg-1, and HlVgR ge...

  13. Isolation of tick and mosquito-borne arboviruses from ticks sampled from livestock and wild animal hosts in Ijara District, Kenya.

    Science.gov (United States)

    Lwande, Olivia Wesula; Lutomiah, Joel; Obanda, Vincent; Gakuya, Francis; Mutisya, James; Mulwa, Francis; Michuki, George; Chepkorir, Edith; Fischer, Anne; Venter, Marietjie; Sang, Rosemary

    2013-09-01

    Tick-borne viruses infect humans through the bite of infected ticks during opportunistic feeding or through crushing of ticks by hand and, in some instances, through contact with infected viremic animals. The Ijara District, an arid to semiarid region in northern Kenya, is home to a pastoralist community for whom livestock keeping is a way of life. Part of the Ijara District lies within the boundaries of a Kenya Wildlife Service-protected conservation area. Arbovirus activity among mosquitoes, animals, and humans is reported in the region, mainly because prevailing conditions necessitate that people continuously move their animals in search of pasture, bringing them in contact with ongoing arbovirus transmission cycles. To identify the tick-borne viruses circulating among these communities, we analyzed ticks sampled from diverse animal hosts. A total of 10,488 ticks were sampled from both wildlife and livestock hosts and processed in 1520 pools of up to eight ticks per pool. The sampled ticks were classified to species, processed for virus screening by cell culture using Vero cells and RT-PCR (in the case of Hyalomma species), followed by amplicon sequencing. The tick species sampled included Rhipicephalus pulchellus (76.12%), Hyalomma truncatum (8.68%), Amblyomma gemma (5.00%), Amblyomma lepidum (4.34%), and others (5.86%). We isolated and identified Bunyamwera (44), Dugbe (5), Ndumu (2), Semliki forest (25), Thogoto (3), and West Nile (3) virus strains. This observation constitutes a previously unreported detection of mosquito-borne Semliki forest and Bunyamwera viruses in ticks, and association of West Nile virus with A. gemma and Rh. pulchellus ticks. These findings provide additional evidence on the potential role of ticks and associated animals in the circulation of diverse arboviruses in northeastern Kenya, including viruses previously known to be essentially mosquito borne.

  14. Predictors of protective behaviour against ticks in the UK: a mixed methods study.

    Science.gov (United States)

    Mowbray, Fiona; Amlôt, Richard; Rubin, G James

    2014-06-01

    The objective of this research was to determine the most appropriate protective behaviours to promote in order to protect members of the public from Lyme borreliosis, to identify the drivers and barriers for these behaviours, and to determine the strongest predictors of tick-protective behaviour. We used a mixed methods study with qualitative interviews and a quantitative web survey. Interviews with topic experts and members of the public suggested that predictors of tick checking included perceived disease likelihood and severity as well as overall awareness of ticks and tick-borne disease. Twenty-four percent of participants regularly checked for ticks after walking in a tick-endemic area. The strongest predictors of checking for ticks were greater levels of knowledge, perceived likelihood of being bitten, self-efficacy about tick removal, and lower levels of disgust about ticks. Barriers to checking included forgetfulness and lacking time. At-risk members of the UK public require information to increase awareness of ticks and protective behaviours, particularly tick checking. Information may be most effective if it focuses on increasing self-efficacy while also reducing disgust.

  15. Survey of tick species parasiting domestic ruminants in Ghaemshahr county, Mazandaran province, Iran

    Institute of Scientific and Technical Information of China (English)

    Hosseini Vasoukolaei Nasibeh; Telmadarraiy Zakkyeh; Vatandoost Hassan; Yaghoobi Ershadi Mohammad Reza; Hosseini Vasoukolaei Morteza; Oshaghi Mohammad Ali

    2010-01-01

    Objective:To determine the tick species parasitizing domestic ruminants in Ghaemshahr county in Mazandaran, a Caspian province in the north of Iran.Methods:About361 sheep, 54 goats and10cattle of18 herds in several villages in Ghaemshahr were inspected for tick infestation. Separated ticks were preserved in70% alcohol and identified.Results:About323 ticks (207female,116 male) were collected, the occurrence of ticks on sheep, goats and cattle were28.3%, 22.2% and20.0%respectively. The mean number of ticks on each animal was low (3-5ticks per animal).Rhipicephalus sanguineus, Rhipicephalus bursa, Ixodes ricinus, Boophilus annulatus, Haemaphysalis punctata andHaemaphysalis numidiana were the tick species we found.Rhipicephalus sanguineus were the most abundant species in the study area. The largest number of ticks were generally present from April to July, mostly in animal ears and tails. Ixodes, Boophilus andHaemaphysalis occurred in mountainous areas of Ghaemshahr, whereas Rhipicephalus were present in both mountains and plains of the study area.Conclusions: The result of this study is a survey of tick species from domestic animals in Iran and implication of possible prevention measures for diseases transmitted by ticks.

  16. Tick infestation on wild snakes in northern part of western Ghats of India.

    Science.gov (United States)

    Pandit, Pranav; Bandivdekar, Ruta; Geevarghese, G; Pande, Satish; Mandke, Omkar

    2011-05-01

    In total, 167 individuals of 30 species of snakes belonging to 22 genera and five families were examined for tick infestation from November 2008 to March 2010. Only two species of snakes, Ptyas mucosa (L., 1758) (Indian rat snake) and Naja naja (L., 1758) (spectacled cobra), were found infested by ticks. All ticks collected were identified to be Amblyomma gervaisi [previously Aponomma gervaisi (Lucas, 1847) 1. The average prevalence of these ticks on Indian rat snakes (n=48) was 29.16%, with abundance of 7.02 ticks per individual; on spectacled cobras (n=20), average prevalence was 30.00%, with abundance of 6.9 ticks per individual. The nymphs and males were predominant. All the ticks were found on the dorsal aspect of the body of the snake, and no ticks were recorded on the head, tail, or ventral body. The rate of tick infestation was highest in scrubland and was lowest in evergreen forests. Female Indian rat snakes showed higher tick infestation rates than male Indian rat snakes. Using Mann-Whitney U test, we found that longer snakes of both species had significantly higher rate of tick infestation in both the species of snakes.

  17. Prevalence and diversity of Babesia spp. in questing Ixodes ricinus ticks from Norway

    Directory of Open Access Journals (Sweden)

    Øines Øivind

    2012-08-01

    Full Text Available Abstract Background Ixodes ricinus ticks transmit Babesia species to vertebrate hosts. Using molecular tools we were able to detect the presence of this piroplasmid in its vector. The aims of this study were to investigate the prevalence and identity of Babesia species in questing ticks collected in various areas of Norway. Methods DNA from questing l. ricinus ticks were examined with a realtime PCR for the presence of Babesia. Positive samples of tick DNA were identified to species using PCR, and sequence analysis. Results From a total of 1908 questing l. ricinus ticks, 17 (0.9% indicated the presence of Babesia spp. after realtime-PCR screening. Ixodes ricinus harbouring Babesia spp. was detected in 9 out of 22 localities. Further molecular analyses of DNA from these positive ticks indicate the presence of Babesia venatorum, B. divergens, B. capreoli and a currently undescribed Babesia in Norwegian ticks. The most prevalent was B. venatorum found in 71% of the positive ticks. Conclusions A total of 17 out of 1908 (0.9% ticks were positive for Babesia. Our data confirm that there are several Babesia species in ticks in Norway. Babesia venatorum was the most prevalent. This species has a zoonotic potential and may cause human babesiosis following a tick bite.

  18. Filarial Nematode Infection in Ixodes scapularis Ticks Collected from Southern Connecticut

    Directory of Open Access Journals (Sweden)

    Pabbati Namrata

    2014-05-01

    Full Text Available It was recently demonstrated that the lone star tick Amblyomma americanum could harbor filarial nematodes within the genus Acanthocheilonema. In this study, Ixodes scapularis (deer ticks collected from Southern Connecticut were evaluated for their potential to harbor filarial nematodes. Non-engorged nymphal and adult stage Ixodes scapularis ticks were collected in Southern Connecticut using the standard drag method. In situ hybridization with filarial nematode specific sequences demonstrated the presence of filarial nematodes in Ixodes ticks. Filarial nematode specific DNA sequences were amplified and confirmed by direct sequencing in Ixodes nymphal and adult ticks using either general filarial nematode or Onchocercidae family specific PCR primers. Phylogenetic analysis of the 12S rDNA gene sequence indicated that the filarial nematode infecting Ixodes scapularis ticks is most closely related to the species found in Amblyoma americanum ticks and belongs to the genus of Acanthocheilonema. Our data also demonstrated that infection rate of these filarial nematode in Ixodes ticks is relatively high (about 22% and 30% in nymphal and adult Ixodes ticks, respectively. In summary, the results from our studies demonstrated that filarial nematode infection was found in Ixodes ticks similar to what has been found in Amblyomma americanum ticks.

  19. Toxicity of methyl parathion to bats: Mortality and coordination loss

    Science.gov (United States)

    Clark, D.R.

    1986-01-01

    The 24-h oral LD50 of methyl parathion (phosphorothioic acid O,O-dimethyl O-(4-nitrophenyl) ester) to little brown bats (Myotis lucifugus) (372 mg/kg) was 8.5 times the LD50 for mice (Mus musculus) (44 mg/kg). However, orally dosed mice either died or appeared behaviorally normal after 2 to 3 h, whereas many dosed bats, although alive at 24 h, could not right themselves when placed on their backs. The oral dose estimated to cause this loss of coordination in 50% of a sample of big brown bats (Eptesicus fuscus) was one-third or less the LD50 of this species. Cholinesterase activity depression in brains of little brown bats was similar whether dosage was oral or dermal. With death as the criterion, bats proved relatively insensitive to methyl parathion in 24-h tests, but considerations of the chemical's potential to cause coordination loss, leading to capture and death by predators, coupled with bats' naturally low reproductive rates, suggest possible injury to exposed bat populations.

  20. The sonar aperture and its neural representation in bats.

    Science.gov (United States)

    Heinrich, Melina; Warmbold, Alexander; Hoffmann, Susanne; Firzlaff, Uwe; Wiegrebe, Lutz

    2011-10-26

    As opposed to visual imaging, biosonar imaging of spatial object properties represents a challenge for the auditory system because its sensory epithelium is not arranged along space axes. For echolocating bats, object width is encoded by the amplitude of its echo (echo intensity) but also by the naturally covarying spread of angles of incidence from which the echoes impinge on the bat's ears (sonar aperture). It is unclear whether bats use the echo intensity and/or the sonar aperture to estimate an object's width. We addressed this question in a combined psychophysical and electrophysiological approach. In three virtual-object playback experiments, bats of the species Phyllostomus discolor had to discriminate simple reflections of their own echolocation calls differing in echo intensity, sonar aperture, or both. Discrimination performance for objects with physically correct covariation of sonar aperture and echo intensity ("object width") did not differ from discrimination performances when only the sonar aperture was varied. Thus, the bats were able to detect changes in object width in the absence of intensity cues. The psychophysical results are reflected in the responses of a population of units in the auditory midbrain and cortex that responded strongest to echoes from objects with a specific sonar aperture, regardless of variations in echo intensity. Neurometric functions obtained from cortical units encoding the sonar aperture are sufficient to explain the behavioral performance of the bats. These current data show that the sonar aperture is a behaviorally relevant and reliably encoded cue for object size in bat sonar.

  1. Modeling the colonization of Hawaii by hoary bats (Lasiurus cinereus)

    Science.gov (United States)

    Bonaccorso, Frank J.; McGuire, Liam P.

    2013-01-01

    The Hawaiian archipelago, the most isolated cluster of islands on Earth, has been colonized successfully twice by bats. The putative “lava tube bat” of Hawaii is extinct, whereas the Hawaiian Hoary Bat, Lasiurus cinereus semotus, survives as an endangered species. We conducted a three-stage analysis to identify conditions under which hoary bats originally colonized Hawaii. We used FLIGHT to determine if stores of fat would provide the energy necessary to fly from the Farallon Islands (California) to Hawaii, a distance of 3,665 km. The Farallons are a known stopover and the closest landfall to Hawaii for hoary bats during migrations within North America. Our modeling variables included physiological, morphological, and behavioral data characterizing North American Hoary Bat populations. The second step of our modeling process investigated the potential limiting factor of water during flight. The third step in our modeling examines the role that prevailing trade winds may have played in colonization flights. Of our 36 modeling scenarios, 17 (47 %) require tailwind assistance within the range of observed wind speeds, and 7 of these scenarios required −1 tailwinds as regularly expected due to easterly trade winds. Therefore the climatic conditions needed for bats to colonize Hawaii may not occur infrequently either in contemporary times or since the end of the Pleistocene. Hawaii’s hoary bats have undergone divergence from mainland populations resulting in smaller body size and unique pelage color.

  2. The role of tragus on echolocating bat, Eptesicus fuscus

    Science.gov (United States)

    Chiu, Chen; Moss, Cynthia

    2005-04-01

    Echolocating bats produce ultrasonic vocal signals and utilize the returning echoes to detect, localize and track prey, and also to avoid obstacles. The pinna and tragus, two major components of the bats external ears, play important roles in filtering returning echoes. The tragus is generally believed to play a role in vertical sound localization. The purpose of this study is to further examine how manipulation of the tragus affects a free-flying bat's prey capture and obstacle avoidance behavior. The first part of this study involved a prey capture experiment, and the bat was trained to catch the tethered mealworms in a large room. The second experiment involved obstacle avoidance, and the bat's task was to fly through the largest opening from a horizontal wire array without touching the wires. In both experiments, the bat performed the tasks under three different conditions: with intact tragus, tragus-deflection and recovery from tragus-deflection. Significantly lower performance was observed in both experiments when tragi were glued down. However, the bat adjusted quickly and returned to baseline performance a few days after the manipulation. The results suggest that tragus-deflection does have effects on both the prey capture and obstacle avoidance behavior. [Work supported by NSF.

  3. Preliminary survey of ticks (Acari: Ixodidae) parasitizing wild turkeys (Aves: Phasianidae) in eastern Kansas.

    Science.gov (United States)

    Mock, D E; Applegate, R D; Fox, L B

    2001-01-01

    During the spring and fall turkey hunting seasons of 1999, hunters and Kansas Department of Wildlife and Parks field personnel examined wild turkeys, Meleagris gallopavo L., for ticks and submitted them to us for identification. From springtime hunting, we received 113 ticks from 12 turkeys killed in nine counties, all in the eastern one-third of Kansas. Collectors reported examining three additional wild turkeys on which no ticks were found. All ticks were nymphal lone star ticks, Amblyomma americanum (L.). Of 11 wild turkeys examined in seven counties during October, one was parasitized by 30 A. americanum larvae. Data from this study and accounts from the published literature suggest that parasitism of wild turkeys by immature lone star ticks is commonplace wherever this host and ectoparasite are sympatric. Our study suggests that M. gallopavo may be an important host that supports lone star tick populations.

  4. Natural Anaplasma phagocytophilum infection in ticks from a forest area of Selenge province, Mongolia

    Directory of Open Access Journals (Sweden)

    G Javkhlan

    2014-03-01

    Full Text Available Anaplasma phagocytophilum is a zoonotic agent of public health importance, infecting both humans and animals. An investigation of the presence of Anaplasma phagocytophilum as well as Anaplasma platys was conducted in a forest area of Selenge province, Mongolia, where ticks are widely distributed and tick-borne diseases are highly endemic. Ticks were collected and tested using polymerase chain reaction based on groEL methodology. Anaplasma phagocytophilum was detected in 14 (6% of Ixodes persulcatus ticks and four (1% Dermacentor nuttalli ticks; infection of Anaplasma platys was detected in 1% of Ixodes persulcatus ticks and 10% of Dermacentor nuttalli ticks. The phylogenetic tree showed that the Anaplasma phagocytophilum clustered with the Russian group, most likely due to similar geographical locations. This finding is significant for both veterinary and public health officials given that these agents can cause both animal and human illness.

  5. Review: Importance of ticks and their chemical and immunological control in livestock

    Institute of Scientific and Technical Information of China (English)

    RAJPUT Zahid Iqbal; HU Song-hua; CHEN Wan-jun; ARIJO Abdullah G.; XIAO Chen-wen

    2006-01-01

    The medical and economic importance of ticks has long been recognized due to their ability to transmit diseases to humans and animals. Ticks cause great economic losses to livestock, and adversely affect livestock hosts in several ways. Loss of blood is a direct effect of ticks acting as potential vector for haemo-protozoa and helminth parasites. Blood sucking by large numbers of ticks causes reduction in live weight and anemia among domestic animals, while their bites also reduce the quality of hides. However, major losses caused by ticks are due to their ability to transmit protozoan, rickettsial and viral diseases of livestock, which are of great economic importance world-wide. There are quite a few methods for controlling ticks, but every method has certain shortcomings. The present review is focused on ticks importance and their control.

  6. On the potential roles of ticks and migrating birds in the ecology of West Nile virus

    Directory of Open Access Journals (Sweden)

    Karl Hagman

    2014-01-01

    Full Text Available Background: Mosquitoes are the primary vectors of West Nile virus (WNV. Ticks have, however, been suggested to be potential reservoirs of WNV. To investigate their role in the spread of the virus, ticks, which had been collected from birds migrating northward from Africa to Europe, were analyzed for the potential presence of WNV RNA. Methods: On the Mediterranean islands of Capri and Antikythira, a total of 14,824 birds were captured and investigated from which 747 ticks were collected. Results and conclusions: Most of the identified ticks (93% were nymphs and larvae of Hyalomma marginatum sensu lato (s.l., most of which were or appear to be Hyalomma rufipes. Of these ticks, 729 were individually screened for WNV RNA. None of the ticks was found to be WNV positive. Thus, there was no evidence that H. marginatum s.l. ticks play a role in the spread of WNV from Africa to Europe.

  7. To beat or not to beat a tick: comparison of DNA extraction methods for ticks (Ixodes scapularis

    Directory of Open Access Journals (Sweden)

    Alyssa D. Ammazzalorso

    2015-08-01

    Full Text Available Background. Blacklegged ticks (Ixodes scapularis are important disease vectors in the United States, known to transmit a variety of pathogens to humans, including bacteria, protozoa, and viruses. Their importance as a disease vector necessitates reliable and comparable methods for extracting microbial DNA from ticks. Furthermore, to explore the population genetics or genomics of this tick, appropriate DNA extraction techniques are needed for both the vector and its microbes. Although a few studies have investigated different methods of DNA isolation from ticks, they are limited in the number and types of DNA extraction and lack species-specific quantification of DNA yield.Methods. Here we determined the most efficient and consistent method of DNA extraction from two different developmental stages of I. scapularis—nymph and adult—that are the most important for disease transmission. We used various methods of physical disruption of the hard, chitinous exoskeleton, as well as commercial and non-commercial DNA isolation kits. To gauge the effectiveness of these methods, we quantified the DNA yield and confirmed the DNA quality via PCR of both tick and microbial genetic material.Results. DNA extraction using the Thermo GeneJET Genomic DNA Purification Kit resulted in the highest DNA yields and the most consistent PCR amplification when combined with either cutting or bead beating with select matrices across life stages. DNA isolation methods using ammonium hydroxide as well as the MoBio PowerSoil kit also produced strong and successful PCR amplification, but only for females.Discussion. We contrasted a variety of readily available methods of DNA extraction from single individual blacklegged ticks and presented the results through a quantitative and qualitative assessment.

  8. 77 FR 15153 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing of Proposed Rule Change by...

    Science.gov (United States)

    2012-03-14

    ... BATS Exchange, Inc. to Amend BATS Rule 2.12, Entitled ``BATS Trading, Inc. as Inbound Router'' March 12... BATS Rule 2.12, Entitled ``BATS Trading, Inc. as Inbound Router'' and To Make Related Changes); 65516... Effectiveness of Proposed Rule Change to Extend the Pilot Period of the Inbound Router, as Described in Rule...

  9. Bats and wind energy: a literature synthesis and annotated bibliography

    Science.gov (United States)

    Ellison, Laura E.

    2012-01-01

    Turbines have been used to harness energy from wind for hundreds of years. However, with growing concerns about climate change, wind energy has only recently entered the mainstream of global electricity production. Since early on in the development of wind-energy production, concerns have arisen about the potential impacts of turbines to wildlife; these concerns have especially focused on the mortality of birds. Despite recent improvements to turbines that have resulted in reduced mortality of birds, there is clear evidence that bat mortality at wind turbines is of far greater conservation concern. Bats of certain species are dying by the thousands at turbines across North America, and the species consistently affected tend to be those that rely on trees as roosts and most migrate long distances. Turbine-related bat mortalities are now affecting nearly a quarter of all bat species occurring in the United States and Canada. Most documented bat mortality at wind-energy facilities has occurred in late summer and early fall and has involved tree bats, with hoary bats (Lasiurus cinereus) being the most prevalent among fatalities. This literature synthesis and annotated bibliography focuses on refereed journal publications and theses about bats and wind-energy development in North America (United States and Canada). Thirty-six publications and eight theses were found, and their key findings were summarized. These publications date from 1996 through 2011, with the bulk of publications appearing from 2007 to present, reflecting the relatively recent conservation concerns about bats and wind energy. The idea for this Open-File Report formed while organizing a joint U.S. Fish and Wildlife Service/U.S. Geological Survey "Bats and Wind Energy Workshop," on January 25-26, 2012. The purposes of the workshop were to develop a list of research priorities to support decision making concerning bats with respect to siting and operations of wind-energy facilities across the United

  10. High prevalence of Trypanosoma vegrandis in bats from Western Australia.

    Science.gov (United States)

    Austen, Jill M; O'Dea, Mark; Jackson, Bethany; Ryan, Una

    2015-12-15

    The present study describes the first report of Trypanosoma vegrandis in bats using morphology and sequence analysis of the 18S rRNA gene. The PCR prevalence of T. vegrandis in bats was 81.8% (18/22). The high prevalence of T. vegrandis in the present study suggests that bats may play an important role in the epidemiology of T. vegrandis in Australia. T. vegrandis appears to be geographically dispersed, has a wide distribution in Australia and low levels of host specificity.

  11. The Second Swift BAT Gamma-Ray Burst Catalog

    Science.gov (United States)

    Barthelmy, S. D.; Baumgartner, W. H.; Cummings, J. R.; Fenimore, E. E.; Gehrels, N.; Krimm, H. A.; Markwardt, C. B.; Palmer, D. M.; Parsons, A. M.; Sato, G.; Stamatikos, M.; Tueller, J.; Ukwatta, T. N.; Zhang, B.

    2010-01-01

    We present the second Swift Burst Alert Telescope (BAT) catalog of gamma-ray bursts (GRBs), which contains 476 bursts detected by the BAT between 2004 December 19 and 2009 December 21. This catalog (hereafter the BAT2 catalog) presents burst trigger time, location, 90% error radius, duration, fluence, peak flux, time-averaged spectral parameters and time-resolved spectral parametert:; measured by the BAT. In the correlation study of various observed parameters extracted from the BAT prompt emission data, we distinguish among long-duration GRBs (L-GRBs), short-duration GRBs (S-GRBs), and short-duration GRBs with extended emission (S-GRBs with E.E.) to investigate differences in the prompt emission properties. The fraction of L-GRBs, S-GRBs and S-GRBs with E.E. in the catalog are 89%, 8% and 2% respectively. We compare the BAT prompt emission properties with the BATSE, BeppoSAX and HETE-2 GRB samples. We also correlate the observed prompt emission properties with the redshifts for the GRBs with known redshift. The BAT T90 and T50 durations peak at 70 s and 30 s, respectively. We confirm that the spectra of the BAT S-GRBs are generally harder than those of the L-GRBs. The time-averaged spectra of the BAT S GRBs with E.E. are similar to those of the L-GRBs. Whereas, the spectra of the initial short spikes of the S-GRBs with E.E. are similar to those of the S-GRBs. We show that the BAT GRB samples are significantly softer than the BATSE bright GRBs, and that the time-averaged E obs/peak of the BAT GRBs peaks at 80 keV which is significantly lower energy than those of the BATSE sample which peak at 320 keV. The time-averaged spectral properties of the BAT GRB sample are similar to those of the HETE-2 GRB samples. By time-resolved spectral analysis, we find that 10% of the BAT observed photon indices are outside the allowed region of the synchrotron shock model. The observed durations of the BAT high redshift GRBs are not systematically longer than those of the moderate

  12. Monitoring seasonal bat activity on a coastal barrier island in Maryland, USA.

    Science.gov (United States)

    Johnson, Joshua B; Gates, J Edward; Zegre, Nicolas P

    2011-02-01

    Research on effects of wind turbines on bats has increased dramatically in recent years because of significant numbers of bats killed by rotating wind turbine blades. Whereas most research has focused on the Midwest and inland portions of eastern North America, bat activity and migration on the Atlantic Coast has largely been unexamined. We used three long-term acoustic monitoring stations to determine seasonal bat activity patterns on the Assateague Island National Seashore, a barrier island off the coast of Maryland, from 2005 to 2006. We recorded five species, including eastern red bats (Lasiurus borealis), big brown bats (Eptesicus fuscus), hoary bats (Lasiurus cinereus), tri-colored bats (Perimyotis subflavus), and silver-haired bats (Lasionycteris noctivagans). Seasonal bat activity (number of bat passes recorded) followed a cosine function and gradually increased beginning in April, peaked in August, and declined gradually until cessation in December. Based on autoregressive models, inter-night bat activity was autocorrelated for lags of seven nights or fewer but varied among acoustic monitoring stations. Higher nightly temperatures and lower wind speeds positively affected bat activity. When autoregressive model predictions were fitted to the observed nightly bat pass totals, model residuals>2 standard deviations from the mean existed only during migration periods, indicating that periodic increases in bat activity could not be accounted for by seasonal trends and weather variables alone. Rather, the additional bat passes were attributable to migrating bats. We conclude that bats, specifically eastern red, hoary, and silver-haired bats, use this barrier island during migration and that this phenomenon may have implications for the development of near and offshore wind energy.

  13. Molecular Survey of Bacterial Zoonotic Agents in Bats from the Country of Georgia (Caucasus)

    Science.gov (United States)

    Osikowicz, Lynn; McKee, Clifton; Kuzmin, Ivan; Kandaurov, Andrei; Babuadze, Giorgi; Natradze, Ioseb; Imnadze, Paata; Kosoy, Michael

    2017-01-01

    Bats are important reservoirs for many zoonotic pathogens. However, no surveys of bacterial pathogens in bats have been performed in the Caucasus region. To understand the occurrence and distribution of bacterial infections in these mammals, 218 bats belonging to eight species collected from four regions of Georgia were examined for Bartonella, Brucella, Leptospira, and Yersinia using molecular approaches. Bartonella DNA was detected in 77 (35%) bats from all eight species and was distributed in all four regions. The prevalence ranged 6–50% per bat species. The Bartonella DNA represented 25 unique genetic variants that clustered into 21 lineages. Brucella DNA was detected in two Miniopterus schreibersii bats and in two Myotis blythii bats, all of which were from Imereti (west-central region). Leptospira DNA was detected in 25 (13%) bats that included four M. schreibersii bats and 21 M. blythii bats collected from two regions. The Leptospira sequences represented five genetic variants with one of them being closely related to the zoonotic pathogen L. interrogans (98.6% genetic identity). No Yersinia DNA was detected in the bats. Mixed infections were observed in several cases. One M. blythii bat and one M. schreibersii bat were co-infected with Bartonella, Brucella, and Leptospira; one M. blythii bat and one M. schreibersii bat were co-infected with Bartonella and Brucella; 15 M. blythii bats and three M. schreibersii bats were co-infected with Bartonella and Leptospira. Our results suggest that bats in Georgia are exposed to multiple bacterial infections. Further studies are needed to evaluate pathogenicity of these agents to bats and their zoonotic potential. PMID:28129398

  14. Bat Mx1 and Oas1, but not Pkr are highly induced by bat interferon and viral infection.

    Science.gov (United States)

    Zhou, Peng; Cowled, Christopher; Wang, Lin-Fa; Baker, Michelle L

    2013-01-01

    Bats harbour many emerging and re-emerging viruses, several of which are highly pathogenic in other mammals but cause no diseases in bats. As the interferon (IFN) response represents a first line of defence against viral infection, the ability of bats to control viral replication may be linked to the activation of the IFN system. The three most studied antiviral IFN-stimulated genes (ISGs) in other mammals; Pkr, Mx1 and Oas1 were examined in our model bat species, Pteropus alecto. Our results demonstrate that the three ISGs from P. alecto are highly conserved in their functional domains and promoter elements compared to corresponding genes from other mammals. However, P. alecto Oas1 contains two IFN-stimulated response elements (ISRE) in its promoter region compared with the single ISRE present in human OAS1 which may lead to higher IFN inducibility of the bat gene. Both Oas1 and Mx1 were induced in a highly IFN-dependent manner following stimulation with IFN or synthetic double-strand RNA (dsRNA) whereas Pkr showed evidence of being induced in an IFN-independent manner. Furthermore, bat Oas1 appeared to be the most inducible of the three ISGs following either IFN stimulation or viral infection, providing evidence that Oas1 may play a more important role in antiviral activity in bats compared with Mx1 or Pkr. Our results have important implications for the different roles of ISGs in bats and provide the first step in understanding the role of these molecules in the ability of bats to coexist with viruses.

  15. Tick-host-pathogen interactions in Lyme borreliosis

    NARCIS (Netherlands)

    J.W.R. Hovius

    2009-01-01

    Since its discovery approximately 30 years ago, Lyme borreliosis has become the most important vector-borne disease in the Western world. This thesis describes in molecular detail novel tick-host-pathogen interactions in Lyme borreliosis, contributing to the understanding of the pathogenesis of this

  16. New Records of Ticks from the Lesser Antilles

    NARCIS (Netherlands)

    Kohls, Glen M.

    1969-01-01

    This study is based primarily on ticks collected by Dr. P. WAGENAAR HUMMELINCK (Zoölogisch Laboratorium, Utrecht) and associates. A few additional collections were received from Dr. K. E. HYLAND (University of Rhode Island), and from Dr. R. L. WENZEL (Field Museum of Natural History, Chicago). THOMP

  17. Tick off to Take off: The Pre-Departure Guide

    Science.gov (United States)

    Arthur, Erica

    2009-01-01

    "Tick Off to Take Off (TOTTO)" is an online pre-departure guide for UK undergraduates intending to study abroad. It aims to simplify the application process, centralise information, increase efficiency and improve retention rates. TOTTO responds to the changing climate surrounding study abroad in UK universities and offers one way to…

  18. Notes on the comparative morphology of ticks (Anactinotrichida: Ixodida)

    NARCIS (Netherlands)

    hammen, van der L.

    1983-01-01

    A study is made of the comparative morphology of Ticks, based on the principles and methods set down in the author's previous studies in Mites and other Chelicerates, and in his Glossary of Acarological Terminology. Special attention is paid to the morphology of gnathosoma and appendages.

  19. Passive surveillance for ticks on horses in Saskatchewan

    Science.gov (United States)

    Schvartz, Gili; Epp, Tasha; Burgess, Hilary J.; Chilton, Neil B.; Armstrong, James S.; Lohmann, Katharina L.

    2015-01-01

    Passive surveillance of ticks on horses in Saskatchewan revealed that the horses were parasitized by 3 species, Dermacentor albipictus, D. andersoni, and D. variabilis. The nymphs and adults of D. albipictus occurred on horses earlier in the year than did adults of the 2 other species. PMID:25969582

  20. Survey on cattle ticks in Nur, north of Iran

    Directory of Open Access Journals (Sweden)

    Ashkan Ghasemi Moghaddam

    2014-03-01

    Conclusions: Results of the current investigation indicate the presence of two species of acarine ectoparasites which have potential health risk Ixodes ricinus and Boophilus annulatus. More studies are required to increase our data concerning ticks and other ectopreasites of ruminants in other areas of Mazandaran province and should be noted to their ability in transmission of infectious agents.

  1. Tick paralysis in Australia caused by Ixodes holocyclus Neumann

    DEFF Research Database (Denmark)

    Hall-Mendelin, S; Craig, S B; Hall, R A;

    2011-01-01

    Ticks are obligate haematophagous ectoparasites of various animals, including humans, and are abundant in temperate and tropical zones around the world. They are the most important vectors for the pathogens causing disease in livestock and second only to mosquitoes as vectors of pathogens causing...

  2. Beware of Ticks (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    2015-05-14

    Lyme disease is an infection caused by a bacteria that is transmitted by the bites of infected blacklegged ticks. In this podcast, Dr. Christina Nelson discusses ways to help prevent Lyme disease.  Created: 5/14/2015 by MMWR.   Date Released: 5/14/2015.

  3. The wild life of tick-borne pathogens

    NARCIS (Netherlands)

    Hofmeester, Tim R.

    2016-01-01

    Diseases that are transmitted by arthropod vectors from animal hosts to humans – so called zoonotic vector-borne diseases – have increased in incidence in the last decades. In North America and Europe, tick-borne pathogens cause the majority of vector-borne diseases, including Lyme borre

  4. Tick-Associated Diseases: Symptoms, Treatment and Prevention

    Science.gov (United States)

    Anderson, Alice; Chaney, Elizabeth

    2009-01-01

    According to the Centers for Disease Control and Prevention (CDC), there are eleven tick-associated diseases prevalent in the United States. Most commonly diagnosed are Lyme disease, anaplasmosis (ehrlichiosis) and babeisois, with Lyme disease being the most common vector-borne disease in the country. In southeastern states, studies have shown the…

  5. Current Status of Tick Fauna in North of Iran

    Directory of Open Access Journals (Sweden)

    P Shayan

    2007-04-01

    Full Text Available Background: The distribution and ecological preferences of ticks of domestic animals in North of Iran were studied four times a year from 2002 to 2005. Methods: A total of 1720 tick specimens were collected from cattle, sheep and goats from different localities of Caspian Sea areas consisting of Guilan, Mazandaran, Golestan and Ardebil provinces, Iran. Results: Fourteen tick species were identified as Hyalomma anatolicum anatolicum (5.23%, H.marginatum (20.34%, H.detritum (3.48%, Haemaphysalis punctata (12.79%, Haem. Parva (0.58%, Haem.concinna (0.58%, Haem.choldokovsky (6.97%, Ixodes ricinus (2.32%, Rhipicephalus sanguineus (19.76%, Rh.bursa (4.65%, Boophilus annulatus (9.88%, Dermacentor niveus (6.39%, D. marginatus (1.74% and Ornithodoros lahorensis (5.23%. Both Dermacentor and Ornithodoros were found only in Ardebil with cold climatic conditions and high altitude. The only ticks, which were found in forest area, were Boophilus annulatus and Ixodes ricinus. Conclusion: The veterinary and public health importance of the above species should be emphasized.

  6. Wild Birds and the Urban Ecology of Ticks

    Centers for Disease Control (CDC) Podcasts

    2012-12-21

    Dr. Sarah Hamer, Assistant Professor and Veterinary Ecologist with the College of Veterinary Medicine at Texas A&M University, discusses her investigation of ticks on wild birds in urban Chicago.  Created: 12/21/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 12/27/2012.

  7. Interaction of the Lyme disease spirochete with its tick vector

    Science.gov (United States)

    Caimano, Melissa J.; Drecktrah, Dan; Kung, Faith; Samuels, D. Scott

    2016-01-01

    Summary Borrelia burgdorferi , the causative agent of Lyme disease (along with closely related genospecies), is in the deeply branching spirochete phylum. The bacterium is maintained in nature in an enzootic cycle that involves transmission from a tick vector to a vertebrate host and acquisition from a vertebrate host to a tick vector. During its arthropod sojourn, B. burgdorferi faces a variety of stresses, including nutrient deprivation. Here, we review some of the spirochetal factors that promote persistence, maintenance and dissemination of B. burgdorferi in the tick, and then focus on the utilization of available carbohydrates as well as the exquisite regulatory systems invoked to adapt to the austere environment between blood meals and to signal species transitions as the bacteria traverse their enzootic cycle. The spirochetes shift their source of carbon and energy from glucose in the vertebrate to glycerol in the tick. Regulation of survival under limiting nutrients requires the classic stringent response in which RelBbu controls the levels of the alarmones guanosine tetraphosphate and guanosine pentaphosphate (collectively termed (p)ppGpp), while regulation at the tick–vertebrate interface as well as regulation of protective responses to the blood meal require the two-component system Hk1/Rrp1 to activate production of the second messenger cyclic-dimeric-GMP (c-di-GMP). PMID:27147446

  8. Rediscovery of Meristaspis lateralis (Kolenati) (Acari: Mesostigmata: Spinturnicidae) parasitizing the Egyptian fruit bat, Rousettus aegyptiacus (Geoffroy) (Mammalia: Chiroptera), with a key to mites of bats in Egypt.

    Science.gov (United States)

    Negm, Mohamed W; Fakeer, Mahmoud M

    2014-04-01

    Faunistic information about bat mites in Egypt is scarce. Collection records of parasitic mites, Meristaspis lateralis (Kolenati, 1856) (Mesostigmata: Spinturnicidae), are reported from the Egyptian fruit bat, Rousettus aegyptiacus (Geoffroy, 1810) (Mammalia: Chiroptera) in Assiut Governorate, Egypt. Seven species of bat mites are recognized from Egypt to date. A host-parasite checklist and an identification key to these species are presented.

  9. TRANSLATING ECOLOGY, PHYSIOLOGY, BIOCHEMISTRY, AND POPULATION GENETICS RESEARCH TO MEET THE CHALLENGE OF TICK AND TICK-BORNE DISEASES IN NORTH AMERICA.

    Science.gov (United States)

    Esteve-Gassent, Maria D; Castro-Arellano, Ivan; Feria-Arroyo, Teresa P; Patino, Ramiro; Li, Andrew Y; Medina, Raul F; de León, Adalberto A Pérez; Rodríguez-Vivas, Roger Iván

    2016-05-01

    Emerging and re-emerging tick-borne diseases threaten public health and the wellbeing of domestic animals and wildlife globally. The adoption of an evolutionary ecology framework aimed to diminish the impact of tick-borne diseases needs to be part of strategies to protect human and animal populations. We present a review of current knowledge on the adaptation of ticks to their environment, and the impact that global change could have on their geographic distribution in North America. Environmental pressures will affect tick population genetics by selecting genotypes able to withstand new and changing environments and by altering the connectivity and isolation of several tick populations. Research in these areas is particularly lacking in the southern United States and most of Mexico with knowledge gaps on the ecology of these diseases, including a void in the identity of reservoir hosts for several tick-borne pathogens. Additionally, the way in which anthropogenic changes to landscapes may influence tick-borne disease ecology remains to be fully understood. Enhanced knowledge in these areas is needed in order to implement effective and sustainable integrated tick management strategies. We propose to refocus ecology studies with emphasis on metacommunity-based approaches to enable a holistic perspective addressing whole pathogen and host assemblages. Network analyses could be used to develop mechanistic models involving multihost-pathogen communities. An increase in our understanding of the ecology of tick-borne diseases across their geographic distribution will aid in the design of effective area-wide tick control strategies aimed to diminish the burden of pathogens transmitted by ticks.

  10. Bacterial diversity indicates dietary overlap among bats of different feeding habits.

    Science.gov (United States)

    Banskar, Sunil; Mourya, Devendra T; Shouche, Yogesh S

    2016-01-01

    Bats are among the most conspicuous mammals with extraordinary adaptations. They play a key role in the ecosystem. Frugivorous bats are important seed dispersing agents that help in maintaining forest tree diversity, while insectivorous bats are natural insect pest control agents. Several previous reports suggest that bats are reservoir of viruses; nonetheless their bacterial counterparts are relatively less explored. The present study describes the microbial diversity associated with the intestine of bats from different regions of India. Our observations stipulate that there is substantial sharing of bacterial communities between the insectivorous and frugivorous bats, which signifies fairly large dietary overlap. We also observed the presence of higher abundance of Mycoplasma in Cynopterus species of bats, indicating possible Mycoplasma infection. Considering the scarcity of literature related to microbial communities of bat intestinal tract, this study can direct future microbial diversity studies in bats with reference to their dietary habits, host-bacteria interaction and zoonosis.

  11. Improved Bat Algorithm Applied to Multilevel Image Thresholding

    Directory of Open Access Journals (Sweden)

    Adis Alihodzic

    2014-01-01

    Full Text Available Multilevel image thresholding is a very important image processing technique that is used as a basis for image segmentation and further higher level processing. However, the required computational time for exhaustive search grows exponentially with the number of desired thresholds. Swarm intelligence metaheuristics are well known as successful and efficient optimization methods for intractable problems. In this paper, we adjusted one of the latest swarm intelligence algorithms, the bat algorithm, for the multilevel image thresholding problem. The results of testing on standard benchmark images show that the bat algorithm is comparable with other state-of-the-art algorithms. We improved standard bat algorithm, where our modifications add some elements from the differential evolution and from the artificial bee colony algorithm. Our new proposed improved bat algorithm proved to be better than five other state-of-the-art algorithms, improving quality of results in all cases and significantly improving convergence speed.

  12. Experimental Studies Cast Doubt on Deceit Syndrome of Bat Flower

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    @@ Bat Flower (Tacca chantrieri) is a southwest China's species of a tropical plant genus called Tacca,which features near black flowers,conspicuous involucral bracts and whisker-like filiform bracteoles.

  13. Do bigger bats need more time to forage?

    Directory of Open Access Journals (Sweden)

    CEL. Esbérard

    Full Text Available We test the hypothesis is that bats using the same area and at the same time would be using similar preys, but they would have different foraging times due to specific differences in biomass. A total of 730 captures was analyzed 13 species of Vespertilionidae and Molossidae bats netted over a small dam in southeastern Brazil from 1993 and 1999. The relationship between the average time of captures and the biomass of the species of Vespertilinidae and Molossidae most frequent (captures > 4 was positive and significant (r = 0.83, p = 0.022, N = 7. Two lines are discussed to answer the longer foraging time for bigger bats: 1 larger insectivorous bats don't consume proportionally larger preys and 2 larger insects are less available.

  14. Indiana Bat (Myotis sodalis) Draft Recovery Plan: First Revision

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — U.S. Fish and Wildlife Service's Draft recovery plan for Indiana bats, a Federally endangered species. First revision. The purpose of this draft recovery plan is to...

  15. Bats, emerging infectious diseases, and the rabies paradigm revisited

    Directory of Open Access Journals (Sweden)

    Ivan V. Kuzmin

    2011-06-01

    Full Text Available The significance of bats as sources of emerging infectious diseases has been increasingly appreciated, and new data have been accumulated rapidly during recent years. For some emerging pathogens the bat origin has been confirmed (such as lyssaviruses, henipaviruses, coronaviruses, for other it has been suggested (filoviruses. Several recently identified viruses remain to be ‘orphan’ but have a potential for further emergence (such as Tioman, Menangle, and Pulau viruses. In the present review we summarize information on major bat-associated emerging infections and discuss specific characteristics of bats as carriers of pathogens (from evolutionary, ecological, and immunological positions. We also discuss drivers and forces of an infectious disease emergence and describe various existing and potential approaches for control and prevention of such infections at individual, populational, and societal levels.

  16. Bats and birds increase crop yield in tropical agroforestry landscapes.

    Science.gov (United States)

    Maas, Bea; Clough, Yann; Tscharntke, Teja

    2013-12-01

    Human welfare is significantly linked to ecosystem services such as the suppression of pest insects by birds and bats. However, effects of biocontrol services on tropical cash crop yield are still largely unknown. For the first time, we manipulated the access of birds and bats in an exclosure experiment (day, night and full exclosures compared to open controls in Indonesian cacao agroforestry) and quantified the arthropod communities, the fruit development and the final yield over a long time period (15 months). We found that bat and bird exclusion increased insect herbivore abundance, despite the concurrent release of mesopredators such as ants and spiders, and negatively affected fruit development, with final crop yield decreasing by 31% across local (shade cover) and landscape (distance to primary forest) gradients. Our results highlight the tremendous economic impact of common insectivorous birds and bats, which need to become an essential part of sustainable landscape management.

  17. Asia's First Bat Research Center Established in Beijing

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    @@ In cooperation with a local government, the CAS Institute of Zoology (IOZ) has established Asia's first bat research and protection center in Fangshan, a southwest suburb of Beijing. Its opening ceremony was held on November 16, 2004.

  18. Science et débat public sur le vivant

    Directory of Open Access Journals (Sweden)

    Piron Florence

    2015-01-01

    Full Text Available Quels sont les repères éthiques et politiques que les sociétés se donnent pour respecter la vie et le vivant selon leur culture ? D’où viennent les débats et les dissensus? Au-delà des débats de société suscités par le vivant aujourd’hui, il est essentiel de mettre au jour les présupposés épistémologiques qui, en plus des politiques scientifiques, orientent les recherches sur le vivant qui, ensuite, sont mobilisées comme moyen de légitimation des arguments dans ces débats. La science apparaît alors comme une institution non neutre, inscrite dans la culture, qui influence les débats publics sur le vivant, au lieu de seulement les éclairer.

  19. Bat Surveys on Theodore Roosevelt National Wildlife Refuge Complex

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Mist net, Anabat, telemetry, and roost surveys were conducted from April-October 2007 to determine bat species diversity and relative abundance on Theodore Roosevelt...

  20. Summary on Bats and Roost Trees Noxubee NWR

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Availability and characteristics of Cavity trees used by Rafinesque's Big-eared Bat in bottamland hardwoods in Mississippi. We surveyed approximately 1,250 ha of...

  1. Bats from Fazenda Intervales, Southeastern Brazil: species account and comparison between different sampling methods

    Directory of Open Access Journals (Sweden)

    Christine V. Portfors

    2000-06-01

    Full Text Available Assessing the composition of an area's bat fauna is typically accomplished by using captures or by monitoring echolocation calls with bat detectors. The two methods may not provide the same data regarding species composition. Mist nets and harp traps may be biased towards sampling low flying species, and bat detectors biased towards detecting high intensity echolocators. A comparison of the bat fauna of Fazenda Intervales, southeastern Brazil, as revealed by mist nets and harp trap captures, checking roosts and by monitoring echolocation calls of flying bats illustrates this point. A total of 17 species of bats was sampled. Fourteen bat species were captured and the echolocation calls of 12 species were recorded, three of them not revealed by mist nets or harp traps. The different sampling methods provided different pictures of the bat fauna. Phyllostomid bats dominated the catches in mist nets, but in the field their echolocation calls were never detected. No single sampling approach provided a complete assessment of the bat fauna in the study area. In general, bats producing low intensity echolocation calls, such as phyllostomids, are more easily assessed by netting, and bats producing high intensity echolocation calls are better surveyed by bat detectors. The results demonstrate that a combined and varied approach to sampling is required for a complete assessment of the bat fauna of an area.

  2. Tropical secondary forest management influences frugivorous bat composition, abundance and fruit consumption in Chiapas, Mexico.

    Science.gov (United States)

    Vleut, Ivar; Levy-Tacher, Samuel Israel; de Boer, Willem Frederik; Galindo-González, Jorge; Vazquez, Luis-Bernardo

    2013-01-01

    Most studies on frugivorous bat assemblages in secondary forests have concentrated on differences among successional stages, and have disregarded the effect of forest management. Secondary forest management practices alter the vegetation structure and fruit availability, important factors associated with differences in frugivorous bat assemblage structure, and fruit consumption and can therefore modify forest succession. Our objective was to elucidate factors (forest structural variables and fruit availability) determining bat diversity, abundance, composition and species-specific abundance of bats in (i) secondary forests managed by Lacandon farmers dominated by Ochroma pyramidale, in (ii) secondary forests without management, and in (iii) mature rain forests in Chiapas, Southern Mexico. Frugivorous bat species diversity (Shannon H') was similar between forest types. However, bat abundance was highest in rain forest and O. pyramidale forests. Bat species composition was different among forest types with more Carollia sowelli and Sturnira lilium captures in O. pyramidale forests. Overall, bat fruit consumption was dominated by early-successional shrubs, highest late-successional fruit consumption was found in rain forests and more bats consumed early-successional shrub fruits in O. pyramidale forests. Ochroma pyramidale forests presented a higher canopy openness, tree height, lower tree density and diversity of fruit than secondary forests. Tree density and canopy openness were negatively correlated with bat species diversity and bat abundance, but bat abundance increased with fruit abundance and tree height. Hence, secondary forest management alters forests' structural characteristics and resource availability, and shapes the frugivorous bat community structure, and thereby the fruit consumption by bats.

  3. Vampire bat-transmitted rabies in cattle.

    Science.gov (United States)

    Arellano-Sota, C

    1988-01-01

    A short history of bovine paralytic rabies in the Americas is given. Based on information from the Animal Health Yearbook--a cooperative publication of the Food and Agriculture Organization (FAO), the World Health Organization (WHO), and the International Office of Epizootics (OIE)--a comparison is made of the epidemiology of the disease in 1968, 1978, and 1985. An important reduction in the number of cases of rabies was observed in some countries (Bolivia, Brazil, Guatemala, Mexico, Nicaragua, and Panama), mainly as a result of the use of effective vaccines that are now available and of the application of new technology to reduce the vampire bat population, the vector of the disease in cattle. The trials performed in Argentina and Mexico in the 1960s and 1970s provide enough evidence that many vaccines will protect cattle against bovine paralytic rabies. Results of these trials are presented.

  4. Molecular detection of Crimean-Congo haemorrhagic fever (CCHF) virus in ticks from southeastern Iran.

    Science.gov (United States)

    Mehravaran, Ahmad; Moradi, Maryam; Telmadarraiy, Zakyeh; Mostafavi, Ehsan; Moradi, Ali Reza; Khakifirouz, Sahar; Shah-Hosseini, Nariman; Varaie, Fereshteh Sadat Rasi; Jalali, Tahmineh; Hekmat, Soheila; Ghiasi, Seyed Mojtaba; Chinikar, Sadegh

    2013-02-01

    Crimean-Congo haemorrhagic fever (CCHF) virus is a tick-borne member of the genus Nairovirus, family Bunyaviridae. CCHF virus has been isolated from at least 31 different species of ticks. The virus is transmitted through the bite of an infected tick or by direct contact with CCHF virus-infected patients or the products of infected livestock. This study was conducted to determine the rate of CCHF virus infection in ticks in the district of Zahedan, in the province of Sistan and Baluchistan, southeastern Iran. A total of 140 ticks were collected from Sistan and Baluchistan. Reverse transcriptase-polymerase chain reaction (RT-PCR) was used for the detection of the CCHF virus genome in the tick population. This genome was detected in 4.3% of ticks collected from livestock of different regions of Zahedan. The infected tick genera belonged to Hyalomma and Haemaphysalis. Although in the epidemiology of CCHF virus Hyalomma ticks are considered to be the most important vectors and reservoirs, the virus has also been reported to occur in other genera of ticks, which conforms to the current data in our study from Sistan and Baluchistan. Given that animals are common hosts for Hyalomma and Haemaphysalis, regular monitoring programmes for livestock should be applied for CCHF virus control.

  5. Perspectives on the potential of entomopathogenic fungi in biological control of ticks.

    Science.gov (United States)

    Fernandes, Éverton K K; Bittencourt, Vânia R E P; Roberts, Donald W

    2012-03-01

    Ticks are serious health threats for humans, and both domestic and wild animals. Ticks are controlled mostly by application of chemical products; but these acaricides have several negative side effects, including toxicity to animals, environmental contamination, and induction of chemical resistance in some tick populations. Entomopathogenic fungi infect arthropods in nature and can occur at enzootic or epizootic levels in their host populations. Laboratory studies clearly demonstrate that these fungi can cause high mortality in all developmental stages of several tick species, and also reduce oviposition of infected engorged females. Tick mortality following application of fungi in the field, however, often is less than that suggested by laboratory tests. This is due to many negative biotic and climatic factors. To increase efficacy of fungal agents for biological control of ticks under natural conditions, several points need consideration: (1) select effective isolates (viz., high virulence; and tolerance to high temperature, ultraviolet radiation and desiccation); (2) understand the main factors that affect virulence of fungal isolates to their target arthropods including the role of toxic metabolites of the fungal isolates; and (3) define with more precision the immune response of ticks to infection by entomopathogenic fungi. The current study reviews recent literature on biological control of ticks, and comments on the relevance of these results to advancing the development of fungal biocontrol agents, including improving formulation of fungal spores for use in tick control, and using entomopathogenic fungi in integrated pest (tick) management programs.

  6. Isolation of entomopathogenic fungi from soils and Ixodes scapularis (Acari: Ixodidae) ticks: prevalence and methods.

    Science.gov (United States)

    Tuininga, Amy R; Miller, Jessica L; Morath, Shannon U; Daniels, Thomas J; Falco, Richard C; Marchese, Michael; Sahabi, Sadia; Rosa, Dieshia; Stafford, Kirby C

    2009-05-01

    Entomopathogenic fungi are commonly found in forested soils that provide tick habitat, and many species are pathogenic to Ixodes scapularis Say, the blacklegged tick. As a first step to developing effective biocontrol strategies, the objective of this study was to determine the best methods to isolate entomopathogenic fungal species from field-collected samples of soils and ticks from an Eastern deciduous forest where I. scapularis is common. Several methods were assessed: (1) soils, leaf litter, and ticks were plated on two types of media; (2) soils were assayed for entomopathogenic fungi using the Galleria bait method; (3) DNA from internal transcribed spacer (ITS) regions of the nuclear ribosomal repeat was extracted from pure cultures obtained from soils, Galleria, and ticks and was amplified and sequenced; and (4) DNA was extracted directly from ticks, amplified, and sequenced. We conclude that (1) ticks encounter potentially entomopathogenic fungi more often in soil than in leaf litter, (2) many species of potentially entomopathogenic fungi found in the soil can readily be cultured, (3) the Galleria bait method is a sufficiently efficient method for isolation of these fungi from soils, and (4) although DNA extraction from ticks was not possible in this study because of small sample size, DNA extraction from fungi isolated from soils and from ticks was successful and provided clean sequences in 100 and 73% of samples, respectively. A combination of the above methods is clearly necessary for optimal characterization of entomopathogenic fungi associated with ticks in the environment.

  7. Complementary data on four methods for sampling free-living ticks in the Brazilian Pantanal.

    Science.gov (United States)

    Ramos, Vanessa do Nascimento; Osava, Carolina Fonseca; Piovezan, Ubiratan; Szabó, Matias Pablo Juan

    2014-01-01

    In this study, four methods for sampling free-living ticks that are used in ecological and human tick-bite risk studies were evaluated. Cloth dragging, carbon dioxide traps and visual searches and inspection of plant litter on the ground were used in field and forest areas within the Brazilian Pantanal. Among the three tick species collected, Amblyomma sculptum predominated, followed by Amblyomma parvum and Amblyomma ovale. Dragging, a cheap and simple technique, yielded the highest numbers of ticks, particularly nymphs. The visual search detected a high number of adult ticks and provided information on tick questing height. Even though laborious, plant litter examination showed that large numbers of ticks may use this stratum. Carbon dioxide (CO2) traps are expensive and difficult to handle, but they are highly efficient for adult ticks, especially A. parvum. These data indicate that one method alone is incapable of providing a representative sample of the tick fauna in a particular area and that multiple techniques should be used for tick population studies.

  8. Ticks and Fleas Infestation on East Hedgehogs (Erinaceus concolor in Van Province, Eastern Region of Turkey

    Directory of Open Access Journals (Sweden)

    Yaşar Goz

    2015-10-01

    Full Text Available Background: Ixodid ticks (Acari: İxodidae and fleas (Siphonaptera are the major vectors of pathogens threatening animals and human healths. The aim of our study was to detect the infestation rates of East Hedgehogs (Erinaceus concolor with ticks and fleas in Van Province, eastern region of Turkey.Methods: We examined fleas and ticks infestation patterns in 21 hedgehogs, collected from three suburbs with the greater of number gardens. In order to estimate flea and tick infestation of hedgehogs, we immobilized the ectoparasites by treatment the body with a insecticide trichlorphon (Neguvon®-Bayer.Results: On the hedgehogs, 60 ixodid ticks and 125 fleas were detected. All of the ixodid ticks were Rhipicephalus turanicus and all of the fleas were Archaeopsylla erinacei. Infestation rate for ticks and fleas was detected 66.66 % and 100 %, respectively.Conclusion: We detected ticks (R. turanicus and fleas (A. erinacei in hedgehogs at fairly high rates. Since many ticks and fleas species may harbor on hedgehogs and transmit some tick-borne and flea-borne patogens, this results are the important in terms of veterinary and public health. 

  9. Novel phlebovirus detected in Haemaphysalis parva ticks in a Greek island.

    Science.gov (United States)

    Papa, Anna; Kontana, Anastasia; Tsioka, Katerina; Saratsis, Anastasios; Sotiraki, Smaragda

    2017-01-01

    During the last decade the number of novel tick-borne phleboviruses has increased rapidly, especially after the identification of severe fever with thrombocytopenia syndrome and Heartland viruses which can cause severe disease in humans. A novel virus, Antigone virus was recently detected in ticks collected from the mainland of Greece. The aim of the present study was to investigate the presence of tick-borne phleboviruses in an island in Greece. During November 2015, 31 ticks were collected from sheep in Lesvos island. Phleboviral RNA was detected in 12/22 adult Haemaphysalis parva ticks. The virus was provisionally named Lesvos virus after the name of the island. Phylogenetic analysis of a 1108-bp L RNA fragment revealed that the Lesvos virus sequences cluster together with Dabieshan and Yongjia tick viruses detected in China in H. longicornis and H. hystricis ticks, respectively. Further studies are needed to investigate its exact distribution, epidemiology and virulence. It is expected that the research studies on tick biology and pathogen-tick-host interactions will allow a better understanding of the virus life cycle and the elucidation of the possible role of the novel tick-borne phleboviruses in public health.

  10. Coexistence of emerging bacterial pathogens in Ixodes ricinus ticks in Serbia*

    Directory of Open Access Journals (Sweden)

    Tomanović S.

    2010-09-01

    Full Text Available The list of tick-borne pathogens is long, varied and includes viruses, bacteria, protozoa and nematodes. As all of these agents can exist in ticks, their co-infections have been previously reported. We studied co-infections of emerging bacterial pathogens (Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum and Francisella tularensis in Ixodes ricinus ticks in Serbia. Using PCR technique, we detected species-specific sequences, rrf-rrl rDNA intergenic spacer for B. burgdorferi s.l., p44/msp2 paralogs for A. phagocytophilum, and the 17 kDa lipoprotein gene, TUL4, for F. tularensis, respectively, in total DNA extracted from the ticks. Common infections with more than one pathogen were detected in 42 (28.8 % of 146 infected I. ricinus ticks. Co-infections with two pathogens were present in 39 (26.7 % of infected ticks. Simultaneous presence of A. phagocytophilum and different genospecies of B. burgdorferi s.l. complex was recorded in 16 ticks, co-infection with different B. burgdorferi s. l. genospecies was found in 15 ticks and eight ticks harbored mixed infections with F. tularensis and B. burgdorferi s.l. genospecies. Less common were triple pathogen species infections, detected in three ticks, one infected with A. phagocytophilum / B. burgdorferi s.s. / B. lusitaniae and two infected with F. tularensis / B. burgdorferi s.s. / B. lusitaniae. No mixed infections of A. phagocytophilum and F. tularensis were detected.

  11. Tick-borne encephalitis virus infection in humans

    Directory of Open Access Journals (Sweden)

    Hrnjaković-Cvjetković Ivana

    2016-01-01

    Full Text Available Introduction. Tick-borne meningoencephalitis virus is a flavivirus that causes the most important vector-borne central nervous system infection in many countries of Europe and Asia. There are three subtypes of tick-borne encephalitis virus: European, Siberian and the Far-Eastern subtype. Transmission. In endemic areas, the virus remains in transmissive cycles between Ixodes ticks and small rodents. Clinical picture. In most cases (70−98% infection goes asymptomatically. In about one-third of meningitis cases, meningoencephalitis or meningomyelitis is developed. Postencephalytic syndrome may be the complication of the infection, presenting with neurological symptoms. Diagnosis. Etiologic diagnosis of tick-borne meningoencephalitis is only made on basis of laboratory analyses. Reverse transcription-polymerase chain reaction is used for determining the presence of virus in the blood and cerebrospinal fluid. Antibodies in blood and cerebrospinal fluid can be detected by serological tests. Prevention. The most efficient way to control this potentially severe disease with possible serious long-term consequences is vaccination. It should be recommended to persons who live or travel to endemic areas. Conclusion. In Serbia, tick-borne encephalitis virus infection belongs to the list of reportable diseases; however, there are no reported cases because the diagnostics is not performed routinely. We believe that the significance of this zoonosis must be examined in our country and some of its parts because of preliminary positive serological findings found out in Vojvodina as well as because of reported cases in neighboring countries such as Hungary and Croatia and its worldwide distribution.

  12. Chronic course of Ixodes tick borreliosis in Krasnoyarsk region

    Directory of Open Access Journals (Sweden)

    N. S. Minoranskaya

    2014-01-01

    Full Text Available The purpose of the study – the optimization of clinical diagnosis of chronic course of Ixodes tick-borne borreliosis based on indicators of immune and cytokine status of patients.Materials and Methods: clinical and immunological study of patients with chronic Ixodes tick-borne borreliosis in the Krasnoyarsk region. The observations were made on 205 patients for 1,5 years. The diagnosis was based on clinical and epidemiological data confirmed the identification of specific antibodies to borrelia by ELISA. The indices of cellular and humoral immune system, phagocytosis, cytokine (interleukin-1β, 4, 8 , tumor necrosis factor-α.Results: Show Part chronicity of infection after an noneritemic form of the disease (37,5% and combined forms of Ixodes tick-borne borreliosis with tick-borne encephalitis (33,2%. Clinical manifestations were characterized by the involvement in the pathological process of the musculoskeletal system (42,9% and combined lesions to the nervous system (38.5%. A rare variant of the chronic course of borreliosis was central nervous system as the onset of the disease (3,5%. Common infectious syndrome relapse accompanied by autonomic dysfunction with prevalence parasimpatotonus (59,0% and simpatotonus (41,0%, and febrile reactions (71,2% were more subfebrile with fever (51,2%.Conclusion: pathogenetic mechanisms of chronic course of Ixodes tick-borne borreliosis closely associated with inflammation and immune-mediated reactions of the organism , and are characterized by the presence of cellular immunodeficiency, insolvency phagocytosis, suppression of the synthesis of interleukin-4 and interleukin-8 intensive products.

  13. Unveiling the Hidden Bat Diversity of a Neotropical Montane Forest

    OpenAIRE

    Chaverri, Gloriana; Garin, Inazio; Alberdi, Antton; Jimenez, Lide; Castillo-Salazar, Cristian; Aihartza, Joxerra

    2016-01-01

    Mountain environments, characterized by high levels of endemism, are at risk of experiencing significant biodiversity loss due to current trends in global warming. While many acknowledge their importance and vulnerability, these ecosystems still remain poorly studied, particularly for taxa that are difficult to sample such as bats. Aiming to estimate the amount of cryptic diversity among bats of a Neotropical montane cloud forest in Talamanca Range—south-east Central America—, we performed a ...

  14. Fruit bats as a natural reservoir of zoonotic viruses

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    As a natural reservoir of manifold zoonotic viruses, fruit bats have been involved in at least three emerging zoonoses in recent years. This paper aims to introduce the epidemiological characteristics of these diseases emerged in the Australasian region between 1994 and 1999, transmission pathways of the newly discovered viruses and the relationship between the changed entironment of fruit bats and occurrences of these emerging diseases and provide a clue for the epidemiological investigations of SARS.

  15. Trawling bats exploit an echo-acoustic ground effect.

    Science.gov (United States)

    Zsebok, Sandor; Kroll, Ferdinand; Heinrich, Melina; Genzel, Daria; Siemers, Björn M; Wiegrebe, Lutz

    2013-01-01

    A water surface acts not only as an optic mirror but also as an acoustic mirror. Echolocation calls emitted by bats at low heights above water are reflected away from the bat, and hence the background clutter is reduced. Moreover, targets on the surface create an enhanced echo. Here, we formally quantified the effect of the surface and target height on both target detection and -discrimination in a combined laboratory and field approach with Myotis daubentonii. In a two-alternative, forced-choice paradigm, the bats had to detect a mealworm and discriminate it from an inedible dummy (20 mm PVC disc). Psychophysical performance was measured as a function of height above either smooth surfaces (water or PVC) or above a clutter surface (artificial grass). At low heights above the clutter surface (10, 20, or 35 cm), the bats' detection performance was worse than above a smooth surface. At a height of 50 cm, the surface structure had no influence on target detection. Above the clutter surface, also target discrimination was significantly impaired with decreasing target height. A detailed analysis of the bats' echolocation calls during target approach shows that above the clutter surface, the bats produce calls with significantly higher peak frequency. Flight-path reconstruction revealed that the bats attacked an target from below over water but from above over a clutter surface. These results are consistent with the hypothesis that trawling bats exploit an echo-acoustic ground effect, in terms of a spatio-temporal integration of direct reflections with indirect reflections from the water surface, to optimize prey detection and -discrimination not only for prey on the water but also for some range above.

  16. Molecular Detection of Candidatus Bartonella hemsundetiensis in Bats.

    Science.gov (United States)

    Lilley, Thomas M; Veikkolainen, Ville; Pulliainen, Arto T

    2015-11-01

    Although bats have been implicated as reservoir hosts for a number of zoonotic and life-threatening viruses, the bat bacterial flora and its zoonotic threat remain elusive. However, members of the vector-borne bacterial genera Bartonella causing various human as well as animal diseases have recently been isolated or detected from bats and their ectoparasites. In this study, we sampled 124 insectivorous microbats (Daubenton's bat, Myotis daubentonii) for peripheral blood in southwestern Finland in 2010. A Bartonella-specific PCR targeting rpoB (RNA polymerase β-subunit) was positive with blood samples from 46 bats (prevalence 37%). Scaled mass indexes of the infected and noninfected bats did not differ (p = 0.057). One rpoB sequence was identical with the rpoB sequence of B. naantaliensis strain 2574/1, previously isolated from bats in Finland. The rest of the sequences were highly similar to each other with nucleotide identity scores of 96% or higher. Nucleotide identity scores to the previously described type strain sequences of Bartonella or other database entries were no higher than 87%. Sequence analyses of another gene, gltA (citrate synthase), gave no higher than 90% nucleotide identity scores. On the basis of the conventional 95% sequence similarity cutoff in bacterial species delineation, a novel species of Bartonella was detected. We propose a species name Candidatus B. hemsundetiensis. Phylogenetic analyses based on rpoB and gltA sequences indicate that Candidatus B. hemsundetiensis clusters in a deep-branching position close to the ancestral species B. tamiae and B. bacilliformis. Our study reinforces the importance of bats as reservoirs of Bartonella.

  17. Establishment, immortalisation and characterisation of pteropid bat cell lines.

    Directory of Open Access Journals (Sweden)

    Gary Crameri

    Full Text Available BACKGROUND: Bats are the suspected natural reservoir hosts for a number of new and emerging zoonotic viruses including Nipah virus, Hendra virus, severe acute respiratory syndrome coronavirus and Ebola virus. Since the discovery of SARS-like coronaviruses in Chinese horseshoe bats, attempts to isolate a SL-CoV from bats have failed and attempts to isolate other bat-borne viruses in various mammalian cell lines have been similarly unsuccessful. New stable bat cell lines are needed to help with these investigations and as tools to assist in the study of bat immunology and virus-host interactions. METHODOLOGY/FINDINGS: Black flying foxes (Pteropus alecto were captured from the wild and transported live to the laboratory for primary cell culture preparation using a variety of different methods and culture media. Primary cells were successfully cultured from 20 different organs. Cell immortalisation can occur spontaneously, however we used a retroviral system to immortalise cells via the transfer and stable production of the Simian virus 40 Large T antigen and the human telomerase reverse transcriptase protein. Initial infection experiments with both cloned and uncloned cell lines using Hendra and Nipah viruses demonstrated varying degrees of infection efficiency between the different cell lines, although it was possible to infect cells in all tissue types. CONCLUSIONS/SIGNIFICANCE: The approaches developed and optimised in this study should be applicable to bats of other species. We are in the process of generating further cell lines from a number of different bat species using the methodology established in this study.

  18. Book review: Bats: A world of science and mystery.

    Science.gov (United States)

    Cryan, Paul

    2015-01-01

    This book has something for everyone, from casual seekers of fascinating eye candy to professional scientists interested in the latest discoveries. Without losing sight of how mysterious bats remain despite decades of research, the authors deftly introduce readers to bats and the people who study them. The book is nice to look at, easy to understand, and interesting in many ways. These stories stick in the reader's memory long after being read—a sign of great scientific communication.

  19. Immune Cell Targets of Infection at the Tick-Skin Interface during Powassan Virus Transmission.

    Directory of Open Access Journals (Sweden)

    Meghan E Hermance

    Full Text Available Powassan virus (POWV is a tick-borne flavivirus that can result in a severe neuroinvasive disease with 50% of survivors displaying long-term neurological sequelae. Human POWV cases have been documented in Canada, the United States, and Russia. Although the number of reported POWV human cases has increased in the past fifteen years, POWV remains one of the less studied human pathogenic flaviviruses. Ixodes ticks are the vectors for POWV, and the virus is transmitted to a host's skin very early during the tick feeding process. Central to the successful transmission of a tick-borne pathogen are complex interactions between the host immune response and early tick-mediated immunomodulation, all of which initially occur at the skin interface. In our prior work, we examined the cutaneous immune gene expression during the early stages of POWV-infected Ixodes scapularis feeding. The present study serves to further investigate the skin interface by identifying early cell targets of infection at the POWV-infected tick feeding site. An in vivo infection model consisting of POWV-infected ticks feeding on mice for short durations was used in this study. Skin biopsies from the tick feeding sites were harvested at various early time points, enabling us to examine the skin histopathology and detect POWV viral antigen in immune cells present at the tick feeding site. The histopathology from the present study demonstrates that neutrophil and mononuclear cell infiltrates are recruited earlier to the feeding site of a POWV-infected tick versus an uninfected tick. This is the first report demonstrating that macrophages and fibroblasts contain POWV antigens, which suggests that they are early cellular targets of infection at the tick feeding site. These data provide key insights towards defining the complex interactions between the host immune response and early tick-mediated immunomodulation.

  20. Molecular detection of bacterial and parasitic pathogens in hard ticks from Portugal.

    Science.gov (United States)

    Maia, Carla; Ferreira, Andreia; Nunes, Mónica; Vieira, Maria Luísa; Campino, Lenea; Cardoso, Luís

    2014-06-01

    Ticks are important vector arthropods of human and animal pathogens. As information about agents of disease circulating in vectors in Portugal is limited, the aim of the present study was to detect bacteria and parasites with veterinary and zoonotic importance in ticks collected from dogs, cats, and field vegetation. A total of 925 ticks, comprising 888 (96.0%) adults, 8 (0.9%) nymphs, and 29 (3.1%) larvae, were collected in 4 geographic areas (districts) of Portugal. Among those, 620 (67.0%) were removed from naturally infested dogs, 42 (4.5%) from cats, and 263 (28.4%) were questing ticks obtained from field vegetation. Rhipicephalus sanguineus was the predominant tick species, and the only one collected from dogs and vegetation, while all Ixodes ricinus specimens (n=6) were recovered from cats. Rickettsia massiliae and Rickettsia conorii were identified in 35 ticks collected from cats and dogs and in 3 ticks collected from dogs. Among ticks collected from cats or dogs, 4 Rh. sanguineus specimens were detected with Hepatozoon felis, 3 with Anaplasma platys, 2 with Hepatozoon canis, one with Anaplasma phagocytophilum, one with Babesia vogeli, one with Borrelia burgdorferi sensu lato and one with Cercopithifilaria spp. Rickettsia helvetica was detected in one I. ricinus tick collected from a cat. To the best of our knowledge, this was the first time that Cercopithifilaria spp., Ba. vogeli, H. canis, and H. felis have been detected in ticks from Portugal. The wide range of tick-borne pathogens identified, some of zoonotic concern, suggests a risk for the emergence of tick-borne diseases in domestic animals and humans in Portugal. Further studies on these and other tick-borne agents should be performed to better understand their epidemiological and clinical importance, and to support the implementation of effective control measures.