WorldWideScience

Sample records for bass dicentrarchus labrax

  1. European sea bass, Dicentrarchus labrax, in a changing ocean

    Science.gov (United States)

    Pope, E. C.; Ellis, R. P.; Scolamacchia, M.; Scolding, J. W. S.; Keay, A.; Chingombe, P.; Shields, R. J.; Wilcox, R.; Speirs, D. C.; Wilson, R. W.; Lewis, C.; Flynn, K. J.

    2014-05-01

    Ocean acidification, caused by rising concentrations of carbon dioxide (CO2), is widely considered to be a major global threat to marine ecosystems. To investigate the potential effects of ocean acidification on the early life stages of a commercially important fish species, European sea bass (Dicentrarchus labrax), 12 000 larvae were incubated from hatch through metamorphosis under a matrix of two temperatures (17 and 19 °C) and two seawater pCO2 levels (ambient and 1,000 μatm) and sampled regularly for 42 days. Calculated daily mortality was significantly affected by both temperature and pCO2, with both increased temperature and elevated pCO2 associated with lower daily mortality and a significant interaction between these two factors. There was no significant pCO2 effect noted on larval morphology during this period but larvae raised at 19 °C possessed significantly larger eyes and lower carbon:nitrogen ratios at the end of the study compared to those raised under 17 °C. Similarly, when the incubation was continued to post-metamorphic (juvenile) animals (day 67-69), fish raised under a combination of 19 °C and 1000 μatm pCO2 were significantly heavier. However, juvenile D. labrax raised under this combination of 19 °C and 1000 μatm pCO2 also exhibited lower aerobic scopes than those incubated at 19 °C and ambient pCO2. Most studies investigating the effects of near-future oceanic conditions on the early life stages of marine fish have used incubations of relatively short durations and suggested that these animals are resilient to ocean acidification. Whilst the increased survival and growth observed in this study supports this view, we conclude that more work is required to investigate whether the differences in juvenile physiology observed in this study manifest as negative impacts in adult fish.

  2. Biometry traits and geometric morphometrics in sea bass (Dicentrarchus labrax) from different farming systems

    OpenAIRE

    Emilio Tibaldi; Maria Messina; Ivana Balenovic; Francesca Tulli

    2010-01-01

    The effect of the farming system on biometry traits and dressing out yield were inves- tigated in market-size European sea bass (Dicentrarchus labrax) cultured extensively or intensively in sea cages or land-based basins. Fish external appearences and shapes were studies with geometric morphometrics in order to assess the potential of combined methodologies in the assessment of finfish quality. Both standard biometry and geometric morphometrics were able to discriminate between sea bass farme...

  3. Appearent Digestibility of Plant Protein Based Diets by European Sea Bass Dicentrarchus labrax L., 1758

    OpenAIRE

    Altan, Özgür; Ali Yıldırım Korkut

    2011-01-01

    Commercial culture of carnivorous fish demands the reduction of environmental impact of feeds; that requires minimal use of dietary animal protein. This study investigated the digestibility of diets formulated exclusively out of plant protein, added rendered ingredients and feed attractants, by the carnivore European sea bass, Dicentrarchus labrax. Juvenile European sea bass (14.0±1.0 cm) conditioned to accept artificial dry feed were stocked in polypropylene cages and fed a...

  4. Seasonal variations of the humoral immune parameters of European sea bass (Dicentrarchus labrax L.)

    OpenAIRE

    Valero, Y. (Yulema)

    2014-01-01

    Seasonal cycles, mainly due to great variations in the light duration and temperature, are important and modulate several aspects of the animal behavior. In the case of poikilotherms animals such as fish this is very relevant. Thus, temperature changes fish immunity and affects disease resistance. We evaluate in this work the season variations of the European sea bass (Dicentrarchus labrax) humoral innate parameters focusing on winter months, at which the culture of this specie is more diffic...

  5. Dietary probiotic live yeast modulates antioxidant enzyme activities and gene expression of sea bass (Dicentrarchus labrax) larvae

    OpenAIRE

    Tovar-ramirez, D.; Mazurais, David; Gatesoupe, J. F.; Quazuguel, Patrick; Cahu, Chantal; Zambonino-infante, J. L.

    2010-01-01

    The main goal of this work was to determine the effect of dietary live yeast Debaryomyces hansenii on the enzymatic antioxidative status of sea bass Dicentrarchus labrax larvae. Growth, activity and expression of the main antioxidative enzymes: catalase (CAT), glutathione peroxidase (GPX) and superoxide dismutase (SOD), and heat shock protein (HSP70) were measured in sea bass larvae at 23 and 48 days after hatching. Larvae were fed on two microdiets: group one, fed microdiet containing live y...

  6. Vibrio lentus protects gnotobiotic sea bass (Dicentrarchus labrax L.) larvae against challenge with Vibrio harveyi.

    Science.gov (United States)

    Schaeck, M; Duchateau, L; Van den Broeck, W; Van Trappen, S; De Vos, P; Coulombet, C; Boon, N; Haesebrouck, F; Decostere, A

    2016-03-15

    Due to the mounting awareness of the risks associated with the use of antibiotics in aquaculture, treatment with probiotics has recently emerged as the preferred environmental-friendly prophylactic approach in marine larviculture. However, the presence of unknown and variable microbiota in fish larvae makes it impossible to disentangle the efficacy of treatment with probiotics. In this respect, the recent development of a germ-free culture model for European sea bass (Dicentrarchus labrax L.) larvae opened the door for more controlled studies on the use of probiotics. In the present study, 206 bacterial isolates, retrieved from sea bass larvae and adults, were screened in vitro for haemolytic activity, bile tolerance and antagonistic activity against six sea bass pathogens. Subsequently, the harmlessness and the protective effect of the putative probiotic candidates against the sea bass pathogen Vibrio harveyi were evaluated in vivo adopting the previously developed germ-free sea bass larval model. An equivalence trial clearly showed that no harmful effect on larval survival was elicited by all three selected probiotic candidates: Bacillus sp. LT3, Vibrio lentus and Vibrio proteolyticus. Survival of Vibrio harveyi challenged larvae treated with V. lentus was superior in comparison with the untreated challenged group, whereas this was not the case for the larvae supplemented with Bacillus sp. LT3 and V. proteolyticus. In this respect, our results unmistakably revealed the protective effect of V. lentus against vibriosis caused by V. harveyi in gnotobiotic sea bass larvae, rendering this study the first in its kind. PMID:26931390

  7. Concurrent environmental stressors and jellyfish stings impair caged European sea bass (Dicentrarchus labrax) physiological performances.

    Science.gov (United States)

    Bosch-Belmar, Mar; Giomi, Folco; Rinaldi, Alessandro; Mandich, Alberta; Fuentes, Verónica; Mirto, Simone; Sarà, Gianluca; Piraino, Stefano

    2016-01-01

    The increasing frequency of jellyfish outbreaks in coastal areas has led to multiple ecological and socio-economic issues, including mass mortalities of farmed fish. We investigated the sensitivity of the European sea bass (Dicentrarchus labrax), a widely cultured fish in the Mediterranean Sea, to the combined stressors of temperature, hypoxia and stings from the jellyfish Pelagia noctiluca, through measurement of oxygen consumption rates (MO2), critical oxygen levels (PO2crit), and histological analysis of tissue damage. Higher levels of MO2, PO2crit and gill damage in treated fish demonstrated that the synergy of environmental and biotic stressors dramatically impair farmed fish metabolic performances and increase their health vulnerability. As a corollary, in the current scenario of ocean warming, these findings suggest that the combined effects of recurrent hypoxic events and jellyfish blooms in coastal areas might also threaten wild fish populations. PMID:27301314

  8. Seasonal variations of the humoral immune parameters of European sea bass (Dicentrarchus labrax L.).

    Science.gov (United States)

    Valero, Yulema; García-Alcázar, Alicia; Esteban, M Ángeles; Cuesta, Alberto; Chaves-Pozo, Elena

    2014-08-01

    Seasonal cycles, mainly due to great variations in the light duration and temperature, are important and modulate several aspects of the animal behavior. In the case of poikilotherms animals such as fish this is very relevant. Thus, temperature changes fish immunity and affects disease resistance. We evaluate in this work the season variations of the European sea bass (Dicentrarchus labrax) humoral innate parameters focusing on winter months, at which the culture of this specie is more difficult. Our results showed that not all the innate immune parameters are depressed by low temperatures. Moreover, some of them are more dependent than others to the season and both temperature and photoperiod are operating together. PMID:24852342

  9. Element content in cultured and wild sea bass (Dicentrarchus labrax from the Adriatic Sea

    Directory of Open Access Journals (Sweden)

    Žvab Rožič P.

    2013-04-01

    Full Text Available The aim of this study was to determine the levels of potentially toxic elements in cultured and wild fish tissues and to assess their risk for human health. For this purpose, sea bass specimens (Dicentrarchus labrax were sampled in selected fish farm and three other locations along the eastern Adriatic coast. Ranges of element concentrations in sea bass muscles were 1.60-4.46 ppm for As, 0.001-0.079 ppm for Cd, 0.14-49.10 ppm for Cr, 1.38-4.85 ppm for Cu, 0.11-1.31 ppm for Hg, 0.01-0.65 ppm for Pb and 21.9-136.0 ppm for Zn. Mean Cd, Cr, Cu, Hg, Pb, and Zn concentrations in commercially interesting cultured fish samples were below the permissible levels, while mean As values slightly exceed those limits. In wild fishes mean Cd, Cu, Pb and Zn concentrations were below the recommended limits, for As, Cr and Hg the mean values were higher. The smallest cultured sea bass samples showed As, Cr, Pb, and Zn concentrations exceeding the recommended limits but values decreased with fish size. Therefore, the metal concentrations in commercial fishes showed no threat for human consumption.

  10. Betanodavirus ability to infect juvenile European sea bass, Dicentrarchus labrax, at different water salinity.

    Science.gov (United States)

    Pascoli, F; Serra, M; Toson, M; Pretto, T; Toffan, A

    2016-09-01

    Viral encephalopathy and retinopathy (VER) is one of the most devastating and economically relevant diseases for marine aquaculture. The presence of betanodavirus in freshwater fish is recorded, but very little is known about VER outbreaks in marine species reared in freshwater. Our study investigated the ability of betanodavirus to cause disease in European sea bass, Dicentrarchus labrax, reared at different salinity levels. Fish were challenged with RGNNV or mock infected by bath at different salinity levels (freshwater, 25‰ and 33‰). Fish were checked twice a day and the dead ones were examined by standard virological techniques, by rRT-PCR and by histochemical and immunohistochemical analyses. All the infected groups showed a significant higher mortality rate than the one of the mock-infected group. VERv presence was confirmed by rRT-PCR. Histochemical and immunohistochemical analyses highlighted the typical lesions associated with VER. Our results highlight that salinity does not affect the ability of betanodavirus to induce clinical signs and mortality in European sea bass infected under experimental conditions. These results underline the great adaptation potential of VERv, which in combination with its already known high environmental resistance and broad host range, may explain the diffusion of this disease and the threat posed to aquaculture worldwide. PMID:26763095

  11. Effects of herbal supplements on growth performance of sea bass (Dicentrarchus labrax: Change in body composition and some blood parameters

    Directory of Open Access Journals (Sweden)

    SEVDAN YILMAZ

    2012-01-01

    Full Text Available This study was conducted to investigate the effects of dietary thyme (Thymus vulgaris, rosemary (Rosmarinus officinalis and fenugreek (Trigonella foenum graecum as feed additives on growth performance, proximate composition and ammonia excretion of European sea bass Dicentrarchus labrax. Four isonitrogenous (48% crude protein and isocaloric (21 kj/g diets were formulated to contain 0% (control or 1% of thyme, rosemary or fenugreek. The thyme supplementation significantly increased protein efficiency ratio, fillet protein levels, protein and energy retentions (P0.05. The results indicate that dietary thyme improved the protein and energy retentions of sea bass.

  12. Intestinal alterations in European sea bass Dicentrarchus labrax (Linnaeus, 1758) exposed to microplastics: Preliminary results.

    Science.gov (United States)

    Pedà, Cristina; Caccamo, Letteria; Fossi, Maria Cristina; Gai, Francesco; Andaloro, Franco; Genovese, Lucrezia; Perdichizzi, Anna; Romeo, Teresa; Maricchiolo, Giulia

    2016-05-01

    This study investigates, for the first time, the intestinal responses of European sea bass Dicentrarchus labrax chronically exposed to microplastics through ingestion. Fish (n = 162) were fed with 3 different treatment diets for 90 days: control, native polyvinyl chloride (PVC) and polluted polyvinyl chloride (PVC) pellets. Intestines were fixed and processed for histological analysis using standard techniques. Histopathological alterations were examined using a score value (from 0 to 4). The distal part of intestine in all samples proved to be the most affected by pathological alterations, showing a gradual change varying from moderate to severe related to exposure times. The histological picture that characterizes both groups especially after 90 days of exposure, suggests that the intestinal functions can be in some cases totally compromised. The worst condition is increasingly evident in the distal intestine of fish fed with polluted PVC pellets respect to control groups (p < 0.05) to different exposure times. These first results underline the need to assess the impact of increasing microplastics pollution on the marine trophic web. PMID:26851981

  13. Chemical residues and biochemical responses in wild and cultured European sea bass (Dicentrarchus labrax L.)

    International Nuclear Information System (INIS)

    Cultured and wild sea bass (Dicentrarchus labrax) from the Arade Estuary were sampled in summer and winter and the degree of exposure to metals and polycyclic aromatic hydrocarbons (PAHs) assessed, together with some biochemical responses against those and other pollutants. The highest levels of copper (up to 997 μg g-1 dry weight) and cadmium (up to 4.22 μg g-1 dry weight) were detected in the liver and kidney of cultured specimens, whereas the highest exposure to PAHs was observed in wild fish. Significant alterations in some biochemical markers were detected and associated to pollutant exposure. Thus, metallothionein concentrations were higher in the tissues of cultured fish and positively correlated with metal residues. The activity 7-ethoxyresorufin O-deethylase ranged from 28 pmol/min/mg protein in cultured fish to 83 pmol/min/mg protein in wild fish collected near a marina area. Cultured fish and wild fish from the marina area had depressed acetylcholinesterase in muscle tissue and a parasitic infection in the gonads. The obtained results support the usefulness of the combined use of chemical and biochemical markers to assess the impact of anthropogenic pollutants in both wild and cultured fish

  14. Behavioural stress responses predict environmental perception in European sea bass (Dicentrarchus labrax.

    Directory of Open Access Journals (Sweden)

    Sandie Millot

    Full Text Available Individual variation in the response to environmental challenges depends partly on innate reaction norms, partly on experience-based cognitive/emotional evaluations that individuals make of the situation. The goal of this study was to investigate whether pre-existing differences in behaviour predict the outcome of such assessment of environmental cues, using a conditioned place preference/avoidance (CPP/CPA paradigm. A comparative vertebrate model (European sea bass, Dicentrarchus labrax was used, and ninety juvenile individuals were initially screened for behavioural reactivity using a net restraining test. Thereafter each individual was tested in a choice tank using net chasing as aversive stimulus or exposure to familiar conspecifics as appetitive stimulus in the preferred or non preferred side respectively (called hereafter stimulation side. Locomotor behaviour (i.e. time spent, distance travelled and swimming speed in each tank side of each individual was recorded and analysed with video software. The results showed that fish which were previously exposed to appetitive stimulus increased significantly the time spent on the stimulation side, while aversive stimulus led to a strong decrease in time spent on the stimulation side. Moreover, this study showed clearly that proactive fish were characterised by a stronger preference for the social stimulus and when placed in a putative aversive environment showed a lower physiological stress responses than reactive fish. In conclusion, this study showed for the first time in sea bass, that the CPP/CPA paradigm can be used to assess the valence (positive vs. negative that fish attribute to different stimuli and that individual behavioural traits is predictive of how stimuli are perceived and thus of the magnitude of preference or avoidance behaviour.

  15. Expression and localization of Aquaporin 1a in the sea-bass (Dicentrarchus labrax during ontogeny

    Directory of Open Access Journals (Sweden)

    IvoneGiffard-Mena

    2011-07-01

    Full Text Available The successful establishment of a species in a given habitat depends on the ability of each of its developing stages to adapt to the environment. In order to understand this process we have studied the adaptation of a euryhaline fish, the sea-bass Dicentrarchus labrax, to various salinities during its ontogeny. The expression and localization of Aquaporin 1a (AQP1a mRNA and protein were determined in different osmoregulatory tissues. In larvae, the sites of AQP1a expression are variable and they shift according to age, implying functional changes. In juveniles after metamorphosis (D32-48 post hatch, 15 - 25 mm and in pre-adults, an increase in AQP1a transcript abundance was noted in the digestive tract, and the AQP1a location was observed in the intestine. In juveniles (D87-100 post hatch, 38 - 48 mm, the transcript levels of AQP1a in the digestive tract and in the kidney were higher in sea water than at lower salinity. These observations, in agreement with existing models, suggest that in sea water-acclimated fish, the imbibed water is absorbed via AQP1a through the digestive tract, particularly the intestine and the rectum. In addition, AQP1a may play a role in water reabsorption in the kidney. These mechanisms compensate dehydratation in sea water, and they contribute to the adaptation of juveniles to salinity changes during sea-lagoon migrations. These results contribute to the interpretation of the adaptation of populations to habitats where salinity varies.

  16. Individual fish rhythm directs group feeding: a case study with sea bass juveniles (Dicentrarchus labrax) under self-demand feeding conditions

    OpenAIRE

    Millot, Sandie; Begout, Marie-laure

    2009-01-01

    The long term influence of individual biological rhythms on group feed demand behaviour was investigated in European sea bass (Dicentrarchus labrax) held under controlled environmental conditions with an on-demand feeding system. The experiment was realized over 219 days with 190 fish distributed on 4 tanks. Sea bass had a mean body mass comprised between 139 g to 183 g. The number of feed demand acts by each individual was calculated daily, and the population could thus be partitioned into t...

  17. Does Virulence Assessment of Vibrio anguillarum Using Sea Bass (Dicentrarchus labrax) Larvae Correspond with Genotypic and Phenotypic Characterization?

    DEFF Research Database (Denmark)

    Frans, Ingeborg; Dierckens, Kristof; Crauwels, Sam;

    2013-01-01

    Background: Vibriosis is one of the most ubiquitous fish diseases caused by bacteria belonging to the genus Vibrio such as Vibrio (Listonella) anguillarum. Despite a lot of research efforts, the virulence factors and mechanism of V. anguillarum are still insufficiently known, in part because of the......'s Phenotype MicroArray (TM) technology and some virulence factor assays. Conclusions/Significance: Virulence testing revealed ten virulent and five avirulent strains. While some relation could be established between serotype, genotype and phenotype, no relation was found between virulence and genotypic or...... lack of standardized virulence assays. Methodology/Principal Findings: We investigated and compared the virulence of 15 V. anguillarum strains obtained from different hosts or non-host niches using a standardized gnotobiotic bioassay with European sea bass (Dicentrarchus labrax L.) larvae as model...

  18. Effects of persistent organic pollutants on the thyroid function of the European sea bass (Dicentrarchus labrax) from the Aegean Sea, is it an endocrine disruption?

    OpenAIRE

    Schnitzler, Joseph; Koutrarkis, Emmanuil; Siebert, Ursula; Thomé, Jean-Pierre; Das, Krishna

    2008-01-01

    We evaluated the alterations of organochlorinated compounds such as polychlorobiphenyls (PCB), dichloro-diphenyl-dichloroethylene (DDE) and dichloro-diphenyl-trichloroethane (DDT) on the thyroid in wild and cultured sea bass (Dicentrarchus labrax) at environmental concentrations. These compounds influence the endocrine system of many fish species and are qualified as endocrine disruptors. The thyroid seems to be a target organ. Two alteration endpoints: the thyroid histology and the muscular ...

  19. Characteristics of fads2 gene expression and putative promoter in European sea bass (Dicentrarchus labrax): Comparison with salmonid species and analysis of CpG methylation

    OpenAIRE

    Geay, Florian; Zambonino, Jose-luis; Reinhardt, Richard; Kuhl, Heiner; Santigosa, Ester; Cahu, Chantal; Mazurais, David

    2012-01-01

    Marine fish species exhibit low capacity to biosynthesise highly unsaturated fatty acid (HUFA) in comparison to strict freshwater and anadromous species. It is admitted that the Delta(6) desaturase (FADS2) is a key enzyme in the HUFA biosynthetic pathway. We investigated by quantitative PCR the relative amounts of FADS2 mRNA in European sea bass (Dicentrarchus labrax) in comparison with a salmonid species, the rainbow trout (Oncorhynchus mykiss L.). The analysis of the expression data was per...

  20. Administration of a Polyphenol-Enriched Feed to Farmed Sea Bass (Dicentrarchus labrax L. Modulates Intestinal and Spleen Immune Responses

    Directory of Open Access Journals (Sweden)

    Thea Magrone

    2016-01-01

    Full Text Available Farmed fish are exposed to a continuous antigenic pressure by microbial and environmental agents, which may lead to a condition of chronic inflammation. In view of the notion that polyphenols, largely contained in fruits and vegetables, are endowed with antioxidant and anti-inflammatory activities, farmed sea bass (Dicentrarchus labrax L. have been administered with red grape polyphenol-enriched feed. Polyphenols were extracted from the seeds of Canosina Nero di Troia Vitis vinifera and mixed with conventional feed at two different concentrations (100 and 200 mg/kg, resp.. Fish samples collected at days 223 and 273, respectively, were evaluated for intestinal and spleen cytokine release as well as for spleen macrophage (MØ and melanomacrophage center (MMC areas and distribution. Data will show that in treated fish decrease of intestinal interleukin- (IL- 1β and IL-6 and increase of splenic interferon- (IFN- γ occur. On the other hand, in the spleen reduction of MØ number seems to parallel increase in MMCs. Collectively, these data suggest that polyphenol-administered sea bass generate lower levels of intestinal proinflammatory cytokines, while producing larger amounts of spleen IFN-γ, as an expression of a robust and protective adaptive immune response. Increase of MMCs corroborates the evidence for a protective spleen response induced by feed enriched with polyphenols.

  1. Administration of a Polyphenol-Enriched Feed to Farmed Sea Bass (Dicentrarchus labrax L.) Modulates Intestinal and Spleen Immune Responses.

    Science.gov (United States)

    Magrone, Thea; Fontana, Sergio; Laforgia, Flavia; Dragone, Teresa; Jirillo, Emilio; Passantino, Letizia

    2016-01-01

    Farmed fish are exposed to a continuous antigenic pressure by microbial and environmental agents, which may lead to a condition of chronic inflammation. In view of the notion that polyphenols, largely contained in fruits and vegetables, are endowed with antioxidant and anti-inflammatory activities, farmed sea bass (Dicentrarchus labrax L.) have been administered with red grape polyphenol-enriched feed. Polyphenols were extracted from the seeds of Canosina Nero di Troia Vitis vinifera and mixed with conventional feed at two different concentrations (100 and 200 mg/kg, resp.). Fish samples collected at days 223 and 273, respectively, were evaluated for intestinal and spleen cytokine release as well as for spleen macrophage (MØ) and melanomacrophage center (MMC) areas and distribution. Data will show that in treated fish decrease of intestinal interleukin- (IL-) 1β and IL-6 and increase of splenic interferon- (IFN-) γ occur. On the other hand, in the spleen reduction of MØ number seems to parallel increase in MMCs. Collectively, these data suggest that polyphenol-administered sea bass generate lower levels of intestinal proinflammatory cytokines, while producing larger amounts of spleen IFN-γ, as an expression of a robust and protective adaptive immune response. Increase of MMCs corroborates the evidence for a protective spleen response induced by feed enriched with polyphenols. PMID:26779301

  2. Intraspecific individual variation of temperature tolerance associated with oxygen demand in the European sea bass (Dicentrarchus labrax).

    Science.gov (United States)

    Ozolina, Karlina; Shiels, Holly A; Ollivier, Hélène; Claireaux, Guy

    2016-01-01

    The European sea bass (Dicentrarchus labrax) is an economically important fish native to the Mediterranean and Northern Atlantic. Its complex life cycle involves many migrations through temperature gradients that affect the energetic demands of swimming. Previous studies have shown large intraspecific variation in swimming performance and temperature tolerance, which could include deleterious and advantageous traits under the evolutionary pressure of climate change. However, little is known of the underlying determinants of this individual variation. We investigated individual variation in temperature tolerance in 30 sea bass by exposing them to a warm temperature challenge test. The eight most temperature-tolerant and eight most temperature-sensitive fish were then studied further to determine maximal swimming speed (U CAT), aerobic scope and post-exercise oxygen consumption. Finally, ventricular contractility in each group was determined using isometric muscle preparations. The temperature-tolerant fish showed lower resting oxygen consumption rates, possessed larger hearts and initially recovered from exhaustive exercise faster than the temperature-sensitive fish. Thus, whole-animal temperature tolerance was associated with important performance traits. However, the temperature-tolerant fish also demonstrated poorer maximal swimming capacity (i.e. lower U CAT) than their temperature-sensitive counterparts, which may indicate a trade-off between temperature tolerance and swimming performance. Interestingly, the larger relative ventricular mass of the temperature-tolerant fish did not equate to greater ventricular contractility, suggesting that larger stroke volumes, rather than greater contractile strength, may be associated with thermal tolerance in this species. PMID:27382468

  3. The Effect of Dietary Oils of Vegetable Origin on the Performance, Body Composition and Fatty Acid Profiles of Sea Bass (Dicentrarchus labrax L., 1758) Juveniles

    OpenAIRE

    Yildiz, Mustafa; ŞENER, Erdal

    2004-01-01

    Body fat composition and growth performance of sea bass juveniles fed with different kinds of vegetable oils instead of fish oil were studied. Feeding trials were carried out with 600 sea bass (Dicentrarchus labrax L.) juveniles with on initial live weight of 7.58 ± 0.13 g. Experimental feeds contained fish oil, soybean oil, sunflower oil, corn oil and olive oil. In the chemical analyses of the experimental feeds, total crude fat was 12.33 ± 0.24% and total crude protein was 57.42 ± 0.31%. Ac...

  4. Influence of dietary vitamin C dosage on turbot (Scophthalmus maximus) and European sea bass (Dicentrarchus labrax) nursery stages

    OpenAIRE

    Merchie, G.; Lavens, P.; Storch, V.; Übel, U.; Nelis, H.; De leenheer, A P; Sorgeloos, P.

    1996-01-01

    Stable forms of vitamin C were verified as dietary sources of ascorbic acid (AA) for the nursery stages of European sea bass and turbot. In a first experiment, various concentrations of ascorbyl palmitate (AP) and one level of AA 2-polyphosphate (ApP) were evaluated in a semi purified diet for European sea bass, Dicentrarchus labrax. A significantly lower AA concentration was detected in the fry fed the AP-supplemented diets compared to the ApP-fed group, providing evidence that AP is an infe...

  5. A decadal trend of juvenile European sea bass (Dicentrarchus labrax, L. responses to climate patterns in the Mondego estuary, Portugal

    Directory of Open Access Journals (Sweden)

    Eduardo Granja Bento

    2015-11-01

    Full Text Available Estuarine systems support the life cycle stages of commercially important marine fish and are influenced by large and local-scale climatic patterns. Also, extreme events triggered by climate changes may influence the functioning of nursery grounds and recruitment for several fish species. In this study, performed in the Mondego estuary, Portugal, we used an 11-year database (2003-2013 for analyzing the variability in the population of a marine juvenile migrant fish, the European sea bass Dicentrarchus labrax, regarding changes in abundance, population structure, growth rates and secondary production and annual day of peak abundance. Higher densities and production occurred at the beginning of the study, but no differences in 0-group growth could be observed. In order to detect change points in both biological and climatic data, the cumulative sum (CUSUM of the deviations from the mean for the 2003-2013 period were determined for each parameter. The relationship between large- and local-scale drivers and 0-group abundance, secondary production and day of peak abundance were evaluated using a Pearson correlation analysis of CUSUM of biological and environmental data, considering the correspondent yearly values and with a time-lag of 1 year. The North Atlantic Oscillation (NAO index, sea surface temperature (SST and their respective winter values were tested as large-scale factors, while river runoff, salinity and water temperature were considered as local climate patterns. River runoff was the significant factor explaining D. labrax 0-group abundances and the NAO and water temperature were also significant predictors considering the 1-year lag. Regarding D. labrax 0-group secondary production, salinity and water temperature were the significant predictors. The NAO with 1-year lag was also negatively correlated with the day of peak abundance. The observed variability regarding yearly trends in abundance of juvenile fish was mostly linked to local

  6. Does virulence assessment of Vibrio anguillarum using sea bass (Dicentrarchus labrax larvae correspond with genotypic and phenotypic characterization?

    Directory of Open Access Journals (Sweden)

    Ingeborg Frans

    Full Text Available BACKGROUND: Vibriosis is one of the most ubiquitous fish diseases caused by bacteria belonging to the genus Vibrio such as Vibrio (Listonella anguillarum. Despite a lot of research efforts, the virulence factors and mechanism of V. anguillarum are still insufficiently known, in part because of the lack of standardized virulence assays. METHODOLOGY/PRINCIPAL FINDINGS: We investigated and compared the virulence of 15 V. anguillarum strains obtained from different hosts or non-host niches using a standardized gnotobiotic bioassay with European sea bass (Dicentrarchus labrax L. larvae as model hosts. In addition, to assess potential relationships between virulence and genotypic and phenotypic characteristics, the strains were characterized by random amplified polymorphic DNA (RAPD and repetitive extragenic palindromic PCR (rep-PCR analyses, as well as by phenotypic analyses using Biolog's Phenotype MicroArray™ technology and some virulence factor assays. CONCLUSIONS/SIGNIFICANCE: Virulence testing revealed ten virulent and five avirulent strains. While some relation could be established between serotype, genotype and phenotype, no relation was found between virulence and genotypic or phenotypic characteristics, illustrating the complexity of V. anguillarum virulence. Moreover, the standardized gnotobiotic system used in this study has proven its strength as a model to assess and compare the virulence of different V. anguillarum strains in vivo. In this way, the bioassay contributes to the study of mechanisms underlying virulence in V. anguillarum.

  7. Impact of chronic cadmium exposure at environmental dose on escape behaviour in sea bass (Dicentrarchus labrax L.; Teleostei, Moronidae)

    International Nuclear Information System (INIS)

    The effect of chronic exposure to a low concentration (0.5 μg l-1) of cadmium ions was investigated on escape behaviour of sea bass, Dicentrarchus labrax, using video analysis. Observations were also performed on the microanatomy of lateral system neuromasts. When fish were exposed for 4 h per day over 8 days to the cadmium ions, most of both types of neuromasts observed remained intact. However, some of them presented damaged sensory maculae. Whereas before cadmium exposure, fish responded positively to nearly all the lateral system stimulations, after exposure they decreased by about 10% their positive responses to stimulations. From the 15th day after the beginning of cadmium exposure, neuromasts presented progressively less damage, cadmium accumulation in gills and scales decreased significantly and fish escape behaviour had recovered. This study presents a new concept in ecotoxicology: using behavioural change to reveal the effects of pollution levels, scarcely detectable by currently used techniques (physiological responses). - Cadmium exposure involved a significant bioaccumulation in fish scales, slight damage to the lateral line system and a significant decrease in fish escape behaviour

  8. Carbonate precipitates and bicarbonate secretion in the intestine of sea bass, Dicentrarchus labrax.

    Science.gov (United States)

    Faggio, Caterina; Torre, Agata; Lando, Gabriele; Sabatino, Giuseppe; Trischitta, Francesca

    2011-05-01

    The aim of this paper was to study the chemical composition of the precipitates found in the intestine of Dicentrarchus labrax and the source of HCO(3)(-) secreted into the intestinal lumen. The chemical analysis was performed by employing the potentiometric double titration method and by means of an electron microscope coupled with a spectrometer and X-ray powder diffraction. The results obtained suggest the presence of very insoluble intestinal precipitates, presumably formed by a mixture of CaCO(3) and MgCO(3), with a higher quantity of the former with respect to the latter. HCO(3)(-) secretion rate was investigated with the aid of the pH stat method in isolated tissues mounted in Ussing chamber, where the transepithelial electrical parameters were also measured. When the serosal surface of the intestinal mucosa was bathed in HCO(3)(-)-Ringer bubbled with 1% CO(2) in O(2) while the serosal surface was bathed in HCO(3)(-) free Ringer solution bubbled with pure O(2), bicarbonate secretion proceeded at an almost stable rate of 0.9 ± 0.05 μeq cm(-2) h(-1) for about 3 h while I(sc) maintained a constant value of 38 ± 1.5 μA cm(-2). The carbonic anhydrase inhibitor ethoxyzolamide elicited a progressive reduction of HCO(3)(-) secretion that was about 75% of the initial value after 80 min. When serosal HCO(3)(-)-CO(2) saline was substituted with Hepes-O(2) saline base secretion progressively declined reaching a value of about 20% of the initial value. It was also strongly inhibited when Na(+) was substituted with the impermeant cation choline and when either DIDS or ouabain were added to the basolateral side. These results suggest that most of the bicarbonate secreted is of extracellular source and is probably transported across the basolateral membrane by both Na(+) independent mechanism and Na(+) dependent transporter, presumably a NaHCO(3) cotransport. PMID:21152925

  9. Fertilization strategies for Sea Bass Dicentrarchus labrax (Linnaeus, 1758): effects of pre-incubation and duration of egg receptivity in seawater

    DEFF Research Database (Denmark)

    Siddique, Mohammad A Momin; Butts, Ian; Linhart, Otomar;

    2015-01-01

    for both these treatments after 3 min of pre-incubation, which clearly indicates that sea bass eggs are able to be fertilized by sperm for up to 3 min after release into seawater. This study has particular importance for understanding fertilization strategies, reproductive potential, as well as......Studying gamete biology can provide important information about a species fertilization strategy as well as their reproductive ecology. Currently, there is a lack of knowledge about how long sea bass Dicentrarchus labrax eggs can remain viable after being activated in seawater. The objectives of...... this study were to understand the effects of pre-incubation of fresh and overripe sea bass eggs in seawater and to determine the duration of egg receptivity. Pooled eggs (fresh and overripe) from four females were pre-incubated in seawater for 0 min (control), 0.5 min, 1 min, 3 min, 10 min and 30 min...

  10. Effects of persistent organic pollutants on the thyroid function of the sea bass (Dicentrarchus labrax), an endocrine disruption?

    OpenAIRE

    Schnitzler, Joseph; Koutrakis, Emmanuil; Thomé, Jean-Pierre; Siebert, Ursula; Das, Krishna

    2007-01-01

    Organochlorinated compounds such as polychlorobiphenyls (PCB), dichloro-diphenyl-dichloroethylene (DDE) and dichloro-diphenyl-trichloroethane (DDT) have the characteristic to influence the endocrine system of many fish species and mammals and are thus qualified as endocrine disruptors. The objective of this project aims a better understanding of the effects of these compounds on the thyroid function of European seabass (Dicentrarchus labrax). Thyroid tissue and muscle of 46 seabass from t...

  11. Metabolism of the polycyclic musk galaxolide and its interference with endogenous and xenobiotic metabolizing enzymes in the European sea bass (Dicentrarchus labrax).

    Science.gov (United States)

    Fernandes, Denise; Dimastrogiovanni, Giorgio; Blázquez, Mercedes; Porte, Cinta

    2013-03-01

    This study investigates the metabolism and mode of action of galaxolide (HHCB) in the European sea bass -Dicentrarchus labrax- following a single intraperitoneal injection of 50 mg HHCB/kg body weight. In addition, a group of fish was injected with 50 mg/kg of ketoconazole (KCZ), a fungicide that is known to interfere with different Cyp isoenzymes. HHCB was actively metabolised by sea bass and acted as a weak inhibitor of the synthesis of oxyandrogens in gonads of male fish. Both, HHCB and a hydroxylated metabolite were detected in bile. The fungicide ketoconazole was a strong inhibitor of Cyp11β and Cyp3a-catalyzed activities. The work contributes to the better understanding of the impact of synthetic musks on fish and proposes the determination of HHCB and/or its hydroxylated metabolite in bile as a tool to assess environmental exposure in wild fish. PMID:23274450

  12. First haematic results for the sea bass (Dicentrarchus labrax metabolic profile assessment

    Directory of Open Access Journals (Sweden)

    Riccardo Bozzi

    2010-01-01

    Full Text Available The assessment of blood reference ranges of farmed fish can be extremely useful in improving production and productquality. A first attempt to establish the normality ranges for the most important haematochemical parameters of farmedsea bass was carried out by analysing the trend of Haematocrit, Glucose, Total Protein, Albumin, Globulin, TotalCholesterol and some electrolytes in 353 sea bass farmed with two different farming systems within 1 year. A strong seasonaleffect was found with regard to each parameter; the role of some environmental conditions was evaluated; andsome reference ranges were proposed for the culturing methods considered.

  13. Cellular and molecular immune responses of the sea bass (Dicentrarchus labrax) experimentally infected with betanodavirus

    DEFF Research Database (Denmark)

    Scapigliati, G.; Buonocore, F.; Randelli, E.;

    2010-01-01

    Naïve sea bass juveniles (38.4 ± 4.5 g) were intramuscularly infected with a sublethal dose of betanodavirus isolate 378/I03, followed after 43 days by a similar boosting. This infection resulted in an overall mortality of 7.6%. At various intervals, sampling of fish tissues was performed to inve...

  14. Effects of using slurry ice during transportation on the microbiological, chemical, and sensory assessments of aquacultured sea bass (Dicentrarchus labrax) stored at 4 degrees C.

    Science.gov (United States)

    Cakli, Sukran; Kilinc, Berna; Dincer, Tolga; Tolasa, Sebnem

    2006-01-01

    Slurry ice, a biphasic system consisting of small spherical ice crystals surrounded by seawater at subzero temperature, was evaluated as a new chilled storage method for whole sea bass (Dicentrarchus labrax) a sparidae fish species of remarkable commercial interests. In this study two different group of chilling methods were used during transportation; in slurry ice packaged (Group A), and flake ice packaged (Group B). The effect of this advanced system during transportation on quality losses and the shelf life of aquacultured sea bass was evaluated. Mesophilic counts for sea bass exceeded 7 log cfu/g, which is considered the maximum level for acceptability for freshwater and marine fish after 13 days for groups A and B. On day 13 TVB-N values of groups A and B, reached the legal limits (35 mg/100 g set for TVB-N) for consumption. According to the results of sensory analyses, up to day 9 all the groups were determined as "acceptable" but on day 13 the groups A and B were no longer acceptable. The main negative aspect related to quality loss in slurry ice group corresponded to the appearance of eyes and gills. Using slurry ice during transportation did not extend the shelf life of sea bass stored at 4 degrees C. PMID:16864138

  15. Metabolism of the polycyclic musk galaxolide and its interference with endogenous and xenobiotic metabolizing enzymes in the European sea bass (Dicentrarchus labrax)

    International Nuclear Information System (INIS)

    This study investigates the metabolism and mode of action of galaxolide (HHCB) in the European sea bass -Dicentrarchus labrax- following a single intraperitoneal injection of 50 mg HHCB/kg body weight. In addition, a group of fish was injected with 50 mg/kg of ketoconazole (KCZ), a fungicide that is known to interfere with different Cyp isoenzymes. HHCB was actively metabolised by sea bass and acted as a weak inhibitor of the synthesis of oxyandrogens in gonads of male fish. Both, HHCB and a hydroxylated metabolite were detected in bile. The fungicide ketoconazole was a strong inhibitor of Cyp11β and Cyp3a-catalyzed activities. The work contributes to the better understanding of the impact of synthetic musks on fish and proposes the determination of HHCB and/or its hydroxylated metabolite in bile as a tool to assess environmental exposure in wild fish. -- Highlights: ► The metabolism and mode of action of galaxolide has been investigated in sea bass. ► A hydroxylated metabolite was for the first time identified in fish bile. ► EROD and BCOD activities were not altered by galaxolide exposure. ► Galaxolide decreased moderately the synthesis of oxyandrogens in testes. -- HHCB is actively metabolised by sea bass and acts as a weak inhibitor of the synthesis of oxyandrogens in gonads of male fish

  16. Near infrared reflectance spectroscopy (NIRS characterization of European sea bass (Dicentrarchus labrax from different rearing systems

    Directory of Open Access Journals (Sweden)

    Andrea Santulli

    2010-01-01

    Full Text Available The present study aimed to predict by NIRS the proximate chemical composition and some carcass traits of sea bass coming from 11 farms with different rearing systems (extensive, intensive in land-based basins, sea cages and located in northern (Friuli, Veneto, central (Tuscany and southern (Puglia and Sicily Italy. NIRS analysis of freeze dried sea bass fillets gave fairly good predictions of slaughter weight and fillet yield (R2cv=0.48-0.55, while results for carcass yield were poor. NIRS analysis was highly predictive for the condition factor (R2cv=0.790, SECV=0.09 and for water, ether extract and gross energy showing high correlations (R2cv>0.90 with NIR spectral infor- mation and high accuracy (SECV=0.67%, 0.46% and 0.38 kJ/g for water, ether extract and energy, respectively. Crude protein prediction showed lower performance, even if still good, compared to pre- vious variables (R2cv=0.734, SECV=0.34. The score plot of principal component analysis showed in- tensively-reared sea bass separated from extensively reared fish.

  17. MODIFICATION OF PHOTOPERIOD REDUCES EARLY SEXUAL MATURATION IN JUVENILE SEA BASS (Dicentrarchus labrax (Hormonal aspects.

    Directory of Open Access Journals (Sweden)

    M. Carrillo

    2011-04-01

    Full Text Available The effect of short-term exposure to continuous light (LL to reduce early male sexual maturation was investigated in the sea bass. Four LL light regimes (1 or 2-month duration were established during the pregametogenesis, whereas a simulated natural photoperiod (SNP and a long-term exposure group (12-month duration to LL were kept as controls according to previous trial in this species. Exposure to different LL treatments induced a differential response on the sex-steroid levels. Particularly, significant differences (ANOVA, n=20, P<0.05 in the levels of 11-KT were observed during the peak of reproductive period (February in groups 4 and 5 (control in comparison with groups 1, 2, 3, 6. These results suggested the role of this androgen as a putative threshold determining early puberty in the sea bass as previously reported. Profiles of T were similar during whole experimental period. E2 levels at the beginning of pregametogenesis (September presented significant differences between SNP groups (5 and 2 and LL treatments groups (1, 3, 4, 6. Thus, the identification of a short-term exposure to LL approach can be of interest for sea bass aquaculture, since it could reduce the presence of early sexual maturing males under farming conditions.

  18. Varying plant protein sources in the diet of sea bass Dicentrarchus labrax differently affects lipid metabolism and deposition

    Directory of Open Access Journals (Sweden)

    E. Tibaldi

    2010-04-01

    Full Text Available The liver activity of lipogenic enzymes, the lipid content in various tissues, and plasma lipid levels of major, were measured in sea bass (D. labrax fed over 96 days either a, fish meal-based control diet or preparations where 70% of fish meal protein was replaced by wheat gluten singly or in combination with pea or soybean meals. Relative to the controls, sea bass fed the wheat gluten-based diet resulted in stimulated lipogenesis in liver and increased lipid deposition in muscle. The opposite occurred when a substantial amount of soybean meal was included in the diet. Mesenteric fat depots were apparently insensitive to major changes in dietary protein source in fish showing similar intakes of digestible protein, energy and lipid. These results confirm that varying plant protein source in the diet differently affects lipid metabolism and deposition in sea bass.

  19. Effects of persistent organic pollutants on the thyroid function of the European sea bass (Dicentrarchus labrax) from the Aegean sea, is it an endocrine disruption?

    OpenAIRE

    Schnitzler, J.G; Koutrakis, E.T.; Siebert, U; Thomé, J.-P.; Das, K.

    2008-01-01

    We evaluated the alterations of organochlorinated compounds such as polychlorobiphenyls (PCB), dichloro-diphenyl-dichloroethylene (DDE) and dichloro-diphenyl-trichloroethane (DDT) on the thyroid in wild and cultured sea bass (Dicentrarchus labrax) at environmental concentrations. These compounds influence the endocrine system of many fish species and are qualified as endocrine disruptors. The thyroid seems to be a target organ. Two alteration endpoints: the thyroid histology and the muscular ...

  20. The effect of lordosis severity on juvenile sea bass (Dicentrarchus labrax L., 1758) swimming performance

    OpenAIRE

    Başaran, Fatih; ÖZBİLGİN, Hüseyin; ÖZBİLGİN, Yeliz DOĞANYILMAZ

    2009-01-01

    The relationship between the lordosis severity and swimming performance in sea bass juveniles was investigated. In total, 149 experimental animals 110-130 days old that ranged from 1.44 to 3.44 g (meanTW ± SD: 2.41 ± 0.49 g) and 5.4 to 6.5 cm (meanTL ± SD: 6.03 ± 0.39 cm) were used in experiments to determine critical swimming speed (Ucrit) in water that was 14 ± 1 °C. Vertebral angle in normal healthy fish is 180°. The lordosis severity in abnormal fish is indicated by a reduction in this va...

  1. Quantitative immunoenzymatic detection of viral encephalopathy and retinopathy virus (betanodavirus) in sea bass Dicentrarchus labrax.

    Science.gov (United States)

    Nuñez-Ortiz, N; Stocchi, V; Toffan, A; Pascoli, F; Sood, N; Buonocore, F; Picchietti, S; Papeschi, C; Taddei, A R; Thompson, K D; Scapigliati, G

    2016-07-01

    Viral encephalopathy and retinopathy disease caused by betanodavirus, genus of the family Nodaviridae, affects marine, wild and farmed species including sea bass, one of the most important farmed species in Europe. This work describes a reliable and sensitive indirect ELISA assay to detect betanodavirus in biological samples using a polyclonal antiserum (pAb 283) against the 283/I09 virus strain, the most common red-spotted grouper nervous necrosis virus (RGNNV) genotype in the Mediterranean area, and a capture-based ELISA using a monoclonal antibody (mAb 4C3) specific to a common epitope present on the capsid protein. Using adsorbed, purified VERv preparation, the detection limit of indirect ELISA was 2 μg mL(-1) (3 × 10(5) TCID50 per mL), whereas for capture-based ELISA, the sensitivity for the antigen in solution was 17 μg mL(-1) (35 × 10(5) TCID50 per mL). The capture-based ELISA was employed to detect VERv in brain homogenates of in vivo infected sea bass and resulted positive in 22 of 32 samples, some of these with a high viral load estimates (about 1.1 × 10(8)  TCID50 per mL). The ELISA system we propose may be helpful in investigations where coupling of viral content in fish tissues with the presence of circulating VERv-specific IgM is required, or for use in samples where PCR is difficult to perform. PMID:26610431

  2. Mycobiota and Aflatoxin B1 in Feed for Farmed Sea Bass (Dicentrarchus labrax

    Directory of Open Access Journals (Sweden)

    Fernando Manuel d´Almeida Bernardo

    2011-02-01

    Full Text Available The safety characteristics of feed used in fish and crustacean aquaculture systems are an essential tool to assure the productivity of those animal exploitations. Safety of feed may be affected by different hazards, including biological and chemical groups. The aim of this preliminary study was to evaluate fungi contamination and the presence of aflatoxins in 87 samples of feed for sea bass, collected in Portugal. Molds were found in 35 samples (40.2% in levels ranging from 1 to 3.3 log10 CFU∙g−1. Six genera of molds were found. Aspergillus flavus was the most frequent, found in all positive samples, with a range from 2 to 3.2 log10 CFU∙g−1. Aspergillus niger was found in 34 samples (39.1%, ranging from 1 to 2.7 log10 CFU∙g−1. Aspergillus glaucus was found in 26 samples (29.9% with levels between 1 and 2.4 log10 CFU∙g−1. Penicillium spp. and Cladosporium spp. were both found in 25 samples (28.7%. Fusarium spp. was found in 22 samples (25.3%, ranging from 1 to 2.3 log10 CFU∙g−1. All feed samples were screened for aflatoxins using a HPLC technique, with a detection limit of 1.0 μg∙kg−1. All samples were aflatoxin negative.

  3. The effect of density on sea bass (Dicentrarchus labrax) performance in a tank-based recirculating system

    OpenAIRE

    Sammouth, Sophie; Roque d'Orbcastel, Emmanuelle; Gasset, Eric; Lemarie, Gilles; Breuil, Gilles; Marino, Giovanna; Coeurdacier, Jean-luc; Fivelstad, Sveinung; Blancheton, Jean-Paul

    2009-01-01

    Sea bass (Dicentrarchus tabrax) (135 +/- 4 g) were reared under tank-based recirculating aquaculture system for a 63-day period at four densities: 10, 40, 70, 100 kg m(-3). Fish performance, stress indicators (plasma cortisol, proteonemia plus other blood parameters-Na+, K+, glucose, pH, total CO2- and water quality were monitored. At the end of the 63-day period, resistance to infection was also studied by a nodavirus challenge. A 25-day test was performed on fish from two extreme densities ...

  4. Multiple vitellogenins and product yolk proteins in European sea bass (Dicentrarchus labrax): Molecular characterization, quantification in plasma, liver and ovary, and maturational proteolysis.

    Science.gov (United States)

    Yilmaz, Ozlem; Prat, Francisco; Ibáñez, A Jose; Köksoy, Sadi; Amano, Haruna; Sullivan, Craig V

    2016-01-01

    Three complete vitellogenin (Vtg) polypeptides of European sea bass (Dicentrarchus labrax), an acanthomorph teleost spawning pelagic eggs in seawater, were deduced from cDNA and identified as VtgAa, VtgAb and VtgC based on current Vtg nomenclature and phylogeny. Label free quantitative mass spectrometry verified the presence of the three sea bass Vtgs or their product yolk proteins (YPs) in liver, plasma and ovary of postvitellogenic females. As evidenced by normalized spectral counts, VtgAb-derived protein was 2- to 5-fold more abundant, depending on sample type, than for VtgAa, while VtgC-derived protein was less abundant, albeit only 3-fold lower than for VtgAb in the ovary. Western blotting with Vtg type-specific antisera raised against corresponding gray mullet (Mugil cephalus) lipovitellins (Lvs) detected all three types of sea bass Vtg in the blood plasma of gravid females and/or estrogenized males and showed that all three forms of sea bass Lv undergo limited partial degradation during oocyte maturation. The comparatively high levels of VtgC-derived YPs in fully-grown oocytes and the maturational proteolysis of all three types of Lv differ from what has been reported for other teleosts spawning pelagic eggs in seawater but are similar to recent findings for two species of North American Moronidae, the striped bass (Morone saxatilis) and white perch (Morone americana), which spawn pelagic and demersal eggs, respectively in fresh water. Together with the high Vtg sequence homologies and virtually identical structural features of each type of Vtg between species, these findings indicate that the moronid multiple Vtg systems do not substantially vary with reproductive environment. PMID:26643259

  5. The influence of different dietary energy content and feeding regimes on growth and feed utilization of European sea bass (Dicentrarchus labrax, L.

    Directory of Open Access Journals (Sweden)

    Pier Paolo Gatta

    2010-01-01

    Full Text Available The growing importance of European sea bass (Dicentrarchus labrax in aquaculture underlines the need to optimize the feeding strategy for this fish species. The aim of the present study was to assess the effect of dietary energy content and feeding regime on growth performance, feed uti- lization and feeding costs for European sea bass. Seven hundreds and forthyfourfish(averageinitial forthyfourfish(averageinitial four fish ( average initial body weight 68g were randomly allocated into twelve tanks 800 l in a closed recirculation system (water temperature: 22°C; dissolved oxygen ≥90% of saturation. Three isoproteic (47% crude protein extruded diets were formulated with different lipid levels i.e. 16% (diet D16, 24% (diet D24 and 32% (diet D32 and each diet was fed at two different feeding regimes (satiation and 80% satiation accord- ing to a bifactorial experimental design. Feed intake (FI was recorded daily. After 77 days, fish were bulk weighed and growth, SGR and FCR were calculated. Feedingregimesaffectedall theanalysed Feeding regimes affected all the analysed parameters (P<0.05, whereas diet influenced only FCR, FI, protein and lipid intake and the economic efficiency ratio (EER. Fish fed the lowest energy content diet (D16 to satiation resulted in the highest feed intake, a FCR similar to that of fish fed diets D24 and D32 and in the lowest EER.

  6. Molecular characterization and in vivo expression of hypoxia inducible factor (HIF-1α in sea bass (Dicentrarchus labrax exposed to acute and chronic hypoxi

    Directory of Open Access Journals (Sweden)

    Marco Saroglia

    2010-01-01

    Full Text Available Aquatic hypoxia is a frequent event and in fish a complex set of physiological and bi- ochemical alterations are employed to cope with this environmental stress. Many of these adjustments depend to a large extent on changes in the expression of genes that encode for physiologically relevant proteins. Genes that are induced by hypoxia appear to share a common mode of transcriptional regula- tion. This induction depends upon activation of a transcription factor, the hypoxia inducible factor-1 (HIF-1, which is a heterodimer composed of two subunits: α ‧ and β. In this study we report first on the molecular cloning and characterization of HIF-1α ‧ in sea bass (Dicentrarchus labrax. The full-length sea bass cDNA for HIF-1α was isolated and deposited in the GenBank with accession no. DQ171936. It consists of 3317 base pairs (bp carrying a single open-read- ing frame that encompasses 2265 bp of the coding region and 1052 bp of the 3’ UTR. We then utilized the real-time PCR technology to monitor dynamic changes in levels of HIF-1α ‧ tran- scripts, in response to acute and chronic hypoxic stress. The number of HIF-1α ‧ mRNA copies were signifi- cantly increased in response to both acute (1.9 mg/L, dissolved oxygen for 4 hours and chronic (4.3 mg/L, DO for 15 days hypoxia in sea bass, whereas it remained unchanged in fish exposed to hyperoxic (DO 13.5±1.2 mg/L, 155 % saturation conditions. This is the first study carried out to investigate the behaviour of HIF-1α gene transcripts during hypoxia in representative of marine hypoxia-sensitive fish species.

  7. Biological effects of diethylene glycol (DEG) and produced waters (PWs) released from offshore activities: A multi-biomarker approach with the sea bass Dicentrarchus labrax

    International Nuclear Information System (INIS)

    Diethylene glycol (DEG) is largely used during oil and gas exploitation by offshore platforms. The aim of this work was to investigate if this compound induces direct molecular/cellular effects in marine organisms, or indirectly modulate those of produced waters (PWs). Sea bass (Dicentrarchus labrax) were exposed to DEG dosed alone or in combination with PWs from an Adriatic platform. A wide array of analysed biomarkers included cytochrome P450-dependent enzymatic activity, bile metabolites, glutathione S-transferases, acetylcholinesterase, peroxisomal proliferation, antioxidant defences (catalase, glutathione reductase, glutathione peroxidases, glutathione), total oxyradical scavenging capacity, malondialdehyde and DNA integrity (single strand breaks and frequency of micronuclei). Results did not reveal marked effects of DEG, while PWs influenced the biotransformation system, the oxidative status and the onset of genotoxic damages. Co-exposures caused only limited differences of biomarker responses at some experimental conditions, overall suggesting a limited biological impact of DEG at levels normally deriving from offshore activities. - A biological risk for marine organisms can be excluded for DEG concentrations as those normally associated to produced waters discharged in the Adriatic Sea.

  8. 17β-Estradiol induces changes in cytokine levels in head kidney and blood of juvenile sea bass (Dicentrarchus labrax, L., 1758).

    Science.gov (United States)

    Seemann, Frauke; Knigge, Thomas; Rocher, Béatrice; Minier, Christophe; Monsinjon, Tiphaine

    2013-01-01

    The cytokine network is involved in the immune system communication. As estrogens influence the cytokine expression in mammals, this study investigated the impact of exogenous estrogenic pollutants on selected cytokines in Dicentrarchus labrax. The gene expression of Interleukin 6, Tumour Necrosis Factor α, Transforming Growth Factor β1 and Interleukin 1β was assessed and accomplished with protein measurements in the blood for the last two. Impacts through 17β-estradiol mainly occurred at the beginning of organ regionalisation, thus falling together with a developmentally induced increase of Interleukin 1β and Tumour Necrosis Factor α gene expression in 102 dph fish. 17β-estradiol depressed this modification after 35 days of exposure and the cytokine gene expression tended to be generally down-regulated independently of the 17β-estradiol concentrations after 56 days of exposure. This impact was confirmed at the protein level, showing that 17β-estradiol affects the fine control of the cytokine network in sea bass. PMID:23602341

  9. Biological effects of diethylene glycol (DEG) and produced waters (PWs) released from offshore activities: A multi-biomarker approach with the sea bass Dicentrarchus labrax

    Energy Technology Data Exchange (ETDEWEB)

    Stefania, Gorbi; Maura, Benedetti [Dipartimento di Biochimica, Biologia e Genetica, Universita Politecnica delle Marche, Via Ranieri, Monte d' Ago, 60121 Ancona (Italy); Claudia, Virno Lamberti [Istituto Superiore per la Ricerca e la Protezione Ambientale (ISPRA), Via di Casalotti 300 Roma (Italy); Barbara, Pisanelli [Dipartimento di Biochimica, Biologia e Genetica, Universita Politecnica delle Marche, Via Ranieri, Monte d' Ago, 60121 Ancona (Italy); Ginevra, Moltedo [Istituto Superiore per la Ricerca e la Protezione Ambientale (ISPRA), Via di Casalotti 300 Roma (Italy); Francesco, Regoli, E-mail: f.regoli@univpm.i [Dipartimento di Biochimica, Biologia e Genetica, Universita Politecnica delle Marche, Via Ranieri, Monte d' Ago, 60121 Ancona (Italy)

    2009-11-15

    Diethylene glycol (DEG) is largely used during oil and gas exploitation by offshore platforms. The aim of this work was to investigate if this compound induces direct molecular/cellular effects in marine organisms, or indirectly modulate those of produced waters (PWs). Sea bass (Dicentrarchus labrax) were exposed to DEG dosed alone or in combination with PWs from an Adriatic platform. A wide array of analysed biomarkers included cytochrome P450-dependent enzymatic activity, bile metabolites, glutathione S-transferases, acetylcholinesterase, peroxisomal proliferation, antioxidant defences (catalase, glutathione reductase, glutathione peroxidases, glutathione), total oxyradical scavenging capacity, malondialdehyde and DNA integrity (single strand breaks and frequency of micronuclei). Results did not reveal marked effects of DEG, while PWs influenced the biotransformation system, the oxidative status and the onset of genotoxic damages. Co-exposures caused only limited differences of biomarker responses at some experimental conditions, overall suggesting a limited biological impact of DEG at levels normally deriving from offshore activities. - A biological risk for marine organisms can be excluded for DEG concentrations as those normally associated to produced waters discharged in the Adriatic Sea.

  10. In situ mortality experiments with juvenile sea bass (Dicentrarchus labrax in relation to impulsive sound levels caused by pile driving of windmill foundations.

    Directory of Open Access Journals (Sweden)

    Elisabeth Debusschere

    Full Text Available Impact assessments of offshore wind farm installations and operations on the marine fauna are performed in many countries. Yet, only limited quantitative data on the physiological impact of impulsive sounds on (juvenile fishes during pile driving of offshore wind farm foundations are available. Our current knowledge on fish injury and mortality due to pile driving is mainly based on laboratory experiments, in which high-intensity pile driving sounds are generated inside acoustic chambers. To validate these lab results, an in situ field experiment was carried out on board of a pile driving vessel. Juvenile European sea bass (Dicentrarchus labrax of 68 and 115 days post hatching were exposed to pile-driving sounds as close as 45 m from the actual pile driving activity. Fish were exposed to strikes with a sound exposure level between 181 and 188 dB re 1 µPa².s. The number of strikes ranged from 1739 to 3067, resulting in a cumulative sound exposure level between 215 and 222 dB re 1 µPa².s. Control treatments consisted of fish not exposed to pile driving sounds. No differences in immediate mortality were found between exposed and control fish groups. Also no differences were noted in the delayed mortality up to 14 days after exposure between both groups. Our in situ experiments largely confirm the mortality results of the lab experiments found in other studies.

  11. Genomic characterization of the European sea bass Dicentrarchus labrax reveals the presence of a novel uncoupling protein (UCP gene family member in the teleost fish lineage

    Directory of Open Access Journals (Sweden)

    Tine Mbaye

    2012-05-01

    Full Text Available Abstract Background Uncoupling proteins (UCP are evolutionary conserved mitochondrial carriers that control energy metabolism and therefore play important roles in several physiological processes such as thermogenesis, regulation of reactive oxygen species (ROS, growth control, lipid metabolism and regulation of insulin secretion. Despite their importance in various physiological processes, their molecular function remains controversial. The evolution and phylogenetic distribution may assist to identify their general biological function and structure-function relationships. The exact number of uncoupling protein genes in the fish genome and their evolution is unresolved. Results Here we report the first characterisation of UCP gene family members in sea bass, Dicentrarchus labrax, and then retrace the evolution of the protein family in vertebrates. Four UCP genes that are shared by five other fish species were identified in sea bass genome. Phylogenetic reconstitution among vertebrate species and synteny analysis revealed that UCP1, UCP2 and UCP3 evolved from duplication events that occurred in the common ancestor of vertebrates, whereas the novel fourth UCP originated specifically in the teleost lineage. Functional divergence analysis among teleost species revealed specific amino acid positions that have been subjected to altered functional constraints after duplications. Conclusions This work provides the first unambiguous evidence for the presence of a fourth UCP gene in teleost fish genome and brings new insights into the evolutionary history of the gene family. Our results suggest functional divergence among paralogues which might result from long-term and differential selective pressures, and therefore, provide the indication that UCP genes may have diverse physiological functions in teleost fishes. Further experimental analysis of the critical amino acids identified here may provide valuable information on the physiological functions of

  12. A model for predicting the quantities of dissolved inorganic nitrogen released in effluents from a sea bass (Dicentrarchus labrax) recirculating water system

    OpenAIRE

    Pagand, Pascal; Blancheton, Jean-Paul; Casellas, Claude

    2000-01-01

    Fish excretions and the transformation of nitrogen by bacteria in the nitrifying biofilter are two of the main sources of dissolved inorganic nitrogen (DIN) in fish farms that use recirculating water systems. In this study, the DIN concentration in an experimental Dicentrarchus labrax aquaculture system was calculated using empirical sub-models for fish growth, ingested food and water replacement. The specific growth rate (SGR) (% day(-1)) and the daily feeding rate (DFR) (% day(-1)) both dep...

  13. Acceleration performance of individual European sea bass Dicentrarchus labrax measured with a sprint performance chamber: comparison with high-speed cinematography and correlates with ecological performance.

    Science.gov (United States)

    Vandamm, Joshua P; Marras, Stefano; Claireaux, Guy; Handelsman, Corey A; Nelson, Jay A

    2012-01-01

    Locomotor performance can influence the ecological and evolutionary success of a species. For fish, favorable outcomes of predator-prey encounters are often presumably due to robust acceleration ability. Although escape-response or "fast-start" studies utilizing high-speed cinematography are prevalent, little is known about the contribution of relative acceleration performance to ecological or evolutionary success in a species. This dearth of knowledge may be due to the time-consuming nature of analyzing film, which imposes a practical limit on sample sizes. Herein, we present a high-throughput potential alternative for measuring fish acceleration performance using a sprint performance chamber (SPC). The acceleration performance of a large number of juvenile European sea bass (Dicentrarchus labrax) from two populations was analyzed. Animals from both hatchery and natural ontogenies were assessed, and animals of known acceleration ability had their ecological performance measured in a mesocosm environment. Individuals from one population also had their acceleration performance assessed by both high-speed cinematography and an SPC. Acceleration performance measured in an SPC was lower than that measured by classical high-speed video techniques. However, short-term repeatability and interindividual variation of acceleration performance were similar between the two techniques, and the SPC recorded higher sprint swimming velocities. Wild fish were quicker to accelerate in an SPC and had significantly greater accelerations than all groups of hatchery-raised fish. Acceleration performance had no significant effect on ecological performance (as assessed through animal growth and survival in the mesocosms). However, it is worth noting that wild animals did survive predation in the mesocosm better than farmed ones. Moreover, the hatchery-originated fish that survived the mesocosm experiment, when no predators were present, displayed significantly increased acceleration

  14. The influence of dietary β-glucans on the adaptive and innate immune responses of European sea bass (Dicentrarchus labrax vaccinated against vibriosis

    Directory of Open Access Journals (Sweden)

    Pier Paolo Gatta

    2010-01-01

    Full Text Available The effects of feeding 1,3/1,6 β-glucans on the innate and the adaptive immune responses of European sea bass (Dicentrarchus labrax was investigated. Two experiments were carried out during the study. In the first, a number of non-specific immune parameters were examined at 4, 7, 10, 14, 21 and 25 days of feeding fish with a semipurified diet containing Macrogard ©, a commercially available form of 1,3/1,6 β-glucans. The respiratory burst activity of head kidney macrophages isolated from the different groups of fish fed the immunostimulant peaked and subsequently decreased at different times during the experiment. Head kidney macrophages from fish fed 250 ppm β-glucans had a statistically higher level of respiratory burst activity at Day 21 of feeding compared with fish fed no immunostimulant. No statistical differences were observed in lyzozyme activity during this trial. In the second experiment, the effect of feeding 1,3/1,6 β-glucans on the immune response of fish to an alginate-encapsulated Vibrio vaccine administered orally was examined. Respiratory burst of head kidney macrophages and serum lysozyme activity decreased in all fish over the course of the trial, while serum lysozyme activity was considerably lower than values obtained in the first experiment. Fish vaccinated orally had significant increases in antibody response by Week 2 post-vaccination, but β-glucans did not appear to affect these levels. Vaccination may have resulted in activating the immune system as a whole, thus masking any difference in immunostimulation by the β-glucans. It may be that the optimal doses and timing of β-glucans administration is different when the immunostimulant is administered alone or in combination with the vaccine. In conclusion, European sea bass can be immunomodulated with oral administration of β-glucan. Optimal doses and administration times have been established when β-glucans are fed alone, although further studies are needed to

  15. Evaluation of different methods of stunning/killing sea bass (Dicentrarchus labrax) by tissue stress/quality indicators

    OpenAIRE

    Zampacavallo, Giulia; Parisi, Giuliana; Mecatti, Massimo; Lupi, Paola; Giorgi, Gianluca; Poli, Bianca Maria

    2014-01-01

    The aim of the study was to evaluate the effect on the final product quality of certain innovative stunning/killing methods for sea bass as substitutes for the most common methods used by European farmers. The changes in tissue stress/quality parameters were monitored from the first hours after death and during the shelf life of the fish. Two trials were conducted in July and November on n. 231 sea bass stunned/killed by ice-water slurry, by single gas or mixture of gases in ice-water and by ...

  16. Growth parameters in European sea bass (Dicentrarchus labraxL.): effects of live weight and water temperature

    OpenAIRE

    Rodolfo Ballestrazzi; Edo D’Agaro; Domenico Lanari

    2010-01-01

    The voluntary feed intake (VFI) and growth rate of sea bass were studied for 147 days, based on different starting live  weights, under natural photoperiods and varied water temperatures. Sea bass (n = 720) were divided into five weight  classes (60-70, 90-110, 130-150, 160-180 and 230-250 g) and distributed among 20 tanks. Seven different water tem-  peratures were compared: 13, 16, 19, 22, 25, 28 and 31 °C. A commercial extruded diet (N x 6.25, 43.7% DM; crude  fat, ...

  17. Phenanthrene and nitrite effects on juvenile sea bass, Dicentrarchus labrax, using hepatic biotransformation enzymes, biliary fluorescence, and micronuclei as biomarkers

    Digital Repository Service at National Institute of Oceanography (India)

    Reis-Henriques, M.A.; Ferreira, M.; Coimbra, A.M.; DeSilva, C.; Shailaja, M.S.

    measured at days 1, 3, and 6 of exposure. Sea bass exposed to PHE exhibited lower hepatic 7-ethoxyresorufin O-deethylase (EROD) activity as compared to the control group. The activity of the phase II enzyme, glutathione S-transferase (GST), was similar...

  18. Consumer preferences regarding the introduction of new organic products. The case of the Mediterranean sea bass (Dicentrarchus labrax) in Italy.

    Science.gov (United States)

    Mauracher, C; Tempesta, T; Vecchiato, D

    2013-04-01

    The introduction of new products on the market poses several challenges; in particular, whether the characteristics of the proposed product will be judged positively by potential consumers. This paper analyses the preferences of consumers regarding the introduction on the Italian market of a new product: organic Mediterranean sea bass. The aim of this study is to assess the importance given by consumers to four main characteristics of sea bass (country of origin, size, production method - organic or conventional - and price) so as to be able to formulate marketing strategies. We applied a choice experiment (CE) in order to define not only the ordinal ranking of preferences but also the willingness to pay (WTP) for the key characteristics of the newly-introduced product. We found that consumers show a higher WTP for the sea bass country of origin than for the breeding method used. Our results suggest that while organic aquaculture might be a new and important strategy for diversification, if suitable communication, either from a public policy or commercial perspective, and labelling/certification are not taken into consideration, the added value of the production method might not be perceived by the final consumers. PMID:23268110

  19. Growth parameters in European sea bass (Dicentrarchus labraxL.: effects of live weight and water temperature

    Directory of Open Access Journals (Sweden)

    Rodolfo Ballestrazzi

    2010-01-01

    Full Text Available The voluntary feed intake (VFI and growth rate of sea bass were studied for 147 days, based on different starting live  weights, under natural photoperiods and varied water temperatures. Sea bass (n = 720 were divided into five weight  classes (60-70, 90-110, 130-150, 160-180 and 230-250 g and distributed among 20 tanks. Seven different water tem-  peratures were compared: 13, 16, 19, 22, 25, 28 and 31 °C. A commercial extruded diet (N x 6.25, 43.7% DM; crude  fat, 25.7% DM was used. The trial was performed in a closed-circuit plant, with a daily water turnover rate of 10%. Each  tank was fitted with an apparatus for collecting the uneaten food. Automatic feeders distributed equal amounts of food  for ten meals per day. The daily food allowance was adjusted, based on fish biomass, to permit ad libitum feeding and  to leave approximately 20% uneaten. Fish were exposed to natural photoperiod (March-July. Non-linear regression  equations were used to calculate the best-fitting curves for the data. 

  20. Effect of dietary fat level on carcass traits and flesh quality of European Sea Bass (Dicentrarchus labrax from mariculture

    Directory of Open Access Journals (Sweden)

    Severino Segato

    2010-01-01

    Full Text Available The study aimed at evaluating the effect of the reduction of dietary fat on juvenile European sea bass nutritional value and quality traits. Fish were reared in floating cages (Trieste Gulf, Italy from July (11 to October (10. Two isoproteic diets were compared: LF (low fat, EE = 19.4% vs. HF (high fat, EE = 24.6%. No significantly different growth performance was observed. LF diet-fed fish were characterized by the reduction of celomatic fat (not edible fraction and by the increase in dressing percentage. The tested dietary fat level also affected both fillet and epiaxial white muscle proximate composition, resulting in a significantly lower fillet lipid concentration in LF diet-fed fish. Dietary treatment influenced cooked fillet colour and texture probably as a consequence of the different intramuscular fat deposition. Fillet from HF-fed fish, in fact, presented higher lightness (L* value and lower instrumental strengthness.

  1. Evaluation of different methods of stunning/killing sea bass (Dicentrarchus labrax) by tissue stress/quality indicators.

    Science.gov (United States)

    Zampacavallo, Giulia; Parisi, Giuliana; Mecatti, Massimo; Lupi, Paola; Giorgi, Gianluca; Poli, Bianca Maria

    2015-05-01

    The aim of the study was to evaluate the effect on the final product quality of certain innovative stunning/killing methods for sea bass as substitutes for the most common methods used by European farmers. The changes in tissue stress/quality parameters were monitored from the first hours after death and during the shelf life of the fish. Two trials were conducted in July and November on n. 231 sea bass stunned/killed by ice-water slurry, by single gas or mixture of gases in ice-water and by single- or two-stage electrical stunning/killing methods. Behavioural responses, stun/death time, rigor index, muscular and ocular pH, lactic acid, ATP and catabolites at death and within the 24 h after death were determined. In the November trial, the sensorial evaluation, rigor index, IMP, inosine, hypoxanthine, and K1 values were also evaluated during refrigerated storage until spoilage. The stunning/killing in ice-water appeared to induce low effects on the analysed parameters and preserve a good product quality as indicated by the highest pH and ATP values at death, the delayed full rigor onset and the 1 day longer shelf life (14 days) in comparison with the single- or two-stage electrical stunning/killing. The gas mixture addition provided a 40 % shortening of the time to obtain stunning/killing and 14 days of shelf life. The actual level of quality loss with the different killing conditions and the actual impact of a significant shortage of rigor mortis onset and pH drop on the possible pre-rigor filleting remain to be studied in depth. PMID:25892757

  2. Gonadotropin Inhibitory Hormone Down-Regulates the Brain-Pituitary Reproductive Axis of Male European Sea Bass (Dicentrarchus labrax).

    Science.gov (United States)

    Paullada-Salmerón, José A; Cowan, Mairi; Aliaga-Guerrero, María; Morano, Francesca; Zanuy, Silvia; Muñoz-Cueto, José A

    2016-06-01

    Gonadotropin-inhibitory hormone (GnIH) inhibits gonadotropin synthesis and release from the pituitary of birds and mammals. However, the physiological role of orthologous GnIH peptides on the reproductive axis of fish is still uncertain, and their actions on the main neuroendocrine systems controlling reproduction (i.e., GnRHs, kisspeptins) have received little attention. In a recent study performed in the European sea bass, we cloned a cDNA encoding a precursor polypeptide that contained C-terminal MPMRFamide (sbGnIH-1) and MPQRFamide (sbGnIH-2) peptide sequences, developed a specific antiserum against sbGnIH-2, and characterized its central and pituitary GnIH projections in this species. In this study, we analyzed the effects of intracerebroventricular injection of sbGnIH-1 and sbGnIH-2 on brain and pituitary expression of reproductive hormone genes (gnrh1, gnrh2, gnrh3, kiss1, kiss2, gnih, lhbeta, fshbeta), and their receptors (gnrhr II-1a, gnrhr II-2b, kiss1r, kiss2r, and gnihr) as well as on plasma Fsh and Lh levels. In addition, we determined the effects of GnIH on pituitary somatotropin (Gh) expression. The results obtained revealed the inhibitory role of sbGnIH-2 on brain gnrh2, kiss1, kiss2, kiss1r, gnih, and gnihr transcripts and on pituitary fshbeta, lhbeta, gh, and gnrhr-II-1a expression, whereas sbGnIH-1 only down-regulated brain gnrh1 expression. However, at different doses, central administration of both sbGnIH-1 and sbGnIH-2 decreased Lh plasma levels. Our work represents the first study reporting the effects of centrally administered GnIH in fish and provides evidence of the differential actions of sbGnIH-1 and sbGnIH-2 on the reproductive axis of sea bass, the main inhibitory role being exerted by the sbGnIH-2 peptide. PMID:26984999

  3. Effects of electro-fishing on galvano-taxis and carcass quality characteristics in sea bass (Dicentrarchus labrax

    Directory of Open Access Journals (Sweden)

    Edo D’Agaro

    2010-01-01

    Full Text Available The aim of this study was to investigate the effects of electro-fishing in sea water. We evaluated the feasibility of an electro-fishing system using numerical simulations for laboratory tanks and the open sea and performing a laboratory experiment. A non-homogeneous bi-dimensional electric-field model for marine water and fish based on discrete formulation of electro-magnetic field equations was developed using GAME (geometric approach for Maxwell equations software. Voltage gradients inside the fish and close to the body were determined. Re- sults showed that fish in the open sea and in groups had greater internal voltage differences than did fish in tanks and single fish. Sea bass (length:10 and 30 cm were exposed in laboratory tanks to pulsed direct current (PDC, 25-125 Hz and duty cycle (5-40%. We measured the electro-taxis and tetanus thresholds after electrical exposure. It is significant that these values decreased with increasing the size of fish. No differences were found after electro-fishing on overall appearance, internal and external haemorrhage, standard freshness scoring techniques and carcass quality characteristics

  4. Production and characterization of recombinantly derived peptides and antibodies for accurate determinations of somatolactin, growth hormone and insulin-like growth factor-I in European sea bass (Dicentrarchus labrax).

    Science.gov (United States)

    de Celis, S Vega-Rubín; Gómez-Requeni, P; Pérez-Sánchez, J

    2004-12-01

    A specific radioimmunoassay (RIA) for European sea bass (Dicentrarchus labrax) growth hormone (GH) was developed and validated. For this purpose, a stable source of GH was produced by means of recombinant DNA technology in a bacteria system. The identity of the purified protein (ion exchange chromatography) was demonstrated by Western blot and a specific GH antiserum was raised in rabbit. In Western blot and RIA system, this antiserum recognized specifically native and recombinant GH, and it did not cross-react with fish prolactin (PRL) and somatolactin (SL). In a similar way, a specific polyclonal antiserum against the now available recombinant European sea bass SL was raised and used in the RIA system to a sensitivity of 0.3 ng/ml (90% of binding of tracer). Further, European sea bass insulin-like growth factor-I (IGF-I) was cloned and sequenced, and its high degree of identity with IGF-I peptides of barramundi, tuna, and sparid fish allowed the use of a commercial IGF-I RIA based on barramundi IGF-I antiserum. These assay tools assisted for the first time accurate determinations of SL and GH-IGF-I axis activity in a fish species of the Moronidae family. Data values were compared to those found with gilthead sea bream (Sparus aurata), which is currently used as a Mediterranean fish model for growth endocrinology studies. As a characteristic feature, the average concentration year round of circulating GH in growing mature males of European sea bass was higher than in gilthead sea bream. By contrast, the average concentration of circulating SL was lower. Concerning to circulating concentration of IGF-I, the measured plasma values for a given growth rate were also lower in European sea bass. These findings are discussed on the basis of a different energy status that might allowed a reduced but more continuous growth in European sea bass. PMID:15560873

  5. Nutritional Status as the Key Modulator of Antioxidant Responses Induced by High Environmental Ammonia and Salinity Stress in European Sea Bass (Dicentrarchus labrax.

    Directory of Open Access Journals (Sweden)

    Amit Kumar Sinha

    Full Text Available Salinity fluctuation is one of the main factors affecting the overall fitness of marine fish. In addition, water borne ammonia may occur simultaneously with salinity stress. Additionally, under such stressful circumstances, fish may encounter food deprivation. The physiological and ion-osmo regulatory adaptive capacities to cope with all these stressors alone or in combination are extensively addressed in fish. To date, studies revealing the modulation of antioxidant potential as compensatory response to multiple stressors are rather lacking. Therefore, the present work evaluated the individual and combined effects of salinity challenge, ammonia toxicity and nutritional status on oxidative stress and antioxidant status in a marine teleost, European sea bass (Dicentrarchus labrax. Fish were acclimated to normal seawater (32 ppt, to brackish water (20 ppt and 10 ppt and to hypo-saline water (2.5 ppt. Following acclimation to different salinities for two weeks, fish were exposed to high environmental ammonia (HEA, 20 mg/L representing 50% of 96h LC50 value for ammonia for 12 h, 48 h, 84 h and 180 h, and were either fed (2% body weight or fasted (unfed for 7 days prior to HEA exposure. Results show that in response to decreasing salinities, oxidative stress indices such as xanthine oxidase activity, levels of hydrogen peroxide (H2O2 and lipid peroxidation (malondialdehyde, MDA increased in the hepatic tissue of fasted fish but remained unaffected in fed fish. HEA exposure at normal salinity (32 ppt and at reduced salinities (20 ppt and 10 ppt increased ammonia accumulation significantly (84 h-180 h in both feeding regimes which was associated with an increment of H2O2 and MDA contents. Unlike in fasted fish, H2O2 and MDA levels in fed fish were restored to control levels (84 h-180 h; with a concomitant increase in superoxide dismutase (SOD, catalase (CAT, components of the glutathione redox cycle (reduced glutathione, glutathione peroxidase and

  6. Cloning and expression analysis of myostatin, fibroblast growth factor 6, insulin-like growth factor I and II in liver and muscle of sea bass (Dicentrarchus labrax, L. during long-term fasting and refeeding

    Directory of Open Access Journals (Sweden)

    M. Saroglia

    2010-04-01

    Full Text Available The exceptionally fast growth that fish experience after periods of fasting has been called “compensatory growth”. This phenomenon has been studied in intensive aquaculture as a means of enhancing growth rates, but the mechanisms by which food intake activates an increase in somatic growth, and especially in muscle growth, are complex and not yet fully understood. In the present paper, we describe the molecular cloning and sequencing of sea bass (Dicentrarchus labrax myostatin (MSTN and fibroblast growth factor 6 (FGF6, which have been shown to be major genetic determinants of skeletal muscle growth, together with insulin-like growth factor I (IGFI and IGF-II, which are potent mitogens known to play important roles in growth and development. We then report the pattern of expression of the four aforementioned genes, in liver and myotomal muscle in response to prolonged fasting and refeeding. Nutritional status significantly influenced the expression of IGF-I, IGF-II and MSTN, whereas the muscular FGF6 expression levels were not affected by the feeding status of the animals. Taken together these data indicate that IGF-I, IGF-II and MSTN are involved in the sea bass muscle compensatory growth induced by refeeding, whereas FGF6 probably has not a role in this phenomenon.

  7. Effects of Offshore Wind Farms on the Early Life Stages of Dicentrarchus labrax.

    Science.gov (United States)

    Debusschere, Elisabeth; De Coensel, Bert; Vandendriessche, Sofie; Botteldooren, Dick; Hostens, Kris; Vincx, Magda; Degraer, Steven

    2016-01-01

    Anthropogenically generated underwater noise in the marine environment is ubiquitous, comprising both intense impulse and continuous noise. The installation of offshore wind farms across the North Sea has triggered a range of ecological questions regarding the impact of anthropogenically produced underwater noise on marine wildlife. Our interest is on the impact on the "passive drifters," i.e., the early life stages of fish that form the basis of fish populations and are an important prey for pelagic predators. This study deals with the impact of pile driving and operational noise generated at offshore wind farms on Dicentrarchus labrax (sea bass) larvae. PMID:26610960

  8. Studie van de biologie en de kweek van zeebaars Dicentrarchus labrax (L.) in intensieve aquacultuurcondities

    OpenAIRE

    Verdonck, W.

    1989-01-01

    In Europe. the interest in sea bass (Dicentrarchus labrax) as a culture fish is fast increasing. This results in a rapid expansion of sea bass culture and of that of other marine fish species. such as seabream (Sparus aurata) and turbot (Scophtalmus maximus). In 1983 a research project was started, with the aim of culturing sea bass in the thermal effluents of the nuclear power station at Doel. In this way the possibility of producing valuable proteins is created while at the same time therma...

  9. Aquaculture et ichtyoparasitologie: action in vitro du Nitroxinil© (Antihelminthique) sur Diplectanum aequans , ectoparasite branchial du bar Dicentrarchus labrax

    OpenAIRE

    Silan, Patrick; Birgi, Emile; Louis, Christophe; Clota,, Frédéric; Mathieu, André; Giral, Louis

    1996-01-01

    International audience The sea bass Dicentrarchus labrax is subject to intensive rearing. Several monogeneans, gill ectoparasites with a direct biological cycle, parasitized this Teleostei. Under certain conditions of host density, populations of these platyhelminths can increase and consequently induce important mortality. It's especially the case of Diplectanum aequans, a monopisthocotylea against which no treatment is known. In vitro effects of nitroxinil© (or nitroxynil©), an anthelmin...

  10. Effects of the total replacement of fish-based diet with plant-based diet on the hepatic transcriptome of two European sea bass (Dicentrarchus labrax half-sibfamilies showing different growth rates with the plant-based diet

    Directory of Open Access Journals (Sweden)

    Geay Florian

    2011-10-01

    Full Text Available Abstract Background Efforts towards utilisation of diets without fish meal (FM or fish oil (FO in finfish aquaculture have been being made for more than two decades. Metabolic responses to substitution of fishery products have been shown to impact growth performance and immune system of fish as well as their subsequent nutritional value, particularly in marine fish species, which exhibit low capacity for biosynthesis of long-chain poly-unsaturated fatty acids (LC-PUFA. The main objective of the present study was to analyse the effects of a plant-based diet on the hepatic transcriptome of European sea bass (Dicentrarchus labrax. Results We report the first results obtained using a transcriptomic approach on the liver of two half-sibfamilies of the European sea bass that exhibit similar growth rates when fed a fish-based diet (FD, but significantly different growth rates when fed an all-plant diet (VD. Overall gene expression was analysed using oligo DNA microarrays (GPL9663. Statistical analysis identified 582 unique annotated genes differentially expressed between groups of fish fed the two diets, 199 genes regulated by genetic factors, and 72 genes that exhibited diet-family interactions. The expression of several genes involved in the LC-PUFA and cholesterol biosynthetic pathways was found to be up-regulated in fish fed VD, suggesting a stimulation of the lipogenic pathways. No significant diet-family interaction for the regulation of LC-PUFA biosynthesis pathways could be detected by microarray analysis. This result was in agreement with LC-PUFA profiles, which were found to be similar in the flesh of the two half-sibfamilies. In addition, the combination of our transcriptomic data with an analysis of plasmatic immune parameters revealed a stimulation of complement activity associated with an immunodeficiency in the fish fed VD, and different inflammatory status between the two half-sibfamilies. Biological processes related to protein

  11. Combination effects of nano-TiO2 and 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) on biotransformation gene expression in the liver of European sea bass Dicentrarchus labrax.

    Science.gov (United States)

    Vannuccini, Maria Luisa; Grassi, Giacomo; Leaver, Michael J; Corsi, Ilaria

    2015-01-01

    The aim of present study was to investigate the influence of titanium dioxide nanoparticles (nano-TiO2, Aeroxide® P25) on 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) dependent biotransformation gene expression in liver of juvenile European sea bass Dicentrarchus labrax. An in vivo 7day waterborne exposure was performed with nano-TiO2 (1mg/L) and 2,3,7,8-TCDD (46pg/L), singly and in combination. The mRNA expression of aryl hydrocarbon receptor repressor (Ahrr), estrogen receptor (erβ2), ABC transport proteins as Abcb1, Abcc1-c2-g2, cytochrome P450 (cyp1a), glutathione-s-transferase (gsta), glutathione reductase (gr) and engulfment and motility (ELMO) domain-containing protein 2 (elmod2) was investigated. Ahrr, erβ2, abcc1 and abcg2 resulted down-regulated with respect to controls in all experimental groups. Co-exposure to nano-TiO2 and 2,3,7,8-TCDD caused a further significant down regulation of ahrr, erβ2, Abcb1 and Abcc2 compared to single chemical exposure (nano-TiO2 or 2,3,7,8-TCDD alone). No effects were observed for 2,3,7,8-TCDD and nano-TiO2 alone in abcb1 gene, while abcc2 was down-regulated by nano-TiO2 alone. Cyp1a, gst and elmod2 genes were up-regulated by 2,3,7,8-TCDD and to a similar extent after co-exposure. Overall the results indicate that nano-TiO2 is unlikely to interfere with 2,3,7,8-TCDD-dependent biotransformation gene expression in the liver of European sea bass, although the effects of co-exposure observed in ABC transport mRNAs might suggest an impact on xenobiotic metabolite disposition and transport in European sea bass liver. PMID:26235595

  12. Study of endocrine disruption in seabass (Dicentrarchus labrax)

    OpenAIRE

    Schnitzler, Joseph; Koutrakis, Emmanuil; Thomé, Jean-Pierre; Siebert, Ursula; Das, Krishna

    2006-01-01

    Organochlorinated compounds such as polychlorobiphenyls (PCB), dichloro-diphenyl-dichloroethylene (DDE) and dichloro-diphenyl-trichloroethane (DDT) have the characteristic to influence the endocrine system of many fish species and mammals and are thus qualified as endocrine disruptors. The objective of this project aims a better understanding of the effects of these compounds on the thyroid function of European seabass (Dicentrarchus labrax). Thyroid tissue and muscle of 46 seabass from t...

  13. Effect of different dose gamma radiation and refrigeration on the chemical and sensory properties and microbiological status of aqua cultured sea bass (Dicentrarchus labrax)

    International Nuclear Information System (INIS)

    Quality and shelf life of non-irradiated and irradiated (2.5 and 5kGy) sea bass in ice conditions and stored at +4 deg. C were investigated by measurement in microbiological, chemical sensory analyses. Microbial counts for non-irradiated sea bass samples were higher than irradiated fish. Among chemical indicators of spoilage, total volatile base nitrogen (TVB-N) values increased to 36.44mg/100g for non-irradiated sea bass during iced storage, whereas for irradiated fish lower values of 25.26mg/100g and 23.61mg/100g were recorded at 2.5 and 5kGy, respectively (day 17). Trimethylamine (TMA-N) values and thiobarbituric acid (TBA) values for irradiated samples were lower than that for non-irradiated samples. Acceptability scores for odour, taste and texture of cooked sea bass decreased with storage time. The sensory scores of sea bass stored in control and 2.5-5kGy at +4 deg. C were 13 and 15 days, respectively. The results obtained from this study showed that the shelf life of sea bass stored in ice, as determined by overall acceptability of all data, is 13 days for non-irradiated sea bass and 15 days for 2.5kGy irradiated and 17 days for 5kGy irradiated sea bass

  14. Antioxidant, antimicrobial and sensorial effects of Rosemary (Rosmarinus officinalis L.) and Sage (Salvia officinalis L.) on Sea bass (Dicentrarchus labrax L.) fillets

    OpenAIRE

    Can Altınelataman; Duygu Kışla; Berna Kılınç; Evren Burcu Şen Yılmaz; Aslı Cadun Yünlü; Tolga Dinçer; Ufuk Çelik

    2015-01-01

    In this study, effects of sum of vapor distillate and water phase extract of rosemary and sage leaves on sea bass fillets quality, were investigated. For this purpose, effective solution was obtained with same amounts of these plants, cooled down to room temperature, applied to fillets and samples were stored in refrigerated conditions during 13 days. In monitoring period, pH, TVB-N (Total Viable Base –Nitrogen), TBA (Tiobarbutiric acid ), color, textural, microbiological and sensorial analys...

  15. Effects of Sodium Butyrate Treatment on Histone Modifications and the Expression of Genes Related to Epigenetic Regulatory Mechanisms and Immune Response in European Sea Bass (Dicentrarchus Labrax) Fed a Plant-Based Diet

    Science.gov (United States)

    Díaz, Noelia; Rimoldi, Simona; Ceccotti, Chiara; Gliozheni, Emi; Piferrer, Francesc

    2016-01-01

    Bacteria that inhabit the epithelium of the animals’ digestive tract provide the essential biochemical pathways for fermenting otherwise indigestible dietary fibers, leading to the production of short-chain fatty acids (SCFAs). Of the major SCFAs, butyrate has received particular attention due to its numerous positive effects on the health of the intestinal tract and peripheral tissues. The mechanisms of action of this four-carbon chain organic acid are different; many of these are related to its potent regulatory effect on gene expression since butyrate is a histone deacetylase inhibitor that play a predominant role in the epigenetic regulation of gene expression and cell function. In the present work, we investigated in the European sea bass (Dicentrarchus labrax) the effects of butyrate used as a feed additive on fish epigenetics as well as its regulatory role in mucosal protection and immune homeostasis through impact on gene expression. Seven target genes related to inflammatory response and reinforcement of the epithelial defense barrier [tnfα (tumor necrosis factor alpha) il1β, (interleukin 1beta), il-6, il-8, il-10, and muc2 (mucin 2)] and five target genes related to epigenetic modifications [dicer1(double-stranded RNA-specific endoribonuclease), ehmt2 (euchromatic histone-lysine-N-methyltransferase 2), pcgf2 (polycomb group ring finger 2), hdac11 (histone deacetylase-11), and jarid2a (jumonji)] were analyzed in fish intestine and liver. We also investigated the effect of dietary butyrate supplementation on histone acetylation, by performing an immunoblotting analysis on liver core histone extracts. Results of the eight-week-long feeding trial showed no significant differences in weight gain or SGR (specific growth rate) of sea bass that received 0.2% sodium butyrate supplementation in the diet in comparison to control fish that received a diet without Na-butyrate. Dietary butyrate led to a twofold increase in the acetylation level of histone H4 at

  16. Is the kisspeptin system involved in responses to food restriction in order to preserve reproduction in pubertal male sea bass (Dicentrarchus labrax)?

    Science.gov (United States)

    Escobar, Sebastián; Felip, Alicia; Zanuy, Silvia; Carrillo, Manuel

    2016-09-01

    Previous works on European sea bass have determined that long-term exposure to restrictive feeding diets alters the rhythms of some reproductive/metabolic hormones, delaying maturation and increasing apoptosis during gametogenesis. However, exactly how these diets affect key genes and hormones on the brain-pituitary-gonad (BPG) axis to trigger puberty is still largely unknown. We may hypothesize that all these signals could be integrated, at least in part, by the kisspeptin system. In order to capture a glimpse of these regulatory mechanisms, kiss1 and kiss2 mRNA expression levels and those of their kiss receptors (kiss1r, kiss2r) were analyzed in different areas of the brain and in the pituitary of pubertal male sea bass during gametogenesis. Furthermore, other reproductive hormones and factors as well as the percentage of males showing full spermiation were also analyzed. Treated fish fed maintenance diets provided evidence of overexpression of the kisspeptin system in the main hypophysiotropic regions of the brain throughout the entire sexual cycle. Conversely, Gnrh1 and gonadotropin pituitary content and plasma sexual steroid levels were downregulated, except for Fsh levels, which were shown to increase during spermiation. Treated fish exhibited lower rates of spermiation as compared to control group and a delay in its accomplishment. These results demonstrate how the kisspeptin system and plasma Fsh levels are differentially affected by maintenance diets, causing a retardation, but not a full blockage of the reproductive process in the teleost fish European sea bass. This suggests that a hormonal adaptive strategy may be operating in order to preserve reproductive function in this species. PMID:27164487

  17. Impact of acute stress on antimicrobial polypeptides mRNA copy number in several tissues of marine sea bass (Dicentrarchus labrax

    Directory of Open Access Journals (Sweden)

    Terova Genciana

    2011-12-01

    Full Text Available Abstract Background In comparison to higher vertebrates, fish are thought to rely heavily on innate immune system for initial protection against pathogen invasion because their acquired immune system displays a considerably poor immunological memory, and short-lived secondary response. The endogenous antimicrobial polypeptides (AMPPs directly and rapidly killing pathogens such as bacteria, fungi, parasites, and viruses are included within the realm of innate defenses. In addition to piscidins, AMPPs that in recent years have been shown to be commonly linked to innate defense, are histones and their polypeptide fragments, and peptides derived from the respiratory protein hemoglobin. There is evidence that a number of stresses lead to significant regulation of AMPPs and thus their monitoring could be a highly sensitive measure of health status and risk of an infectious disease outbreak, which is a major impediment to the continued success of virtually all aquaculture enterprises and is often the most significant cause of economic losses. Results We firstly isolated and deposited in Genbank database the cDNA sequences encoding for hemoglobin-β-like protein (Hb-LP [GeneBank: JN410659], H2B histone-like protein 1 (HLP1 GenBank: JN410660], and HLP2 [GenBank: JN410661]. The "de novo" prediction of the three-dimensional structures for each protein is presented. Phylogenetic trees were constructed on Hb-LP, HLP1, and HLP2 sequences of sea bass and those of other teleost, avian, reptiles, amphibian and mammalian species. We then used real time RT-PCR technology to monitor for the first time in sea bass, dynamic changes in mRNA copy number of Hb-LP, HLP1, HLP2, and dicentracin in gills, skin, eyes, stomach and proximal intestine in response to acute crowding/confinement stress. We showed that acute crowding stress induces an increase in the expression levels of the aforementioned genes, in gills and skin of sea bass, but not in other tissues, and that

  18. Dominant Aerobic Bacterial Community of Sea Bass (Dicentrarchus Labrax L.1758) Larvae During Weaning from Artemia to Dry Feed in Culture Conditions

    OpenAIRE

    AYAZ, Ayberk; KARATAŞ*, Süheyla

    2010-01-01

    The aim of this study was to determine the dominant aerobic bacterial community of sea bass larvae during their weaning period in 2 different marine hatcheries in Muğla-Bodrum region. Samplings were made in January, March, and May 2005. Larvae and water samples were diluted in certain ratios and were inoculated to Marine Agar, TCBS Agar, Pseudomonas Agar, King Bee Agar, MRS agar, Blood Agar and Plate Count Agar, in that order. Water temperature, pH, saturation, salinity, and features of the s...

  19. Effects of dopaminergic system activation on feeding behavior and growth performance of the sea bass (Dicentrarchus labrax): a self-feeding approach.

    Science.gov (United States)

    Leal, Esther; Fernández-Durán, Begoña; Agulleiro, Maria Josep; Conde-Siera, Marta; Míguez, Jesús Manuel; Cerdá-Reverter, José Miguel

    2013-06-01

    Dopamine is synthesized from l-dopa and subsequently processed into norepinephrine and epinephrine. Any excess neurotransmitter can be taken up again by the neurons to be broken down enzymatically into DOPAC. The effect of dopamine on mammalian food intake is controversial. Mice unable to synthesize central dopamine die of starvation. However, studies have also shown that central injection of dopamine inhibits food intake. The effect of dopaminergic system in the fish feeding behavior has been scarcely explored. We report that the inclusion of l-dopa in the diets results in the activation of sea bass central dopaminergic system but also in the significant increase of the hypothalamic serotonin levels. Dietary l-dopa induces a decrease of food intake and feed conversion efficiency that drives a decline of all growth parameters tested. No behavioral effects were observed after l-dopa treatment. l-dopa treatment stimulated central expression of NPY and CRF. It suggests that CRF might mediate l-dopa effects on food intake but also that CRF neurons lie downstream of NPY neurons in the hierarchical forebrain system, thus controlling energy balance. Unexpectedly, dietary administration of haloperidol, a D2-receptor antagonist, cannot block dopamine effects but also induces a decline of the food intake. This decrease seems to be a side effect of haloperidol treatment since fish exhibited a decreased locomotor activity. We conclude that oral l-dopa inhibits sea bass food intake and growth. Mechanism could also involve an increase of hypothalamic serotoninergic tone. PMID:23747830

  20. Melatonin Inhibits GnRH-1, GnRH-3 and GnRH Receptor Expression in the Brain of the European Sea Bass, Dicentrarchus labrax

    Directory of Open Access Journals (Sweden)

    José Antonio Muñoz-Cueto

    2013-04-01

    Full Text Available Several evidences supported the existence of melatonin effects on reproductive system in fish. In order to investigate whether melatonin is involved in the modulation of GnRH systems in the European sea bass, we have injected melatonin (0.5 µg/g body mass in male specimens. The brain mRNA transcript levels of the three GnRH forms and the five GnRH receptors present in this species were determined by real time quantitative PCR. Our findings revealed day–night variations in the brain expression of GnRH-1, GnRH-3 and several GnRH receptors (dlGnRHR-II-1c, -2a, which exhibited higher transcript levels at mid-light compared to mid-dark phase of the photocycle. Moreover, an inhibitory effect of melatonin on the nocturnal expression of GnRH-1, GnRH-3, and GnRH receptors subtypes 1c, 2a and 2b was also demonstrated. Interestingly, the inhibitory effect of melatonin affected the expression of hypophysiotrophic GnRH forms and GnRH receptors that exhibit day–night fluctuations, suggesting that exogenous melatonin reinforce physiological mechanisms already established. These interactions between melatoninergic and GnRH systems could be mediating photoperiod effects on reproductive and other rhythmic physiological events in the European sea bass.

  1. Dietary Mannan Oligosaccharides: Counteracting the Side Effects of Soybean Meal Oil Inclusion on European Sea Bass (Dicentrarchus labrax) Gut Health and Skin Mucosa Mucus Production?

    Science.gov (United States)

    Torrecillas, Silvia; Montero, Daniel; Caballero, Maria José; Pittman, Karin A.; Custódio, Marco; Campo, Aurora; Sweetman, John; Izquierdo, Marisol

    2015-01-01

    The main objective of this study was to assess the effects of 4 g kg−1 dietary mannan oligosaccharides (MOS) inclusion in soybean oil (SBO)- and fish oil (FO)-based diets on the gut health and skin mucosa mucus production of European sea bass juveniles after 8 weeks of feeding. Dietary MOS, regardless of the oil source, promoted growth. The intestinal somatic index was not affected, however dietary SBO reduced the intestinal fold length, while dietary MOS increased it. The dietary oil source fed produced changes on the posterior intestine fatty acid profiles irrespective of MOS dietary supplementation. SBO down-regulated the gene expression of TCRβ, COX2, IL-1β, TNFα, IL-8, IL-6, IL-10, TGFβ, and Ig and up-regulated MHCII. MOS supplementation up-regulated the expression of MHCI, CD4, COX2, TNFα, and Ig when included in FO-based diets. However, there was a minor up-regulating effect on these genes when MOS was supplemented in the SBO-based diet. Both dietary oil sources and MOS affected mean mucous cell areas within the posterior gut, however the addition of MOS to a SBO diet increased the mucous cell size over the values shown in FO fed fish. Dietary SBO also trends to reduce mucous cell density in the anterior gut relative to FO, suggesting a lower overall mucosal secretion. There are no effects of dietary oil or MOS in the skin mucosal patterns. Complete replacement of FO by SBO, modified the gut fatty acid profile, altered posterior gut-associated immune system (GALT)-related gene expression and gut mucous cells patterns, induced shorter intestinal folds and tended to reduce European sea bass growth. However, when combined with MOS, the harmful effects of SBO appear to be partially balanced by moderating the down-regulation of certain GALT-related genes involved in the functioning of gut mucous barrier and increasing posterior gut mucous cell diffusion rates, thus helping to preserve immune homeostasis. This denotes the importance of a balanced

  2. Comparative pathogenicity study of ten different betanodavirus strains in experimentally infected European sea bass, Dicentrarchus labrax (L.)

    DEFF Research Database (Denmark)

    Vendramin, Niccolò; Toffan, A.; Mancin, M.;

    2014-01-01

    Viral encephalopathy and retinopathy (VER), otherwise known as viral nervous necrosis (VNN), is a severe pathological condition caused by RNA viruses belonging to the Nodaviridae family, genus Betanodavirus. The disease, described in more than 50 fish species worldwide, is considered as the most...... serious viral threat affecting marine farmed species in the Mediterranean region, thus representing one of the bottlenecks for further development of the aquaculture industry. To date, four different genotypes have been identified, namely red-spotted grouper nervous necrosis virus (RGNNV), striped jack...... trial. The investigation was conducted using the European sea bass, the first target fish species for the disease in the Mediterranean basin. Naive fish were challenged by immersion and clinical signs and mortality were recorded for 68 days; furthermore, samples collected at selected time points were...

  3. Effects of fish oil replacement by vegetable oil blend on digestive enzymes and tissue histomorphology of European sea bass (Dicentrarchus labrax) juveniles.

    Science.gov (United States)

    Castro, Carolina; Couto, Ana; Pérez-Jiménez, Amalia; Serra, Cláudia R; Díaz-Rosales, Patricia; Fernandes, Rui; Corraze, Geneviève; Panserat, Stéphane; Oliva-Teles, Aires

    2016-02-01

    The impact of replacing circa 70% fish oil (FO) by a vegetable oil (VO) blend (rapeseed, linseed, palm oils; 20:50:30) in diets for European sea bass juveniles (IBW 96 ± 0.8 g) was evaluated in terms of activities of digestive enzymes (amylase, lipase, alkaline phosphatase, trypsin and total alkaline proteases) in the anterior (AI) and posterior (PI) intestine and tissue morphology (pyloric caeca-PC, AI, PI, distal intestine-DI and liver). For that purpose, fish were fed the experimental diets for 36 days and then liver and intestine were sampled at 2, 6 and 24 h after the last meal. Alkaline protease characterization was also done in AI and PI at 6 h post-feeding. Dietary VO promoted higher alkaline phosphatase activity at 2 h post-feeding in the AI and at all sampling points in the PI. Total alkaline protease activity was higher at 6 h post-feeding in the PI of fish fed the FO diet. Identical number of bands was observed in zymograms of alkaline proteases of fish fed both diets. No alterations in the histomorphology of PC, AI, PI or DI were noticed in fish fed the VO diets, while in the liver a tendency towards increased hepatocyte vacuolization due to lipid accumulation was observed. Overall, and with the exception of a higher intestine alkaline phosphatase activity, 70% FO replacement by a VO blend in diets for European sea bass resulted in no distinctive alterations on the postprandial pattern of digestive enzyme activities and intestine histomorphology. PMID:26364216

  4. Antioxidant, antimicrobial and sensorial effects of Rosemary (Rosmarinus officinalis L. and Sage (Salvia officinalis L. on Sea bass (Dicentrarchus labrax L. fillets

    Directory of Open Access Journals (Sweden)

    Can Altınelataman

    2015-09-01

    Full Text Available In this study, effects of sum of vapor distillate and water phase extract of rosemary and sage leaves on sea bass fillets quality, were investigated. For this purpose, effective solution was obtained with same amounts of these plants, cooled down to room temperature, applied to fillets and samples were stored in refrigerated conditions during 13 days. In monitoring period, pH, TVB-N (Total Viable Base –Nitrogen, TBA (Tiobarbutiric acid , color, textural, microbiological and sensorial analysis of samples were done. In rosemary group  Control sample was reached the consumption  limits with the value of 36.35± 0.89 (mg TVB-N /100 g in the 10th day of storage. But with the effect of rosemary extraction, rosemary group 3 more days to reach the spoilage limit. In results, sage was determined as more effective for TBA, TVB-N, rosemary for textural, sensorial and color analysis. For antimicrobial influence, both leaves have positive effectiveness. Especially control goups of both groups reached the spoilage limit in the 6th day of storage period where as the extraction groups were still under the consumptional limits. No spoilage were observed in rancidity values in both groups of the trial.

  5. Teneur en ADN de la larve de Dicentrarchus labrax : évolution ontogénétique et effet de la privation de nourriture

    OpenAIRE

    Bergeron, Jean-pierre; Person, Jeanine

    1997-01-01

    Sea bass Dicentrarchus labrax larvae were hatched and reared for 34 days in the laboratory to test a recent biochemical index (DNA/C) of larval fish nutritional condition. Variations in DNA/C ratio values were monitored during the whole larval ontogenesis of fed individuals and the effect of starvation was assessed at three developmental stages. Three main periods in the relative DNA content variations were determined in close connection with growth patterns during larval ontogenesis.

  6. Biochemical and nutritional traits of sea bass (Dicentrachus labrax from different rearing systems.

    Directory of Open Access Journals (Sweden)

    Andrea Santulli

    2010-01-01

    Full Text Available Farmed European sea bass (Dicentrarchus labrax, sampled from three different culture systems (intensive in sea-cages, intensive in land-based basins and extensive in lagoon and storage basins of salt-work, of the Northern, Central and Southern Italy, were analyzed with the aim to employ nutritional trait to describe and to distinguish the “origin” of the product. Lipid and fatty acid profile, strongly affected by the feeding history and environmental factors, responsible of the nu- tritional and perceived quality of fish product, are proposed as marker of origin.

  7. Isolamento de Pasteurella spp. e Vibrio spp. em robalos (Dicentrarchus labrax: susceptibilidade a diferentes grupos de antibióticos

    Directory of Open Access Journals (Sweden)

    Saavedra M.J.

    2004-01-01

    Full Text Available The most frequent infectious diseases that affect fish are those of bacterial origin. In European sea bass fish farms (Dicentrarchus labrax are included Vibrio spp., Pasteurella piscicida and Myxobacter spp. In addition to these, it is also possible to find, although lesser frequently, other pathogenic agents such as Pseudomonas spp., Aeromonas spp., Staphylococcus epidermis, Streptococcus spp. and Enterobacter spp. The presence of these micro-organisms in fish farms contributes for a significant decrease in fish production and subsequent loss of profitability in these aquaculture units. The use of antibiotics may therefore be necessary as a prophylactic measure although their systematic utilization leads to the development of strains of antibiotic resistant bacteria. Bearing that in mind, a survey was conducted on the susceptibility of isolated strains of bacteria found in juvenile European sea bass. It was concluded that chloranphenicol and tetracycline are two important antibiotic alternatives for therapy against isolated bacterial agents.

  8. Hepcidin-Dependent Regulation of Erythropoiesis during Anemia in a Teleost Fish, Dicentrarchus labrax

    Science.gov (United States)

    Caldas, Carolina; Ramos, Miguel F.; Rodrigues, Pedro N. S.

    2016-01-01

    Anemia is a common disorder, characterized by abnormally low levels of red blood cells or hemoglobin. The mechanisms of anemia development and response have been thoroughly studied in mammals, but little is known in other vertebrates, particularly teleost fish. In this study, different degrees of anemia were induced in healthy European sea bass specimens (Dicentrarchus labrax) and at pre-determined time points hematological parameters, liver iron content and the expression of genes involved in iron homeostasis and hematopoiesis, with particular attention on hepcidins, were evaluated. The experimental anemia prompted a decrease in hamp1 expression in all tested organs, in accordance to an increased need for iron absorption and mobilization, with slight increases in hamp2 in the kidney and intestine. The liver was clearly the major organ involved in iron homeostasis, decreasing its iron content and showing a gene expression profile consistent with an increased iron release and mobilization. Although both the spleen and head kidney are involved in erythropoiesis, the spleen was found to assume a more preponderant role in the recovery of erythrocyte levels. The intestine was also involved in the response to anemia, through the increase of iron transporting genes. Administration of Hamp1 or Hamp2 mature peptides showed that only Hamp1 affects hematological parameters and liver iron content. In conclusion, the molecular mechanisms of response to anemia present in sea bass are similar to the ones described for mammals, with these results indicating that the two hepcidin types from teleosts assume different roles during anemia. PMID:27100629

  9. Metals content in otoliths of Dicentrarchus labrax from two fish farms of Sicily.

    Science.gov (United States)

    Traina, A; Oliveri, E; Salvagio Manta, D; Barra, M; Mazzola, S; Cuttitta, A

    2015-06-01

    Otoliths of cultured sea bass (Dicentrarchus labrax) from two different fish farms of Sicily were collected and analyzed by using inductively coupled plasma optical emission spectroscopy. Metal content (Ba, Cd, Fe, Mg, Mn, Sr, and Zn) was measured in order to test the potential use of biogenic carbonates as proxies of dissimilar environmental conditions since the fish farms are implanted in opposite coastal marine areas (Gulf of Castellammare and Gulf of Gela) characterized by different oceanographic features and human activities. Cluster analysis discriminates samples as different groups on the basis of metal content. Results show that concentrations of Sr in the otoliths have a similar range of distribution and not significantly different between the two farms. Otherwise, Fe, Mg, Mn, and Cd show higher concentrations in otoliths collected from fish reared in the farm in the southern coast (Gulf of Gela), an area subject to a great anthropogenic pressure. Zn is the only element with higher values in the otoliths from the farm in the northern coast (Gulf of Trappeto) probably due to industrial effluent. In this work, obtained data confirm the high potential of trace elements measurements in these biogenic carbonates as proxies of different environmental conditions. PMID:25980727

  10. Impact of date palm fruits extracts and probiotic enriched diet on antioxidant status, innate immune response and immune-related gene expression of European seabass (Dicentrarchus labrax).

    Science.gov (United States)

    Guardiola, F A; Porcino, C; Cerezuela, R; Cuesta, A; Faggio, C; Esteban, M A

    2016-05-01

    The application of additives in the diet as plants or extracts of plants as natural and innocuous compounds has potential in aquaculture as an alternative to antibiotics and immunoprophylactics. The aim of the current study was to evaluate the potential effects of dietary supplementation of date palm fruit extracts alone or in combination with Pdp11 probiotic on serum antioxidant status, on the humoral and cellular innate immune status, as well as, on the expression levels of some immune-related genes in head-kidney and gut of European sea bass (Dicentrarchus labrax) after 2 and 4 weeks of administration. This study showed for the first time in European sea bass an immunostimulation in several of the parameters evaluated in fish fed with date palm fruits extracts enriched diet or fed with this substance in combination with Pdp 11 probiotic, mainly after 4 weeks of treatment. In the same way, dietary supplementation of mixture diet has positive effects on the expression levels of immune-related genes, chiefly in head-kidney of Dicentrarchus labrax. Therefore, the combination of both could be considered of great interest as potential additives for farmed fish. PMID:27033470

  11. Modification Of Photoperiod In Reproduction Of European Seabass (Dicentrarchus Labrax).

    OpenAIRE

    Edmond Hala

    2012-01-01

    The modification of photoperiod is routinely used in aquaculture with the aim to enhance production by manipulating the timing of reproduction in several important fish species. In European sea bass was proved that photoperiod manipulation plays an important role in different aspects of reproduction performance. The present study review the effects of photoperiod modification on some physiological aspects related to period of spawning, sexual differentiation and early puberty of the sea bass ...

  12. The Highly conserved gonadotropin-releasing hormone-2 form acts as a melatonin-releasing factor in the pineal of a teleost fish, the european sea bass Dicentrarchus labrax.

    Science.gov (United States)

    Servili, Arianna; Lethimonier, Christèle; Lareyre, Jean-Jacques; López-Olmeda, José Fernando; Sánchez-Vázquez, Francisco Javier; Kah, Olivier; Muñoz-Cueto, José Antonio

    2010-05-01

    With the exception of modern mammals, most vertebrate species possess two GnRH genes, GnRH-1 and GnRH-2. In addition, in many teleost fish, there is a third gene called GnRH-3. If the main function of GnRH-1 is unambiguously to stimulate gonadotropin release, the other two GnRH forms still lack clear functions. This is particularly true for the highly conserved GnRH-2 that encodes chicken GnRH-II. This GnRH variant is consistently expressed in neurons of the dorsal synencephalon in most vertebrate groups but still has no clear functions supported by anatomical, pharmacological, and physiological data. In this study performed on a perciform fish, the European sea bass, we show for the first time that the pineal organ receives GnRH-2-immunoreactive fibers originating from the synencephalic GnRH-2 neurons. This was shown through a combination of retrograde tracing and immunohistochemistry, using highly specific antibodies. Supporting the presence of GnRH-2 functional targets, RT-PCR data together with the in situ hybridization studies showed that the sea bass pineal gland strongly expressed a GnRH receptor (dlGnRHR-II-2b) with clear selectivity for GnRH-2 and, to a lesser extent, the dlGnRHR-II-1a subtype. Finally, in vitro and in vivo experiments demonstrate stimulatory effects of GnRH-2 on nocturnal melatonin secretion by the sea bass pineal organ. Altogether, these data provide, for the first time in a vertebrate species, converging evidence supporting a role of GnRH-2 in the modulation of fish pineal functions. PMID:20215565

  13. Variations in Toxic Metal Levels of Two Fish Species, Pomatomus saltatrix and Dicentrarchus labrax, and Risk Estimation for Children

    Institute of Scientific and Technical Information of China (English)

    Mehmet Yaman; Ibrahim H. Yaman

    2014-01-01

    The concentrations of five toxic metals were monthly determined in two fish species ,obtained from fish markets in Turkey during 2010-2011 .For the determinations ,AAS and ICP-AES were used .The ob-tained lead concentrations for all studied Pomatomus saltatrix (mean 635 μg · kg -1 ) and Dicentrarchus labrax (mean 463 μg · kg -1 ) samples were found to be significantly higher than the maximum allowances concentra-tion (MAC) of 300 μg · kg -1 .Mean chromium (324 μg · kg -1 ) and Cu (940 μg · kg -1 ) concentrations in Pomatomus saltatrix were higher than in Dicentrarchus labrax (268 μg Cr · kg -1 and 600 μg Cu · kg -1 ) while Ni in Pomatomus saltatrix (216μg · kg -1 ) was lower in Dicentrarchus labrax (291μg · kg -1 ) .The estimated non-carcinogenic and carcinogenic health risks by the Target Hazard Quotient and target carcinogenic risk indi-cate that there are no sytemic effects ,and the risk of developing cancer over a human lifetime is between 2~9 in 1 000 000 .

  14. Phylogenetic analysis of antimicrobial lactic acid bacteria from farmed seabass Dicentrarchus labrax.

    Science.gov (United States)

    Bourouni, Ouissal Chahad; El Bour, Monia; Calo-Mata, Pilar; Mraouna, Radhia; Abedellatif, Boudabous; Barros-Velàzquez, Jorge

    2012-04-01

    The use of lactic acid bacteria (LAB) in the prevention or reduction of fish diseases is receiving increasing attention. In the present study, 47 LAB strains were isolated from farmed seabass ( Dicentrarchus labrax ) and were phenotypically and phylogenetically analysed by 16S rDNA and randomly amplified polymorphic DNA - polymerase chain reaction (RAPD-PCR). Their antimicrobial effect was tested in vitro against a wide variety of pathogenic and spoilage bacteria. Most of the strains isolated were enterococci belonging to the following species: Enterococcus faecium (59%), Enterococcus faecalis (21%), Enterococcus sanguinicola (4 strains), Enterococcus mundtii (1 strain), Enterococcus pseudoavium (1 strain), and Lactococcus lactis (1 strain). An Aerococcus viridans strain was also isolated. The survey of their antimicrobial susceptibility showed that all isolates were sensitive to vancomycin and exhibited resistance to between 4 and 10 other antibiotics relevant for therapy in human and animal medicine. Different patterns of resistance were noted for skin and intestines isolates. More than 69% (32 strains) of the isolates inhibited the growth of the majority of pathogenic and spoilage bacteria tested, including Listeria monocytogenes, Staphylococcus aureus, Aeromonas hydrophila, Aeromonas salmonicida, Vibrio anguillarum, and Carnobacterium sp. To our knowledge, this is the first report of bioactive enterococcal species isolated from seabass that could potentially inhibit the undesirable bacteria found in food systems. PMID:22439634

  15. Oxidative stress, genotoxicity and histopathology biomarker responses in Mugil cephalus and Dicentrarchus labrax gill exposed to persistent pollutants. A field study in the Bizerte Lagoon: Tunisia.

    Science.gov (United States)

    Ameur, Walid Ben; El Megdiche, Yassine; de Lapuente, Joaquin; Barhoumi, Badreddine; Trabelsi, Souad; Ennaceur, Soukaina; Camps, Lydia; Serret, Joan; Ramos-López, David; Gonzalez-Linares, Javier; Touil, Soufiane; Driss, Mohamed Ridha; Borràs, Miquel

    2015-09-01

    The use of biomarkers has become an important tool for modern environmental assessment as they can help to predict pollutants involved in the monitoring program. Despite the importance of fish gill in several functions (gaseous exchange, osmotic and ionic regulation, acid-base balance and nitrogenous waste) its use in coastal water biomonitoring focusing on protection and damage is scarce. This field study investigates biochemical (catalase, superoxide dismutase, lipid peroxidation), molecular (DNA integrity) and morphological (histology) parameters in gill of mullet (Mugil cephalus) and sea bass (Dicentrarchus labrax) and originating from Bizerte lagoon (a coastal lagoon impacted by different anthropogenic activities) and from the Mediterranean Sea (a reference site). Remarkable alterations in the activities of oxidative stress enzymes and DNA integrity in the tissue of the two studied fish species were detected in Bizerte Lagoon. The study of histopathological alterations of gills in both two fish species from Bizerte Lagoon suggest thickening of primary lamellae, cellular hyperplasia, aneurism, curving, shortening and fusion of secondary lamellae. The adopted approach, considering simultaneously protection responses and damaging effects, revealed its usefulness on the pollution assessment. PMID:25912422

  16. Bioaccumulation and elimination of mercury in juvenile seabass (Dicentrarchus labrax) in a warmer environment.

    Science.gov (United States)

    Maulvault, Ana Luísa; Custódio, Ana; Anacleto, Patrícia; Repolho, Tiago; Pousão, Pedro; Nunes, Maria Leonor; Diniz, Mário; Rosa, Rui; Marques, António

    2016-08-01

    Warming is an expected impact of climate change that will affect coastal areas in the future. These areas are also subjected to strong anthropogenic pressures leading to chemical contamination. Yet, the consequences of both factors for marine ecosystems, biota and consumers are still unknown. The present work aims to investigate, for the first time, the effect of temperature increase on bioaccumulation and elimination of mercury [(total mercury (THg) and methylmercury (MeHg)] in three tissues (muscle, liver, and brain) of a commercially important seafood species - European seabass (Dicentrarchus labrax). Fish were exposed to the ambient temperature currently used in seabass rearing (18°C) and to the expected ocean warming (+4°C, i.e. 22°C), as well as dietary MeHg during 28 days, followed by a depuration period of 28 days fed with a control diet. In both temperature exposures, higher MeHg contents were observed in the brain, followed by the muscle and liver. Liver registered the highest elimination percentages (EF; up to 64% in the liver, 20% in the brain, and 3% in the muscle). Overall, the results clearly indicate that a warming environment promotes MeHg bioaccumulation in all tissues (e.g. highest levels in brain: 8.1mgkg(-1) ww at 22°C against 6.2mgkg(-1) ww at 18°C after 28 days of MeHg exposure) and hampers MeHg elimination (e.g. liver EF decreases after 28 days of depuration: from 64.2% at 18°C to 50.3% at 22°C). These findings suggest that seafood safety may be compromised in a warming context, particularly for seafood species with contaminant concentrations close to the current regulatory levels. Hence, results point out the need to strengthen research in this area and to revise and/or adapt the current recommendations regarding human exposure to chemical contaminants through seafood consumption, in order to integrate the expected effects of climate change. PMID:27179934

  17. Expression and distribution of the glucocorticoid receptor DlGR1 in the teleost Dicentrarchus labrax brain

    Directory of Open Access Journals (Sweden)

    Nicolò Parrinello

    2010-01-01

    Full Text Available Cortisol is the main corticosteroid secreted by the interrenal cells of the head kidney and it exerts a role in mantaining the omeostatic status in fish. In teleosts its effects are mediated through intracellular receptors expressed in several tissues, that are ligand-dependent transcription factors by binding to specific tissue DNA sequences. In Dicentrarchus labrax we previously cloned and sequenced a glucocorticoid receptor, DlGR1, isolated from leukocytes of peritoneal cavity. In this work we showed mRNA expression and tissue immunohistochemical localization of brain DlGR1 by in situ hybridization assays, with a riboprobe with DlGR1 cDNA trascriptional activation domain, and by immunohistochemical methods, using a specific antibody for a selected sequence of the receptor tran- scriptional domain. The mRNA and the protein are expressed in pyramidal cells of the optic lobe and in the small globular neurons of the diencephalon.

  18. Importance of prebiotics in aquaculture as immunostimulants. Effects on immune system of Sparus aurata and Dicentrarchus labrax.

    Science.gov (United States)

    Carbone, Donatella; Faggio, Caterina

    2016-07-01

    Infectious diseases in fish represent a major problem for the aquaculture field as they produce extensive damages and loss. Over the last few years, with increased development of the aquaculture industry, different methods have been used to contrast these pathologies. Common interest has led to the use of components (as additives in diets) that could contrast diseases without causing any negative impact on the environment. These components are represented by prebiotics, probiotics, and plant extracts. In this review, the effects of prebiotics are described. Prebiotics are indigestible fibres fermented by gut enzymes and commensal bacteria, whose beneficial effects are due to the by-products generated from fermentation. The influence of pre-biotics on the immune system of fish is called immunosaccharides. Mannanoligosaccharides (MOS), Fructooligosaccharides (FOS) and Inulin act at different levels in the innate immune response. For example, through phagocytosis, lysozyme activity, and the complement system activity, an increase in fish growth and an amelioration of their health status is brought about. In this review, the use of prebiotics in aquaculture, such as immunostimulants, has been highlighted: particularly in two teleost fish species, Sparus aurata and Dicentrarchus labrax. The results demonstrate that the road is still long and further studies are required, but the use of prebiotics, individually or coupled together, can open the doors to pioneering a new model of alternative components to antimicrobial agents. PMID:27074444

  19. Detection of metals and polychlorobiphenyls and their correlation with detoxificant enzymes activity in Dicentrarchus labrax

    Directory of Open Access Journals (Sweden)

    I. Traversi

    2011-01-01

    Full Text Available Several pollutants released to the environment, are biotransformed into more soluble molecules, in liver, by several enzymes, as catalase (CAT and glutathione-S-tranferase (GST, which are fundamental for detoxification and excretion. The aim of this study was to investigate the relationships among xenobiotic levels and CAT and GST enzymatic activities, in reared European sea bass.

  20. Diets supplemented with seaweed affect metabolic rate, innate immune, and antioxidant responses, but not individual growth rate in European seabass (Dicentrarchus labrax)

    DEFF Research Database (Denmark)

    Peixoto, Maria J.; Svendsen, Jon Christian; Malte, Hans;

    2016-01-01

    This study investigated the effects of seaweed dietary supplementation on measures of fish performance including aerobic metabolism, digestive enzymes activity, innate immune status, oxidative damage, and growth rate using European seabass (Dicentrarchus labrax). Fish were fed for 49 days with...... three different diets: a control diet (CTRL), a Gracilaria-supplemented diet (GR7.5), and a mixed diet (Mix) composed of Gracilaria, Fucus, and Ulva genera representatives. All diets were isoenergetic (22 kJ g−1 adjusted for dry matter (DM)), isoproteic (47 %DM), and isolipidic (18 %DM) and tested in...... triplicate groups of 20 fish (initial body weight 25.5 ± 4.1 g). Final results showed similar growth rates and digestive activities between diets. Maximum and standard metabolic rates and aerobic metabolic scope revealed comparable results for the three diets. In contrast, fish fed with GR7.5 exhibited...

  1. Evaluation of garlic and onion powder as phyto-additives in the diet of sea bass (Dicentrarcus labrax)

    OpenAIRE

    Norhan E. Saleh; Fady R. Michael; Mohamed M. Toutou

    2015-01-01

    The present study is a preliminary work which was conducted to evaluate the impact of adding 3 levels of garlic (10, 20 and 30 g/kg diet) as well as onion powder (5, 10 and 20 g/kg diet) in a basal diet of sea bass (Dicentrarcus labrax) fry (initial weight = 0.4 ± 0.05 g/fish) on growth performance, feed utilization, body composition, survival rate and some hematological parameters. The present results suggested that dietary garlic or onion powder administrated separately at levels of 30 or 1...

  2. Cryopreservation of sea bass (Dicentrarchus labrax) spermatozoa in experimental and production simulating conditions

    OpenAIRE

    Fauvel, Christian; Suquet, Marc; Dreanno, Catherine; Zonno, Vincenzo; Menu, Bruno

    1998-01-01

    Un protocole de cryoconservation du sperme mis au point chez le turbot a été appliqué au loup en petit (250 μL) et grand volume (1,5 mL). Dilué dans le milieu de Mounib et congelé par une baisse de température de −65 °C·min−1, le sperme a présenté à la décongélation une motilité initiale comparable à celle du témoin, mais une chute de motilité significativement supérieure (p< 0,001, n= 10) aux temps d'observation ultérieurs. L'insémination de petits volumes (2mL, soient appro...

  3. Vaccination of European sea bass fry through bioencapsulation of Artemia nauplii

    OpenAIRE

    Chair, M.; Gapasin, R.S.J.; Dehasque, M.; Sorgeloos, P.

    1994-01-01

    European sea bass (Dicentrarchus labrax) fry vaccinated orally by bioencapsulation in Artemia nauplii or by bath method exhibited better performance than control fish in terms of growth, food conversion and resistance to stress. The comparable survival between vaccinated and non-vaccinated animals suggests that vaccination methods are stressful. The present study shows that oral vaccination can be used to enhance growth in fish fry.

  4. Evaluation of garlic and onion powder as phyto-additives in the diet of sea bass (Dicentrarcus labrax

    Directory of Open Access Journals (Sweden)

    Norhan E. Saleh

    2015-01-01

    Full Text Available The present study is a preliminary work which was conducted to evaluate the impact of adding 3 levels of garlic (10, 20 and 30 g/kg diet as well as onion powder (5, 10 and 20 g/kg diet in a basal diet of sea bass (Dicentrarcus labrax fry (initial weight = 0.4 ± 0.05 g/fish on growth performance, feed utilization, body composition, survival rate and some hematological parameters. The present results suggested that dietary garlic or onion powder administrated separately at levels of 30 or 10 g/kg respectively could improve survival, growth and feed utilization of sea bass fry. Administration of garlic and onion indicates a slide edge for garlic to onion in growth, feed utilization and fish protein content. It will also induce a significant increase in some blood variables (hemoglobin content, hematocrit value, mean corpuscular volume, mean corpuscular hemoglobin and leukocytes count in treated fish when compared to the control fish group.

  5. Real Option Approach to Economic Analysis of European Sea Bass (Dicetrarchus labrax Farming in Croatia

    Directory of Open Access Journals (Sweden)

    Lari Hadelan

    2012-10-01

    Full Text Available The paper emphasizes the economic performance of the fresh European sea bass production and profitability of related processing to value-added fillets. Croatian annual farmed European sea bass and gilthead sea bream production in amount of 4,000 tones plays only about 1.7% of the World production with mediocre economic benefits for producers. However, product diversification, including processing measures as filleting, vacuuming and smoked processing can ensure additional product value providing long-term strategic orientation for fish-farmers. Seabass filleting, although at the initial phase, can be a modus of value-added production, which protects the producers of the price risk volatility targeting the population averse to the long lasting traditional fish mill preparation. Applied Real Option method can be helpful tool in the situation when the strategic project value includes not just the current economic features but also opportunities related to the basic model. Option approach indicates that seabass filleting triplicate the economic performance with respect to fresh seabass production.

  6. Organochlorines in cultivated sea bass and in diet

    Energy Technology Data Exchange (ETDEWEB)

    Gil, O.; Antunes, P. [Inst. Nacional de Investigacao Agraria e das Pescas/IPIMAR, Lisboa (Portugal)

    2004-09-15

    The main source of organochlorines bioaccumulation seems to be the food and marine species are considered one of the most important sources of organochlorines for human population. Therefore, it is essential to inventory the levels of these contaminants in marine organisms and find ways to reduce these levels. Aquaculture has been developed in the past decades and sea bass (Dicentrarchus labrax) is one of the main species produced in Portugal. The levels of organochlorines of commercial formulations of diets used in fish farming can influence the concentrations of fish produced in these systems of culture. In this study eighteen polychlorinated biphenyl (PCB) congeners and p,p'-DDT compounds were quantified in cultivated sea bass from two farms and the influence of size and diet contamination in bioaccumulation of these compounds was evaluated.

  7. Energy savings in sea bass swimming in a school: measurements of tail beat frequency and oxygen consumption at different swimming speeds

    DEFF Research Database (Denmark)

    Herskin, J; Steffensen, JF

    1998-01-01

    Tail beat frequency of sea bass, Dicentrarchus labrax (L.) (23.5 ± 0·5 cm, LT), swimming at the front of a school was significantly higher than when swimming at the rear, for all water velocities tested from 14·8 to 32 cm s-1. The logarithm of oxygen consumption rate, and the tail beat frequency of...... solitary swimming sea bass (28·8 ± 0·4 cm, LT), were each correlated linearly with swimming speed, and also with one another. The tail beat frequency of individual fish was 9-14% lower when at the rear of a school than when at the front, corresponding to a 9-23% reduction in oxygen consumption rate....

  8. Discrimination of two geographically distinct populations of sea bass Dicentrarchus labrax, using stable isotopic signatures of mercury (δ202Hg, Δ199Hg)

    OpenAIRE

    Cransveld, Alice; Amouroux, David; Koutrakis, Emmanuil; Bérail, Sylvain; Caiyan, Feng; Barre, Julien P. G.; Schnitzler, Joseph; Das, Krishna

    2014-01-01

    Despite the reduction of mercury (Hg) emissions in Europe in the last decades, Hg emissions are increasing worldwide and concentrations found in some marine predators remain high. This raises questions on mercury's biogeochemical cycle at both local and global scale. In the present work, we investigate the possibility to use mercury isotopic signature in fish as a tool to discriminate different polluted areas and potential pollution sources. Indeed, Hg can exhibit both mass-dependent (MDF) an...

  9. Outcome of EPIZONE Extension ON VER/VNN: Pathogenicity study of 10 betanodavirus strains with an in vivo challenge in European sea bass (Dicentrarchus labrax)

    DEFF Research Database (Denmark)

    Vendramin, Niccolò; Toffan, A.; Cappellozza, E.;

    2012-01-01

    detected in wild fish as well as other aquatic organisms (artemia, rotifers, molluscs and crustaceans) in addition to farmed fish. The RGNNV genotype is the most widespread in the Mediterranean region, nevertheless some strains, characterized by containing genetic material belonging to both the RGNNV and......Viral encephalopathy and retinopathy (VER) otherwise known as viral nervous necrosis (VNN) is a severe pathological condition, caused by small RNA viruses belonging to the Nodaviridae family, genus Betanodavirus. The disease, which has been described in more than 45 fish species worldwide, is...... considered the most serious viral threat affecting marine farmed species in the Mediterranean region, thus representing one of the bottlenecks for further development of aquaculture industry. Epidemiological investigations carried out in different geographical areas demonstrated that Betanodavirus can be...

  10. Virulence and molecular typing of Vibrio harveyi strains isolated from cultured dentex, gilthead sea bream and European sea bass.

    Science.gov (United States)

    Pujalte, M J; Sitjà-Bobadilla, A; Macián, M C; Belloch, C; Alvarez-Pellitero, P; Pérez-Sánchez, J; Uruburu, F; Garay, E

    2003-06-01

    Vibrio harveyi was isolated from internal organs or ulcers of diseased and apparently healthy gilthead sea bream (Sparus aurata) and European sea bass (Dicentrarchus labrax) cultured in several fish farms located on the Spanish Mediterranean coast. The prevalence of the bacterium was significantly higher in European sea bass than in gilthead sea bream, and was closely related to the season in both fish species, occurring almost exclusively on warm months (June to November). After phenotypic characterization, a selection of forty five isolates from gilthead sea bream, sea bass, and several isolates previously obtained from common dentex (Dentex dentex) of the same area, were molecularly typed by automated ribotyping and random amplified polymorphic DNA (RAPD) analysis. Cluster analysis of data established 8 RAPD types and 13 ribotypes among wild isolates, and the combination of both techniques allowed to define fourteen different groups and a clear discrimination of all outbreaks and samplings. Several strains isolated from diseased gilthead sea bream and sea bass and also from asymptomatic sea bream, were tested for virulence in both fish species by intracoelomic injection. All the isolates (11) were pathogenic for sea bass, with nine out of the eleven LD50 values ranging from 1.5 x 10(5) to 1.6 x 10(6) cfu/fish. Gilthead sea bream was unaffected by the seven tested strains, even by those more virulent for sea bass, and only one strain caused a 10% mortality at 4.2 x 10(7) cfu/fish. This is the first report on virulence of V. harveyi for sea bass. PMID:12866856

  11. Fish consumption and risk of contamination by mercury – Considerations on the definition of edible parts based on the case study of European sea bass

    International Nuclear Information System (INIS)

    Highlights: ► We estimated the risk to humans trough ingestion of sea bass contaminated with Hg. ► Total and organic Hg in muscle exceeded weekly and daily safety limits. ► There’s risk through ingestion although Hg was below the maximum limit set by EU. ► The ingestion of European sea bass contaminated with Hg poses risk to human health. ► Other organs rather than muscle should be considered as edible tissue. - Abstract: In the present study, the risk to humans by consuming European sea bass (Dicentrarchus labrax), captured at three sites along a Hg contamination gradient, was evaluated by comparing muscle and kidney total Hg (T-Hg) levels with the European regulations for marketed fish. Moreover, T-Hg and organic Hg (O-Hg) levels in muscle were compared with the Provisional Tolerable Weekly Intake (PTWI) and the Reference Dose (RfD). Although T-Hg levels in muscle were below the European value allowable for marketed fish, kidney’s levels were higher than the set value, stressing the importance of redefining the concept of edible tissue and which tissues should be considered. Mercury weekly ingestion in the contaminated areas was higher than the PTWI, and O-Hg daily ingestion rates were higher than the RfD in all sampling sites. Thus, populations consuming sea bass from the contaminated sites may be at risk, with particular relevance for children and pregnant women.

  12. Gonadotropins in European sea bass: Endocrine roles and biotechnological applications.

    Science.gov (United States)

    Mazón, María José; Molés, Gregorio; Rocha, Ana; Crespo, Berta; Lan-Chow-Wing, Olivier; Espigares, Felipe; Muñoz, Iciar; Felip, Alicia; Carrillo, Manuel; Zanuy, Silvia; Gómez, Ana

    2015-09-15

    Follicle stimulating hormone (Fsh) and luteinizing hormone (Lh) are central endocrine regulators of the gonadal function in vertebrates. They act through specific receptors located in certain cell types found in the gonads. In fish, the differential roles of these hormones are being progressively elucidated due to the development of suitable tools for their study. In European sea bass (Dicentrarchus labrax), isolation of the genes coding for the gonadotropin subunits and receptors allowed in first instance to conduct expression studies. Later, to overcome the limitation of using native hormones, recombinant dimeric gonadotropins, which show different functional characteristics depending on the cell system and DNA construct, were generated. In addition, single gonadotropin beta-subunits have been produced and used as antigens for antibody production. This approach has allowed the development of detection methods for native gonadotropins, with European sea bass being one of the few species where both gonadotropins can be detected in their native form. By administering recombinant gonadotropins to gonad tissues in vitro, we were able to study their effects on steroidogenesis and intracellular pathways. Their administration in vivo has also been tested for use in basic studies and as a biotechnological approach for hormone therapy and assisted reproduction strategies. In addition to the production of recombinant hormones, gene-based therapies using somatic gene transfer have been offered as an alternative. This approach has been tested in sea bass for gonadotropin delivery in vivo. The hormones produced by the genes injected were functional and have allowed studies on the action of gonadotropins in spermatogenesis. PMID:26002037

  13. ANÁLISIS DE LA SITUACIÓN ECONÓMICA-FINANCIERA DEL SECTOR PRODUCTOR DE LA DORADA (Sparus aurata L.), LUBINA (Dicentrarchus labrax L.) Y CORVINA (Argyrosomus regius A.), EN EL LITORAL MEDITERRANEO ESPAÑOL

    OpenAIRE

    BENITO ALAS, FERNANDO

    2016-01-01

    [EN] The state of the Spanish aquaculture Sea bream, Sea bass and Meagre produced in fish farms in the Spanish Mediterranean coast is analyzed setting as objective the analysis of the economical and financial situation of companies in the sector to characterize the successful companies. For this project a study was made during the period from 2002 to 2011, on the period before the economical crisis (2002-2007) and also during the crisis (2007-2011), to interpret the evolution of the compa...

  14. [Cloning, physical and chemical property analysis of the Japanese sea bass Wap65-2 gene and its expression following Vibrio harveyi infection].

    Science.gov (United States)

    Shi, Yu-Hong; Chen, Jiong; Gao, Shan-Shan; Shen, Guang-Qiang; Lu, Xin-Jiang; Li, Ming-Yun

    2012-10-01

    The warm temperature acclimation related 65 kDa protein-2 (Wap65-2), a teleost plasma glycoprotein, plays an important role in immune regulation against bacterial infection. Here, for the first time we determined the full length cDNA sequence of the Japanese sea bass Wap65-2 gene (1 601 bp in length excluding the 3'-polyA tail). The sequence contains an open reading frame that encodes a protein of 436 amino acids with a molecular weight of 4.87×10(4). The predicted protein had a signal peptide in the N-terminal domain containing 19 residues. Sequence comparison and phylogenetic tree analysis showed that the Japanese sea bass Wap65-2 has a relatively high similarity to the Dicentrarchus labrax Wap65-2. In the healthy Japanese sea bass, Wap65-2 mRNA was expressed mainly in the liver and weakly in the heart and muscle. qRT-PCR results revealed that liver Wap65-2 transcripts were significantly increased after a Vibrio harveyi infection, and peaked 24 hour post injection (6.89 fold increase). The Japanese sea bass Wap65-2 protein was expressed in Escherichia coli and subsequently used for antiserum preparation. Western blot analysis showed that Wap65-2 was significantly increased in V. harveyi infected Japanese sea bass and reached a maximum of 5.33-fold increase at 36 h. In conclusion, the alteration of Japanese sea bass Wap65-2 expression was tightly associated with the progression of the V. harveyi bacterial infection. PMID:23019029

  15. Tenacibaculum dicentrarchi sp. nov., a marine bacterium of the family Flavobacteriaceae isolated from European sea bass.

    Science.gov (United States)

    Piñeiro-Vidal, Maximino; Gijón, Daniel; Zarza, Carles; Santos, Ysabel

    2012-02-01

    A novel Gram-stain-negative rod-shaped gliding bacterial strain, designated 35/09(T), was isolated from diseased European sea bass (Dicentrarchus labrax L.) in Spain. Colonies were pale-yellow-pigmented with uneven edges and did not adhere to the agar. The DNA G+C content of the isolate was 31.3 mol%. 16S rRNA gene sequence analysis indicated affiliation to the genus Tenacibaculum (family Flavobacteriaceae, phylum 'Bacteroidetes'). Sequence similarities between the isolate and type strains of other members of the genus were 93.1-97.3 %. The major fatty acids (>5 % of the total fatty acids) were iso-C(15 : 0) (24.8 %), iso-C(15 : 0) 3-OH (18.0 %), anteiso-C(15 : 0) (8.1 %), C(15 : 1)ω6c (6.9 %) and iso-C(15 : 1) (6.2 %). Genotypic and phenotypic data indicate that strain 35/09(T) should be classified as a representative of a novel species in the genus Tenacibaculum, for which the name Tenacibaculum dicentrarchi sp. nov. is proposed; the type strain is 35/09(T) ( = CECT 7612(T) = NCIMB 14598(T)). PMID:21460137

  16. A standard experimental diet for the study of fatty acid requirements of weaning and first ongrowing stages of European sea bass (Dicentrarchus labrax L.): selection of the basal diet

    OpenAIRE

    Coutteau, P.; G. Van Stappen; Sorgeloos, P.

    1995-01-01

    A standard experimental diet was developed to study lipid nutrition in marine fish larvae during weaning and first ongrowing. Basal diets were prepared by extrusion-cooking, crumbling of the pellets, and sieving to obtain particles in the size ranges 150-300 µm and 300-500 µm. Three protein sources in the extruded basal diet were evaluated: (1) micronized cod protein granulate (COD); (2) a mixture of casein, gelatin, and albumin (CGA); (3) a mixture of cod fish meal, whey protein, soybean pro...

  17. Sensitive periods for 17β-estradiol exposure during immune system development in sea bass head kidney.

    Science.gov (United States)

    Seemann, Frauke; Knigge, Thomas; Duflot, Aurélie; Marie, Sabine; Olivier, Stéphanie; Minier, Christophe; Monsinjon, Tiphaine

    2016-06-01

    An increasing body of evidence suggests that sex steroids play an important role in the development and regulation of vertebrate immune defense. Therefore, compounds with estrogenic activity may influence the immune system via receptor-mediated pathways. The presence of estrogen receptors in immune cells and organs during the early stages of development may indicate that female steroid hormones are involved in the maturation of the fish immune system. This is of particular importance, as some marine fish are probably exposed to sources of exogenous estrogens while they reside in their estuarine nursery grounds. In this study, the influence of 17β-estradiol (E2) on estrogen receptor and cytokine gene expression was assessed in juvenile sea bass (Dicentrarchus labrax) together with characterization of the head kidney leukocyte populations and corresponding phagocytic activity during organ regionalization from 98 to 239 dph. E2 exposure, beginning at 90 dph resulted in indirect and delayed modifications of interleukin 1β and estrogen receptor α gene expression, which may affect B-lymphocyte proliferation in the sea bass head kidney. The E2 treatment of 120 dph fish led to an increase in estrogen receptor β2 and a decrease in transforming growth factor β1 gene expression, which coincided with decreased phagocytic activity of head kidney lymphocytes and monocytes/macrophages. Additionally, these changes were observed during developmental periods described as critical phases for B-lymphocyte development in mammals. Consequently, exogenous estrogens have the potential to modify the innate immune response in juvenile sea bass and to exert detrimental effects on head kidney development. Copyright © 2015 John Wiley & Sons, Ltd. PMID:26278277

  18. Drospirenone intake alters plasmatic steroid levels and cyp17a1 expression in gonads of juvenile sea bass.

    Science.gov (United States)

    Blanco, Maria; Fernandes, Denise; Medina, Paula; Blázquez, Mercedes; Porte, Cinta

    2016-06-01

    Drospirenone (DRO) is one of the most widely used progestins in contraceptive treatments and hormone replacement therapies. The pharmacokinetics and potential toxicological effects of DRO were investigated in juvenile sea bass (Dicentrarchus labrax) exposed through the diet (0.01-10 μg DRO/g) for up to 31 days. DRO was detected in the blood (4-27 ng/mL) of fish exposed to the highest concentration, with no significant bioaccumulation over time and no alteration of hepatic metabolizing enzymes, namely, CYP1A and CYP3A-catalysed activities and UDP-glucuronyltransferase (UGT). Pregnenolone (P5), progesterone (P4), 17α-hydroxyprogesterone (17P4), 17α-hydroxypregnenolone (17P5), androstenedione (AD) and testosterone (T) were determined in plasma and gene expression of cyp17a1, cyp19a1a and cyp11β analysed by qRT-PCR in gonads. The significant increase in plasmatic levels of 17P5, 17P4 and AD detected after 31 days exposure to 10 ng DRO/g together with the increased expression of cyp17a1 in females evidence the ability of DRO to alter steroid synthesis at low intake concentrations (7 ng DRO/day). However, the potential consequences of this steroid shift for female reproduction remain to be investigated. PMID:26995450

  19. Nodavirus Colonizes and Replicates in the Testis of Gilthead Seabream and European Sea Bass Modulating Its Immune and Reproductive Functions

    Science.gov (United States)

    Valero, Yulema; Arizcun, Marta; Esteban, M. Ángeles; Bandín, Isabel; Olveira, José G.; Patel, Sonal; Cuesta, Alberto; Chaves-Pozo, Elena

    2015-01-01

    Viruses are threatening pathogens for fish aquaculture. Some of them are transmitted through gonad fluids or gametes as occurs with nervous necrosis virus (NNV). In order to be transmitted through the gonad, the virus should colonize and replicate inside some cell types of this tissue and avoid the subsequent immune response locally. However, whether NNV colonizes the gonad, the cell types that are infected, and how the immune response in the gonad is regulated has never been studied. We have demonstrated for the first time the presence and localization of NNV into the testis after an experimental infection in the European sea bass (Dicentrarchus labrax), and in the gilthead seabream (Sparus aurata), a very susceptible and an asymptomatic host fish species, respectively. Thus, we localized in the testis viral RNA in both species using in situ PCR and viral proteins in gilthead seabream by immunohistochemistry, suggesting that males might also transmit the virus. In addition, we were able to isolate infective particles from the testis of both species demonstrating that NNV colonizes and replicates into the testis of both species. Blood contamination of the tissues sampled was discarded by completely fish bleeding, furthermore the in situ PCR and immunocytochemistry techniques never showed staining in blood vessels or cells. Moreover, we also determined how the immune and reproductive functions are affected comparing the effects in the testis with those found in the brain, the main target tissue of the virus. Interestingly, NNV triggered the immune response in the European sea bass but not in the gilthead seabream testis. Regarding reproductive functions, NNV infection alters 17β-estradiol and 11-ketotestosterone production and the potential sensitivity of brain and testis to these hormones, whereas there is no disruption of testicular functions according to several reproductive parameters. Moreover, we have also studied the NNV infection of the testis in vitro to

  20. Seven bass drawing, Highlanders

    OpenAIRE

    Helmlinger, Aurélie

    2011-01-01

    Seven bass drawing, Highlanders panyard, Cor. EMR William sts, Success Village, Laventille( erreur dans le nom de fichier : " highlanders_nine_bass_drawing_1" ; nom correct ="highlanders_seven_bass_drawing_1 " )

  1. Effects of dietary carbohydrate on hepatic de novo lipogenesis in European seabass (Dicentrarchus labrax L.).

    Science.gov (United States)

    Viegas, Ivan; Jarak, Ivana; Rito, João; Carvalho, Rui A; Metón, Isidoro; Pardal, Miguel A; Baanante, Isabel V; Jones, John G

    2016-07-01

    Farmed seabass have higher adiposity than their wild counterparts and this is often attributed to carbohydrate (CHO) feeding. Whether this reflects a reduction in fat oxidation, increased de novo lipogenesis (DNL), or both, is not known. To study the effects of high CHO diets on hepatic TG biosynthesis, hepatic TG deuterium ((2)H) enrichment was determined following 6 days in (2)H-enriched tank water for fish fed with a no-CHO control diet (CTRL), and diets with digestible starch (DS) and raw starch (RS). Hepatic fractional synthetic rates (FSRs, percent per day(-1)) were calculated for hepatic TG-glyceryl and FA moieties through (2)H NMR analysis. Glyceryl FSRs exceeded FA FSRs in all cases, indicating active cycling. DS fish did not show increased lipogenic potential compared to CTRL. RS fish had lower glyceryl FSRs compared with the other diets and negligible levels of FA FSRs despite similar hepatic TG levels to CTRL. DS-fed fish showed higher activity for enzymes that can provide NADPH for lipogenesis, relative to CTRL in the case of glucose-6-phosphate dehydrogenase (G6PDH) and relative to RS for both G6PDH and 6-phosphogluconate dehydrogenase. This approach indicated that elevated hepatic adiposity from DS feeding was not attributable to increased DNL. PMID:27247346

  2. Effects of oleic acid on the high threshold barium current in seabass Dicentrarchus labrax ventricular myocytes

    OpenAIRE

    Chatelier, Aurelien; Imbert, Nathalie; Zambonino, Jose-luis; McKenzie, David; Bois, P.

    2006-01-01

    The present study employed a patch clamp technique in isolated seabass ventricular myocytes to investigate the hypothesis that oleic acid (OA), a mono-unsaturated fatty acid, can exert direct effects upon whole-cell barium currents. Acute application of free OA caused a dose-dependent depression of the whole-cell barium current that was evoked by a voltage step to 0 mV from a holding potential of -80 mV. The derived 50% inhibitory concentration (IC50) was 12.49 +/- 0.27 mu mol l(-1). At a con...

  3. Effects of rearing density on seabass (Dicentrarchus labrax, L. gene expression

    Directory of Open Access Journals (Sweden)

    M. Saroglia

    2011-03-01

    Full Text Available Animal welfare involves the subjective feeling of animals and the experience of pleasure, pain, frustration, hunger or other states and it is therefore difficult to define and to measure (Drawkins, 1990. When water quality criteria are respected and feeding restrictions are avoided, fish density may become one of the more relevant factors expected to potentially affect fish welfare. Such high density environment, may lead to a fish conditions that cannot be described or forecast simply with measurement of hematological responses (Roche and Bogé, 1996, in the same time, detection of zootechnical performances, do not provide a specific indications...

  4. Hierarchical Bass model

    CERN Document Server

    Tashiro, Tohru

    2013-01-01

    We propose a new model about diffusion of a product which includes a memory of how many adopters or advertisements a non-adopter met, where (non-)adopters mean people (not) possessing the product. This effect is lacking in the Bass model. As an application, we utilize the model to fit the iPod sales data, and so the better agreement is obtained than the Bass model.

  5. Hierarchical Bass model

    Science.gov (United States)

    Tashiro, Tohru

    2014-03-01

    We propose a new model about diffusion of a product which includes a memory of how many adopters or advertisements a non-adopter met, where (non-)adopters mean people (not) possessing the product. This effect is lacking in the Bass model. As an application, we utilize the model to fit the iPod sales data, and so the better agreement is obtained than the Bass model.

  6. Hierarchical Bass model

    International Nuclear Information System (INIS)

    We propose a new model about diffusion of a product which includes a memory of how many adopters or advertisements a non-adopter met, where (non-)adopters mean people (not) possessing the product. This effect is lacking in the Bass model. As an application, we utilize the model to fit the iPod sales data, and so the better agreement is obtained than the Bass model

  7. Estudio de la respuesta inmune de la lubina Dicentrarchus labrax L. frente a mixosporidios parásitos

    OpenAIRE

    Muñoz Ruiz, Pilar

    2000-01-01

    Los objetivos de esta tesis eran realizar la caracterización antigénica de Sphaerospora dicentrarchi, un mixosporidio de las lubinas; analizar la presencia de carbohidratos en éste y otros mixosporidios; estudiar la modulación in vitro de la actividad de los leucocitos de la lubina por el parásito; y estudiar el efecto de la inmunización de lubinas con esporas de S. dicentrarchi. Los resultados demostraron la existencia de bandas en los extractos antigénicos de S. dicentrarchi con pesos molec...

  8. Sources of blood glucose and liver glycogen in the seabass (Dicentrarchus labrax L.): implications to carbohydrate metabolism in fish

    OpenAIRE

    Viegas, Ivan Daniel dos Santos Martins

    2012-01-01

    The Varian VNMRS 600 MHz spectrometer is supported by the National NMR Network (PTNMR) and was purchased in the framework of the National Programme for Scientific Re-equipment, contract REDE/1517/RMN/2005, with funds from POCI 2010, Fundo Europeu de Desenvolvimento Regional and Fundação para a Ciência e Tecnologia

  9. Live food mediated vitamin C transfer to Dicentrarchus labraxand Clarias gariepinus

    OpenAIRE

    Merchie, G.; Lavens, P.; Dhert, Ph.; Pector, R.; Mai Soni, A.F.; Nelis, H.; Ollevier, F.P.; De leenheer, A P; Sorgeloos, P.

    1995-01-01

    Live food enrichment techniques, using formulated diets and emulsions for improving the nutritional quality of Brachionus and Artemia , were studied as a tool for transferring ascorbic acid (AA) to fish larvae. Artemia nauplii enriched for 24h with an experimental emulsion containing 20% HUFA and 0%, 10% and 20% ascorbyl palmitate (AP) were administered to catfish larvae in a 20-day feeding trial. Survival was not affected by the dietary AA, but from day 7 onwards a significantly positive eff...

  10. The Flexible Bass Absorber

    DEFF Research Database (Denmark)

    Adelman-Larsen, Niels Werner; Thompson, Eric Robert; Gade, Anders Christian

    2007-01-01

    Multi-purpose concert halls face a dilemma. They host different performance types that require significantly different acoustic conditions in order to provide the best sound quality to both the performers, sound engineers and the audience. Pop and rock music often contain high levels of bass sound...

  11. The Flexible Bass Absorber

    DEFF Research Database (Denmark)

    Adelman-Larsen, Niels Werner; Thompson, Eric Robert; Gade, Anders Christian

    2007-01-01

    Multi-purpose concert halls face a dilemma. They host different performance types that require significantly different acoustic conditions in order to provide the best sound quality to both the performers, sound engineers and the audience. Pop and rock music often contains high levels of bass sound...

  12. Tenor bass, dr02, Central Symphony

    OpenAIRE

    Helmlinger, Aurélie

    2011-01-01

    Tenor bass, dr02, augmented, Central Symphony Steel Orchestra panyard, Government House road, Tobago( erreur dans le nom de fichier : "central_symphony_steel_tenor_bass_1_dr02" ; nom correct ="central_symphony_tenor_bass_1_dr02 " )

  13. Nine bass drawing, Tropical Angel Harps

    OpenAIRE

    Helmlinger, Aurélie

    2011-01-01

    Nine bass drawing, one tone per drum, Tropical Angel Harps panyard, Southern Main Rd, Enterprise, Chaguanas (erreur sur le nom de fichier : " claytones_nine_bass_drawing_1" ; nom correct = " tropical_angel_harps_nine_bass_drawing_1")

  14. Seven bass drawing, Tropical Angel Harps

    OpenAIRE

    Helmlinger, Aurélie

    2011-01-01

    Seven bass drawing, whole tone style, Tropical Angel Harps panyard, Southern Main Rd, Enterprise, Chaguanas (erreur sur le nom de fichier : " claytones_seven_bass_drawing_1" ; nom correct = " topical_angel_harps_seven_bass_drawing_1")

  15. Some Model Theoretic Remarks on Bass Modules

    OpenAIRE

    E. Momtahan

    2011-01-01

    We study Bass modules, Bass rings, and related concepts from a model theoretic point of view. We observe that the class of Bass modules (over a fixed ring) is not stable under elementary equivalence. We observe that under which conditions the class of Bass rings are stable under elementary equivalence.

  16. Update on Fish Disease Situation in Italy

    OpenAIRE

    Vendramin, Niccolò; Toffan, A.

    2012-01-01

    In this presentation we provide a general overview of the aquatic animal health issues related to the aquaculture sector and wild environment in Italy in 2011.Considering saltwater species European sea bass (Dicentrarchus labrax) and Gilthead sea bream (Sparus aurata) are still the most widely farmed species, nevertheless some “new” candidates are employed often.The first two species represents more than 95% of the total production while the remaining is obtained by different promising candid...

  17. PHYTOPLANKTON ASSEMBLAGES AT FISH FARM IN MASLINOVA BAY (THE ISLAND OF BRAČ)

    OpenAIRE

    Sanda Skejić; Živana Ninčević Gladan; Ivona Marasović

    2012-01-01

    The aim of this study was to establish phytoplankton composition at the sea bream (Sparus aurata) and sea bass (Dicentrarchus labrax) fish farm in the middle Adriatic Sea. The investigation was performed from September 2005 to September 2006 at a station located in Maslinova Bay at the island of Brač. Considering the whole research period, diatoms generally prevailed in terms of abundance while dinoflagellates were particularly abundant in June. Number of species of diatoms in comparison to d...

  18. Caractérisation de l'adaptation comportementale des téléostéens en élevage : plasticité et effets de la domestication

    OpenAIRE

    Benhaïm, David

    2011-01-01

    The present work aims at a better understanding of the adaptation to farming conditions through a behavioural approach based on the comparison between wild vs. domesticated populations of three species: a marine species, sea bass (Dicentrarchus labrax), two freshwater species, arctic charr (Salvelinus alpinus) and brown trout (Salmo trutta). The thesis is divided into two parts which objectives were : 1) to test the impact of biotic and abiotic factors selected based on their importance in aq...

  19. MERAMOD - predicting the deposition and benthic impact of aquaculture in the Eastern Mediterranean

    OpenAIRE

    Cromey, C.J.; Thetmeyer, Helmut; Lampadariou, N.; Black, K.D.; Kögeler, J.; Karakassis, I.

    2012-01-01

    A model, composed of coupled particle tracking and benthic response modules, for predicting waste solids flux and benthic impacts of gilthead sea bream (Sparus aurata L.) and sea bass (Dicentrarchus labrax L.) aquaculture, was tested at six sites with different hydrodynamics, bathymetries and biomasses in the Aegean and Ionian Seas, Eastern Mediterranean with observations of sediment trap flux and benthic impact indicators. Seven sediment trap validation studies were conducted that varied in ...

  20. Utilization of desalinated b rackish water resi dues for cultivation of the m a rine fish species, Dicentrarchus labra x, Sparus aurata, and Sciaenops ocellatus

    Directory of Open Access Journals (Sweden)

    Mutaz A. Al - Qutob

    2013-05-01

    Full Text Available The utilization of brackish water residues from desalination units for fish mariculture inPalestine could represent an environmental friendly alternative of disposing brine water which could havean adverse effect on wild life. In this study, three juvenile marine fish species (Gilt-head bream S. aurata, European sea bass D. labrax, and red drum S. ocellatus with average weights of 0.7-4.9 g, wereacclimated and reared in brine brackish water residues collected from Jericho desalination units withsalinities of 6.5 ‰ and 11 ‰ diluted sea water as control for 3-7 months. Fish were fed 56 % richprotein diet. Brine brackish water contained high levels of CL-1 (3369 mgL-1, Na+1(3735 mgL-1, K+1(300mgL-1, SO4 -2 (716 mgL-1 with the divalent ions Mg+2 (57.3 mgL-1 and Ca+2 (276 mgL-1.Theexperimental well showed more than the maximum allowable concentration of Cr (14.49 μgL-1, Ag (5.3μgL-1 and Mn (27.88 μgL-1 for water quality of fisheries use. The sea bass with an average weight of0.76 g (at a salinity of 6.5 ‰ showed an acceptable growth performance parameters and reached apercentage weight gain (% WG of 6345.23 % and a survival rate of 77.5 % compared to control groupsat 11 ‰ that reached at the same time a % WG of 6543.78 % and a survival rate of 82 % after 30weeks. The red drum juveniles reached a % WG of 2661.6 % and 2673.92 % after 15 weeks at 6.5 ‰and 11 ‰ respectively while sea bream reached a % WG of 241.63 % and 772.44 % after 15 weeks at6.5 ‰ and 11 ‰ respectively. Survival rate was only 5 % at both salinities for the two species. In afurther study sea bass fingerlings with an average weight of 20.5 g were reared in brackish water of 6.5‰ salinity for 7 weeks and were fed superior fish meal with fish oil. They received diets of 2.1 %, 3.0%, and 4.0 % of body weight. Sea bass fingerlings which received diets of 2.1 %, had the highest FCE(0.82 and PER (1.46 with the lowest FCR (1.22. These results confirm that the most

  1. Growth performance of sea bass fed increasing levels of pea-wheat protein in diets varying in fish meal quality

    Directory of Open Access Journals (Sweden)

    E. Tibaldi

    2010-04-01

    Full Text Available A 11-week trial was carried out to compare the growth performance of sea bass (D. labrax fed six isonitrogenous isocaloric diets where protein from two fish meals of different nutritive value was replaced with graded levels (0, 50 or 75% of a mixture made up by a pea protein concentrate and wheat gluten. Fish meal quality did not affect (P>0.05 weight gain or feed efficiency in fish fed graded levels of plant protein in the diet. Feed intake decreased (P<0.05 as the level of plant protein was increased in the diet but this did not led to impaired growth or feed conversion rate. Protein efficiency and retention were equally improved (P<0.05 only with diets where a poor quality fish meal was substituted by protein rich-plant ingredients. Calculations based on the mass balance of nutrients of sea bass proven the inclusion of a mixture of highly purified plant-protein derivatives in complete diets for the sea bass, to be beneficial in reducing pollution load.

  2. BASS Code Development

    Science.gov (United States)

    Sawyer, Scott

    2004-01-01

    The BASS computational aeroacoustic code solves the fully nonlinear Euler equations in the time domain in two-dimensions. The acoustic response of the stator is determined simultaneously for the first three harmonics of the convected vortical gust of the rotor. The spatial mode generation, propagation and decay characteristics are predicted by assuming the acoustic field away from the stator can be represented as a uniform flow with small harmonic perturbations superimposed. The computed field is then decomposed using a joint temporal-spatial transform to determine the wave amplitudes as a function of rotor harmonic and spatial mode order. This report details the following technical aspects of the computations and analysis. 1) the BASS computational technique; 2) the application of periodic time shifted boundary conditions; 3) the linear theory aspects unique to rotor-stator interactions; and 4) the joint spatial-temporal transform. The computational results presented herein are twofold. In each case, the acoustic response of the stator is determined simultaneously for the first three harmonics of the convected vortical gust of the rotor. The fan under consideration here like modern fans is cut-off at +, and propagating acoustic waves are only expected at 2BPF and 3BPF. In the first case, the computations showed excellent agreement with linear theory predictions. The frequency and spatial mode order of acoustic field was computed and found consistent with linear theory. Further, the propagation of the generated modes was also correctly predicted. The upstream going waves propagated from the domain without reflection from the in ow boundary. However, reflections from the out ow boundary were noticed. The amplitude of the reflected wave was approximately 5% of the incident wave. The second set of computations were used to determine the influence of steady loading on the generated noise. Toward this end, the acoustic response was determined with three steady loading

  3. Why the Bass Model Fits without Decision Variables

    OpenAIRE

    Frank M. Bass; Trichy V. Krishnan; Dipak C. Jain

    1994-01-01

    Over a large number of new products and technological innovations, the Bass diffusion model (Bass 1969) describes the empirical adoption curve quite well. In this study, we generalize the Bass model to include decision variables such as price and advertising. The generalized model reduces to the Bass model as a special case and explains why the Bass model works so well without including decision variables. We compare our generalized Bass model to other approaches from the literature for inclu...

  4. Sound Generating Mechanism of the Double Bass

    Directory of Open Access Journals (Sweden)

    F. Pantelić

    2013-11-01

    Full Text Available This paper deals with the mechanical properties of the double bass and double bass bow. The sound of the instrument, as well as the vibrations of the bow, were recorded while playing. The sound was recorded with a microphone, while a sensor, placed on the bow’s stick, registered its vibrations. By observing these signals, from double bass and bow, the correlation between them was determined in order to explain the bow-string mechanism.

  5. Chronic stress impairs performance, energy metabolism and welfare indicators in European seabass (Dicentrarchus labrax): The combined effects of fish crowding and water quality deterioration

    NARCIS (Netherlands)

    Santos, G.A.; Schrama, J.W.; Mamauag, R.E.P.; Rombout, J.H.W.M.; Verreth, J.A.J.

    2010-01-01

    Rearing fish at high densities may act as a chronic stressor leading to a reduced performance. We hypothesise that this is due to an increase in energy requirements for maintenance and altered energy partitioning. To test this hypothesis, European seabass (mean initial weight 82.1 g) were stocked at

  6. Growth and nitrogen metabolism of sea bass fed graded levels of nucleic acid nitrogen from yeast or RNA extract as partial substitute for protein nitrogen from fish meal

    Directory of Open Access Journals (Sweden)

    S. Kaushik

    2010-01-01

    Full Text Available Some studies carried out in mammalian models have shown de novo synthesis and salvage of nucleotides to be a costly metabolic process and a dietary supplementation with nucleic acids (NA or nucleotides has been suggested to result in a protein sparing action (Sanderson and He, 1994. On the other hand, high levels of dietary NA could have toxic effects and lead to disturbance in protein, lipid and carbohydrate metabolism in monogastric animals lacking uricase activity, an enzyme involved in NA degradation (Clifford and Story, 1976. So far, there is no clear indication of such effects in fish fed nucleic acid-enriched diets (Tacon and Cooke, 1980; Rumsey et al., 1992; Fournier et al., 2002. The aim of this experiment was to investigate growth response and N metabolism in juvenile sea bass (D. labrax fed diets supplying graded levels of nucleic acid N from dry brewer's yeast or RNA extract as partial substitutes for protein nitrogen provided by fish meal.

  7. 33 CFR 117.703 - Bass River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bass River. 117.703 Section 117.703 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.703 Bass River. The draw of the U.S. 9...

  8. 33 CFR 117.588 - Bass River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bass River. 117.588 Section 117.588 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.588 Bass River. The Hall Whitaker...

  9. Cage culture of sea bass in Malaysia

    OpenAIRE

    1994-01-01

    The article discusses the cage culture practice of sea bass (Lates calcarifer) in Malaysia. Problems on feed and seed supply and overcrowding are also discussed. Despite these problems, seabass cage culture still continuously booms.

  10. Bass Strait underpins Aussie oil flow

    International Nuclear Information System (INIS)

    This paper reports that the Bass Strait region off Australia's southern coast is expected to remain the mainstay of the country's oil production in the near term. Government and industry see Australia's western offshore areas as the key to maintaining the country's level of oil self-sufficiency at an acceptable level beyond 2000. But Bass Strait oil flow, in decline since 1985, at about 300,000 b/d still provides more than half of Australia's current production. Bass Strait operators have a healthy program of exploration and development on tap in the near term. Chief focus will be in the Gippsland basin, off Victoria's southeast coast, which currently provides most Bass Strait oil and gas production

  11. Intersex fish : Endocrine disruption in smallmouth bass

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Intersex and abnormal vitellogenin in smallmouth bass from portions of the Potomac watershed pose a threat to fish resources. This fact sheet summarizes studies...

  12. Stock characteristics of Hudson River striped bass

    International Nuclear Information System (INIS)

    Striped bass, because of their tremendous popularity both commercially and recreationally, were a principal focus of the Hudson River power plant case. Between 1976 and 1979, over 23,000 age-II and older striped bass were studied as one facet of an extensive research program on the spring population in the Hudson River. Samples were collected from the overwintering as well as the spawning portion of the striped bass population, and included immature as well as mature fish. At least 12 age-groups contributed to spawning each year. Of these 12, age-groups III, IV, and V usually were most abundant, but the percentage of the population represented by any single age-group varied as the result of fluctuations in year-class strength. Males first became sexually mature at age II and females at age IV. Fast-growing individuals within a year class tended to mature earlier. Fecundity increased with the size of fish, reaching an observed maximum of about 3 million eggs per female. Although significant annual variations in maturity and growth were detected for Hudson River striped bass, there was no evidence of a consistent change in either variable that might be associated with increasing power plant operations and a reduction in striped bass abundance. Age at maturity and age structure are the two life history components that differ the most between the Hudson River population and other striped bass populations. 36 refs., 7 tabs

  13. Influencia de la luz y los patrones de alimentación sobre el reloj molecular, fisiología digestiva y comportamiento de dos peces teleósteos : lubina (Dicentrarchus labrax) y pez cebra (Danio rerio)= Influence of light and feeding patterns on the molecular clock, digestive physiology and behaviour of two teleost fishes: seabass (Dicentrarchus labrax) and zebrafish (Danio rerio).

    OpenAIRE

    Pozo Cano, Ana del

    2013-01-01

    La luz y los patrones de alimentación influyeron sobre el comportamiento, fisiología y reloj molecular de dos peces teleósteos. Se clonaron dos criptocromos de lubina (cry1 y cry2), expresándose en todos los tejidos estudiados y mostrando ritmos diarios de expresión en cerebro, hígado y corazón (excepto cry2). La fase (día/noche) de alimentación a demanda en lubina afecta a los patrones diarios de actividad amilasa intestinal y expresión de period1 en tejidos periféricos (i.e. hígado), pero n...

  14. Rumble in the Jungle: City, Place and Uncanny Bass

    OpenAIRE

    Chris Christodoulou

    2011-01-01

    While bass powerfully resonates among the cultural discourses, lexicology and commercial marketing of a range of electronic dance music (EDM) styles, little popular music scholarship has paid attention to the subjective, phenomenological and psycho-physiological significance of bass in its modulation of intense feelings of pleasure. This article examines the linking in jungle/drum 'n' bass culture of bass as a sonic space that produces a powerful sense of jouissance where identity can ...

  15. 76 FR 14804 - Drawbridge Operation Regulations; Bass River, Beverly, MA

    Science.gov (United States)

    2011-03-18

    ... SECURITY Coast Guard 33 CFR Part 117 Drawbridge Operation Regulations; Bass River, Beverly, MA AGENCY... the Hall Whitaker Bridge at mile 0.6 across the Bass River ] at Beverly, Massachusetts. The deviation.... SUPPLEMENTARY INFORMATION: The Hall Whitaker Bridge, across the Bass River at Beverly, Massachusetts, has...

  16. PHYTOPLANKTON COMPOSITION AT THE FISH AND SHELLFISH FARM IN THE KALDONTA BAY (CRES ISLAND)

    OpenAIRE

    Marija Tomec

    2004-01-01

    The Kaldonta Bay is situated at the south–western coast of the Cres island in the Lošinj channel, rather protected from larger influence of general sea water current. In the Bay there are installed 44 floating cages of 5 by 10 m dimensions. The cages are used for the culture of about 70 tons of sea water fish: gilthead sea bream (Sparus aurata), sea bass (Dicentrarchus labrax), sharp–snouted sparus (Diplodus puntazzo) and dentex (Dentex dentex). Besides some physico–chemical parameters (sea w...

  17. 3D Morphology, Ultrastructure and Development of Ceratomyxa puntazzi Stages: First Insights into the Mechanisms of Motility and Budding in the Myxozoa

    Czech Academy of Sciences Publication Activity Database

    Alama-Bermejo, G.; Bron, J. E.; Raga, J. A.; Holzer, Astrid S.

    2012-01-01

    Roč. 7, č. 2 (2012), e32679. E-ISSN 1932-6203 Institutional support: RVO:60077344 Keywords : ELECTRON-MICROSCOPIC DESCRIPTION * BREAM SPARUS-AURATA * N-SP MYXOSPOREA * HOST-PARASITE RELATIONSHIP * DICENTRARCHUS-LABRAX L * CULTURED SEA BASS * TETRACAPSULOIDES-BRYOSALMONAE * DIPLODUS-PUNTAZZO * ENTERIC PARASITE * ACTIN DYNAMICS Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.730, year: 2012 http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0032679

  18. Update on Fish Disease Situation in Italy

    DEFF Research Database (Denmark)

    Vendramin, Niccolò; Toffan, A.

    2012-01-01

    In this presentation we provide a general overview of the aquatic animal health issues related to the aquaculture sector and wild environment in Italy in 2011. Considering saltwater species European sea bass (Dicentrarchus labrax) and Gilthead sea bream (Sparus aurata) are still the most widely...... Amyloodinium ocellatum) and gill flukes (Diplectanum aequans and Sparicotyle chrysophrii) mainly present in inland farms (earth ponds and concrete tanks based); isopods crustacea (Ceratotoa, Anylocra) and Enteromyxidiosis (Enteromyxum leei) represent a treat for offshore cages. Among the dismetabolic unknown...

  19. Hyperparasitism of trichodinid ciliates on monogenean gill flukes of two marine fish.

    Science.gov (United States)

    Colorni, A; Diamant, A

    2005-06-01

    Two unusual cases of hyperparasitism of trichodinid ciliates on monogenean gill flukes are described from southern Israel (Red Sea). The first case occurred in cultured European sea bass Dicentrarchus labrax infected by Diplectanum aequans, while the second was observed in a feral devil firefish Pterois miles infected by Haliotrema sp. In both cases, the trichodinids heavily co-infested the host fish gills. The flukes were completely coated by the ciliates, which gave them a cobblestone appearance, but no damage to their tegument was apparent. Both cases are most likely a result of accidental hyperparasitism, brought about by perturbed environmental conditions. PMID:16060271

  20. The fundamental thermal niche of adult landlocked striped bass

    Science.gov (United States)

    Bettoli, P.W.

    2005-01-01

    Researchers have described the temperatures selected by landlocked striped bass Morone saxatilis in different locales throughout the USA. However, seasonally low concentrations of dissolved oxygen (DO) in many systems prevented striped bass from using the cool waters (niche of adult landlocked striped bass may be lower than literature estimates. These results also represent the first unbiased field estimates of the influence of season on the thermal ecology of adult striped bass. The thermal characteristics of habitats considered optimal in habitat suitability index models for adult landlocked striped bass (i.e., 18-24??C) should be revised to include cooler waters. ?? Copyright by the American Fisheries Society 2005.

  1. Feed training of peacock bass (Cichla sp.)

    OpenAIRE

    M.A.M Moura; KUBITZA F.; CYRINO J. E. P.

    2000-01-01

    The Amazonian cichlid peacock bass (Cichla sp.) is a highly marketable food and sport fish, therefore a suitable species for aquaculture. However, because of its piscivorous feeding preferences, the species does not accept dry feeds voluntarily, turning its intensive culture difficult and costly. This study aimed to wean fingerling peacock bass from inert moist food to dry diets. In a first experiment, 1,134 fingerlings weighting 0.27 g were divided in two 0.37 m³ hapas and fed ground fish fl...

  2. Benzocaine as an anesthetic for striped bass

    Science.gov (United States)

    Gilderhus, Philip A.; Lemm, Carol A.; Woods, L. Curry, III

    1991-01-01

    Benzocaine was tested as an anesthetic on juvenile and mature adult striped bass (Morone saxatilis ). Concentrations of 55 mg/L at 22 degree C to 80 mg/L at 11 degree C effectively anesthetized fish in about 3 min. Recovery was more rapid as temperature increased. Fish survived concentrations of twice the effective concentration and exposure times up to 60 min at the effective concentration. Striped bass required higher concentrations for anesthetization than had been previously demonstrated for salmonid fishes, but safety margins for both concentration and exposure time were wider than for the salmonids.

  3. Book review: Black bass diversity: Multidisciplinary science for conservation

    Science.gov (United States)

    Jelks, Howard

    2016-01-01

    These proceedings are from the third symposium dedicated to management and conservation of black basses in the genus Micropterus. The first symposium was held in 1975 (R. H. Stroud and H. Clepper. Black Bass Biology and Management. Washington (DC): Sport Fishing Institute) followed 25 years later by Black Bass 2000 (D. P. Philipp and M. S. Ridgway. 2002. Black Bass: Ecology, Conservation, and Management. Bethesda (MD): American Fisheries Society). Although the previous books discussed conservation of genetic variation and distinct strains of basses, the bulk of the papers in those tomes emphasized management of largemouth and smallmouth bass. In contrast, this third symposium is focused on the rarer bass species and challenges for their successful management.

  4. Comparative Ecology of Juvenile Striped Bass and Juvenile Hybrid Striped Bass in Claytor Lake, Virginia

    OpenAIRE

    Rash, Jacob Michael

    2003-01-01

    Since the introduction of hybrid striped bass M. chrysops x M. saxatilis to Claytor Lake, Virginia in 1993, relative abundance of striped bass Morone saxatilis has dropped disproportionately to stocking density. Potentially deleterious interactions between the two fishes that may limit recruitment to age 1 were considered in terms of trophic relationships, physiological indices of health, overwinter survival, and post-stocking predation. Both fishes preferred habitat types characterized ...

  5. Effects of water velocity on activity of juvenile striped bass

    Energy Technology Data Exchange (ETDEWEB)

    Bowles, R.R.; Griffith, J.S.; Coutant, C.C.

    1976-07-01

    The swimming activity of juvenile striped bass (Morone saxatilis Walbaum) 8 to 80 mm long was investigated in a test chamber simulating, on a small scale, a fixed-screen cooling water intake structure. As water velocity increased from 0 to 30 cm/sec area and distance traveled by juvenile bass 10 to 80 mm long decreased. However, as water velocity increased from 0 to 3 cm/sec the area and distance covered by larval bass increased. The presence of food increased the activity of larval bass, but decreased the activity of juveniles. Area ranged by striped bass at test velocities ranging from 0 to 30 cm/sec increased in proportion to body length. Juvenile striped bass tested at acclimation temperatures between 20 and 5/sup 0/C experienced a 30% reduction of activity. Activity was also reduced as temperature increased from 20 to 30/sup 0/C.

  6. Spatial simulation of smallmouth bass in streams

    International Nuclear Information System (INIS)

    The hydropower industry and its regulators are hampered by the inability to predict the relationship between alternative flow regimes and fish population response. We have developed a spatially explicit, individual-based model of populations of small-mouth bass in streams as part of the Compensatory Mechanisms in Fish Populations Program (see Sale and Otto 1991). In the model, the profitability of alternative stream locations varies in response to habitat depth and velocity through changes in the frequency of prey encounters and the metabolic costs experienced by fish. We conducted an evaluation of our hydraulic simulation at the scale of individual stream cells. The potential error in predictions for individual cell velocities suggests that larger-scale model predictions for the representative reach are most appropriate. At this scale, the model appears to produce realistic patterns in the growth and dispersal of young-of-year small-mouth bass. This verification step allows us to proceed with greater confidence in evaluating the original question of how small-mouth bass populations respond to alternative flow regimes

  7. The importance of bass clarity in pop and rock venues

    DEFF Research Database (Denmark)

    Adelman-Larsen, Niels Werner; Thompson, Eric Robert

    2008-01-01

    High levels of bass sound have been shown to stimulate the part of the brain that controls such basic instincts as sexual desire and hunger [Todd, 2000]. In rock and pop music, the bass frequencies from 40-125 Hz get amplified to very loud levels. Easily half of the electrical power of the PA and...

  8. Rearing sunshine bass using diets formulated for summer water temperatures

    Science.gov (United States)

    Elevated water temperatures are common in hybrid striped bass or Sunshine bass (HSB; Morone chrysops x M. saxatilis) production ponds during summer months in the southern US. Median daily water temperatures often exceed 30 C from June through September. This experiment was conducted to extend and re...

  9. 75 FR 38935 - Fisheries of the Northeastern United States; Black Sea Bass Fishery; 2010 Black Sea Bass...

    Science.gov (United States)

    2010-07-07

    ... emergency rule to increase the 2010 black sea bass specifications on February 10, 2010 (75 FR 6586). The... (75 FR 6586), NMFS requested, and subsequently received, comments on the increased black sea bass TAL... December 22, 2009 (74 FR 67978), and became effective on January 1, 2010. The final rule implemented a...

  10. THE DIATONIC ACCORDION BASS NOTES LEARNING APPLICATION

    OpenAIRE

    Koren, David

    2013-01-01

    Learning to play a musical instrument is usually tackle with the help of a music teacher. For learning purposes there already exist computer programs and applications that help the user in learning process. Many programs have a disadvantage of not showing the correct finger order while playing an instrument. In this thesis work we developed an application for an Apple iPad tablet, which teaches the user how to play the bass notes on the diatonic accordion. The presented information is based o...

  11. The impact of the 'Sea Empress' oil spill on seabass recruitment

    International Nuclear Information System (INIS)

    Young-of-the-year (O-group) sea bass (Dicentrarchus labrax L.) were collected during 1996 from 12 inshore sites in the Bristol Channel in order to investigate possible effects of the Sea Empress oil spill on their growth and survival. O-group bass were more abundant on the south side of the Bristol Channel than in South Wales nurseries, and particularly scarce within Milford Haven. Some bass caught in nursery areas on the north Cornish coast had spawned in early March, but only fish spawned after late April appeared in South Wales nurseries, where the first arrival data of bass post-larvae was later than in nursery areas in north Devon and Cornwall. O-group bass grew faster within the latter nurseries than in the north coast of the Bristol Channel, where a much higher proportion of fish failed to reach 60 mm, the critical length for survival through the first winter. There were no significant differences in fish condition or in the weight of their stomach contents between sites. Whilst the Sea Empress oil spill may have contributed to the differences in the survival of early-spawned bass larvae and the abundance of O-group bass in nursery areas on either side of the Bristol Channel, these differences are likely to be less significant than the year to year variation due to natural causes. (author)

  12. A reservoir landscape for age-0 largemouth bass

    Science.gov (United States)

    Irwin, E.R.; Jackson, J.R.; Noble, R.L.

    2002-01-01

    Landscape ecology is concerned with how ecological processes are affected by spatial patterns. Identification of heterogeneity in littoral zones has expanded the conceptual framework of aquatic landscapes. Long-term study of a reservoir largemouth bass population indicated that the amount and arrangement of habitat regulated the population processes. The distribution of age-0 largemouth bass was quantified in relation to littoral habitat and relations between landscape features and population parameters on scales from embayment to microhabitat were determined. At the embayment scale, shoreline slope and amount of gravel substratum predicted fivefold variability in abundance among four reservoir embayments. Within an embayment, these habitat features explained between 37 and 88 percent of variation in shoreline distribution of age-0 largemouth bass. At the microhabitat scale, age-0 largemouth bass exhibited patchy distributions in relation to gravel substratum at 40 percent of sites. These results indicate that the landscape scale domain for young largemouth bass is large; whereas, specific patterns explained processes across multiple scales. Distributions of age-0 largemouth bass in relation to habitat, however, were apparent on a fine scale (10 m) and these data, coupled with limited movement behavior of young largemouth bass, indicate that the ecological neighborhood of this life stage is small. Our data also suggested that some habitats may be source habitats because embayments with hypothesized higher source/sink ratios were more productive. Although patch arrangement critical to young largemouth bass ecology was not quantified, it was apparent that embayments with more complex habitats likely provided the extent of the landscape for age-0 largemouth bass in Jordan Lake. Identification of scale of patchiness (of fish distributions and habitats) for this life stage will assist in making inferences regarding complex ecological processes that can affect year

  13. Reproducción natural controlada del black bass Micropterus salmoides - Controlled natural reproduction of black bass Micropterus salmoides

    OpenAIRE

    Amaral Junior, Hilton; Garcia, Silvano; Capozza Tebaldi, Paula

    2009-01-01

    ResumenPara viabilizar la reproducción, larvicutura y alevinaje del Black bass, en la región sur de Brasil, se ha buscado adaptar una tecnología, desarrollada por el Centro Nacional de Acuicultura Piscifactoría las Vegas del Guadiana Badajoz/España. Consiste en controlar el ambiente de desove, utilizando estanques con nidales, para el desove del Black bass. Optimizando esta tecnología, desarrollamos una técnica de adaptación del Black bass al cultivo intensivo durante el período de invierno, ...

  14. Feed training of peacock bass (Cichla sp.

    Directory of Open Access Journals (Sweden)

    MOURA M. A. M.

    2000-01-01

    Full Text Available The Amazonian cichlid peacock bass (Cichla sp. is a highly marketable food and sport fish, therefore a suitable species for aquaculture. However, because of its piscivorous feeding preferences, the species does not accept dry feeds voluntarily, turning its intensive culture difficult and costly. This study aimed to wean fingerling peacock bass from inert moist food to dry diets. In a first experiment, 1,134 fingerlings weighting 0.27 g were divided in two 0.37 m³ hapas and fed ground fish flesh with 35% success. Then, 1.3 g fish were pooled, stocked in six 25 L cages and fed two pellet sequences with 80%, 60%, 40%, 20% and 0% ground fish flesh (GFF. One sequence was flavored with 10% krill meal (Euphausia sp.. Training success of fish fed the GFF-00 diet flavored with krill reached 12%ª compared to 11.6%ª (p < 0.05 for diets without krill meal. A second experiment was set up with 969, 1.5 g fish, trained with GFF with 39.8% success. After the feed training period, 2.2 g fish were then fed a sequence of moist pellets containing 80%, 60% and 45% GFF. Fish trained to feed on moist pellets with 45% ground fish were pooled and stocked into nine 25 L cages. Fish were weaned to dry pellets without ground fish flesh (GFF-00 using three diet sequences: 1 dry pellets; 2 moist pellets; and 3 dry pellets flavored with 4% cod liver oil; all three diets contained 30, 10 and 0% GFF. The three sequences yielded, respectively 30.8%ª, 23.6%ª, and 24.7%ª (p < 0.05 fish feeding on GFF-00. There were no apparent beneficial effects of increasing moisture or addition of cod liver oil as flavor enhancers in the weaning diets. This study revealed the feasibility of training peacock bass to accept dry pellets, but feeding young fish ground fish flesh seemed to be a major bottleneck in improving feed training success.

  15. A Generalized Norton-Bass Model for Multigeneration Diffusion

    OpenAIRE

    Zhengrui Jiang; Dipak C. Jain

    2012-01-01

    The Norton-Bass (NB) model is often credited as the pioneering multigeneration diffusion model in marketing. However, as acknowledged by the authors, when counting the number of adopters who substitute an old product generation with a new generation, the NB model does not differentiate those who have already adopted the old generation from those who have not. In this study, we develop a generalized Norton-Bass (GNB) model that separates the two different types of substitutions. The GNB model ...

  16. NEW CAR DEMAND MODELING AND FORECASTING USING BASS DIFFUSION MODEL

    OpenAIRE

    Zuhaimy Ismail; Noratikah Abu

    2013-01-01

    Forecasting model of new product demand has been developed and applied to forecast new vehicle demand in Malaysia. Since the publication of the Bass model in 1969, innovation of new diffusion theory has sparked considerable research among marketing science scholars, operational researchers and mathematicians. The building of Bass diffusion model for forecasting new product within the Malaysian society is presented in this study. The proposed model represents the spread level of new Proton car...

  17. Estudio del sistema kisspeptina y su papel en el inicio de la pubertad de la lubina europea (Dicentrarchus labrax): Efecto de la restricción calórica en machos

    OpenAIRE

    Escobar Aguirre, Sebastián

    2015-01-01

    Tesi realitzada a l'Instituto de Acuicultura de Torre de la Sal (IATS - CSIC) En esta tesis doctoral se estudia el efecto de una dieta de restricción calórica de mantenimiento a largo plazo (14 meses), en machos de lubina prepúberes, sobre el inicio y desarrollo de la pubertad. Para ello se consideró el papel que los sistemas kisspeptina/GnRH juegan en el cerebro y la gónada de esta especie en términos reproductivos. Nuestros resultados evidencian que tanto las neuronas que expresan kiss1 ...

  18. Caracterización de los mecanismos moleculares y neuroendocrinos mediados por las kisspeptinas en el cerebro de machos de lubina europea (Dicentrarchus labrax) y relacionados con la pubertad y fertilidad

    OpenAIRE

    Espigares Puerto, Felipe

    2015-01-01

    La kisspeptina es el producto peptídico del gen KISS1. Los primeros estudios que se llevaron a cabo en mamíferos, concretamente en humanos y en ratones, revelaron que ciertas mutaciones que inactivaban al receptor de la kisspeptina (GPR54) daban lugar al desarrollo de hipogonadismo hipogonadotrópico. Este hecho sugirió que el sistema KISS1/GPR54 juega un papel importante en la función reproductiva de los mamíferos. En los mamíferos placentarios hay un solo gen KISS1 y otro que codifica GPR54....

  19. Rumble in the Jungle: City, Place and Uncanny Bass

    Directory of Open Access Journals (Sweden)

    Chris Christodoulou

    2011-06-01

    Full Text Available While bass powerfully resonates among the cultural discourses, lexicology and commercial marketing of a range of electronic dance music (EDM styles, little popular music scholarship has paid attention to the subjective, phenomenological and psycho-physiological significance of bass in its modulation of intense feelings of pleasure. This article examines the linking in jungle/drum 'n' bass culture of bass as a sonic space that produces a powerful sense of jouissance where identity can seem to unravel on the dance-floor and an articulation of contemporary urban space as a place of subjective loss and regression. Overlaying Freud's notion of the uncanny and Kristeva's signifying space of the chora, I discuss how this fetishisation of bass can be linked to the music's cultural formation from deindustrialised regions in London and the South-East of England during the early-1990s; its accelerated break-beats and 'dark' bass-lines can be seen to inscribe recent rapid social, cultural and environmental transformations in the urban metropolis.

  20. Assessment of endocrine disruption in Smallmouth bass (Micropterus dolomieu) and largemouth bass (Micropterus salmoides) in the Potomac River Watershed

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Intersex, specifically testicular oocytes, has been observed in male smallmouth bass (SMB) and other centrarchids in the South Branch of the Potomac River and forks...

  1. 75 FR 59078 - Safety Zone; Ledge Removal Project, Bass Harbor, ME

    Science.gov (United States)

    2010-09-27

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Ledge Removal Project, Bass Harbor, ME... temporary safety zone around a ledge removal project in Bass Harbor, Maine. The United States Army Corps of... and around Bass Harbor both to increase mooring capacity for fishing trawlers and recreational...

  2. 77 FR 60904 - Safety Zone; Rio Vista Bass Derby Fireworks, Sacramento River, Rio Vista, CA

    Science.gov (United States)

    2012-10-05

    ... SECURITY Coast Guard 33 CFR Part 165 Safety Zone; Rio Vista Bass Derby Fireworks, Sacramento River, Rio... Guard will enforce the safety zone for the Rio Vista Bass Derby Fireworks in the Captain of the Port... 38 09'18'' N, 121 41'15'' W (NAD 83) for the Rio Vista Bass Derby Fireworks in 33 CFR 165.1191....

  3. Bass-SIR model for diffusion of new products

    CERN Document Server

    Fibich, Gadi

    2016-01-01

    We consider the diffusion of new products in social networks, where consumers who adopt the product can later "recover" and stop influencing others to adopt the product. We show that the diffusion is not described by the SIR model, but rather by a novel model, the Bass-SIR model, which combines the Bass model for diffusion of new products with the SIR model for epidemics. The phase transition of consumers from non-adopters to adopters is described by a non-standard Kolmogorov-Johnson-Mehl-Avrami model, in which clusters growth is limited by adopters' recovery. Therefore, diffusion in the Bass-SIR model only depends on the local structure of the social network, but not on the average distance between consumers. Consequently, unlike the SIR model, a small-worlds structure has a negligible effect on the diffusion. Surprisingly, diffusion on scale-free networks is nearly identical to that on Cartesian ones.

  4. V-moda bass freq低频耳塞

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    V-moda bass freq是一款为喜好低频的用户专门打造的耳塞.外观较为简洁。耳塞的主体单元部分采用了球状设计,表面采用了釉光处理,整体给人以珠圆玉润的感觉。由于专门为配合随声听而设计,所以bass freq非常易于驱动。

  5. Integration of Bass Enhancement and Active Noise Control System in Automobile Cabin

    Directory of Open Access Journals (Sweden)

    Liang Wang

    2008-01-01

    Full Text Available With the advancement of digital signal processing technologies, consumers are more concerned with the quality of multimedia entertainment in automobiles. In order to meet this demand, an audio enhancement system is needed to improve bass reproduction and cancel engine noise in the cabins. This paper presents an integrated active noise control system that is based on frequency-sampling filters to track and extract the bass information from the audio signal, and a multifrequency active noise equalizer to tune the low-frequency engine harmonics to enhance the bass reproduction. In the noise cancellation mode, a maximum of 3 dB bass enhancement can be achieved with significant noise suppression, while higher bass enhancement can be achieved in the bass enhance mode. The results show that the proposed system is effective for solving both the bass audio reproduction and the noise control problems in automobile cabins.

  6. VizieR Online Data Catalog: BANYAN. VII. Candidate YMG members from BASS (Gagne+, 2015)

    Science.gov (United States)

    Gagne, J.; Faherty, J. K.; Cruz, K. L.; Lafreniere, D.; Doyon, R.; Malo, L.; Burgasser, A. J.; Naud, M.-E.; Artigau, E.; Bouchard, S.; Gizis, J. E.; Albert, L.

    2015-09-01

    We obtained low-resolution NIR spectra of 241 candidate young moving group (YMG) members from the BANYAN All-Sky Survey (BASS), LP-BASS, and PRE-BASS samples. A description of individual observations is included in Table 1. There are three samples that are referred to in this Paper: (1) PRE-BASS consists of targets that were initially selected as potential members and followed up with spectroscopy, but that were later rejected as we modified our selection criteria to reject contaminants; (2) Low-Priority BASS (LP-BASS) consists of targets that have NIR colors only slightly redder than field dwarfs; and (3) BASS is the final sample presented in Paper V (Gagne et al., 2015, J/ApJ/798/73) that contains targets at least 1σ redder than field dwarfs and that has a lower fraction of contaminants. (6 data files).

  7. The ground-based solar observations database BASS 2000

    OpenAIRE

    Paletou, F; Lafon, M.; Maeght, P.; Grimaud, F.; Louge, T.; Aboudarham, J.

    2007-01-01

    BASS 2000 is the French solar database for ground-based instruments. We describe hereafter our organization, our tasks and the products we can deliver to the international community. Our prospects cover data mining into the THeMIS archive, a participation to the EST endeavour and the creation and curation of the ESPaDOnS/NARVAL stellar spectra database.

  8. Automatic Phrase Continuation from Guitar and Bass guitar Melodies

    DEFF Research Database (Denmark)

    Cherla, Srikanth; Purwins, Hendrik; Marchini, Marco

    2013-01-01

    A framework is proposed for generating interesting, and musically similar variations of a givenmonophonicmelody. The focus is on rock/pop guitar and bass-guitarmelodies with the aim of eventual extensions to other instruments and musical styles. It is demonstrated here how learning musical style...

  9. Raynaud´s phenomenon in a slap bass player

    DEFF Research Database (Denmark)

    Jepsen, Jørgen Riis; Simonsen, Jane Angel

    2016-01-01

    OBJECTIVE: Secondary Raynaud’s phenomenon is a frequent condition related to occupational exposure to local vibration but has not been described in musicians. This study aims to describe cold-induced blanching of the right second and (in particular) third digits in a 67-year-old double bass player...

  10. Topological Hochschild homology and the Bass trace conjecture

    DEFF Research Database (Denmark)

    Berrick, A. J.; Hesselholt, Lars

    2015-01-01

    We use the methods of topological Hochschild homology to shed new light on groups satisfying the Bass trace conjecture. Factorization of the Hattori–Stallings rank map through the Bökstedt–Hsiang–Madsen cyclotomic trace map leads to Linnell's restriction on such groups. As a new consequence of this...

  11. Results from BASS, the BANYAN All-Sky Survey

    Science.gov (United States)

    Gagne, Jonathan; Lafreniere, David; Doyon, Rene; Faherty, Jacqueline K.; Malo, Lison; Artigau, Etienne

    2015-01-01

    We present results from the BANYAN All-Sky Survey (BASS), a systematic all-sky survey for brown dwarf candidates in young moving groups. We describe a cross-match of the 2MASS and ALLWISE catalogs that provides a list of 98 970 potential nearby dwarfs with spectral types later than M5 with measurements of proper motion at precisions typically better than 15 masyr, as well as the Bayesian Analysis for Nearby Young AssociatioNs II tool (BANYAN II) which we use to build the BASS catalog from this 2MASS-ALLWISE cross-match, consisting of more than 300 candidate members of young moving groups. We present the first results of a spectroscopic follow-up of those candidates, which allowed us to identify several new low-mass stars and brown dwarfs displaying signs of low gravity. We use the BASS catalog to show tentative evidence for mass segregation in AB Doradus and Argus, and reveal a new ˜ 13 Mjup\\ co-moving companion to a young low-mass star in BASS. We obtain a moderate-resolution near-infrared spectrum for the companion, which reveals typical signs of youth and a spectral type L4γ.

  12. 75 FR 6586 - Fisheries of the Northeastern United; Black Sea Bass Fishery; 2010 Black Sea Bass Specifications...

    Science.gov (United States)

    2010-02-10

    ... black sea bass specifications was published in the Federal Register on December 22, 2009 (74 FR 67978...; 62 FR 44421) and finds the Council(s request meets both the criteria and justifications for invoking... 516 d at 74 FR 67978, Decembe r 22, 2009 Emergenc 4,500,000 2,041 800,000 363 3,700,000 1,678...

  13. Comparing catch orientation among Minnesota walleye, northern pike, and bass anglers

    Science.gov (United States)

    Schroeder, Susan A.; Fulton, David C.

    2013-01-01

    We compared the catch orientations of Minnesota walleye (Sander vitreus), northern pike (Esox lucius), largemouth bass (Micropterus salmoides), and smallmouth bass (Micropterus dolomieu) anglers. Results were derived from 2009, 2010, and 2012 surveys of anglers targeting these different species. Consistent with previous research, we identified four dimensions of anglers’ catch orientation: (a) catching something, (b) catching big fish, (c) catching many fish, and (d) keeping fish. Walleye anglers were the most motivated to keep fish, while northern pike anglers were more oriented toward catching big fish. Largemouth bass anglers, and to a lesser extent smallmouth bass anglers, were also oriented toward catching big fish. Bass anglers reported the lowest interest in keeping fish. An orientation to keep fish was negatively related to more restrictive management actions, regardless of species. A stronger orientation to catch big fish was associated with support for increased harvest restrictions only for northern pike and smallmouth bass.

  14. FAST Real Time PCR for control of intra-species recycling in aquaculture feed, focused to the most relevant fish species farmed in Europe.

    Science.gov (United States)

    Espiñeira, Montserrat; Vieites, Juan M

    2016-08-01

    Recent regulations in animal feed composition prohibit intra-species recycling, the recycling of one given animal species to the same species, in order to avoid potential safety risks to human and animal health. These regulations have generated the need of their control in aquaculture by effective and specific analytical techniques. To date, most studies of species identification and detection in feedstuffs are focused on land species, but few studies are focused on species composition in fish feed. The present work describes five methodologies based in Real Time PCR for detection of the most relevant fish species farmed in Europe: gilthead sea bream (Sparus aurata); sea bass (Dicentrarchus labrax); turbot (Scophthalmus maximus); rainbow trout (Onchorynchus mykiss); and salmon (Salmo salar), in order to guarantee the intra-species recycling regulation in aquaculture feedstuffs. PMID:26988512

  15. Teaching Fourier Analysis and Wave Physics with the Bass Guitar

    CERN Document Server

    Courtney, M; Courtney, Michael; Althausen, Norm

    2006-01-01

    This article describes a laboratory or demonstration technique employing the bass guitar and a Vernier LabPro (or a PC soundcard) for teaching wave physics and introducing Fourier analysis. The Fourier transform of an open string provides a demonstration of oscillatory modes out to the 20th harmonic consistent with expectations containing a fundamental frequency and harmonics. The playing of "harmonics" (suppressing resonant modes by lightly touching the string to enforce nodes at desired locations) demonstrates oscillations made up (mostly) of individual modes. Students see that the complete set of Fourier components (fundamental and harmonics) present on the open string can be explicitly connected with individual resonant frequencies as described in typical textbook discussions of natural frequencies of waves on a string. The use of a bass guitar rather than the six string electric guitar allows higher harmonics to be individually excited, and it is also easier for students to play the harmonics themselves.

  16. C-BASS: The C-Band All Sky Survey

    Science.gov (United States)

    Pearson, Timothy J.; C-BASS collaboration

    2016-06-01

    The C-Band All Sky Survey (C-BASS) is a project to image the whole sky at a wavelength of 6 cm (frequency 5 GHz), measuring both the brightness and the polarization of the sky. Correlation polarimeters are mounted on two separate telescopes, one at the Owens Valley Observatory (OVRO) in California and another in South Africa, allowing C-BASS to map the whole sky. The OVRO instrument has completed observations for the northern part of the survey. We are working on final calibration of intensity and polarization. The southern instrument has recently started observations for the southern part of the survey from its site at Klerefontein near Carnarvon in South Africa. The principal aim of C-BASS is to allow the subtraction of polarized Galactic synchrotron emission from the data produced by CMB polarization experiments, such as WMAP, Planck, and dedicated B-mode polarization experiments. In addition it will contribute to studies of: (1) the local (corruption by Faraday rotation, and complements the full-sky maps from WMAP and Planck. I will present the project status, show results of component separation in selected sky regions, and describe the northern survey data products.C-BASS (http://www.astro.caltech.edu/cbass/) is a collaborative project between the Universities of Oxford and Manchester in the UK, the California Institute of Technology (supported by the National Science Foundation and NASA) in the USA, the Hartebeesthoek Radio Astronomy Observatory (supported by the Square Kilometre Array project) in South Africa, and the King Abdulaziz City for Science and Technology (KACST) in Saudi Arabia.

  17. Topological Hochschild homology and the Bass trace conjecture

    OpenAIRE

    Berrick, A. J.; Hesselholt, Lars

    2013-01-01

    We use the methods of topological Hochschild homology to shed new light on the groups satisfying the Bass trace conjecture. We show that the factorization of the Hattori-Stallings rank map through the Bokstedt-Hsiang-Madsen cyclotomic trace map leads to Linnell's restriction on such groups. As a new consequence of this restriction, we show that the conjecture holds for any group G with the property that every subgroup that is isomorphic to the additive group of rational numbers has nontrivial...

  18. Caspase-1 and IL-1β processing in a teleost fish.

    Directory of Open Access Journals (Sweden)

    Marta I R Reis

    Full Text Available Interleukine-1β (IL-1β is the most studied pro-inflammatory cytokine, playing a central role in the generation of systemic and local responses to infection, injury, and immunological challenges. In mammals, IL-1β is synthesized as an inactive 31 kDa precursor that is cleaved by caspase-1 generating a 17.5 kDa secreted active mature form. The caspase-1 cleavage site strictly conserved in all mammalian IL-1β sequences is absent in IL-1β sequences reported for non-mammalian vertebrates. Recently, fish caspase-1 orthologues have been identified in sea bass (Dicentrarchus labrax and sea bream (Sparus aurata but very little is known regarding their processing and activity. In this work it is shown that sea bass caspase-1 auto-processing is similar to that of the human enzyme, resulting in active p24/p10 and p20/p10 heterodimers. Moreover, the presence of alternatively spliced variants of caspase-1 in sea bass is reported. The existence of caspase-1 isoforms in fish and in mammals suggests that they have been evolutionarily maintained and therefore are likely to play a regulatory role in the inflammatory response, as shown for other caspases. Finally, it is shown that sea bass and avian IL-1β are specifically cleaved by caspase-1 at different but phylogenetically conserved aspartates, distinct from the cleavage site of mammalian IL-1β.

  19. The BASS survey for brown dwarfs in young moving groups

    Science.gov (United States)

    Gagne, Jonathan; Lafreniere, David; Doyon, Rene; Malo, Lison; Faherty, Jacqueline K.; Artigau, Etienne; Cruz, Kelle L.; Burgasser, Adam J.; Filippazzo, Joe; Naud, Marie-Eve; Albert, Loic; Bouchard, Sandie; Gizis, John; Robert, Jasmin; Nadeau, Daniel; Bowsher, Emily C.; Nicholls, Christine

    2016-01-01

    I will present in this dissertation talk the construction and follow-up of the BANYAN All-Sky Survey (BASS) that we led to identify dozens of new isolated young brown dwarfs in the Solar neighborhood, several of which have physical properties such as mass, age and temperature that make them similar to exoplanets that were recently discovered using the method of direct imaging.Such isolated analogs of the giant, gaseous exoplanets are precious benchmarks that will allow a deep characterization of their atmospheres using high-resolution and high signal-to-noise spectroscopy, which is made possible due to the absence of a nearby and bright host star.I will end by describing BASS-Ultracool, an extension of BASS that focuses on the identification of extremely cool isolated exoplanet analogs that display methane in their atmospheres. This survey has already uncovered the first bonafide T dwarf member of a moving group, the ~150 Myr AB Doradus T5, SDSS1110+0116.

  20. NEW CAR DEMAND MODELING AND FORECASTING USING BASS DIFFUSION MODEL

    Directory of Open Access Journals (Sweden)

    Zuhaimy Ismail

    2013-01-01

    Full Text Available Forecasting model of new product demand has been developed and applied to forecast new vehicle demand in Malaysia. Since the publication of the Bass model in 1969, innovation of new diffusion theory has sparked considerable research among marketing science scholars, operational researchers and mathematicians. The building of Bass diffusion model for forecasting new product within the Malaysian society is presented in this study. The proposed model represents the spread level of new Proton car among a given set of the society in terms of a simple mathematical function that elapsed since the introduction of the new car. With the limited amount of data available for the new car, a robust Bass model was developed to forecast the sales volume. A procedure of the proposed diffusion model was designed and the parameters were estimated. Results obtained by applying the proposed model and numerical calculation shows that the proposed diffusion model is robust and effective for forecasting demand of new Proton car. The proposed diffusion model is shown to forecast more effectively and accurately even with insufficient previous data on the new product.

  1. An Investigation into the Uptake of Contaminants in Largemouth Bass and Sediment from the Lower Tombigbee and Mobile Rivers, 1992

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes a study with the following results: 1. Mercury was detected in all largemouth bass composite samples, with highest levels found in bass...

  2. High density culture of white bass X striped bass fingerlings in raceways using power plant heated effluent

    Energy Technology Data Exchange (ETDEWEB)

    Collins, C.M.; Burton, G.L.; Schweinforth, R.L.

    1983-06-01

    White bass (Morone chrysops) X striped bass (M. saxatilis) hybrids weighing 1691/lb were initially stocked in five 24 ft/sup 3/ floating screen cages for 20 days. Hybrids averaging one inch in total length and 361 fish/lb were released in four 614 ft/sup 3/ concrete raceways. Two stocking densities, 2.6 and 5.1 fish/ft/sup 3/, were evaluated in the 94-day study using a flow rate of 300 gpm/raceway. Water temperatures averaged 79/sup 0/F and water quality was adequate throughout the production period. Fish were hand fed to satiation daily. Columnaris and Aeromonas hydrophila caused the most serious disease problems. Gas supersaturation was suspect in high mortality levels during cage culture of hybrid bass fry. Cannibalism may have been responsible for unaccountable losses prior to raceway stocking and at harvest. The study yielded 5773 hybrids weighing 658 lb. The high density treatment showed greater weight gain, average weight, average length and percent survival as well as improved food conversion. Results suggest that higher stocking densities and periodic grading may increase production and suppress cannibalism. 10 references, 3 figures, 3 tables.

  3. Effect of salinity on expression of branchial ion transporters in striped bass (Morone saxatilis)

    DEFF Research Database (Denmark)

    Tipsmark, Christian Kølbaek; Madsen, Steffen Søndergaard; Borski, Russell John

    2004-01-01

    proteins in striped bass when compared with the less euryhaline brown trout. In both FW and SW, NEM-sensitive gill H+-ATPase activity was negligible in striped bass and approximately 10-fold higher in brown trout. This suggests that in striped bass Na+-uptake in FW may rely more on a relatively high...

  4. 76 FR 53831 - Fisheries of the Northeastern United States; Summer Flounder, Scup, and Black Sea Bass Fisheries...

    Science.gov (United States)

    2011-08-30

    ... summer flounder, scup, and black sea bass specifications published on December 28, 2010 (75 FR 81498). An... United States; Summer Flounder, Scup, and Black Sea Bass Fisheries; 2011 Summer Flounder, Scup, and Black Sea Bass Specifications; Correction AGENCY: National Marine Fisheries Service (NMFS), National...

  5. 77 FR 68723 - Fisheries of the Northeastern United States; Summer Flounder, Scup, and Black Sea Bass Fisheries...

    Science.gov (United States)

    2012-11-16

    ... Northeastern United States; Summer Flounder, Scup, and Black Sea Bass Fisheries; 2013-2014 Summer Flounder, 2013- 2014 Scup, and 2013 Black Sea Bass Specifications; 2013 Research Set- Aside Projects AGENCY... summer flounder, scup, and black sea bass fisheries, and the 2014 summer flounder and scup fisheries,...

  6. 77 FR 60945 - 2012-2013 Accountability Measure and Closure for Commercial Black Sea Bass in the South Atlantic

    Science.gov (United States)

    2012-10-05

    ... sector of black sea bass from June 1, 2012 to July 1, 2012 (77 FR 28305, May 14, 2012). The commercial... Measure and Closure for Commercial Black Sea Bass in the South Atlantic AGENCY: National Marine Fisheries... bass in the exclusive economic zone (EEZ) of the South Atlantic through this temporary final rule....

  7. Reproducción natural controlada del black bass Micropterus salmoides - Controlled natural reproduction of black bass Micropterus salmoides

    Directory of Open Access Journals (Sweden)

    Amaral Junior, Hilton

    2009-09-01

    Full Text Available ResumenPara viabilizar la reproducción, larvicutura y alevinaje del Black bass, en la región sur de Brasil, se ha buscado adaptar una tecnología, desarrollada por el Centro Nacional de Acuicultura Piscifactoría las Vegas del Guadiana Badajoz/España. Consiste en controlar el ambiente de desove, utilizando estanques con nidales, para el desove del Black bass. Optimizando esta tecnología, desarrollamos una técnica de adaptación del Black bass al cultivo intensivo durante el período de invierno, ofreciendo un pienso de un 40% de proteína cruda y zooplancton (Daphnia sp.. Se dejan los reproductores en un mismo estanque de engorda en sistema extensivo, y son adaptados para un sistema intensivo de cultivo, en estanques de hormigón con entrada y salida del agua. Se acondicionan reproductores machos y hembras, durante los meses de invierno. En la primavera, se abren sucesivamente las compuertas de comunicación del departamentocentral, con los estanques frezaderos. En estos estanques frezaderos,se colocan nidales de grava para la puesta de las hembras. Pasado elperíodo de ocupación cíclica de los estanques de desove, losreproductores vuelven al departamento central. Después de laeclosión, las larvas son alimentadas con pienso molido a un 48% deproteína cruda con una oferta de un 10% de su peso y zooplancton Daphina sp. Los alevines se quedan alojados en estanques de tierrapara el período de engorda.SummaryIn order to make reproduction, larval and fingerling rearing of BlackBass in the south region of Brazil, we try to adapt a technologydeveloped by Centro Nacional de Aquicultura Piscifactoria Las Vegasdel Guadiana, Badajoz, Espanha. The technique consists in controllingthe spawning environment with a tank containing nests. To optimizethis technology, we develop a technique to adapt the black bass in aintensive culture during winter, providing food with 40% proteine andzooplankton (Daphnia sp.. The spawners are manteined in the

  8. Osmoregulatory effects of hypophysectomy and homologous prolactin replacement in hybrid striped bass

    DEFF Research Database (Denmark)

    Jackson, Leslie F; McCormick, Stephen D; Madsen, Steffen S;

    2005-01-01

    The effects of ovine prolactin (oPRL) and striped bass prolactin (sbPRL; Morone saxatilis) on plasma osmolality, electrolyte balance, and gill Na+,K+-ATPase activity were investigated in hypophysectomized (Hx), freshwater (FW)-acclimated, hybrid striped bass (M. saxatilis x Morone chrysops). They...

  9. Energy conversion efficiency of trout and sea bass production in the Black Sea, Turkey

    International Nuclear Information System (INIS)

    This study examined the current energy balance, energy conversion efficiency, and farm-level efficiency of trout and sea bass production in the Black Sea of Turkey. Using a structured survey, we collected data from nine monoculture trout farms and five polyculture trout and sea bass farms during the 2005-2006 production season. Energy values were calculated using energy equivalents of the inputs and outputs for the farms. Data envelopment analysis was used to calculate farm-level efficiency. The total energy use per cubic meter was 46.57 MJ for trout production and 87.13 MJ for sea bass production. The main energy inputs were feed and diesel oil for both trout and sea bass production. Indirect energy use was dominant in trout production, while direct energy use was more common in sea bass production. The energy input-to-output ratio of trout production was higher than that of sea bass production. Sea bass production was more economically energy efficient compared to trout production. The allocative and economic energy efficiencies for trout and sea bass production were 0.788 and 0.881, respectively. For both types of farms, the most discriminative variable affecting economic efficiency was operator experience. Increasing focus on product distribution costs could decrease total energy costs by approximately 12%

  10. 77 FR 65136 - Fisheries of the Northeastern United States; Black Sea Bass Fishery; Recreational Quota Harvested

    Science.gov (United States)

    2012-10-25

    ... the 2012 fishing year is 1.86 million lb (844 mt) (76 FR 82189, December 30, 2011). The 2012 RHL was... Northeastern United States; Black Sea Bass Fishery; Recreational Quota Harvested AGENCY: National Marine...: Temporary rule; closure. SUMMARY: NMFS announces that the 2012 black sea bass recreational harvest limit...

  11. Effect of temperature on larval sunshine bass growth and survival to the fingerling stage

    Science.gov (United States)

    Determining the optimum conditions for tank culture of sunshine bass fingerlings will facilitate a year-round supply of seed for the production cycle of this increasingly popular food fish. This experiment determined the relationship between temperature and larval sunshine bass growth and survival ...

  12. Reproductive cycles of largemouth bass (Micropterus salmoides) in a cooling reservoir

    International Nuclear Information System (INIS)

    Annual reproductive cycles of largemouth bass (Micropterus salmoides) collected in the heated area of a 1120-hectare reservoir receiving thermal effluent from the Savannah River Plant were similar to cycles from bass collected in unheated waters during 1969 and 1970. Average maximum monthly temperatures at the heated area exceeded those in unheated waters by greater than 100C for the 2 years. Few monthly differences in gonosomatic indices were found between heated and unheated areas. Earlier attainment of maximum gonadal size and the presence of significantly larger juvenile bass at the heated area suggested that reproduction might be accelerated by thermal discharge. However, gonadal condition indicated that the reproductive period started in March and continued through April in both areas. Reproduction may have been advanced in some heated-area bass, although this was not obvious from overall changes in the reproductive cycles of bass from unheated areas. (auth)

  13. Alternative plant protein sources in sea bass diets

    Directory of Open Access Journals (Sweden)

    Edo D’Agaro

    2010-01-01

    Full Text Available A control diet (C containing animal protein (mainly fish meal was compared with 6 experimental diets containing different  plant proteins (soybean meal, SM; rapeseed meal, RM; potato protein concentrate, PPC and a mix of the three vegetable  protein sources, M. The plant protein replaced either 25 (1 or 50 (2% of the animal protein with the exception of diet  RM2 where the substitution rate was lowered to 35%, and in diet M where 55% of the total protein given was replaced in  equal amounts by the three plant proteins. For the growth trial, which lasted 97 days, 528 European sea bass (initial live  weight 107 ± 0,06g, distributed among 24 fibreglass tanks with three replicates per treatment, were used. The pelleted  feed was distributed 5 times per day using an automatic dispenser. Energy, crude protein and crude fat digestibility values  for fish meal and soybean meal were similar and not statistically different while the values for rapeseed meal and potato  protein concentrate were significantly lower. Digestive utilization for NFE was higher in fish meal and decreased significant-  ly in soybean meal, rapeseed meal and even more noticeably in potato protein concentrate. Diet digestibility values showed  a similar trend with a clear worsening effect at the higher inclusion rates used. Diet M gave digestibility coefficients lower  than those observed with diets C, SM1, SM2, RS1and RS2and higher than those of diets PPC1and PPC2. Fish fed a diet in  which 25% of the total protein was replaced by soybean had similar performances to those of the control group. On the  other hand, sea bass fed diets SM2, RS1, RS2and M had lower growth rates and worse feed utilization than those observed  with the control. Finally, specific growth rates and food conversion efficiency in sea bass fed diets containing potato protein  concentrate were poor because of the low palatability. These results show that soybean meal can substitute up to 25% of

  14. Four types of neoplasms in Asian sea bass (Lates calcarifer)

    Institute of Scientific and Technical Information of China (English)

    Ramalingam Vijayakumar; Kuzhanthaivel Raja; Vijayapoopathi Singaravel; Ayyaru Gopalakrishnan

    2015-01-01

    Objective:To describe and observe four types of neoplasms on different parts (external and internal organs) of an Asian sea bass (Lates calcarifer). Methods:The sample was collected from local fish landing center (south east coast of India). Histopathology of normal and tumour tissues were analyzed. Results:A total of 83 tumour masses (neoplasm) were recorded on the fish skin, also the neoplasms were recorded in internal organs of fish such as liver, stomach and ovary. Conclusions:Aetiology of such neoplasm’s are unknown, further more researches need to confirm the causative agent for this type of neoplasm.

  15. Testing the thermal-niche oxygen-squeeze hypothesis for estuarine striped bass

    Science.gov (United States)

    Kraus, Richard T.; Secor, D.H.; Wingate, Rebecca L.

    2015-01-01

    In many stratified coastal ecosystems, conceptual and bioenergetics models predict seasonal reduction in quality and quantity of fish habitat due to high temperatures and hypoxia. We tested these predictions using acoustic telemetry of 2 to 4 kg striped bass (Morone saxatilis Walbaum) and high-resolution spatial water quality sampling in the Patuxent River, a sub-estuary of the Chesapeake Bay, during 2008 and 2009. Striped bass avoided hypoxic (dissolved oxygen ≤2 mg·l−1) subpycnocline waters, but frequently occupied habitats with high temperatures (>25 °C) in the summer months, as cooler habitats were typically not available. Using traditional concepts of the seasonal thermal-niche oxygen-squeeze, most of the Patuxent estuary would beconsidered unsuitable habitat for adult striped bass during summer. Application of a bioenergetics model revealed that habitats selected by striped bass during summer would support positive growth rates assuming fish could feed at one-half ofmaximum consumption. Occupancy of the estuary during summer by striped bass in this study was likely facilitated by sufficient prey and innate tolerance of high temperatures by sub-adult fish of the size range that we tagged. Our results help extend the thermalniche oxygen-squeeze hypothesis to native populations of striped bass in semi-enclosed coastal systems. Tolerance of for supraoptimal temperatures in our study supports recent suggestions by others that the thermal-niche concept for striped bass should be revised to include warmer temperatures.

  16. Eggs Incubation, Early Development and growth in Frys of Brown Trout (Salmo trutta macrostigma) and Black Sea Trout (Salmo trutta labrax)

    OpenAIRE

    Ahmet ALP; Erer, Mesut; KAMALAK, Adem

    2010-01-01

    Some of the embryonic development stages and growth of the frys of brown trout (Salmo trutta macrostigma) and Black Sea trout (Salmo trutta labrax) were examined. The first eye pigmentation in the brown trout eggs were realised on the 35 days (244 day-degree) at 7.23°C and 31 days (260 day-degree) at 8.21°C post fertilisation. First eye pigmentation of the Black Sea trout eggs were seen on day 25 (215 day-degree) at 8.21°C. Brown trout larvae were hatched on day 56 (387 day-degree) at 7.23°C ...

  17. Striped Bass Spawning in Non-Estuarine Portions of the Savannah River

    International Nuclear Information System (INIS)

    Historically, the estuarine portions of the Savannah River have been considered to be the only portion of the river in which significant amounts of striped bass (Morone saxatilis) spawning normally occur. A reexamination of data from 1983 through 1985 shows a region between River Kilometers 144 and 253 where significant numbers of striped bass eggs and larvae occur with estimated total egg production near that currently produced in the estuarine reaches. It appears possible that there are two separate spawning populations of striped bass in the Savannah River.

  18. Striped Bass Spawning in Non-Estuarine Portions of the Savannah River

    Energy Technology Data Exchange (ETDEWEB)

    Martin, D.; Paller, M.

    2007-04-17

    Historically, the estuarine portions of the Savannah River have been considered to be the only portion of the river in which significant amounts of striped bass (Morone saxatilis) spawning normally occur. A reexamination of data from 1983 through 1985 shows a region between River Kilometers 144 and 253 where significant numbers of striped bass eggs and larvae occur with estimated total egg production near that currently produced in the estuarine reaches. It appears possible that there are two separate spawning populations of striped bass in the Savannah River.

  19. Otolith Sr concentration analyzed by PIXE in Ariake estuary-dependent sea bass juveniles

    International Nuclear Information System (INIS)

    Japanese sea bass (Lateolabrax japonicus) is a typical euryhaline marine fish and frequently migrates from salt to freshwater environments during early life stages. We hypothesized that strontium concentrations in the otolith could be a useful index to examine freshwater entry because of its lower concentration in freshwater. Otoliths of Japanese sea bass juveniles collected in the Chikugo river and estuary were analyzed by Particle Induced X-ray Emission (PIXE) to see relationship between strontium concentration and ambient salinity. Strontium concentrations in otoliths of sea bass juveniles are significantly lower in the river samples than in brackish water samples. (author)

  20. Mercury in largemouth bass and spotted gar of the Florida Panther National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From June 21 to 25, 1990, 21 largemouth bass (Micropterussa salmoides) and five spotted gar (Lepisosteus oculatus) were collected from selected locations at the...

  1. Contaminants in striped bass from the flint and Apalachicola Rivers 1986-1989

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Five striped bass (Morone saxitilis), collected between April 1986 and May 1989 from the Flint River at Albany, Georgia, and the Apalachicola River at...

  2. Siim Nestor soovitab : Back2Bass Helsinki. Teenage Kicks / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2002-01-01

    Soome trummi-ja-bassi klubi Back2Bass 28. septembril KuKu klubis Tallinnas. 28. sept. Von Krahlis toimuvast live-üritusest Teenage Kicks, kus ansambel Claire's Birthaday esitleb ka oma uut singlit "Do You Remember"

  3. Mercury concentrations in largemouth bass and other fishes of the Loxahatchee National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From September 17-21, 1990, 32 largemouth bass (Micropterus salmoides) and three other fish species were collected from eight locations at the Loxahatchee National...

  4. Mercury concentrations in largemouth bass of the Crystal River National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From July 17 to 26, 1990, 20 largemouth bass (Micropterus salmoides) were collected from four locations at the Crystal River National Wildlife Refuge, Citrus...

  5. Mercury in largemouth bass of the Lake Woodruff National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From August 24 to 28, 1990, largemouth bass (Micropterus salmoides) were collected from selected locations at the Lake Woodruff National Wildlife Refuge, Volusia...

  6. Mercury in largemouth bass and other fishes of the Merritt Island National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From August 16 to 22, 1990, largemouth bass (Micropterus salmoides), bowfin (Amia calva) and spotted seatrout (Cynoscion nebulosus) were collected from selected...

  7. The effect of oceanography on sedimentology and geochemistry of the temperate carbonates of Bass Strait, Australia

    International Nuclear Information System (INIS)

    Full text: Modern cool temperate carbonates occur on the shallow shelf (50 -70 m) of' Bass Strait in an area of approximately 85,000 Km2 between latitudes of 38 deg to 40.5 deg S and longitudes of about 143 deg.30' to 149 deg F. Bass Strait carbonates are mainly affected by different water masses that consist of the warm saline Leeuwin Current and low salinity cold sub-Antarctic water, to the west, while to the east a weak intrusion of high salinity, warm, East Australian Current and relatively low salinity, cool, Tasman Sea water. To recognise the physical and chemical effect of these water masses on the sediments of the region, samples from eastern and western Bass Strait have been selected. The gravel size fractions are mostly distributed in the shallow shelf areas surrounding the islands. The higher gravel concentration nears the islands is attributed to the input of terrigenous materials from these islands and also the occurrence of large skeletal fragments such as molluscs. The sand size fractions are distributed throughout the area due to changes in water energy in different parts of the shelf. In Bass Strait a combination of bryozoans, molluscs and to some extent foraminifera, comprise the main components of the bulk sediments. The proportion of bryozoans is higher in the eastern rather than western Bass Strait. This is due to the more stable oceanographic conditions to the east, where the water energy is less, temperature and salinity are more uniform and the water contains higher concentration of nutrients. The carbonate mineralogy in Bass Strait is influenced by seawater temperature, and this is influenced by the water currents rather than by changes in depth or latitude. The Ca and Mg contour maps correlate well in the eastern and western of Bass Strait, due to the formation of higher amounts of high-Mg calcite in these areas. The Sr concentration is mainly related to carbonate mineralogy. In eastern Bass Strait, the relatively high Sr content is

  8. Ocean acidification impacts on black sea bass and scup embryos, responses of finfish in laboratory experiments

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Black sea bass (Centropristis striata) and scup (Stenotomus chrysops) compose important recreational and commercial fisheries along the United States Atlantic...

  9. Feeding activity and spawning time of striped bass in the Colorado River Inlet, Lake Powell, Utah

    Science.gov (United States)

    Persons, William R.; Bulkly, R.V.

    1982-01-01

    Striped bass, Morone saxatilis, from Lake Powell, Utah spawned in or near the mixing zone of the reservoir and the Colorado River in 1980 and 1981. The fish did not move through Cataract Canyon rapids just above the reservoir in either year. Of 321 adult striped bass stomachs examined, 30% contained food and 28% contained threadfin shad, Dorosoma petenense. No stomachs contained native threatened or endangered Colorado River fishes.

  10. Massive Microbiological Groundwater Contamination Associated with a Waterborne Outbreak in Lake Erie, South Bass Island, Ohio

    OpenAIRE

    Fong, Theng-Theng; Mansfield, Linda S.; Wilson, David L.; Schwab, David J.; Molloy, Stephanie L.; Rose, Joan B.

    2007-01-01

    Background A groundwater-associated outbreak affected approximately 1,450 residents and visitors of South Bass Island, Ohio, between July and September 2004. Objectives To examine the microbiological quality of groundwater wells located on South Bass Island, we sampled 16 wells that provide potable water to public water systems 15–21 September 2004. Methods We tested groundwater wells for fecal indicators, enteric viruses and bacteria, and protozoa (Cryptosporidium and Giardia). The hydrodyna...

  11. Die faktorstruktuur van Bass se veelfaktor- leierskapsvraelys in die Suid-Afrikaanse konteks

    OpenAIRE

    C .P. Ackermann; J. M. Schepers; B. C. Lessing; Z. Dannhauser

    2000-01-01

    The factor structure of Bass's Multifactor Leadership Questionnaire in the South African context. The aim of the study was to determine whether the factor structure of Bass's Multifactor Leadership Questionnaire (MLQ), as a measure of transformational leadership, could be replicated within the South African context. The MLQ was chosen not only because it promised to be a valid and reliable measuring instrument of the construct in question, but also due to the fact that there was an urgent nee...

  12. Experimental Validation of Adjusting the Resonances of a Simplified Bass Clarinet Through Modal Active Control

    OpenAIRE

    Meurisse, Thibaut; MAMOU-MANI, Adrien; Benacchio, Simon; Finel, Victor; Chomette, Baptiste; Causse, René; SHARP, David

    2014-01-01

    This paper reports the experimental results of modifying the resonances of wind instruments using modal active control. Resonances of a simplified bass clarinet (a cylindrical tube coupled to a bass clarinet mouthpiece including a reed) are adjusted either in frequency or in damping in order to modify its playing properties (pitch, strength of the harmonics of the sound, transient behavior). This is achieved using a control system made up of a collocated loudspeaker and microphone linked by a...

  13. A STUDY ON NEW PRODUCT DEMAND FORECASTING BASED ON BASS DIFFUSION MODEL

    OpenAIRE

    Zuhaimy Ismail; Noratikah Abu

    2013-01-01

    A forecasting model of new product demand has been developed and applied to forecast new vehicle demand in Malaysia. Since the publication of the Bass model in 1969, innovation of new diffusion theory has sparked considerable research among marketing science scholars, operational researchers and mathematicians. This study considers the Bass Model for forecasting the diffusion of new products or an innovation in the Malaysian society. The objective of the proposed model is to represent the lev...

  14. A Generalized Bass Model for Product Growth in Networks

    CERN Document Server

    Manshadi, Vahideh H

    2016-01-01

    Many products and innovations become well-known and widely adopted through the social interactions of individuals in a population. The Bass diffusion model has been widely used to model the temporal evolution of adoption in such social systems. In the model, the likelihood of a new adoption is proportional to the number of previous adopters, implicitly assuming a global (or homogeneous) interaction among all individuals in the network. Such global interactions do not exist in many large social networks, however. Instead, individuals typically interact with a small part of the larger population. To quantify the growth rate (or equivalently the adoption timing) in networks with limited interactions, we study a stochastic adoption process where the likelihood that each individual adopts is proportional to the number of adopters among the small group of persons he/she interacts with (and not the entire population of adopters). When the underlying network of interactions is a random $k$-regular graph, we compute t...

  15. Description of two new gill myxozoans from smallmouth (Micropterus dolomieu) and largemouth bass (Micropterus salmoides)

    Science.gov (United States)

    Walsh, Heather L.; Iwanowicz, Luke R.; Glenney, Gavin W.; Iwanowicz, Deborah D.; Blazer, Vicki

    2012-01-01

    Two previously undescribed species of myxozoan parasites were observed in the gills of bass inhabiting the Potomac and James River basins. They are described using morphological characteristics and small-subunit (SSU) rDNA gene sequences. Both were taxonomically identified as new species of Myxobolus; Myxobolus branchiarum n. sp. was found exclusively in smallmouth bass, and Myxobolus micropterii n. sp. was found in largemouth and smallmouth bass. Small, spherical, white plasmodia of M. branchiarum from smallmouth bass were observed grossly in the gills; these plasmodia had an average length of 320.3 µm and width of 246.1 µm. The development of the plasmodia is intralamellar in the secondary lamellae of the gills. Mature spores were pyriform in shape with a length of 12.8 ± 1.4 (8.1–15.1) µm and width of 6.9 ± 1.1 (4.0–9.0) µm. Analysis of SSU rDNA identified M. branchiarum in a sister-group to 3 species of Henneguya, although morphologically caudal appendages were absent. Myxobolus micropterii observed in the gills of largemouth and smallmouth bass had larger, ovoid, cream-colored plasmodia with an average length of 568.1 µm and width of 148.1 µm. The cysts developed at the distal end of the gill filament within the primary lamellae. The mature spores were ovoid in shape with a length of 10.8 ± 0.7 (9.2–12.2) µm and width of 10.6 ± 0.6 (9.0–11.8) µm. SSU rDNA analysis placed M. micropterii in a sister group with Henneguya lobosa and Myxobolus oliveirai. The highest prevalence of M. branchiarum was observed in the gills of bass collected from the Cowpasture River (50.9%). Prevalence was 44.6% in bass from the Potomac River and only 4.3% in bass collected from the Shenandoah River. A seasonal study of M. branchiarum, which included both infected and uninfected smallmouth bass, determined that a significantly higher intensity was observed in the spring than in the summer (P < 0.001) or fall (P  =  0.004). In an analysis excluding uninfected

  16. Behavioural thermoregulation and bioenergetics of riverine smallmouth bass associated with ambient cold-period thermal refuge

    Science.gov (United States)

    Westhoff, J.T.; Paukert, Craig P.; Ettinger-Dietzel, Sarah; Dodd, H.R.; Siepker, Michael

    2016-01-01

    Smallmouth bass in thermally heterogeneous streams may behaviourally thermoregulate during the cold period (i.e., groundwater temperature greater than river water temperature) by inhabiting warm areas in the stream that result from high groundwater influence or springs. Our objectives were to determine movement of smallmouth bass (Micropterus dolomieu) that use thermal refuge and project differences in growth and consumption among smallmouth bass exhibiting different thermal-use patterns. We implanted radio transmitters in 29 smallmouth bass captured in Alley Spring on the Jacks Fork River, Missouri, USA, during the winter of 2012. Additionally, temperature archival tags were implanted in a subset of nine fish. Fish were tracked using radio telemetry monthly from January 2012 through January of 2013. The greatest upstream movement was 42.5 km, and the greatest downstream movement was 22.2 km. Most radio tagged fish (69%) departed Alley Spring when daily maximum river water temperature first exceeded that of the spring (14 °C) and during increased river discharge. Bioenergetic modelling predicted that a 350 g migrating smallmouth bass that used cold-period thermal refuge would grow 16% slower at the same consumption level as a fish that did not seek thermal refuge. Contrary to the bioenergetics models, extrapolation of growth scope results suggested migrating fish grow 29% more than fish using areas of stream with little groundwater influence. Our results contradict previous findings that smallmouth bass are relatively sedentary, provide information about potential cues for migratory behaviour, and give insight to managers regarding use and growth of smallmouth bass in thermally heterogeneous river systems.

  17. Relationship of Broodstock Weight and Hatching Yield of III. Generation (F3 Black Sea Trout (Salmo trutta labrax Pallas, 1814

    Directory of Open Access Journals (Sweden)

    Hakan Baki

    2015-07-01

    Full Text Available In this study, this was the aimed to determine the reproduction and hatching yields in different weight groups in hatchery origin rootstocks (F3 Black Sea trout (Salmo trutta labrax Pallas, 1814. In this study, the female fishes which produced from natural rootstock were used average weight 1437±134.6 g (Group I 2737±210.2 g (Group II and 3785±162.3 g (Group III. After the stripping process; according to the groups, were determined respectively eggs absolute fecundity (number of eggs/broodfish is average 2353±205, 5361±506, 6603±491, relative fecundity (number of eggs/kg is average1687±166, 1968±194, 1744±114. The egg diameter (mm 4.89±0.16, 5.28±0.07, 5.31±0.06 egg weight (mg 77±6, 90±4, 96±3 groups I., II. and III. respectively was calculated. The fertilization ratio (% 95.49±1.23, 96.49±1.14, 98.39±0.52, browse rate (% 79.97±5.36, 84.20±5.23, 94.70±1.50, has been identified. The output rate (% 60.57±7.86, 67.66±6.42, 84.83±3.09, the hatchery efficiency (% 58.14±7.95, 69.77±6.25, 83.51±3.29 was found. relative fecundity average value 168±160, 1968±194, 1744±114.The existence of relationship among the weight of the brood-stock, absolute fecundity (0.0198, 0.0012, 0.3499, and relative egg fecundity (0.3415, 0.0494, 0.00 was tested by regression analysis and consequently the difference between groups were significant. This was determined that between fish weight and absolute fecundity relationship is weak directly proportional for each group, between fish weight and relative fecundity is weak inversely proportional in Group I and II, the Group III is weak for directly proportional.

  18. A STUDY ON NEW PRODUCT DEMAND FORECASTING BASED ON BASS DIFFUSION MODEL

    Directory of Open Access Journals (Sweden)

    Zuhaimy Ismail

    2013-01-01

    Full Text Available A forecasting model of new product demand has been developed and applied to forecast new vehicle demand in Malaysia. Since the publication of the Bass model in 1969, innovation of new diffusion theory has sparked considerable research among marketing science scholars, operational researchers and mathematicians. This study considers the Bass Model for forecasting the diffusion of new products or an innovation in the Malaysian society. The objective of the proposed model is to represent the level of spread on new products among a given set of society in terms of a simple mathematical function that elapsed since the introduction of new products. With limited amount of data available for new products, a robust Bass model was developed to forecast the sales volume. A procedure of the proposed diffusion model was designed and the parameters were estimated. Results obtained by applying the proposed model and numerical calculation show that the proposed Bass diffusion model is robust and effective for forecasting demand of new products. This study concludes that the newly developed bass diffusion of demand function has significantly contributed for forecasting the diffusion of new products.

  19. Dispersal of smallmouth bass from a simulated tournament weigh-in site

    Science.gov (United States)

    Kaintz, Melissa A.; Bettoli, Phillip William

    2010-01-01

    Simulated smallmouth bass Micropterus dolomieu fishing tournaments were staged in Dale Hollow Lake, a 12,400-ha reservoir in Tennessee, between March 2004 and February 2005 to investigate posttournament dispersal. Smallmouth bass (n = 54) were captured with conventional hook-and-line tackle and artificial lures, placed in live wells, and subjected to a weigh-in procedure before being externally tagged with an ultrasonic transmitter and released. Water temperatures ranged from 7.4°C to 29.3°C (mean [SE] = 17.6°C [2.5]), fish ranged in total length from 330 to 572 mm (mean = 452 [8.3]), and no fish were dead at the weigh-ins. Smallmouth bass dispersed rapidly away from the release site, which was located at the head of a 68-ha embayment. After 3-5d, survivors (n = 44) traversed an average distance of 1,475 m [213]. Most (72%) fish swam uplake and out of the 385-ha study area after 6 d. The rapid dispersal of smallmouth bass may be relevant in systems that experience heavy tournament activity. The smallmouth bass caught and subjected to simulated tournament conditions on Dale Hollow Lake did not stockpile near the release site.

  20. 76 FR 82189 - Fisheries of the Northeastern United States; Summer Flounder, Scup, and Black Sea Bass Fisheries...

    Science.gov (United States)

    2011-12-30

    ... deduction. Consistent with the revised quota setting procedures for the FMP (67 FR 6877, February 14, 2002... Northeastern United States; Summer Flounder, Scup, and Black Sea Bass Fisheries; Interim 2012 Summer Flounder, Scup, and Black Sea Bass Specifications; 2012 Research Set-Aside Projects AGENCY: National...

  1. Electrofishing capture probability of smallmouth bass in streams

    Science.gov (United States)

    Dauwalter, D.C.; Fisher, W.L.

    2007-01-01

    Abundance estimation is an integral part of understanding the ecology and advancing the management of fish populations and communities. Mark-recapture and removal methods are commonly used to estimate the abundance of stream fishes. Alternatively, abundance can be estimated by dividing the number of individuals sampled by the probability of capture. We conducted a mark-recapture study and used multiple repeated-measures logistic regression to determine the influence of fish size, sampling procedures, and stream habitat variables on the cumulative capture probability for smallmouth bass Micropterus dolomieu in two eastern Oklahoma streams. The predicted capture probability was used to adjust the number of individuals sampled to obtain abundance estimates. The observed capture probabilities were higher for larger fish and decreased with successive electrofishing passes for larger fish only. Model selection suggested that the number of electrofishing passes, fish length, and mean thalweg depth affected capture probabilities the most; there was little evidence for any effect of electrofishing power density and woody debris density on capture probability. Leave-one-out cross validation showed that the cumulative capture probability model predicts smallmouth abundance accurately. ?? Copyright by the American Fisheries Society 2007.

  2. Historical development of entrainment models for Hudson River striped bass

    International Nuclear Information System (INIS)

    In the mid-1960s, concerns surfaced regarding entrainment and impingement of young-of-the-year (age-0) striped bass by electric power generating facilities on the Hudson River. These concerns stimulated the development of increasingly complex models to evaluate the impacts of these facilities. The earliest simplistic formulas, based on empirical data, proved inadequate because of conceptual shortcomings, incomplete development, and lack of data. By 1972, complex transport models based on biological and hydrodynamic principles had been developed and applied by scientists representing both the utilities and the government. Disagreements about the acceptability of these models spurred the development of even more complex models. The entrainment models stimulated the collection of substantial amounts of field data to define the spatial distributions and entrainment survival of early life stages. As the difficulties of accounting for the movement of early life stages from hydrodynamic principles became more evident and as more field data became available, simpler empirical modeling approaches became both practical and defensible. Both empirical and hydrodynamic modeling approaches were applied during the US Environmental Protection Agency's hearings on the Hudson River power case (1977-1980). The main lessons learned from the experience with entrainment-impingement modeling are that complex mechanistic models are not necessarily better than simpler empirical models for young fish, and that care must be taken to construct even the simple models correctly. 29 refs., 4 figs., 1 tab

  3. Is high pressure treatment able to modify the allergenicity of the largemouth bass allergens?

    Science.gov (United States)

    Liu, Chu-Yi; Tao, Sha; Liu, Rong; Chen, Fu-Sheng; Xue, Wen-Tong

    2012-12-01

    The aim of this paper is to study the influence of high pressure treatment on the structural changes and allergenicity of largemouth bass. We treated the allergens at 100, 200, 300 and 400 MPa for 15 min and at 300 MPa for 5, 10, 15, 20 and 30 min at 20 °C. The treated samples from largemouth bass were tested for their IgE-binding properties by combining Sodium dodecyl sulfate-Polyacrylamide gel electrophoresis (SDS-PAGE) with western blotting (WB) and enzyme-linked immunosorbent assay (ELISA). Circular dichroism analysis was performed to characterize the structural change. In summary, we can determine that the greatest structure changes were found for samples treated by 400 MPa for 15 min. High pressure treatment did change the structure, subunit composition and molecular weight of largemouth bass allergens, but it did not change the allergenicity of the allergens.

  4. Slow growth did not decouple the otolith size-fish size relationship in striped bass

    Science.gov (United States)

    Dickey, C.L.; Isely, J.J.; Tomasso, J.R.

    1997-01-01

    Eight-day-old striped bass Morone saxatilis (6.17-6.22 mm, total length) were fed twice daily at three feeding rates to produce three growth rates. Fish were sampled once per week for 4 weeks to determine total length and otolith radius. Feed ration treatments resulted in discrete size-classes of striped bass after 4 weeks with a 27% difference in mean length between the low and high feed ration treatments. No significant differences in slope or intercept for the regression of fish length on otolith radius were observed among treatments, suggesting that slow growth alone may not be sufficient to result in decoupling of the otolith size-fish size relationship in striped bass.

  5. Combining telephone surveys and fishing catches self-report: the French sea bass recreational fishery assessment.

    Directory of Open Access Journals (Sweden)

    Delphine Rocklin

    Full Text Available Fisheries statistics are known to be underestimated, since they are mainly based on information about commercial fisheries. However, various types of fishing activities exist and evaluating them is necessary for implementing effective management plans. This paper assesses the characteristics and catches of the French European sea bass recreational fishery along the Atlantic coasts, through the combination of large-scale telephone surveys and fishing diaries study. Our results demonstrated that half of the total catches (mainly small fish were released at sea and that the mean length of a kept sea bass was 46.6 cm. We highlighted different patterns of fishing methods and type of gear used. Catches from boats were greater than from the shore, both in abundance and biomass, considering mean values per fishing trip as well as CPUE. Spearfishers caught the highest biomass of sea bass per fishing trip, but the fishing rod with lure was the most effective type of gear in terms of CPUE. Longlines had the highest CPUE value in abundance but not in biomass: they caught numerous but small sea bass. Handlines were less effective, catching few sea bass in both abundance and biomass. We estimated that the annual total recreational sea bass catches was 3,173 tonnes of which 2,345 tonnes were kept. Since the annual commercial catches landings were evaluated at 5,160 tonnes, recreational landings represent 30% of the total fishing catches on the Atlantic coasts of France. Using fishers' self-reports was a valuable way to obtain new information on data-poor fisheries. Our results underline the importance of evaluating recreational fishing as a part of the total amount of fisheries catches. More studies are critically needed to assess overall fish resources caught in order to develop effective fishery management tools.

  6. The effects of bupropion on hybrid striped bass brain chemistry and predatory behavior.

    Science.gov (United States)

    Sweet, Lauren E; Bisesi, Joseph H; Lei, E N Y; Lam, Michael H W; Klaine, Stephen J

    2016-08-01

    Increased use of antidepressants has led to an increase in their detection in final treated wastewater effluents and receiving streams. Antidepressants are intended to modify human behavior by altering brain chemistry, and because of the high functional conservation of antidepressant target receptors in vertebrates, aquatic organisms may be at risk. The antidepressant bupropion is designed to alter brain norepinephrine and dopamine concentrations in humans. The objective of the present study was to understand if alteration of dopaminergic neurotransmitter concentrations in the hybrid striped bass (Morone saxatilis × Morone chrysops) brain by bupropion would alter this predator's ability to capture prey. The authors exposed hybrid striped bass to bupropion in a static system for 6 d, followed by a 6-d recovery period. During the present study's 12-d experiment, each hybrid striped bass was fed 4 unexposed fathead minnows every 3 d, and the time it took the hybrid striped bass to consume each of those 4 fathead minnows was quantified. After each feeding event, hybrid striped bass brains were harvested and analyzed for changes in several brain neurotransmitter concentrations, including serotonin, norepinephrine, dopamine, and many of their metabolites. Although bupropion altered the concentration of dopamine and many of the dopaminergic neurotransmitter metabolite concentrations in the brains on day 3 of the exposure, it did not alter the time to capture prey. This suggests that alteration of dopaminergic neurotransmitter concentrations in the hybrid striped bass brain does not alter a predator's ability to capture prey. Environ Toxicol Chem 2016;35:2058-2065. © 2016 SETAC. PMID:26748934

  7. Indigenous development and performance evaluation of BARC aerodynamic size separator (BASS)

    International Nuclear Information System (INIS)

    Commercially available cascade impactors, commonly used for aerodynamic size separation of aerosol particles, are based on the principle of inertial impaction. As of now, these instruments are imported at a cost of several lakhs of rupees; hence an effort has been made to develop an aerodynamic particle sizer indigenously in BARC. This unit, referred to as BARC Aerodynamic Size Separator (BASS), separates aerosols into seven size classes ranging from 0.53 μm to 10 μm and operates at a flow rate of 45 Ipm. Intercomparison studies between the standard Andersen Mark-II (Grasbey Andersen Inc.) impactor and BASS using nebulizer generated aerosols have consistently shown excellent performance by BASS in all respects. In particular, BASS yielded the parameters of polydisperse aerosols quite accurately. Experiments to evaluate the individual stage cut-off diameters show that these are within 8% of their designed value for all stages except the higher two stages which indicate about 30% lower values than the designed ones. The replotting of all the mass distribution data using the experimental cut-off diameters showed perfect lognormal fits, thereby indicating that these diameters are closer to the true stage cut-off diameters for BASS. The studies show that BASS will be suitable for determining the particle size distributions in the context of the radiological safety programmes of DAE. Being indigenous in design, it may be fabricated on a commercial scale at a cost far less than that of the imported units. Such a venture will greatly help several national programmes on atmospheric pollution being carried out by many laboratories and institutions across the country. (author)

  8. DIETS IN SEA BASS AND SEA BREAM REARING — DEVELOPMENT AND PROSPECTIVE

    Directory of Open Access Journals (Sweden)

    Lav Bavčević

    2006-07-01

    Full Text Available Sea bass feeding, in the early beginning of cage culture activity, was based on modified trout pellets and minced sardines. Soon–after knowledge on sea bass and sea bream nutritional needs has been rapidly improved. Recommended balance between digestible proteins and digestible energy (DP/DE in sea bass and sea bream diets according to different authors is between 19— 21 MJ/kg and 21–24 MJ/kg. Variations of optimal DP/DE in scientific publications in the past, seems to be reflected on significant variation of DP/DE in commercial diets of different producers. Simple method to estimate optimal amino acid balance in the diet is amino acid analysis of whole body protein. Fat content in feed for sea bass and sea bream is around 20 %. Required enrichment with essential fatty acids (especially HUFA n 3 is usually resolved when at least 7% of fish oil is added in the diet. Essential fatty acid (EFA relative content in farmed sea bass and sea bream muscle fat was found to be similar to the relative content of EFA in fish oil. Vitamins–mineral premixes are standardized and given in higher concentration only in special feeds which can be enriched with immunostimulatns, and used in specific circumstances to improve immunobalance. To establish new feed production for sea bass and sea bream rearing, beside needed knowledge of nutritive value of raw materials and seasonal variations in fish demand, is important to know growth dynamics of cultured organisms and, is the most important — market situation. Competition and increased problems with quality raw material supply are constantly increasing production cost effective value. Today the margin for income–outcome equilibrium are 20 000 t, with the accent that it will be higher in coming years.

  9. Bass-Ihara Zeta functions for non-uniform tree lattices and class number asymptotics

    OpenAIRE

    Deitmar, Antonius; Kang, Ming-Hsuan

    2014-01-01

    It is shown that the Euler product giving the Bass-Ihara zeta function of a finite graph also converges in the case of a non-compact arith- metic quotient graph. Despite the infinite-dimensional setting, it turns out to be a rational function, generally with zeros and poles, in contrast to the compact case. The determinant formulas of Bass and Ihara hold true if one defines the determinant as limit of all finite principal minors. From this analysis, a prime geodesic theorem is derived, which,...

  10. Swimming muscles power suction feeding in largemouth bass.

    Science.gov (United States)

    Camp, Ariel L; Roberts, Thomas J; Brainerd, Elizabeth L

    2015-07-14

    Most aquatic vertebrates use suction to capture food, relying on rapid expansion of the mouth cavity to accelerate water and food into the mouth. In ray-finned fishes, mouth expansion is both fast and forceful, and therefore requires considerable power. However, the cranial muscles of these fishes are relatively small and may not be able to produce enough power for suction expansion. The axial swimming muscles of these fishes also attach to the feeding apparatus and have the potential to generate mouth expansion. Because of their large size, these axial muscles could contribute substantial power to suction feeding. To determine whether suction feeding is powered primarily by axial muscles, we measured the power required for suction expansion in largemouth bass and compared it to the power capacities of the axial and cranial muscles. Using X-ray reconstruction of moving morphology (XROMM), we generated 3D animations of the mouth skeleton and created a dynamic digital endocast to measure the rate of mouth volume expansion. This time-resolved expansion rate was combined with intraoral pressure recordings to calculate the instantaneous power required for suction feeding. Peak expansion powers for all but the weakest strikes far exceeded the maximum power capacity of the cranial muscles. The axial muscles did not merely contribute but were the primary source of suction expansion power and generated up to 95% of peak expansion power. The recruitment of axial muscle power may have been crucial for the evolution of high-power suction feeding in ray-finned fishes. PMID:26100863

  11. Maternally transferred mercury in wild largemouth bass, Micropterus salmoides

    International Nuclear Information System (INIS)

    Maternal transfer of mercury in fish represents a potential route of elimination for adult females and a risk to developing embryos. To better quantify maternal transfer, we measured Hg in female largemouth bass (Micropterus salmoides) muscle and eggs from six waterbodies. Mercury in eggs from two waterbodies exceeded a US federal screening level (0.3 μg g−1) and was likely high enough to cause adverse reproductive effects. We found a curvilinear relationship between female and egg Hg. Fish with −1 Hg had low levels of Hg in eggs; those with Hg >0.37 μg g−1 showed a direct relationship between egg and muscle Hg (Log10 egg Hg = −1.03 + 1.18 * log10 muscle tissue Hg + 2.15 * (log10 muscle tissue Hg + 0.35)2). We also report higher maternal transfer (0.2–13.2%) and higher ratios of egg to muscle tissue Hg (4–52%) and egg to whole body Hg concentrations (7–116%) than previously observed for teleost fish. Highlights: •Previous work suggests maternal Hg transfer in teleosts is consistently low. •We provide evidence that teleosts can have high maternal Hg transfer. •Females with low Hg had similar and low concentrations of Hg in their eggs. •Females with high Hg had Hg in eggs that increased with somatic tissue Hg. •Egg Hg from high Hg females exceeded adverse effect levels. -- Capsule: Here we report higher maternal transfer and higher ratios of egg to muscle tissue Hg than previously observed for teleost fish

  12. Characterization of the environmental quality of sediments from two estuarine systems based on different in-vitro bioassays.

    Science.gov (United States)

    Fernandes, Denise; Pujol, Silvia; Pérez-Albaladejo, Elisabet; Tauler, Romà; Bebianno, Maria João; Porte, Cinta

    2014-05-01

    This study characterizes the environmental quality of sediments from the Arade and Guadiana estuaries using different in-vitro bioassays: a) fish hepatoma cell line (PLHC-1) to determine cytotoxicity and presence of CYP1A and oxidative stress inducing agents; b) gonad subcellular fractions from sea bass (Dicentrarchus labrax) to detect compounds that are likely to act as endocrine disrupters by interfering with the synthesis of androgens (CYP17, CYP11β) and estrogens (CYP19). Approximately 60% of extracts from the Arade estuary were cytotoxic when tested at 60 mg eQsed/mL, while only one sample from Guadiana showed cytotoxicity. Sediments from Arade collected close to harbours and waste water effluents were enriched with CYP1A inducing agents, while those from the upper Guadiana induced oxidative stress in PLHC-1 cells. On the other hand, several extracts from both estuaries were able to significantly inhibit CYP17, CYP11β and CYP19 activities in gonad subcellular fractions of sea bass, which indicates the presence of endocrine disrupters, particularly in several sites from the Arade estuary. Overall, the study highlights the usefulness of in-vitro bioassays to identify those sediments that could pose risk to aquatic organisms and that require further action to improve their environmental quality. PMID:24140013

  13. Indigenous development and performance evaluation of BARC aerodynamic size separator (BASS)

    CERN Document Server

    Singh, S; Khan, A; Mayya, Y S; Narayanan, K P; Purwar, R C; Sapra, B K; Sunny, F

    2002-01-01

    Commercially available cascade impactors, commonly used for aerodynamic size separation of aerosol particles, are based on the principle of inertial impaction. As of now, these instruments are imported at a cost of several lakhs of rupees; hence an effort has been made to develop an aerodynamic particle sizer indigenously in BARC. This unit, referred to as BARC Aerodynamic Size Separator (BASS), separates aerosols into seven size classes ranging from 0.53 mu m to 10 mu m and operates at a flow rate of 45 Ipm. Intercomparison studies between the standard Andersen Mark-II (Grasbey Andersen Inc.) impactor and BASS using nebulizer generated aerosols have consistently shown excellent performance by BASS in all respects. In particular, BASS yielded the parameters of polydisperse aerosols quite accurately. Experiments to evaluate the individual stage cut-off diameters show that these are within 8% of their designed value for all stages except the higher two stages which indicate about 30% lower values than the desig...

  14. Laboratory experiment on bioaccumulation of 109Cd and 134Cs in white sea bass

    International Nuclear Information System (INIS)

    Laboratory radiotracer experiment was performed to study the bioaccumulation of 109Cd and 134Cs in the Malaysian common fish White sea bass (Lates calcarifer). The aim of this study was to compare the biokinetics of uptake these two contrasting radionuclides by White sea bass in laboratory condition scale. Experiments were designed to determine the processes controlling uptake of both radionuclides following exposure via seawater. In this study, the curve shapes of the uptake kinetic of 109Cd and 134Cs in White sea bass were slightly linear and gradually increased with increasing of exposure time but were not reach equilibrium in the period of the study of 21 days. This phenomenon can be concluded that radioelement concentrations of 109Cd and 134Cs, and exposure duration of this experiment may not adequately to reach steady-state condition for uptake kinetic of those radioelements in White sea bass. Furthermore, this was indicated that the uptake rate of 109Cd was 1.79 times faster than 134Cs due to some factors may probably influenced the output of this experiment such as different element accumulation strategies, physiological, behavior of radioelements, for example. (author)

  15. 78 FR 18931 - Proposed Establishment of Class E Airspace; Bass Harbor, ME

    Science.gov (United States)

    2013-03-28

    ...'' under DOT Regulatory Policies and Procedures (44 FR 11034; February 26, 1979); and (3) does not warrant... continues to read as follows: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3... Federal Aviation Administration 14 CFR Part 71 Proposed Establishment of Class E Airspace; Bass Harbor,...

  16. Laboratory approaches to understanding gonadal development and abnormalities in wild-caught smallmouth bass (Micropterus dolomieu)

    Science.gov (United States)

    Our previous work reported smallmouth bass in Northeastern Minnesota rivers and lakes with a prevalence of testicular oocytes (TOs) ranging from 7 to 57%, which is consistent with findings reported in other U.S. river systems. While it is often presumed that TOs are caused by ex...

  17. BIOACCUMULATION AND AQUATIC SYSTEM SIMULATOR (BASS) USER'S MANUAL BETA TEST VERSION 2.1

    Science.gov (United States)

    BASS (Bioaccumulation and Aquatic System Simulator) is a Fortran 95 simulation program that predicts the population and bioaccumulation dynamics of age-structured fish assemblages that are exposed to hydrophobic organic pollutants and class B and borderline metals that complex wi...

  18. 77 FR 76942 - 2013-2014 Summer Flounder and Scup Specifications; 2013 Black Sea Bass Specifications...

    Science.gov (United States)

    2012-12-31

    ... specifications for these fisheries was provided in the proposed specifications (77 FR 68723; November 16, 2012... rule (77 FR 68723). Comment 1: One commenter suggested that the quotas should be reduced by 50 percent... and Scup Specifications; 2013 Black Sea Bass Specifications; Preliminary 2013 Quota Adjustments;...

  19. 78 FR 32355 - Establishment of Class E Airspace; Bass Harbor, ME

    Science.gov (United States)

    2013-05-30

    ... Bass Harbor, ME (78 FR 18931). Interested parties were invited to participate in this rulemaking effort... Procedures (44 FR 11034; February 26, 1979); and (3) does not warrant preparation of a Regulatory Evaluation...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p....

  20. 75 FR 17618 - Fisheries of the Northeastern United States; Black Sea Bass Recreational Fishery; Emergency Rule...

    Science.gov (United States)

    2010-04-07

    ... effective October 5, 2009 (74 FR 51092), for a period of 180 days. This closure was necessary as the... implement the closure, and requires correction. Thus, this action is correcting the October 5, 2009 (74 FR... United States; Black Sea Bass Recreational Fishery; Emergency Rule Correction and Extension...

  1. Low frequency sound reproduction in irregular rooms using CABS (Control Acoustic Bass System)

    DEFF Research Database (Denmark)

    Celestinos, Adrian; Nielsen, Sofus Birkedal

    2011-01-01

    Early investigations on low frequency sound reproduction in rectangular rooms using CABS (Controlled Acoustic Bass System) have shown good results on simulations and measurements in real rooms. CABS takes the advantage of having a rectangular room with parallel walls. By using two low frequency l...

  2. Comparison of tank treatments with copper sulfate and potassium permanganate for sunshine bass with ichthyobodosis

    Science.gov (United States)

    The biflagellated single-cell parasite Ichthyobodo nectator can cause significant losses among fish populations, particularly those cultured in tanks. Potassium permanganate and CuSO4 treatments were evaluated against a naturally-occurring I. nectator infestation on sunshine bass raised in tanks. F...

  3. Laboratory efficacy of florfenicol against Streptococcus iniae infection in sunshine bass

    Science.gov (United States)

    An experimental feeding trial was performed to evaluate the efficacy of florfenicol (FF) in controlling Streptococcus iniae infection in sunshine bass (SB). Doses of FF tested were 0, 5, 10, 15 and 30 mg active ingredient per kilogram of fish body weight (BW) per day. Administration of medicated f...

  4. Phytoplankton succession in sunshine bass fry ponds and the effect of Aquashade®

    Science.gov (United States)

    Phytoplankton management in aquaculture ponds is very critical in maintaining good quality water for culturing fish especially during the fry and fingerling stages. Though much is known about succession in catfish ponds, that is not the case for sunshine bass ponds. This study was designed to look a...

  5. Amen-break : Från ett samplat trumbreak till nya trumkomp i drum'n'bass-musik.

    OpenAIRE

    Björni, Patrik

    2012-01-01

    Drum’n’bass är en genre inom elektronisk dansmusik som utvecklades under 1990-talet. Genren kännetecknas av rytmiskt komplexa trumkomp. Syftet med detta arbete är att ge en uppfattning av trumkomp, vilka kallas för breakbeats i drum’n’bass-musik. Med hjälp av litteratur har jag forskat i historien om drum’n’bass för att ge en uppfattning om hur genren utvecklades och dess bakgrund. Breakbeats är skapade genom att sampla och bearbeta trumkomp från äldre funk-och soullåtar med elektronisk...

  6. Diel behavior of adult striped bass using tailwater habitat as summer refuge

    Science.gov (United States)

    Young, S.P.; Isely, J.J.

    2007-01-01

    General patterns of summer diel distribution and movement were identified for adult striped bass Morone saxatilis using tailwater habitat influenced by the diel operation cycle of a hydroelectric dam during the summers of 2003 and 2004. Striped bass distribution within the tailwater was similar during each diel-tracking event and across both summers. The majority of fish remained within the tailwater the entire summer; however, some made periodic excursions to and from the tailwater throughout the summer. Further, most striped bass were located within 0.5 km of Richard B. Russell Dam during all stages of operation on all occasions - probably because of the constant availability of optimal habitat during all three stages of operation on all diel-tracking events. The diel cycle of dam operation, which included pumped storage during each summer, did not degrade tailwater habitat below optimal conditions, according to summer habitat suitability index values for inland adult striped bass. Movement was significantly higher during hydroelectric generation operations than during no-generation and pumped storage periods in summer 2003; this difference was not apparent during summer 2004. Mean absolute movement peaked during hydroelectric generation on six of eight diel-tracking events. During both summers, movement was directed up-reservoir during no-generation and generation periods and down-reservoir during pumped storage. Mean total daily movement rates ranged from 0.59 to 4.04 km/d and were greater than those previously estimated from bimonthly sampling for this population. Total daily movement rate peaked during the first tracking event each summer and then declined as summer progressed. These findings suggest that hydroelectric discharges affect adult striped bass behavior, but the effects are not adverse as long as habitat is not degraded by hydroelectric facility operations. ?? Copyright by the American Fisheries Society 2007.

  7. Mercury and selenium concentrations in largemouth bass and other fishes of the Lower Suwannee National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From March 22 to April 7, 1990, 71 largemouth bass (Micropterus salmoides) and four other fish species (total of seven fish) were collected from ten locations on or...

  8. Streptococcus iniae infection in cultured Asian sea bass (Lates calcarifer and red tilapia (Oreochromis sp. in southern Thailand

    Directory of Open Access Journals (Sweden)

    Kidchakan Supamattaya

    2010-08-01

    Full Text Available Streptococcal infections are becoming an increasing problem in aquaculture and have been reported worldwide in avariety of fish species. Here we describe the isolation and characterization of Streptococcus iniae from Asian sea bass (Latescalcarifer and red tilapia (Oreochromis sp. cultured in southern Thailand. Conventional and rapid identification systems,as well as the polymerase chain reaction (PCR, were used to determine that the isolate was S. iniae. The virulence of thisS. iniae was higher in Asian sea bass than in red tilapia, as shown by the 10 day-LD50 in Asian sea bass and red tilapia, being1.08x104 and 1.14x107 CFU, respectively. Histopathological changes in Asian sea bass are more severe than those observedin red tilapia. The changes can be found in several organs including liver, pancreas, heart, eye and brain. Histopathologicalfindings included cellular necrosis, infiltration of lymphocytes and granuloma formation in the infected organs.

  9. Metal contaminants in Largemouth bass (Micropterus salmoides) collected in large dams from Tejo River basin and small irrigation dams

    OpenAIRE

    L.P. Andrade; Antunes, P.; Paulo, L; Pereira, M. E.; A.M. Rodrigues

    2012-01-01

    Largemouth bass (Micropterus salmoides) is a very important fresh water fish in the Portuguese regional cuisine mainly in the countryside (Central region and north Alentejo). Because there’s no aquaculture industry, all eaten largemouth bass in Portugal are collected in large dams (Basins of Tejo and Guadiana rivers) and small irrigation dams. For decades, the Tejo River received environmental pollutants from non-point and point sources that included intensive agriculture, industrial entities...

  10. Dental and orthopedic effects of Bass and Herbst therapy for correction of severe class II division 1 malocclusions

    OpenAIRE

    Ömblus, Jane

    1996-01-01

    Ömblus J (1996). Dental and orthopedic effects of Bass and Herbst therapy for correction of severe Class 1I division l malocclusions. Thesis, Karolinska Institutet. Functional appliance therapy to correct Class II division I malocclusions has been a subject of debate throughout this century. The aims of this thesis, based on six publications, were to evaluate the dental and orthopedic effects of Bass appliance therapy in relation to treatment intensity, age, an...

  11. Effect of stocking density on growth and survival of spotted sand bass Paralabrax maculatofasciatus larvae in a closed recirculating system

    OpenAIRE

    Álvarez González, Carlos; Ortiz Galindo, José Luis; Dumas, Silvie; Martínez Díaz, Sergio Francisco; Hernández Ceballos, Dora Esther; Grayeb del Alamo, Tanos; Moreno Lagorreta, Manuel; Peña Martínez, Renato; Civera Cerecedo, Roberto

    2001-01-01

    The effect on growth and survival of the initial stocking density (50, 100, 150, and 200 larvae/ L) in larval rearing of spotted sand bass was evaluated over 30 d in a closed recirculating system. Larvae were fed with rotifers, copepods, nauplii and adult Artemia, and spotted sand bass yolk-sac larvae. Water quality was monitored daily. The notochordal or standard length of sampled larvae was measured by image analysis. Specific growth rates at each density were compared by covariance analysi...

  12. Effects of incremental increases in silt load on the cardiovascular performance of riverine and lacustrine rock bass, Ambloplites rupestris

    International Nuclear Information System (INIS)

    Rock bass (Ambloplites rupestris) are a widespread centrarchid species with both riverine and lacustrine populations. After precipitation events, rivers often carry elevated silt loads, where as lakes generally remain free from suspended silt and sediment. To examine the physiological effects of silt on rock bass, we conducted a series of experiments using fish from Lake Opinicon and the Grand River in Ontario. Ultrasonic Doppler flow probes were surgically affixed around the ventral aorta to monitor cardiovascular performance. After recovery from surgery replicated treatment groups were exposed to incremental increases in silt load (made from bentonite slurry), while cardiac output and its two components, heart rate and stroke volume, were measured simultaneously. Although both groups of rock bass responded significantly to low concentrations of silt (10 NTU), the response by riverine rock bass was rapidly extinguished by acclimation or physiological adjustment. Compensatory mechanisms to minimize cardiac (and respiratory) disruption attributable to increases in suspended silt appear to be inherent in rock bass of riverine origin. These fish appear to fully compensate for interference in gas exchange at the gill surfaces 60 min after initial exposure. In contrast, individual lacustrine rock bass were highly variable in their response to elevated silt concentrations. Changes in stroke volume and cardiac output suggested no clear compensatory mechanism or strategy to cope with increased silt levels. - Cardiovascular compensation in fish exposed to elevated levels of silt

  13. Purification and characterization of the carbonic anhydrase enzyme from Black Sea trout (Salmo trutta Labrax Coruhensis) kidney and inhibition effects of some metal ions on enzyme activity.

    Science.gov (United States)

    Kucuk, Murat; Gulcin, İlhami

    2016-06-01

    In this study, the carbonic anhydrase (CA) enzyme was purified from Black Sea trout (Salmo trutta Labrax Coruhensis) kidney with a specific activity of 603.77EU/mg and a yield of 35.5% using Sepharose-4B-l-tyrosine- sulphanilamide affinity column chromatography. For determining the enzyme purity and subunit molecular mass, sodiumdodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE) was performed and single band was observed. The molecular mass of subunit was found approximately 29.71kDa. The optimum temperature, activation energy (Ea), activation enthalpy (ΔH) and Q10 values were obtained from Arrhenius plot. Km and Vmax values for p-nitrophenyl acetate of the purified enzyme were calculated from Lineweaver-Burk graphs. In addition, the inhibitory effects of different heavy metal ions (Fe(2+), Pb(2+), Co(2+), Ag(+) and Cu(2+)) on Black Sea trout kidney tissue CA enzyme activities were investigated by using esterase method under in vitro conditions. The heavy metal concentrations inhibiting 50% of enzyme activity (IC50) were obtained. Finally Ki values and inhibition types were calculated from Lineweaver-Burk graphs. PMID:27175889

  14. MODELISATION, CONCEPTION ET COMMANDE DE GENERATRICES A RELUCTANCE VARIABLE BASSE VITESSE

    OpenAIRE

    Moreau, Luc

    2005-01-01

    Les travaux présentés portent sur la conception et la commande d'un ensemble convertisseur-génératrice basse vitesse pour les applications éoliennes. Une génératrice 10kW, 50 tr/min (contrainte typique d'une éolienne autonome) est étudiée. La machine à réluctance variable (MRV) à plots dentés et à grand nombre de dents est retenue car elle est bien adaptée à un fonctionnement à basse vitesse de rotation permettant la simplification ou la suppression du multiplicateur de vitesse utilisé avec l...

  15. Interplay Between Amphioxus Complement with Sea Bass Macrophages: Opsonic Activity of Amphioxus Humoral Fluids

    Institute of Scientific and Technical Information of China (English)

    PAN Junli; LIU Min; ZHANG Shicui

    2011-01-01

    Previous studies have shown the existence of a complement system in the amphioxus Branchiostoma japonicum.However,whether it has an opsonic activity similar to that of vertebrates remains unknown.We demonstrated that the humoral fluid (HF)of amphioxus promoted the phagocytosis of yeast cells with sea bass (Lateolabraxjaponicus) macrophages,whereas the C3-depleted and heated HF significantly lost the phagocytosis-promoting capacity.In addition,the precipitation of factor B (Bf) led to a marked loss of opsonic activity.Moreover,C3 fragments in the HF were found to bind to yeast cell surfaces.The results indicate that the amphioxus complement system is an important element involved in the opsonic activity,which promotes the sea bass macrophage phagocytosis by tagging yeast cells with C3 fragments via the activation of alternative complement pathway.

  16. Plasma osmotic and electrolyte concentrations of largemouth bass from some acidic Florida lakes

    Energy Technology Data Exchange (ETDEWEB)

    Canfield, D.E. Jr.; Maceina, M.J.; Nordlie, F.G.; Shireman, J.V.

    1985-05-01

    Five acidic clear (pH 3.7-4.9), three acidic colored (pH 4.1-4.6), and three neutral (pH 6.9-7.3) north-central Florida lakes were surveyed in 1983 to determine plasma osmotic and electrolyte concentrations, growth, and coefficients of condition for largemouth bass Micropterus salmoides floridanus. Plasma osmotic concentrations averaged greater than 273 milliosmoles/kg in fish from acidic colored and circumneutral lakes, but averaged less than 269 milliosmoles/kg in four of the acidic clear lakes. Growth and coefficients of condition of largemouth bass > 305 mm total length in the acidic lakes were significantly lower than in the neutral lakes. Reductions in fish growth and condition, however, could be related to either acidic conditions or lake trophic status. 29 references, 3 tables.

  17. BASS 4: a software system for ergonomic design and evaluation of working hours

    Directory of Open Access Journals (Sweden)

    Carsten Schomann

    2004-12-01

    Full Text Available OBJECTIVE: To extend an existing computer programme for the evaluation and design of shift schedules (BASS 3 by integrating workload as well as economic aspects. METHODS: The redesigned prototype BASS 4 includes a new module with a suitable and easily applicable screening method (EBA for the assessment of the intensity of physical, emotional and cognitive workload components and their temporal patterns. Specified criterion functions based on these ratings allow for an adjustment of shift and rest duration according to the intensity of physical and mental workload. Furthermore, with regard to interactive effects both workload and temporal conditions, e.g. time of day, are taken into account. In a second new module, important economic aspects and criteria have been implemented. Different ergonomic solutions for scheduling problems can now also be evaluated with regard to their economic costs. RESULTS: The new version of the computer programme (BASS 4 can now simultaneously take into account numerous ergonomic, legal, agreed and economic criteria for the design and evaluation of working hours. CONCLUSIONS: BASS 4 can now be used as an instrument for the design and the evaluation of working hours with regard to legal, ergonomic and economic aspects at the shop floor as well as in administrative (e.g. health and safety inspection and research problems.OBJETIVOS: Expandir um programa computacional existente para planejamento e avaliação dos horários de turnos (BASS 3 por meio da incorporação da carga de trabalho e características econômicas. MÉTODOS: O protótipo BASS 4 contém um novo módulo com um método de triagem (EBA conveniente e de fácil aplicação para a avaliação da intensidade dos componentes físico, emocional e cognitivo da carga de trabalho e seus padrões temporais. O uso de critérios específicos com base nestas avaliações possibilita ajustar a duração do turno e do descanso de acordo com a intensidade da carga de

  18. Wind energy in ''Basse Normandie'': the energies of the sustainable development

    International Nuclear Information System (INIS)

    This paper brings together the main topics discussed during the 4. colloquium on the wind energy: the french lateness concerning the wind energy development, the regulatory framework concerning the wind turbines implementation sites, the wind energy situation in ''Basse Normandie'', the offshore wind energy, the site of Sortosville-en-Beaumont, the public relations, the employment and an analysis of some rumors and prejudices. (A.L.B.)

  19. Application of a bioenergetics model for hatchery production: Largemouth bass fed commercial diets

    Science.gov (United States)

    Csargo, Isak J.; Michael L. Brown; Chipps, Steven R.

    2012-01-01

    Fish bioenergetics models based on natural prey items have been widely used to address research and management questions. However, few attempts have been made to evaluate and apply bioenergetics models to hatchery-reared fish receiving commercial feeds that contain substantially higher energy densities than natural prey. In this study, we evaluated a bioenergetics model for age-0 largemouth bass Micropterus salmoidesreared on four commercial feeds. Largemouth bass (n ≈ 3,504) were reared for 70 d at 25°C in sixteen 833-L circular tanks connected in parallel to a recirculation system. Model performance was evaluated using error components (mean, slope, and random) derived from decomposition of the mean square error obtained from regression of observed on predicted values. Mean predicted consumption was only 8.9% lower than mean observed consumption and was similar to error rates observed for largemouth bass consuming natural prey. Model evaluation showed that the 97.5% joint confidence region included the intercept of 0 (−0.43 ± 3.65) and slope of 1 (1.08 ± 0.20), which indicates the model accurately predicted consumption. Moreover model error was similar among feeds (P = 0.98), and most error was probably attributable to sampling error (unconsumed feed), underestimated predator energy densities, or consumption-dependent error, which is common in bioenergetics models. This bioenergetics model could provide a valuable tool in hatchery production of largemouth bass. Furthermore, we believe that bioenergetics modeling could be useful in aquaculture production, particularly for species lacking historical hatchery constants or conventional growth models.

  20. Water chemistry characterization and component performance of a recirculating aquaculture system producing hybrid striped bass

    OpenAIRE

    Easter, Christopher

    1992-01-01

    Eight identical and independent pilot scale recirculating aquaculture production systems were populated with fingerling hybrid striped bass (Morone chrysops female x Morone saxatilis male). Three population densities were established with two replicates at 132 fishlm3 and three replicates each at 66 and 33 fishlm3. Water chemistry and water quality characteristics were monitored throughout the 228 day growth trial for all eight systems. A system component performance analys...

  1. Summer habitat selection by striped bass, Morone Saxatilis, in Cherokee Reservoir, Tennessee, 1977

    Energy Technology Data Exchange (ETDEWEB)

    Waddle, H.R.; Coutant, C.C.; Wilson, J.L.

    1980-02-01

    Summer habitat selection patterns of 18 adult striped bass (Morone saxatilis) in Cherokee Reservoir were monitored with externally attached temperature-sensing acoustic or radio transmitters from June through September 1977. Mortalities of adult striped bass in this reservoir were hypothesized to be related to high summer temperatures and low dissolved oxygen (DO). The inhabited areas or refuges differed from noninhabited areas by maintaining temperatures less than or equal to 22 C and DO concentrations greater than 5 mg/liter. Total water hardness, pH, and water transparency were not significantly different among refuges and noninhabited areas. Movement of fish outside refuges occurred more frequently and for longer periods during June when the summer pattern of high temperatures and low DO was less severe. Fish experienced temperatures between 15 and 27 C with mean temperatures of individuals ranging from 18.5 to 22.0 C. Several tagged fish migrated outside the refuges and selected the lowest available temperature, generally near 21 C, even though DO concentrations at these temperatures were 3 mg/liter or less. Long-term survival of tagged and nontagged fish outside refuges was undetermined because no fish were tracked outside a refuge for more than 12 days without being lost. This study indicates that temperature strongly influences the behavior of striped bass and that adults of this species may have a thermal preferendum of approximately 21 C.

  2. 137Cs elimination by chronically-contaminated largemouth bass (Micropterus salmoides)

    International Nuclear Information System (INIS)

    The temperature-dependent 137Cs biological half-times (Tb) of lifetime-exposed largemouth bass (Micropterus salmoides) from a nuclear cooling reservoir at the US Department of Energy's Savannah River Site were calculated from whole-body measurements of live fish and compared with literature records for acutely and chronically-contaminated fish. The Tb's of the bass averaged 322 d, 225 d, and 140 d at 15, 20, and 26 C, respectively. These mean Tb's were 1.7 to 2.5 times longer than would be expected for acutely contaminated fish, and 1.2 to 1.8 times longer than those predicted for fish at steady-state with their environment according to recent models. This slower elimination did not appear to result from slower elimination from skeletal muscle compared with other soft tissues, in that the muscle to whole-body 137Cs concentration ratios after the elimination period were similar to those of freshly-caught bass. Their results suggested that elimination rates estimated from the terminal elimination components of acutely-dosed fish may not reflect the elimination rates of fish exposed to contaminants throughout their lifetime, even when care is taken to allow sufficient time for absorption of the dose

  3. Histologic and molecular characterization of Edwardsiella piscicida infection in largemouth bass (Micropterus salmoides).

    Science.gov (United States)

    Fogelson, Susan B; Petty, Barbara D; Reichley, Stephen R; Ware, Cynthia; Bowser, Paul R; Crim, Marcus J; Getchell, Rodman G; Sams, Kelly L; Marquis, Hélène; Griffin, Matt J

    2016-05-01

    The genus Edwardsiella is composed of a diverse group of facultative anaerobic, gram-negative bacteria that can produce disease in a wide variety of hosts, including birds, reptiles, mammals, and fish. Our report describes the isolation and identification of Edwardsiella piscicida associated with chronic mortality events in 2 separate captive largemouth bass (Micropterus salmoides) populations in New York and Florida. Wet-mount biopsies of skin mucus, gill, kidney, and spleen from several affected largemouth bass contained significant numbers of motile bacteria. Histologic examination revealed multifocal areas of necrosis scattered throughout the heart, liver, anterior kidney, posterior kidney, and spleen. Many of the necrotic foci were encapsulated or replaced by discrete granulomas and associated with colonies of gram-negative bacteria. Initial phenotypic and matrix-assisted laser desorption ionization-time of flight mass spectrometric analysis against existing spectral databases of recovered isolates identified these bacteria as Edwardsiella tarda Subsequent molecular analysis using repetitive sequence mediated and species-specific PCR, as well as 16S rRNA, rpoB, and gyrB sequences, classified these isolates as E. piscicida As a newly designated taxon, E. piscicida should be considered as a differential for multiorgan necrosis and granulomas in largemouth bass. PMID:26951328

  4. Biomarker Benchmarks: Reproductive and Endocrine Biomarkers in Largemouth Bass and Common Carp from United States Waters

    Science.gov (United States)

    Goodbred, Steven L.; Smith, Stephen B.; Greene, Patricia S.; Rauschenberger, Richard H.; Bartish, Timothy M.

    2007-01-01

    The U.S. Geological Survey (USGS) has developed a national database and report on endocrine and reproductive condition in two species of fish collected in U.S. streams and rivers. This information provides scientists with a national basis for comparing results of endocrine measurements in fish from individual sites throughout the country, so that scientists can better ascertain normal levels of biomarkers. The database includes information on several measures of reproductive and endocrine condition for common carp and largemouth bass. Data summaries are provided by reproductive season and geographic region. A national-scale reconnaissance investigation was initiated in 1994 by the USGS that utilized a suite of biological assays (biomarkers) as indicators of reproductive health, and potentially, endocrine disruption in two widely distributed species of teleost (bony) fish, largemouth bass (Micropterus salmoides) and common carp (Cyrinus carpio). The suite of assays included plasma sex-steroid hormones, stage of gonadal development, and plasma vitellogenin, an egg protein that indicates exposure to estrogenic compounds when found in male fish. More than 2,200 common carp and 650 largemouth bass were collected at 119 rivers and streams (fig. 1).

  5. A simple model for predicting survival of angler-caught and released largemouth bass

    Science.gov (United States)

    Wilde, G.R.; Pope, K.L.

    2008-01-01

    We conducted a controlled experiment in the laboratory to assess the influence of anatomical hooking location and water temperature on survival of angler-caught and released largemouth bass Micropterus salmoides. Survival was 98% (58 of 59 fish) among fish that were hand-hooked within the oral cavity (including the gills), whereas survival was 66% (33 of 50 fish) among fish that were hand-hooked in the esophagus. Survival of hooked fish was not significantly influenced by water temperature (7-27??C) or the hooking location X water temperature interaction. We combined our results with prior research to develop a predictive model of largemouth bass survival, which was 98.3% (SD = 1.87%) for fish hooked in the oral cavity and 55.0% (SD = 9.70%) for fish hooked in the esophagus. The model is valid for water temperatures ranging from 7??C to 27??C and allows one to estimate, with known precision, the survival of angler-caught and released largemouth bass without the need for controlled studies or for holding fish in pens or cages to assess delayed mortality. ?? Copyright by the American Fisheries Society 2008.

  6. Abundance and Distribution of Walleye, Northern Squawfish, and Smallmouth Bass in John Day Reservoir, 1984-1985 Progress Report.

    Energy Technology Data Exchange (ETDEWEB)

    Beamesderfer, Raymond C.

    1985-12-01

    Sampling was conducted in John Day Reservoir to collect walleye, northern squawfish and smallmouth bass. Changes in distributions during sampling were characterized from changes in catch per unit effort (CPUE) in sampling areas. Observed movements of marked and radiotagged fish were examined and used to define discrete populations. Abundances were estimated using a modified Schnabel multiple mark and recapture estimator. Abundance estimates were corrected for angler harvest, size specific vulnerability to gear, recruitment due to growth and tag loss during sampling. Age composition of catch was determined to characterize relative contributions of various year classes to the populations. Ages at which fish were fully recruited to gear were defined by catch curves. Survival of fully recruited year classes was calculated from differences in CPUE's between 1984 and 1985. Mean length at age was estimated and used to determine age specific incremental growth. Eighty-eight percent of walleye were caught in McNary tailrace or Irrigon-Paterson, whereas 95% of smallmouth bass were caught from Irrigon-Paterson to the John Day forebay. Abundances of walleye and northern squawfish with fork lengths greater than 250 mm and smallmouth bass with fork lengths greater than 200 mm were estimated to be 16,219, 95,407, and 11,259. Anglers harvested an estimated 235 walleye, 2004 northern squawfish and 4383 smallmouth bass during the sampling season. Six-year-old walleye, 4-year-old northern squawfish and 3-year-old smallmouth bass were most abundant in catches. Walleye and smallmouth bass were fully recruited to sampling gear by age 3. Age at which northern squawfish were fully recruited was uncertain. Mean survival was 46.1% for walleye and 46.5% for northern squawfish. Mean smallmouth bass survival was 46.5% in the lower and 43.7% in the upper reservoir.

  7. Die faktorstruktuur van Bass se veelfaktor- leierskapsvraelys in die Suid-Afrikaanse konteks

    Directory of Open Access Journals (Sweden)

    C .P. Ackermann

    2000-06-01

    Full Text Available The factor structure of Bass's Multifactor Leadership Questionnaire in the South African context. The aim of the study was to determine whether the factor structure of Bass's Multifactor Leadership Questionnaire (MLQ, as a measure of transformational leadership, could be replicated within the South African context. The MLQ was chosen not only because it promised to be a valid and reliable measuring instrument of the construct in question, but also due to the fact that there was an urgent need for such an instrument in the management of human resources within organisations undergoing transformation. The MLQ was administered to 406 subjects within the military context and was subjected to factor analysis and item analysis. The factor analysis yielded three factors, namely transformational leadership, transactional leadership and avoidance of leadership ("laissez faire" leadership. The reliabilities of the scales were determined by means of Cronbach's coefficient alpha, and yielded coefficients of 0,944, 0,736 and 0,803 respectively. The factor structure as conceptualised by Bass (1985 was largely confirmed in the present study. Opsomming Die doel van die studie was om vas te stel of die faktorstruktuur van die Veelfaktorleierskapsvraelys (MLQ van Bass, as maatstafvan transformasionele leierskap, in die Suid-Afrikaanse konteks gerepliseer kon word. Die MLQ is gekies omdat dit belofte inhou as n geldige en betroubare meetinstrument van die onderhawige konstruk, en ook weens die feit dat daar 'n dringende behoefte bestaan aan so n instrument vir gebruik in die bestuur van menslike hulpbronne in organisasies tydens verandering. Die MLQ is op 406 proefpersone binne militêre konteks toegepas, en aan n faktorontleding en n itemontleding onderwerp. Die faktorontleding het drie faktore opgelewer, te wete transformasionele leierskap, transaksionele leierskap en vermyding van leierskap ("laissez faire"-leierskap. Die betroubaarheid van die skale is bepaal

  8. Continuous Tidal Streamflow and Gage-Height Data for Bass and Cinder Creeks on Kiawah Island, South Carolina, September 2007

    Science.gov (United States)

    Conrads, Paul A.; Erbland, John W.

    2009-01-01

    A three-dimensional model of Bass and Cinder Creeks on Kiawah Island, South Carolina, was developed to evaluate methodologies for determining fecal coliform total maximum daily loads for shellfish waters. To calibrate the model, two index-velocity sites on the creeks were instrumented with continuous acoustic velocity meters and water-level sensors to compute a 21-day continuous record of tidal streamflows. In addition to monitoring tidal cycles, streamflow measurements were made at the index-velocity sites, and tidal-cycle streamflow measurements were made at the mouth of Bass Creek and on the Stono River to characterize the streamflow dynamics near the ocean boundary of the three-dimensional model at the beginning, September 6, 2007, and end, September 26, 2007, of the index-velocity meter deployment. The maximum floodtide and ebbtide measured on the Stono River by the mouth of Bass Creek for the two measurements were -155,000 and 170,000 cubic feet per second (ft3/s). At the mouth of Bass Creek, the maximum floodtide and ebbtide measurements during the 2 measurement days were +/-10,200 ft3/s. Tidal streamflows for the 21-day deployment on Bass Creek ranged from -2,510 ft3/s for an incoming tide to 4,360 ft3/s for an outgoing tide. On Cinder Creek, the incoming and outgoing tide varied from -2,180 to 2,400 ft3/s during the same period.

  9. Zooplankton variability and larval striped bass foraging: Evaluating potential match/mismatch regulation

    Science.gov (United States)

    Chick, J.H.; Van Den Avyle, M.J.

    1999-01-01

    We quantified temporal and spatial variability of zooplankton in three potential nursery sites (river, transition zone, lake) for larval striped bass (Morone saxatilis) in Lake Marion, South Carolina, during April and May 1993-1995. In two of three years, microzooplankton (rotifers and copepod nauplii) density was significantly greater in the lake site than in the river or transition zone. Macrozooplankton (>200 ??m) composition varied among the three sites in all years with adult copepods and cladocerans dominant at the lake, and juvenile Corbicula fluminea dominant at the river and transition zone. Laboratory feeding experiments, simulating both among-site (site treatments) and within-site (density treatments) variability, were conducted in 1995 to quantify the effects of the observed zooplankton variability on foraging success of larval striped bass. A greater proportion of larvae fed in the lake than in the river or transition-zone treatments across all density treatments: mean (x), 10x and 100x. Larvae also ingested significantly more dry mass of prey in the lake treatment in both the mean and 10x density treatments. Field zooplankton and laboratory feeding data suggest that both spatial and temporal variability of zooplankton influence larval striped bass foraging. Prey density levels that supported successful foraging in our feeding experiments occurred in the lake during late April and May in 1994 and 1995 but were never observed in the river or transition zone. Because the rivers flowing into Lake Marion are regulated, it may be possible to devise flow management schemes that facilitate larval transport to the lake and thereby increase the proportion of larvae matched to suitable prey resources.

  10. An empirical comparison of stock identification techniques applied to striped bass

    Science.gov (United States)

    Waldman, John R.; Richards, R. Anne; Schill, W. Bane; Wirgin, Isaac; Fabrizio, Mary C.

    1997-01-01

    Managers of migratory striped bass stocks that mix along the Atlantic coast of the USA require periodic estimates of the relative contributions of the individual stocks to coastal mixed- stock fisheries; however, to date, a standard approach has not been adopted. We compared the performances of alternative stock identification approaches, using samples taken from the same sets of fish. Reference (known) samples were collected from three Atlantic coast spawning systems: the Hudson River, Chesapeake Bay, and the Roanoke River. Striped bass of mixed-stock origin were collected from eastern Long Island, New York, and were used as test (unknown) samples. The approaches applied were discriminant analysis of morphometric data and of meristic data, logistic regression analysis of combined meristic and morphometric data, discriminant analysis of scale-shape features, discriminant analysis of immunoassay data, and mixed-stock analysis of mitochondrial DNA (mtDNA) data. Overall correct classification rates of reference samples ranged from 94% to 66% when just the Hudson and Chesapeake stocks were considered and were comparable when the Chesapeake and Roanoke stocks were grouped as the ''southern'' stock. When all three stocks were treated independently, correct classification rates ranged from 82% to 49%. Despite the moderate range in correct classification rates, bias due to misallocation was relatively low for all methods, suggesting that resulting stock composition estimates should be fairly accurate. However, relative contribution estimates for the mixed-stock sample varied widely (e.g., from 81% to 47% for the Hudson River stock, when only the Hudson River and Chesapeake Bay stocks were considered). Discrepancies may be related to the reliance by all of these approaches (except mtDNA) on phenotypic features. Our results support future use of either a morphometrics-based approach (among the phenotypic methods) or a genotypic approach based on mtDNA analysis. We further

  11. A large volume striped bass egg incubation chamber: design and comparison with a traditional method

    Science.gov (United States)

    Harper, C.J.

    2009-01-01

    I conducted a comparative study of a new jar design (experimental chamber) with a standard egg incubation vessel (McDonald jar). Experimental chambers measured 0.4 m in diameter by 1.3 m in height and had a volume of 200 L. McDonald hatching jars measured 16 cm in diameter by 45 cm in height and had a volume of 6 L. Post-hatch survival was estimated at 48, 96 and 144 h. Stocking rates resulted in an average egg density of 21.9 eggs ml-1 (range = 21.6 – 22.1) for McDonald jars and 10.9 eggs ml-1 (range = 7.0 – 16.8) for experimental chambers. I was unable to detect an effect of container type on survival to 48, 96 or 144 h. At 144 h striped bass fry survival averaged 37.3% for McDonald jars and 34.2% for experimental chambers. Survival among replicates was significantly different. Survival of striped bass significantly decreased between 96 and 144 h. Mean survival among replicates ranged from 12.4 to 57.3%. I was unable to detect an effect of initial stocking density on survival. Experimental jars allow for incubation of a larger number of eggs in a much smaller space. As hatchery production is often limited by space or water supply, experimental chambers offer an alternative to extending spawning activities, thereby reducing manpower and cost. However, the increase in the number of eggs per rearing container does increase the risk associated with catastrophic loss of a production unit. I conclude the experimental chamber is suitable for striped bass egg incubation.

  12. Diversity of estuarine movements of striped bass (Morone saxatilis): a synoptic examination of an estuarine system in southern New Jersey

    OpenAIRE

    Kenneth W. Able; Grothues, Thomas M.

    2007-01-01

    We determined the dis-tribution of multiple (n=68; 508−978 mm total length [TL]) striped bass (Morone saxatilis) along the estua-rine salinity gradient in the Mullica River−Great Bay in southern New Jersey over two years to determine the diversity of habitat use and the movements of striped bass. Ultrasoni-cally tagged fish were detected in this estuarine area by means of wireless hydrophones deployed at four gates inside the entrance of the study area and farther up to tidal freshwater (38 k...

  13. IGF-I and branchial IGF receptor expression and localization during salinity acclimation in striped bass

    DEFF Research Database (Denmark)

    Tipsmark, Christian Kølbaek; Luckenbach, John Adam; Madsen, Steffen; Borski, Russell John

    2007-01-01

    The initial response of the IGF-I system and the expression and cellular localization of IGF type-I receptor (IGF-IR) were studied in the gill of a euryhaline teleost during salinity acclimation. Exposure of striped bass (Morone saxatilis) to hyperosmotic and hypoosmotic challenges induced small,...... first time in teleosts that IGF-IR and Na+-K+-ATPase are localized in putative chloride cells at the base of the lamellae, identifying these cells in the gill as a target for IGF-I and IGF-II. Overall the data suggest a hyperosmoregulatory role of IGF-I in this species....

  14. Application of Entropy and Fractal Dimension Analyses to the Pattern Recognition of Contaminated Fish Responses in Aquaculture

    Directory of Open Access Journals (Sweden)

    Harkaitz Eguiraun

    2014-11-01

    Full Text Available The objective of the work was to develop a non-invasive methodology for image acquisition, processing and nonlinear trajectory analysis of the collective fish response to a stochastic event. Object detection and motion estimation were performed by an optical flow algorithm in order to detect moving fish and simultaneously eliminate background, noise and artifacts. The Entropy and the Fractal Dimension (FD of the trajectory followed by the centroids of the groups of fish were calculated using Shannon and permutation Entropy and the Katz, Higuchi and Katz-Castiglioni’s FD algorithms respectively. The methodology was tested on three case groups of European sea bass (Dicentrarchus labrax, two of which were similar (C1 control and C2 tagged fish and very different from the third (C3, tagged fish submerged in methylmercury contaminated water. The results indicate that Shannon entropy and Katz-Castiglioni were the most sensitive algorithms and proved to be promising tools for the non-invasive identification and quantification of differences in fish responses. In conclusion, we believe that this methodology has the potential to be embedded in online/real time architecture for contaminant monitoring programs in the aquaculture industry.

  15. State of the art of Italian aquaculture

    Directory of Open Access Journals (Sweden)

    P. Melotti

    2010-04-01

    Full Text Available According to aquaculture production statistics published by FEAP (2007, Italy is the fifth largest fish producer in the European Union having a total quantity for 2006 estimated around 60,000 t. This data is exclusively referred to rainbow trout (Oncorhynchus mykiss, seabream (Sparus aurata, seabass (Dicentrarchus labrax and European eel (Anguilla anguilla but even if we consider the total aquaculture production elaborated by ISMEA (2006 through year 2005 including sturgeons, carps, striped bass, catfish and ornamental fish, Italy ranks fourth with 69,100 t after Norway (655,364 t, Great Britain (141,793 t and Greece (83,600 t. Over the last 15 years, Italian finfish production has known a decrease related to all the species mainly reared (trout, eel, carps, catfish except for the eurhyaline species that have had an important expansion (Table 1. Based on these considerations, in this work we describe the main features of fish aquaculture in Italy focalizing the attention to the single sectors of the farmed species and their trend for the future.

  16. Real-time RT-PCR detection of betanodavirus in naturally and experimentally infected fish from Spain.

    Science.gov (United States)

    Hodneland, K; García, R; Balbuena, J A; Zarza, C; Fouz, B

    2011-03-01

    Infections with betanodavirus affect a wide range of wild and farmed fish species throughout the world, mostly from the marine environment. The aim of this work was to develop and validate real-time RT-PCR assays for sensitive and specific detection of nodavirus in diseased or carrier fish. The new detection assay was used to study the transmission and development of nodavirus infection in juvenile sea bass, Dicentrarchus labrax (L.), challenged by different routes, and also to screen for nodavirus in various farmed fish species. On average, the sensitivity was 10-100 times higher than a standard RT-PCR, and the assay was able to detect asymptomatic carrier fish that otherwise could have been classified as free of infection. Clinical signs of nodavirus infection were reproduced in fish infected following bath exposure or intramuscular injection, demonstrating horizontal transmission of the disease. Nodavirus was always detected in the brain of diseased fish but also in many recovered fish. The new assay enables us to confirm the presence of the virus at an early phase in the production cycle and may represent a useful tool to prevent or slow down the spread of nodavirus to new locations. PMID:21306586

  17. PHYTOPLANKTON ASSEMBLAGES AT FISH FARM IN MASLINOVA BAY (THE ISLAND OF BRAČ

    Directory of Open Access Journals (Sweden)

    Sanda Skejić

    2012-07-01

    Full Text Available The aim of this study was to establish phytoplankton composition at the sea bream (Sparus aurata and sea bass (Dicentrarchus labrax fish farm in the middle Adriatic Sea. The investigation was performed from September 2005 to September 2006 at a station located in Maslinova Bay at the island of Brač. Considering the whole research period, diatoms generally prevailed in terms of abundance while dinoflagellates were particularly abundant in June. Number of species of diatoms in comparison to dinoflagellates through the investigated period was similar. From 111 species of phytoplankton found, there were 55 species of Bacillariophyceae (diatoms, 47 species of Dinophyta (dinoflagellates, 5 species of Prymnesiophyceae, 3 Chrysophyceae and 1 Euglenophyta. Among the diatoms, the majority of species belonged to genus Chaetoceros. The most represented dinoflagellate genera were Oxytoxum and Gymnodinium. There were no considerable differences in phytoplankton composition with respect to different depths, but seasonal influence was significant. Biodiversity and abundance ranges of phytoplankton species indicated good water conditions and there were no evident alterations induced by the increased release of nutrients.

  18. Experiments on the use of sound as a fish deterrent

    International Nuclear Information System (INIS)

    This report describes a series of experimental studies into the potential use of acoustic stimuli to deter fish from water intakes at thermal and hydroelectric power stations. The aim was to enlarge the range of candidate signals for testing, and to apply these in more rigorous laboratory trials and to a wider range of estuarine and marine fish species than was possible in previous initial preliminary studies. The trials were also required to investigate the degree to which fish might become habituated to the sound signals, consequently reducing their effectiveness. The species of fish which were of interest in this study were the Atlantic salmon (Salmo salar), sea trout (Salmo trutta), the shads (Alosa fallax, A. alosa), the European eel (Anguilla anguilla), bass (Dicentrarchus labrax), herring (Clupea harengus), whiting (Merlangius merlangus) and cod (Gadus morhua). All of these species are considered to be of conservation and/or commercial importance in Britain today and are potentially vulnerable to capture by nuclear, fossil-fuelled and tidal generating stations. Based on the effectiveness of the signals observed in these trials, a properly developed and sited acoustic fish deterrent system is expected to reduce fish impingement significantly at water intakes. Field trials at an estuarine power station are recommended. (author)

  19. Comparison of heavy metal concentration of some marine fishes from Black and Aegean Seas

    Directory of Open Access Journals (Sweden)

    Makedonski Lubomir

    2015-06-01

    Full Text Available Major part of healthy human diet consist of marine fish and seafood products. And it is not surprising that there are numerous studies based on metal accumulation in various fish species. Fish may also be used for heavy metal monitoring programs of marine environments due to their easy sampling, sample preparation and chemical analysis. Concentrations of lead, cadmium, nickel, copper, manganese, zinc, iron, chromium, total mercury and total arsenic were determined in edible part of two commercially valuable fish Greek aquaculture species European sea bass (Dicentrarchus labrax and gilthead sea bream (Sparus aurata purchased from Bulgarian market during 2011. The concentration of metals was measured by atomic absorption spectrophotometry (AAS. The concentration of the heavy metals in examined fish species ranged as follow: Pb 0.008 - 0.013; Cd 0.0017 - 0.022; Ni 0.007 - 0.012; Cu 0.054 - 0.115; Mn 0.043 - 0.09; Zn 0.14 - 0.15; Fe 0.17 - 0.19; Cr 0.05 - 0.07; Hg 0.11 - 0.13; As 1.6 - 1.8 mg kg-1 wet weight, respectively.

  20. Temporal variability in estuarine fish otolith elemental fingerprints: Implications for connectivity assessments

    Science.gov (United States)

    Reis-Santos, Patrick; Gillanders, Bronwyn M.; Tanner, Susanne E.; Vasconcelos, Rita P.; Elsdon, Travis S.; Cabral, Henrique N.

    2012-10-01

    The chemical composition of fish otoliths can provide valuable information for determining the nursery value of estuaries to adult populations of coastal fishes. However, understanding temporal variation in elemental fingerprints at different scales is important as it can potentially confound spatial discrimination among estuaries. Otolith elemental ratios (Li:Ca, Mg:Ca, Mn:Ca, Cu:Ca, Sr:Ca, Ba:Ca and Pb:Ca) of Platichthys flesus and Dicentrarchus labrax, from several estuaries along the Portuguese coast in two years and three seasons (spring, summer and autumn) within a year, were determined via Laser Ablation Inductively Coupled Plasma Mass Spectrometry. Elemental fingerprints varied significantly among years and seasons within a year but we achieved accurate classifications of juvenile fish to estuarine nursery of origin (77-96% overall cross-validated accuracy). Although elemental fingerprints were year-specific, variation among seasons did not hinder spatial discrimination. Estuarine fingerprints of pooled seasonal data were representative of the entire juvenile year class and attained high discrimination (77% and 80% overall cross-validated accuracy for flounder and sea bass, respectively). Incorporating seasonal variation resulted in up to an 11% increase in correct classification of individual estuaries, in comparison to seasons where accuracies were lowest. Overall, understanding the implications of temporal variations in otolith chemistry for spatial discrimination is key to establish baseline data for connectivity studies.

  1. BACTERIOLOGICAL PROPERTIES OF MARINE WATER IN ADRIATIC FISH FARMS: ENUMERATION OF HETEROTROPHIC BACTERIA

    Directory of Open Access Journals (Sweden)

    Emin Teskeredžić

    2012-12-01

    Full Text Available Aquaculture is currently one of the fastest growing food production sectors in the world. Increase in nutrients and organic wastes lead to general deterioration of water quality. The problem of water quality is associated with both physical and chemical factors, as well as microbiological water quality. Heterotrophic bacteria play an important role in the process of decomposition of organic matter in water environment and indicate eutrophication process. Here we present our experience and knowledge on bacterial properties of marine water in the Adriatic fish farms with European sea bass (Dicentrarchus labrax L., 1758, with an emphasis on enumeration of heterotrophic bacteria in marine water. We applied two temperatures of incubation, as well as two methods for enumeration of heterotrophic bacteria: substrate SimPlate® test and spread plate method on conventional artificial media (Marine agar and Tryptic Soy agar with added NaCl. The results of analysis of bacteriological properties of marine water in the Adriatic fish farms showed that enumeration of heterotrophic bacteria in marine water depends on the applied incubation temperature and media for enumeration. At the same time, the incubation temperature of 22C favours more intense growth of marine heterotrophic bacteria, whereas a SimPlate test gives higher values of heterotrophic bacteria. Volatile values of heterotrophic bacteria during this research indicate a possible deterioration of microbiological water quality in the Adriatic fish farms and a need for regular monitoring of marine water quality.

  2. The Bass diffusion model on networks with correlations and inhomogeneous advertising

    Science.gov (United States)

    Bertotti, M. L.; Brunner, J.; Modanese, G.

    2016-09-01

    The Bass model, which is an effective forecasting tool for innovation diffusion based on large collections of empirical data, assumes an homogeneous diffusion process. We introduce a network structure into this model and we investigate numerically the dynamics in the case of networks with link density $P(k)=c/k^\\gamma$, where $k=1, \\ldots , N$. The resulting curve of the total adoptions in time is qualitatively similar to the homogeneous Bass curve corresponding to a case with the same average number of connections. The peak of the adoptions, however, tends to occur earlier, particularly when $\\gamma$ and $N$ are large (i.e., when there are few hubs with a large maximum number of connections). Most interestingly, the adoption curve of the hubs anticipates the total adoption curve in a predictable way, with peak times which can be, for instance when $N=100$, between 10% and 60% of the total adoptions peak. This may allow to monitor the hubs for forecasting purposes. We also consider the case of networks with assortative and disassortative correlations and a case of inhomogeneous advertising where the publicity terms are "targeted" on the hubs while maintaining their total cost constant.

  3. Estimates of entrainment mortality for striped bass and other fish species inhabiting the Hudson River estuary

    International Nuclear Information System (INIS)

    An empirically derived age-, time-, and space-variant equation was used to estimate entrainment mortality at power plants for seven fish species inhabiting the Hudson River estuary. Entrainment mortality is expressed as a conditional rate, which is the fractional reduction in year-class strength due to entrainment if other sources of mortality are density-independent. Estimates of the conditional entrainment mortality, based on historical and projected once-through cooling operation of five power plants, were 11-22% for striped bass, 11-17% for white perch, 5-7% for Atlantic tomcod, 14-21% for American shad, 4-11% for river herring (alewife and blueback herring combined), and 35-79% for bay anchovy. Closed-cycle cooling (natural-draft cooling towers) at three of the power plants (Indian Point, Bowline Point, and Roseton) would reduce entrainment mortality of striped bass by 50-80%, of white perch by 75-80%, of Atlantic tocod by 65-70%, of American shad by 80%, of river herring by 30-90%, and of bay anchovy by 45-80%. The life stages most vulnerable to entrainment mortality were post-yolk-sac larva and entrainable size juvenile. 18 refs., 7 tabs

  4. BASS-Ultracool : A Survey for Isolated Analogs of Methane Exoplanets

    Science.gov (United States)

    Gagné, Jonathan; Faherty, Jacqueline K.; Malo, Lison; Filippazzo, Joseph C.; Burgasser, Adam J.; Artigau, Etienne; Lafrenière, David; Doyon, Rene; Bowsher, Emily; Nicholls, Christine P.

    2015-12-01

    I will present BASS-Ultracool, a new survey to identify isolated cold, late L and T-type members of young moving groups. These objects have masses below 10 MJup and physical properties similar to those of exoplanets identified with the direct-imaging method. The discovery of such isolated planetary-mass objects will allow us to characterize their atmospheres with unprecedented signal-to-noise and spectroscopic resolution due to the absence of a host star. They will serve as benchmarks to understand cold exoplanets such as the recently discovered 51 Eri b.I will also present how the prototype version of the BASS-Ultracool survey has already identified the first isolated T-type member of a nearby moving group SDSS J1110+0116, which is a young 10-12 MJup T5.5 member of the ~150 Myr-old AB Doradus moving group. This object is an isolated and slightly cooler version of the previously identified T3.5 AB Doradus member GU Psc b.

  5. Effects of the Presidente Rivera oil spill on young-of-year striped bass

    International Nuclear Information System (INIS)

    On 24, June 1989, approximately 300,000 gallons of No. 6 fuel oil was spilled from the tanker Presidente Rivera into the Delaware River. This paper reports that the spill occurred in the center of the striped bass nursery area, only six weeks after the prime spawning period. Toxic effects of the spill on young-of-year striped bass were investigated using in situ bioassay techniques. Seventy-five liter chambers, each containing 30 hatchery-reared fish, were moored at four locations within the spill zone and at one upstream references are. chemical analysis of the water was conducted on area. Chemical analysis of the water was conducted on Days 1, 4, and 13 of the experiment. Despite significant oil fouling on chambers, no dissolved aromatic hydrocarbons were detected in the water column. Acute mortality was not apparent, with greater than 90% survival at all stations after four days. After 13 days, survival at the station closest to the spill site was about 20% less than at the reference station

  6. Combustion of Solids in Microgravity: Results from the BASS-II Experiment

    Science.gov (United States)

    Ferkul, Paul V.; Bhattacharjee, Subrata; Fernandez-Pello, Carlos; Miller, Fletcher; Olson, Sandra L.; Takahashi, Fumiaki; T’ien, James S.

    2014-01-01

    The Burning and Suppression of Solids-II (BASS-II) experiment was performed on the International Space Station. Microgravity combustion tests burned thin and thick flat samples, acrylic slabs, spheres, and cylinders. The samples were mounted inside a small wind tunnel which could impose air flow speeds up to 53 cms. The wind tunnel was installed in the Microgravity Science Glovebox which supplied power, imaging, and a level of containment. The effects of air flow speed, fuel thickness, fuel preheating, and oxygen concentration on flame appearance, growth, spread rate, and extinction were examined in both the opposed and concurrent flow configuration. The flames are quite sensitive to air flow speed in the range 0 to 5 cms. They can be sustained at very low flow speeds of less than 1 cms, when they become dim blue and stable. In this state they are not particularly dangerous from a fire safety perspective, but they can flare up quickly with a sudden increase in air flow speed. Including earlier BASS-I results, well over one hundred tests have been conducted of the various samples in the different geometries, flow speeds, and oxygen concentrations. There are several important implications related to fundamental combustion research as well as spacecraft fire safety. This work was supported by the NASA Space Life and Physical Sciences Research and Applications Division (SLPSRA).

  7. Age-at-maturity estimates for Atlantic coast female striped bass

    Science.gov (United States)

    Berlinsky, David L.; Fabrizio, Mary C.; O'Brien, John F.; Specker, Jennifer L.

    1995-01-01

    This study was undertaken to estimate the percentage of mature female striped bass Morone saxatilis present in each age-class during annual coastal feeding migration. Migratory striped bass (N = 302) were sampled in coastal Rhode Island waters during spring (May-June) and fall (September-November) from 1985 to 1987. Stocks were identified by analysis of morphometric characters and isoelectric focusing of eye-lens proteins. Histological sections of ovarian tissue were used to categorize maturity state. Fish were considered mature if a class of oocytes measuring at least 150 μm and containing cytoplasmic inclusions was found in the ovarian sections. All females whose age at next potential spawning was 7 and older were mature. Our empirical observations indicated that 12% of fish in age-class 4, 34% of fish in age-class 5, and 77% of fish in age-class 6 were mature. The estimate of the proportion of mature fish in age-class 5 differs significantly from that of Merriman (1941), who also examined coastal migrants. No significant differences were found in maturity estimates of fish from stocks of different origin.

  8. Implications of power plant mortality for management of the Hudson River striped bass fishery

    International Nuclear Information System (INIS)

    The Atlantic coastal stock of striped bass apparently declined from colonial times to the early 1930s and subsequently recovered. The reasons for the decline and recovery are not known, but fishing remains a possible explanation, which would suggest population sensitivity to increased mortality. Evidence suggests that fishing mortality has been increasing in recent years and will continue to increase in the absence of management intervention. The consequence of increased fishing mortality is an increase in the marginal effect of the power plant mortality which based on the utilities' models and parameter fits, could result in important reductions in the Hudson River striped bass population. Any management actions imposed to arrest population decline or to increase yield per effort in the fishery would be required to mitigate the impact of the power plants by reducing fishing mortality. It is estimated that a 20% conditional power plant mortality is equivalent to a 14% increase in the number of average fishermen using the stock. Consequently, should any management intervention be required on behalf of the population, managers would be required to reduce fishing mortality by about 14% just to account for the power plant mortality. 26 refs., 5 figs., 4 tabs

  9. Abundance and distribution of northern squawfish, walleyes, and smallmouth bass in John Day Reservoir, Columbia river

    International Nuclear Information System (INIS)

    The authors used mark-recapture and catch-per-unit effort data to estimate abundances and distributions of three potential predators on juvenile salmonids migrating through John Day Reservoir in 1984-1986. The northern squawfish Ptychocheilus oregonensis was the most abundant predator (estimated population: 85, 316), followed by smallmouth bass Micropterus dolomieu (34,954) and walleye Stizostedion vitreum (15,168). Because of uncertainty in sampling and assumption of the mark-recapture estimator, the combined abundance of these three predators could lie between 50,000 and 500,000. They believe, however, that bias is probably negative, and that any errors should result in conservative estimates. Northern squawfish were common reservoir-wide, but large concentrations occurred immediately below McNary Dam near the head of John Day Reservoir. Walleyes were largely restricted to the upper third of the reservoir, whereas the number of smallmouth bass increased progressively downriver. As judged by abundance and distribution, northern squawfish have by far the greatest potential for predation on juvenile salmonids. They also expect predation to be unevenly distributed in time and space as a result of variations in the number and distribution of predators

  10. Competitive interactions between walleye (Sander vitreus) and smallmouth bass (Micropterus dolomieu) under various controlled conditions

    Science.gov (United States)

    Wuellner, M.R.; Graeb, B.D.S.; Willis, D.W.; Galster, B.J.; Selch, T.M.; Chipps, S.R.

    2011-01-01

    The range of smallmouth bass (Micropterus dolomieu) is expanding northward, creating new interactions with native predators, including walleye (Sander vitreus). We used a series of experiments to investigate competition between walleye (WAE) and smallmouth bass (SMB) at different life stages and light conditions, identified behaviors that allowed one fish to outcompete another, and evaluated whether prey switching mitigated competitive interactions. Juvenile and adult SMB appeared to outcompete WAE when fed during the daytime; neither species dominated when fed near dusk. Attack rates and capture efficiencies of both species were similar with an intra- or interspecific competitor, but SMB often exploited prey before the competitor had a chance to feed (exploitative competition) or displayed agonistic behaviors toward a potential competitor (interference competition). Prey selectivity of WAE or SMB did not differ when by themselves or with a potential competitor. These results indicate that SMB could outcompete WAE under limiting prey conditions due to the aggressive nature of SMB, but resources may be partitioned at least along a temporal scale. ?? 2011 Taylor & Francis.

  11. The Bass diffusion model on networks with correlations and inhomogeneous advertising

    CERN Document Server

    Bertotti, M L; Modanese, G

    2016-01-01

    The Bass model, which is an effective forecasting tool for innovation diffusion based on large collections of empirical data, assumes an homogeneous diffusion process. We introduce a network structure into this model and we investigate numerically the dynamics in the case of networks with link density $P(k)=c/k^\\gamma$, where $k=1, \\ldots , N$. The resulting curve of the total adoptions in time is qualitatively similar to the homogeneous Bass curve corresponding to a case with the same average number of connections. The peak of the adoptions, however, tends to occur earlier, particularly when $\\gamma$ and $N$ are large (i.e., when there are few hubs with a large maximum number of connections). Most interestingly, the adoption curve of the hubs anticipates the total adoption curve in a predictable way, with peak times which can be, for instance when $N=100$, between 10% and 60% of the total adoptions peak. This may allow to monitor the hubs for forecasting purposes. We also consider the case of networks with a...

  12. Evidence of estrogenic endocrine disruption in smallmouth and largemouth bass inhabiting Northeast U.S. National Wildlife Refuge waters: A reconnaissance study

    Science.gov (United States)

    Iwanowicz, Luke; Blazer, Vicki; Pinkney, A.E.; Guy, C.P.; Major, A.M.; Munney, K.; Mierzykowski, S.; Lingenfelser, S.; Secord, A.; Patnode, K.; Kubiak, T.J.; Stern, C.; Hahn, Cassidy M.; Iwanowicz, Deborah; Walsh, Heather L.; Sperry, Adam J.

    2016-01-01

    Intersex as the manifestation of testicular oocytes (TO) in male gonochoristic fishes has been used as an indicator of estrogenic exposure. Here we evaluated largemouth bass (Micropterus salmoides) or smallmouth bass (Micropterus dolomieu) form 19 National Wildlife Refuges (NWRs) in the Northeast U.S. inhabiting waters on or near NWR lands for evidence of estrogenic endocrine disruption. Waterbodies sampled included rivers, lakes, impoundments, ponds, and reservoirs. Here we focus on evidence of endocrine disruption in male bass evidenced by gonad histopathology including intersex or abnormal plasma vitellogenin (Vtg) concentrations. During the fall seasons of 2008–2010, we collected male smallmouth bass (n=118) from 12 sites and largemouth bass (n=173) from 27 sites. Intersex in male smallmouth bass was observed at all sites and ranged from 60% to 100%; in male largemouth bass the range was 0–100%. Estrogenicity, as measured using a bioluminescent yeast reporter, was detected above the probable no effects concentration (0.73 ng/L) in ambient water samples from 79% of the NWR sites. Additionally, the presence of androgen receptor and glucocorticoid receptor ligands were noted as measured via novel nuclear receptor translocation assays. Mean plasma Vtg was elevated (>0.2 mg/ml) in male smallmouth bass at four sites and in male largemouth bass at one site. This is the first reconnaissance survey of this scope conducted on US National Wildlife Refuges. The baseline data collected here provide a necessary benchmark for future monitoring and justify more comprehensive NWR-specific studies.

  13. Evidence of estrogenic endocrine disruption in smallmouth and largemouth bass inhabiting Northeast U.S. national wildlife refuge waters: A reconnaissance study.

    Science.gov (United States)

    Iwanowicz, L R; Blazer, V S; Pinkney, A E; Guy, C P; Major, A M; Munney, K; Mierzykowski, S; Lingenfelser, S; Secord, A; Patnode, K; Kubiak, T J; Stern, C; Hahn, C M; Iwanowicz, D D; Walsh, H L; Sperry, A

    2016-02-01

    Intersex as the manifestation of testicular oocytes (TO) in male gonochoristic fishes has been used as an indicator of estrogenic exposure. Here we evaluated largemouth bass (Micropterus salmoides) or smallmouth bass (Micropterus dolomieu) form 19 National Wildlife Refuges (NWRs) in the Northeast U.S. inhabiting waters on or near NWR lands for evidence of estrogenic endocrine disruption. Waterbodies sampled included rivers, lakes, impoundments, ponds, and reservoirs. Here we focus on evidence of endocrine disruption in male bass evidenced by gonad histopathology including intersex or abnormal plasma vitellogenin (Vtg) concentrations. During the fall seasons of 2008-2010, we collected male smallmouth bass (n=118) from 12 sites and largemouth bass (n=173) from 27 sites. Intersex in male smallmouth bass was observed at all sites and ranged from 60% to 100%; in male largemouth bass the range was 0-100%. Estrogenicity, as measured using a bioluminescent yeast reporter, was detected above the probable no effects concentration (0.73ng/L) in ambient water samples from 79% of the NWR sites. Additionally, the presence of androgen receptor and glucocorticoid receptor ligands were noted as measured via novel nuclear receptor translocation assays. Mean plasma Vtg was elevated (>0.2mg/ml) in male smallmouth bass at four sites and in male largemouth bass at one site. This is the first reconnaissance survey of this scope conducted on US National Wildlife Refuges. The baseline data collected here provide a necessary benchmark for future monitoring and justify more comprehensive NWR-specific studies. PMID:26454754

  14. Hypoxia affects performance traits and body composition of juvenile hybrid striped bass (Morone chrysops x M. saxatilis)

    Science.gov (United States)

    Performance traits and body composition of juvenile hybrid striped bass (Morone chrysops x M. saxatilis) in response to hypoxia were evaluated in replicate tanks maintained at constant dissolved oxygen concentrations that averaged 23.0 +/- 2.3%, 39.7 +/- 3.0%, and 105.5 +/- 9.5% dissolved oxygen sat...

  15. Quantitative genetics and differential performance and gene expression of half-sib families of hybrid striped bass in communal ponds

    Science.gov (United States)

    The US is one of the world’s largest importers of seafood. A major constraint in producing hybrid striped bass is suboptimal production efficiency due to large performance variation of fish from undomesticated brooders. The objectives of this first-year study were to determine the genetic basis of p...

  16. Minimizing use of fish meal in sunshine bass diets using standard and new varieties of non-genetically modified soybeans

    Science.gov (United States)

    Improved plant ingredients are needed to support sustainable culture of carnivorous fish, such as hybrid striped bass (HSB). We are evaluating meals made from new strains of non-genetically-modified soybeans (non-GMO) with high protein and reduced anti-nutritional factors (ANFs) on HSB nutrient dige...

  17. Computer simulation model for the striped bass young-of-the-year population in the Hudson River

    International Nuclear Information System (INIS)

    This report presents a daily transient (tidal-averaged), longitudinally one-dimensional (cross-section-averaged) computer simulation model for the assessment of the entrainment and impingement impacts of power plant operations on young-of-the-year populations of the striped bass, Morone saxatilis, in the Hudson River

  18. Survival of vaccinated,feed-trained largemouth bass fry (Micropterus Salmoides Floridanus) during natural exposure to Flavobacterium columnare

    Science.gov (United States)

    Largemouth bass (Micropterus salmoides floridanus; Centrarchidae) are often reared in government hatchery programs, then stocked to supplement wild fish populations. After the eggs obtained from broodstock are hatched, fry are stocked into ponds to feed on zooplankton and other small invertebrates....

  19. 77 FR 76950 - Fisheries of the Northeastern United States; Summer Flounder, Scup, and Black Sea Bass Fisheries...

    Science.gov (United States)

    2012-12-31

    ... 23, 2012 (77 FR 24151). An error was found in the summer flounder commercial quota and recreational... Register of April 23, 2012, in FR Doc. 2012-9755, on page 24152, Table 1 is corrected as follows: Table 1... Northeastern United States; Summer Flounder, Scup, and Black Sea Bass Fisheries; 2012 Summer Flounder,...

  20. Controlled Acoustic Bass System (CABS) A Method to Achieve Uniform Sound Field Distribution at Low Frequencies in Rectangular Rooms

    DEFF Research Database (Denmark)

    Celestinos, Adrian; Nielsen, Sofus Birkedal

    2008-01-01

    The sound field produced by loudspeakers at low frequencies in small- and medium-size rectangular listening rooms is highly nonuniform due to the multiple reflections and diffractions of sound on the walls and different objects in the room. A new method, called controlled acoustic bass system (CABS...

  1. Behavioural thermoregulation of largemouth bass (Micropterus salmoides): response of naive fish to the thermal gradient in a nuclear reactor cooling reservoir

    International Nuclear Information System (INIS)

    1.1. We studied patterns of temperature selection of naive largemouth bass (Micropterus salmoides) transplanted from an adjacent normothermic site to a cooling reservoir for a nuclear reactor Lethally hot (> 45°C) water entered the reservoir periodically.2.2. Temperature-sensing radio transmitters, which were surgically implanted in 10 fish, enabled us to monitor movement of bass during different times of year in the thermally heterogeneous environment.3.3. Naive bass exhibited a range of reactive thermoregulatory behaviours which led half of them to cool-water refuges in the reservoir. Moreover, some bass appeared to learn the thermal characteristics of the refuges.4.4. These behaviours were sufficient for 30% of the naive fish to survive extreme thermal conditions

  2. LAS CLAVES DE LA INNOVACIÓN DE SAUL BASS EN LA SECUENCIA DE TÍTULOS DE CRÉDITO DE VÉRTIGO

    OpenAIRE

    Alcaraz Pagán, Mª De Las Nieves

    2016-01-01

    [EN] Saul Bass is considered as the father of contemporary title sequences. The main contribution of this work consists in verifying the close correspondences between Bass' deviced iconography, figures and visual motifs to summarize and synthesise the profound sense of the story told by the film, preceded by their sequences, since it is this idea that is found as the base of what has been established as the turning point and conceptual axis around his innovation. This is something until nowad...

  3. An ovary transcriptome for all maturational stages of the striped bass (Morone saxatilis), a highly advanced perciform fish

    OpenAIRE

    Reading Benjamin J; Chapman Robert W; Schaff Jennifer E; Scholl Elizabeth H; Opperman Charles H; Sullivan Craig V

    2012-01-01

    Abstract Background The striped bass and its relatives (genus Morone) are important fisheries and aquaculture species native to estuaries and rivers of the Atlantic coast and Gulf of Mexico in North America. To open avenues of gene expression research on reproduction and breeding of striped bass, we generated a collection of expressed sequence tags (ESTs) from a complementary DNA (cDNA) library representative of their ovarian transcriptome. Results Sequences of a total of 230,151 ESTs (51,259...

  4. Edward W. Taylor / Patricia Cranton, and Associates (Hrsg.): The Handbook of Transformative Learning, Theory, Research, and Practice. San Francisco, CA: Jossey-Bass 2012 [...] [Sammelrezension

    OpenAIRE

    Fuhr, Thomas

    2012-01-01

    Sammelrezension von: 1. Edward W. Taylor / Patricia Cranton, and Associates (Hrsg.): The Handbook of Transformative Learning, Theory, Research, and Practice, San Francisco, CA: Jossey-Bass 2012 (598 S.; ISBN 978-1-111-21891-4) 2. Jack Mezirow / Edward W. Taylor, and Associates (Hrsg.): Transformative Learning in Practice, Insights from Community, Workplace, and Higher Education, San Francisco, CA: Jossey-Bass 2009 (303 S.; ISBN 978-0-470-25790-6)

  5. Diffusion Raman basse fréquence dans les fibres optiques

    OpenAIRE

    Saissy, A.

    1986-01-01

    Nous comparons la diffusion Raman basse fréquence,10 à 100 cm-1, de fibres optiques constituées de divers matériaux à structure désordonnée (silice, verre fluoré, polymère). Les propriétés propagatives des fibres pour les ondes lumineuses et acoustiques sont prises en compte dans un modèle proposé par A. J. Martin et W. Brenig. Une longueur de corrélation structurale est déterminée pour chacun des matériaux : (6,8 ± 0,3) Å pour SiO2, (6,4 ± 0,5) Å pour ZrF4-BaF2 et (8,3 ± 1) Å pour PMMA. L'im...

  6. Maison forte du Boisset : panoramique complet de la basse-cour

    OpenAIRE

    Pouyllau, Stéphane

    1996-01-01

    Panoramique de 360° réalisé par superposition d'images de la basse cour de la maison forte du boisset en 1998. Le Boisset est une maison forte reconstruite au XVe siècle (entre 1438 et 1480). Le site est entouré d'un anneau fossoyé. Certaines structures (au dessous du bâti actuel) et les fossés datent probablement de la fin du XIIIe siècle. Le premier site est à mettre en liaison avec la présence d'un lignage repérable dans ce secteur en 1260 : la famille des Brun de Boisset. Cette famille es...

  7. Bioenergetics estimate of the effects of stocking density on hatchery production of smallmouth bass fingerlings

    Science.gov (United States)

    Robel, G.L.; Fisher, W.L.

    1999-01-01

    Production of and consumption by hatchery-reared tingerling (age-0) smallmouth bass Micropterus dolomieu at various simulated stocking densities were estimated with a bioenergetics model. Fish growth rates and pond water temperatures during the 1996 growing season at two hatcheries in Oklahoma were used in the model. Fish growth and simulated consumption and production differed greatly between the two hatcheries, probably because of differences in pond fertilization and mortality rates. Our results suggest that appropriate stocking density depends largely on prey availability as affected by pond fertilization and on fingerling mortality rates. The bioenergetics model provided a useful tool for estimating production at various stocking density rates. However, verification of physiological parameters for age-0 fish of hatchery-reared species is needed.

  8. A strain of Siniperca chuatsi rhabdovirus causes high mortality among cultured Largemouth Bass in South China.

    Science.gov (United States)

    Ma, Dongmei; Deng, Guocheng; Bai, Junjie; Li, Shengjie; Yu, Lingyun; Quan, Yingchun; Yang, Xiaojing; Jiang, Xiaoyan; Zhu, Zemin; Ye, Xing

    2013-09-01

    In April 2011, 40% mortality of Largemouth Bass Micropterus salmoides juveniles occurred at a farm of Zhongshan City, Guangdong Province, China. Infected fish became lethargic, exhibited corkscrew and irregular swimming, and developed a distended abdomen and crooked body. Fish began to die within 2 d after the appearance of clinical signs. In order to analyze the pathogeny and diagnose the disease earlier, observation of clinical signs, cell infection, titer calculation, electron microscopy, immersion infection assay for fish, and nucleotide sequence analysis were carried out. Fathead minnow (FHM) cell cultures, inoculated with filtrate of liver and spleen homogenates from the diseased fish, developed the obvious cytopathic effect 46 h after inoculation in the primary culture and 24 h at the first passage. Typical rhabdovirus particles, 115-143 nm in length and 62-78 nm in diameter, were observed in infected FHM cells by direct transmission electron microscopy. The isolated virus produced a titer of 10(7.15) TCID50/mL. Immersion-Fish infected with the virus had similar clinical signs and 80% mortality with 10(2.5) LD50/mL. The data indicated that the rhabdovirus was the lethal pathogeny of the current disease. Based on nucleoprotein-gene nucleotide sequence multiple alignment analysis, the newly isolated virus is a strain of Siniperca chuatsi rhabdovirus (SCRV) under family Rhabdoviridae, which was initially isolated from Mandarin Fish Siniperca chuatsi. Up to the present, at least four virus strains have been isolated from diseased Largemouth Bass, which have had different clinical signs. Comparison of the clinical signs can help in an early diagnosis of the disease. PMID:23915177

  9. Lipid traits and dietary quality of sea bass fillets from Orbetello

    Directory of Open Access Journals (Sweden)

    A. Bonelli

    2010-04-01

    Full Text Available The aim of the study was to investigate the possibility of obtaining: a reliable estimates of sea bass fillet weight and lipid/fatty acid content from simple non destructive morphometric measurements; b estimates of healthy eating quality evaluation from effects of consumption on blood biomarkers related to atherosclerotic/thrombogenic processes. A series of parameters were measured in 708 fish. Estimates of fillet weight from b.w. and max. thickness (R2=0.96, rsd=±20.55g and of lipid content from b.w., total length, max. thickness and condition factor (R2= 0.69, rsd=±3.3g were found to be very reliable; flesh n-3 PUFA and EPA content were also estimated from condition factor and max. girth (R2=0.32, rsd=±0.42g; R2=0.38, rsd=±0.13g. Flesh healthy eating quality was evaluated from changes in blood biomarkers (lipid profile, inflammatory markers, haemorheological profile in dyslipidemic subjects who had eaten fillets three times a week for 10 weeks. A weekly flesh intake of 807g increased erythrocyte n-3 PUFA (P<0.05 and decreased triglycerides (P<0.008, interleukin-6 (P<0.03, interleukin-8 (P<0.04, Whole Blood Viscosity 20.400 (P<0.04 and erythrocyte filtration (P<0.008. Short term intake of sea bass therefore seemed associated with favourable biochemical changes in dyslipidemic subjects, as reflected by lower circulating levels of markers of atherosclerosis.

  10. Acute toxicity of an acid mine drainage mixing zone to juvenile bluegill and largemouth bass

    Science.gov (United States)

    Henry, T.B.; Irwin, E.R.; Grizzle, J.M.; Wildhaber, M.L.; Brumbaugh, W.G.

    1999-01-01

    The toxicity of an acid mixing zone produced at the confluence of a stream that was contaminated by acid mine drainage (AMD) and a pH-neutral stream was investigated in toxicity tests with juvenile bluegill Lepomis macrochirus and largemouth bass Micropterus salmoides. Fish mortalities in instream cages located in the mixing zone, below the mixing zone, and upstream in both tributaries were compared to determine relative toxicity at each site. In all tests and for both species, significantly higher mortality was observed in the mixing zone than at any other location, including the acid stream, which had lower pH (2.9-4.3). The mixing zone was defined chemically by rapid precipitation of dissolved aluminum and iron, which arrived from the low-pH stream, and by the presence of white precipitates, which were attached to the substratum and which extended below the confluence. Possible seasonal changes in mixing zone toxicity were investigated by conducting field tests with bluegill in June, July, and August 1996 and in January 1997 and by conducting field tests with largemouth bass in April and May 1997. Toxicity was not significantly different at the extremes of temperature, pH, and metal concentration that occurred in June and July, as compared with January. Toxicity was significantly lower in August; however, elevated stream discharge during the August test may have disturbed mixing zone characteristics. High toxicity in AMD mixing zones may lower the survival of fishes in streams, reduce available habitat, and impede movements of migratory fish.

  11. Evaluation of potentially nonlethal sampling methods for monitoring mercury concentrations in smallmouth bass (Micropterus dolomieu)

    Science.gov (United States)

    Schmitt, C.J.; Brumbaugh, W.G.

    2007-01-01

    We evaluated three potentially nonlethal alternatives to fillet sampling for the determination of mercury (Hg) concentrations in smallmouth bass (Micropterus dolomieu). Fish (n = 62, 226-464 mm total length) from six sites in southern Missouri were captured by electrofishing. Blood samples (1 mL) from each fish were obtained by caudal veinipuncture with a heparinized needle and syringe. Biopsy needle (10 mm x 14 gauge; three cuts per fish; 10-20 mg total dry weight) and biopsy punch (7 mm x 5 mm in diameter, one plug per fish, 30-50 mg dry weight) samples were obtained from the area beneath the dorsal fin. Fillet samples were obtained from the opposite side of the fish. All samples were freeze-dried and analyzed for total Hg by combustion amalgamation atomic absorption spectrophotometry. Mean relative standard deviations (RSDs) of triplicate samples were similar for all four methods (2.2-2.4%), but the range of RSDs was greater for blood (0.4-5.5%) than for the muscle methods (1.8-4.0%). Total Hg concentrations in muscle were 0.0200-0.8809 ??g/g wet weight; concentrations in plug, needle, and fillet samples from each fish were nearly identical. Blood Hg concentrations were 0.0006-0.0812 ??g/mL and were highly correlated with muscle concentrations; linear regressions between log-transformed blood and fillet Hg concentrations were linear and statistically significant (p methods could provide satisfactory estimates of fillet Hg in smallmouth bass; however, both blood and plug sampling with disposable instruments were easier to perform than needle sampling. The biopsy needle was the most difficult to use, especially on smaller fish, and its relative expense necessitates reuse and, consequently, thorough cleaning between fish to prevent cross-contamination. ?? 2007 Springer Science+Business Media, LLC.

  12. Identification and expression of GnRH2 and GnRH3 in the black sea bass (Centropristis striata), a hermaphroditic teleost.

    Science.gov (United States)

    Morin, Scott J; Decatur, Wayne A; Breton, Timothy S; Marquis, Timothy J; Hayes, Mary K; Berlinsky, David L; Sower, Stacia A

    2015-04-01

    We cloned two cDNAs for two gonadotropin-releasing hormones, GnRH2 (chicken GnRH-II) and GnRH3 (salmon GnRH), respectively, from the black sea bass (Centropristis striata). Black sea bass are protogynous hermaphroditic teleosts that change from females to males between 2 and 5 years of age. Similar to other GnRH precursors, the precursors of black sea bass GnRH2 and GnRH23 consisted of a signal peptide, decapeptide, a downstream processing site, and a GnRH-associated peptide. Our analyses failed to identify GnRH1. GnRH3 precursor transcript was more widely distributed in a variety of tissues compared with GnRH2. Further examination of GnRH expression and gonadal histology was done in black sea bass from three different size groups: small (11.4-44.1 g), medium (179.4-352.2 g) and large (393.8-607.3 g). Interestingly, GnRH3 expression occurred only in the pituitaries of males in the small and medium groups compared with expression of GnRH2. Future functional studies of the sea bass GnRHs will be valuable in elucidating the potential underlying neuroendocrine mechanisms of black sea bass reproduction and may ultimately contribute to management advances in this commercially important fish. PMID:25255937

  13. Assessment of potential impact of the Clinch River Breeder Reactor Plant thermal effluent on the Watts Bar Reservoir striped bass population

    International Nuclear Information System (INIS)

    This report is an assessment of potential adverse impact to striped bass (Morone saxatilis) in Watts Bar Reservoir caused by thermal effluent from operation of the Clinch River Breeder Reactor Plant (CRBRP). The Clinch River arm of Watts Bar Reservoir is occupied by adult striped bass during the warmest months of the year. Concern was raised that operation of the CRBRP, specifically thermal discharges, could conflict with management of striped bass. In all cases examined the thermal plume becomes nearly imperceptible within a short distance from the discharge pipe (about 30 ft [10 m]) compared to river width (about 630 ft [190 m]). Under worst case conditions any presence of the plume in the main channel (opposite side of the river from the discharge) will be confined to the surface layer of the water. An ample portion of river cross sections containing ambient temperature water for passage or residence of adult striped bass will always be available in the vicinity of this thermal effluent. Although a small portion of river cross section would exceed the thermal tolerance of striped bass, the fish would naturally avoid this area and seek out adjacent cooler water. Therefore, it is concluded the CRBRP thermal effluent will not significantly affect the integrity of the striped bass thermal refuge in the Clinch River arm of Watts Bar Reservoir. At this time there is no need to consider alternative diffuser designs and thermal modeling. 8 references, 3 figures, 2 tables

  14. Transcriptional networks associated with the immune system are disrupted by organochlorine pesticides in largemouth bass (Micropterus salmoides) ovary.

    Science.gov (United States)

    Martyniuk, Christopher J; Doperalski, Nicholas J; Feswick, April; Prucha, Melinda S; Kroll, Kevin J; Barber, David S; Denslow, Nancy D

    2016-08-01

    Largemouth bass (Micropterus salmoides) inhabiting Lake Apopka, Florida are exposed to high levels of persistent organochlorine pesticides (OCPs) and dietary uptake is a significant route of exposure for these apex predators. The objectives of this study were to determine the dietary effects of two organochlorine pesticides (p, p'-dichlorodiphenyldichloroethylene; p, p' DDE and methoxychlor; MXC) on the reproductive axis of largemouth bass. Reproductive bass (late vitellogenesis) were fed one of the following diets: control pellets, 125ppm p, p'-DDE, or 10ppm MXC (mg/kg) for 84days. Due to the fact that both p,p' DDE and MXC have anti-androgenic properties, the anti-androgenic pharmaceutical flutamide was fed to a fourth group of largemouth bass (750ppm). Following a 3 month exposure, fish incorporated p,p' DDE and MXC into both muscle and ovary tissue, with the ovary incorporating 3 times more organochlorine pesticides compared to muscle. Endpoints assessed were those related to reproduction due to previous studies demonstrating that these pesticides impact the reproductive axis and we hypothesized that a dietary exposure would result in impaired reproduction. However, oocyte distribution, gonadosomatic index, plasma vitellogenin, and plasma sex steroids (17β-estradiol, E2 and testosterone, T) were not different between control animals and contaminant-fed largemouth bass. Moreover, neither p, p' DDE nor MXC affected E2 or T production in ex vivo oocyte cultures from chemical-fed largemouth bass. However, both pesticides did interfere with the normal upregulation of androgen receptor that is observed in response to human chorionic gonadotropin in ex vivo cultures, an observation that may be related to their anti-androgenic properties. Transcriptomics profiling in the ovary revealed that gene networks related to cell processes such as leukocyte cell adhesion, ossification, platelet function and inhibition, xenobiotic metabolism, fibrinolysis, and thermoregulation

  15. The early stress responses in fish larvae.

    Science.gov (United States)

    Pederzoli, Aurora; Mola, Lucrezia

    2016-05-01

    During the life cycle of fish the larval stages are the most interesting and variable. Teleost larvae undergo a daily increase in adaptability and many organs differentiate and become active. These processes are concerted and require an early neuro-immune-endocrine integration. In larvae communication among the nervous, endocrine and immune systems utilizes several known signal molecule families which could be different from those of the adult fish. The immune-neuroendocrine system was studied in several fish species, among which in particular the sea bass (Dicentrarchus labrax), that is a species of great commercial interest, very important in aquaculture and thus highly studied. Indeed the immune system of this species is the best known among marine teleosts. In this review the data on main signal molecules of stress carried out on larvae of fish are considered and discussed. For sea bass active roles in the early immunological responses of some well-known molecules involved in the stress, such as ACTH, nitric oxide, CRF, HSP-70 and cortisol have been proposed. These molecules and/or their receptors are biologically active mainly in the gut before complete differentiation of gut-associated lymphoid tissue (GALT), probably acting in an autocrine/paracrine way. An intriguing idea emerges from all results of these researches; the molecules involved in stress responses, expressed in the adult cells of the hypothalamic-pituitary axis, during the larval life of fish are present in several other localizations, where they perform probably the same role. It may be hypothesized that the functions performed by hypothalamic-pituitary system are particularly important for the survival of the larva and therefore they comprises several other localizations of body. Indeed the larval stages of fish are very crucial phases that include many physiological changes and several possible stress both internal and environmental. PMID:26968620

  16. Quantitative trait loci involved in sex determination and body growth in the gilthead sea bream (Sparus aurata L. through targeted genome scan.

    Directory of Open Access Journals (Sweden)

    Dimitrios Loukovitis

    Full Text Available Among vertebrates, teleost fish exhibit a considerably wide range of sex determination patterns that may be influenced by extrinsic parameters. However even for model fish species like the zebrafish Danio rerio the precise mechanisms involved in primary sex determination have not been studied extensively. The zebrafish, a gonochoristic species, is lacking discernible sex chromosomes and the sex of juvenile fish is difficult to determine. Sequential protandrous hermaphrodite species provide distinct determination of the gender and allow studying the sex determination process by looking at the mechanism of sex reversal. This is the first attempt to understand the genetic basis of phenotypic variation for sex determination and body weight in a sequential protandrous hermaphrodite species, the gilthead sea bream (Sparus aurata. This work demonstrates a fast and efficient strategy for Quantitative Trait Loci (QTL detection in the gilthead sea bream, a non-model but target hermaphrodite fish species. Therefore a comparative mapping approach was performed to query syntenies against two other Perciformes, the European sea bass (Dicentrarchus labrax, a gonochoristic species and the Asian sea bass (Lates calcarifer a protandrous hermaphrodite. In this manner two significant QTLs, one QTL affecting both body weight and sex and one QTL affecting sex, were detected on the same linkage group. The co-segregation of the two QTLs provides a genomic base to the observed genetic correlation between these two traits in sea bream as well as in other teleosts. The identification of QTLs linked to sex reversal and growth, will contribute significantly to a better understanding of the complex nature of sex determination in S. aurata where most individuals reverse to the female sex at the age of two years through development and maturation of the ovarian portion of the gonad and regression of the testicular area. [Genomic sequences reported in this manuscript have been

  17. Pathogenicity of Aeromonas hydrophila isolated from the Malaysian Sea against coral (Turbinaria sp.) and sea bass (Lates calcarifer).

    Science.gov (United States)

    Hamid, Rahimi; Ahmad, Asmat; Usup, Gires

    2016-09-01

    A study was carried out to determine the pathogenicity (hemolytic activity) on corals (Turbinaria sp.) and sea bass (Lates calcarifer) of Aeromonas hydrophila from water, sediment, and coral. Samples were collected from coastal water and coral reef areas. One hundred and sixty-two isolates were successfully isolated. Out of 162, 95 were from seawater, 49 from sediment, and 18 from coral. Sixteen isolates were picked and identified. Isolates were identified using a conventional biochemical test, the API 20NE kit, and 16S rRNA nucleotide sequences. Hemolytic activity was determined. Out of 16 isolates, 14 isolates were β-hemolytic and two isolates were non-hemolytic. Corals infected with A. hydrophila suffered bleaching. Similar effect was observed for both hemolytic and non-hemolytic isolates. Intramuscular injection of A. hydrophila into sea bass resulted in muscular bleeding and death. Higher infection rates were obtained from hemolytic compared to non-hemolytic strains of A. hydrophila isolates. PMID:27221587

  18. Dynamics of polychlorinated biphenyls in striped bass from the Hudson river. III. tissue disposition and routes for elimination

    International Nuclear Information System (INIS)

    Striped bass were exposed to 14C-polychlorinated biphenyls (PCB) in single-dose and multiple-dose experiments. Samples were analyzed to determine rate constants for PCB elimination from individual tissues, PCB concentration in tissues, the proportion of the PCB burden retained and the proportion of the cumulative dose retained by each tissue at various times after exposure. An experiment was also conducted to determine both the potential for secondary PCB uptake in dietary exposure studies and the relative tissue disposition of PCBs assimilated from dietary sources as compared to direct water uptake. PCBs were present in the tissues of striped bass within 6 h after administration of a single dose. Certain tissue compartments, such as the liver/gall bladder, accumulated PCBs over a period of 48 h even though the whole-body burden had decreased between 24 and 48 h. Except for the gills, elimination rate constants for all tissues were similar and were to the whole body elimination rate constant. Elimination during the first few hours following exposure to PCBs may be due to equilibrium partitioning from the gill to the environment. The multiple-dose study showed that PCB burdens in striped bass continued to increase with dosing. However, tissue-specific rate constants for PCB elimination led to an increased flux of PCB out of tissues, and an overall decline in the percent of the cumulative dose remaining in the body 48 h after administration of each dose. The most likely route for PCB elimination from striped bass was from tissues to the liver and thence to the intestine via the bile. These were no differences in the tissue disposition of PCB related to route of exposure

  19. San Francisco Estuary Striped Bass Migration History Determined by Electron-microprobe Analysis of Otolith Sr/Ca Ratio

    Energy Technology Data Exchange (ETDEWEB)

    Ostrach, D J; Phillis, C C; Weber, P K; Ingram, B L; Zinkl, J G

    2004-09-17

    Habitat use has been shown to be an important factor in the bioaccumulation of contaminants in striped bass. This study examines migration in striped bass as part of a larger study investigating bioaccumulation and maternal transfer of xenobiotics to progeny in the San Francisco Estuary system. Habitat use, residence time and spawning migration over the life of females (n = 23) was studied. Female striped bass were collected between Knights Landing and Colusa on the Sacramento River during the spawning runs of 1999 and 2001. Otoliths were removed, processed and aged via otolith microstructure. Subsequently, otoliths were analyzed for strontium/calcium (Sr/Ca) ratio using an electron-microprobe to measure salinity exposure and to distinguish freshwater, estuary, and marine habitat use. Salinity exposure during the last year before capture was examined more closely for comparison of habitat use by the maternal parent to contaminant burden transferred to progeny. Results were selectively confirmed by ion microprobe analyses for habitat use. The Sr/Ca data demonstrate a wide range of migratory patterns. Age of initial ocean entry differs among individuals before returning to freshwater, presumably to spawn. Some fish reside in freshwater year-round, while others return to more saline habitats and make periodic migrations to freshwater. Frequency of habitat shifts and residence times differs among fish, as well as over the lifetime of individual fish. While at least one fish spent its final year in freshwater, the majority of spawning fish spent their final year in elevated salinity. However, not all fish migrated to freshwater to spawn in the previous year. Results from this investigation concerning migration history in striped bass can be combined with contaminant and histological developmental analyses to better understand the bioaccumulation of contaminants and the subsequent effects they and habitat use have on fish populations in the San Francisco Estuary system.

  20. Largemouth bass (Micropterus salmoides) and striped mullet (Mugil cephalus) as vectors of contaminants to human consumers in northwest Florida

    Science.gov (United States)

    Karouna-Renier, Natalie K.; Snyder, Richard A.; Lange, Ted; Gibson, Suzanne; Allison, Jeffrey G.; Wagner, Matthew E.; Rao, K. Ranga

    2011-01-01

    The health benefits of regular consumption of fish and seafood have been espoused for many years. However, fish are also a potential source of environmental contaminants that have well known adverse effects on human health. We investigated the consumption risks for largemouth bass (Micropterus salmoides; n = 104) and striped mullet (Mugil cephalus; n = 170), two commonly harvested and consumed fish species inhabiting fresh and estuarine waters in northwest Florida. Skinless fillets were analyzed for total mercury, inorganic arsenic, polychlorinated dibenzo-p-dioxins and polychlorinated dibenzofurans (PCDD/F), polychlorinated biphenyls (PCBs), and organochlorine pesticides. Contaminant levels were compared to screening values (SV) calculated using U.S. Environmental Protection Agency (EPA) recommendations for establishing consumption advisories. Largemouth bass were found to contain high levels of total mercury at all sampling locations (0.37-0.89 ug/g) and one location exhibited elevated total PCBs (39.4 ng/g). All of the samples exceeded Florida fish consumption advisory trigger levels for total mercury and one location exceeded the U.S. EPA SV for total PCBs. As a result of the high mercury levels, the non-cancer health risks (hazard index-HI) for bass were above 1 for all locations. Striped mullet from several locations with known point sources contained elevated levels of PCBs (overall range 3.4-59.3 ng/g). However, total mercury levels in mullet were low. Eight of the 16 mullet sampling locations exceeded the U.S. EPA SV for total PCBs and two locations exceeded an HI of 1 due to elevated PCBs. Despite the elevated levels of total PCBs in some samples, only two locations exceeded the acceptable cancer risk range and therefore cancer health risks from consumption of bass and mullet were determined to be low at most sampling locations.

  1. Characterization of Exopolysaccharides Produced by Bacillus cereus and Brachybacterium sp. Isolated from Asian Sea Bass (Lates calcarifer

    Directory of Open Access Journals (Sweden)

    Mohamed Orsod

    2012-09-01

    Full Text Available Aims: EPS extracted from marine bacteria, which associated with Asian sea bass has potential antimicrobial activities.Methodology and Results: Two marine Bacteria were isolated from Asian sea bass (Lates calcarifer obtained from aquaculture farm, located at Johor bahru Malaysia. 16S rRNA analysis for bacteria identity revealed that bacteria ors1 had 99 % identity to Bacillus cereus and ors2 had 96 % identity with Brachybacterium sp. All bacteria shared many similarities and variation in terms of biochemical reactions and microscopic observation. Exopolysaccharides (EPSs were extracted and purified from bacteria as they produced mucous colonies. Average analysis of EPS components showed 50 % carbohydrates, 26 % protein and 24 % fatty acids. The FTIR analysis confirmed the functional groups of the EPS. Screening for antimicrobial activities assays using Kirby-Bauer methods against both grams positive and negative had shown presence of inhibition zones.Conclusion, significance and impact of study: This study recommends that bacteria isolated from Asian sea bass are having antimicrobial activities and could be used as a potential source for the development of marine drugs.

  2. Laser capture microdissection of intestinal tissue from sea bass larvae using an optimized RNA integrity assay and validated reference genes.

    Science.gov (United States)

    Schaeck, M; De Spiegelaere, W; De Craene, J; Van den Broeck, W; De Spiegeleer, B; Burvenich, C; Haesebrouck, F; Decostere, A

    2016-01-01

    The increasing demand for a sustainable larviculture has promoted research regarding environmental parameters, diseases and nutrition, intersecting at the mucosal surface of the gastrointestinal tract of fish larvae. The combination of laser capture microdissection (LCM) and gene expression experiments allows cell specific expression profiling. This study aimed at optimizing an LCM protocol for intestinal tissue of sea bass larvae. Furthermore, a 3'/5' integrity assay was developed for LCM samples of fish tissue, comprising low RNA concentrations. Furthermore, reliable reference genes for performing qPCR in larval sea bass gene expression studies were identified, as data normalization is critical in gene expression experiments using RT-qPCR. We demonstrate that a careful optimization of the LCM procedure allows recovery of high quality mRNA from defined cell populations in complex intestinal tissues. According to the geNorm and Normfinder algorithms, ef1a, rpl13a, rps18 and faua were the most stable genes to be implemented as reference genes for an appropriate normalization of intestinal tissue from sea bass across a range of experimental settings. The methodology developed here, offers a rapid and valuable approach to characterize cells/tissues in the intestinal tissue of fish larvae and their changes following pathogen exposure, nutritional/environmental changes, probiotic supplementation or a combination thereof. PMID:26883391

  3. Victims Themselves of a Close Encounter: On the Sensory Language and Bass Fiction of Space Ape (In Memoriam

    Directory of Open Access Journals (Sweden)

    tobias c. van Veen

    2015-11-01

    Full Text Available This text is written in memoriam to dubstep emcee and poet Space Ape (Stephen Samuel Gordon, b. June 17th, 1970; d. October 2nd, 2014. By his own words, Space Ape arose from the depths of the black Atlantic, on a mission to relieve the “pressure” through bass fiction. My aim is to explicate Space Ape’s bass fiction as the intersection of material and imaginal forces, connecting it to a broader Afrofuturist constellation of mythopoetic becomings. Memory and matter converge in the affect and sounding of Space Ape the “hostile alien” (“Space Ape”, Burial, 2006, a figure shaped at the intersection of the dread body, riddim warfare, and speculative lyricism. Space Ape set out to “xorcise” that which consumed him from within by embracing the “spirit of change”. Turning to process philosophy, I demonstrate how Space Ape’s bass fiction—his virtual body—activates the abstract concepts of becoming in the “close encounter” with the hostile alien.

  4. Species profiles: Life histories and environmental requirements of coastal fishes and invertebrates (South Atlantic): Black sea bass

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, L.P.

    1989-07-01

    Species profiles are literature summaries on the taxonomy, morphology, range, life history, and environmental requirements of coastal aquatic species. They are designed to assist in environmental impact assessment. The black sea bass, Centropristis striata, is an abundant species associated with the inshore sponge-coral habitat in the South Atlantic Bight (Cape Hatteras to Cape Canaveral). It is a protogynous hermaphrodite (each individual is first a female and then a male) that spawns from January to June on the Continental shelf. Juveniles utilize estuaries, as well as offshore areas, for nurseries. It is a slow growing species with a life span of about 10 years. Juveniles and adults are bottom-feeding carnivores. Adults have been collected at temperatures as low as 6 /degree/C but are most abundant at temperatures of 8 to 10 /degree/C and above. Juveniles tolerate lower temperatures and greater salinity ranges than adults. Black sea bass are primarily harvested by the recreational hook and line fishery and the commercial trap fishery. Yield-per-recruit analyses indicate that the harvest of black sea bass is less than the maximum possible due to a combination of high fishing pressure and harvest of small fish. 58 refs., 2 figs., 6 tabs.

  5. Is the perceived resiliency of fish larvae to ocean acidification masking more subtle effects?

    Directory of Open Access Journals (Sweden)

    E. C. Pope

    2013-10-01

    Full Text Available Ocean acidification, caused by rising concentrations of carbon dioxide (CO2, is widely considered to be a major global threat to marine ecosystems. To investigate the potential effects of ocean acidification on the early life stages of a commercially important fish species, European sea bass (Dicentrarchus labrax, 12 000 larvae were incubated from hatch through metamorphosis under a matrix of two temperatures (17 and 19 °C and two seawater pCO2s (400 and 750 μatm and sampled regularly for 42 days. Calculated daily mortality was significantly affected by both temperature and pCO2, with both increased temperature and elevated pCO2 associated with lower daily mortality and a significant interaction between these two factors. There was no significant pCO2 effect noted on larval morphology during this period but larvae raised at 19 °C possessed significantly larger eyes and lower carbon:nitrogen ratios at the end of the study compared to those raised under 17 °C. These results suggest that D. labrax larvae are resilient to near-future oceanic conditions. However, when the incubation was continued to post-metamorphic (juvenile animals (day 67–69, fish raised under a combination of 19 °C and 750 μatm pCO2 were significantly heavier and exhibited lower aerobic scopes than those incubated at 19 °C and 400 μatm. Most other studies investigating the effects of near-future oceanic conditions on the early life stages of marine fish have used incubations of relatively short durations and suggested these animals are resilient to ocean acidification. We propose the durations of these other studies may be insufficient for more subtle effects, such as those observed in this study, to become apparent. These findings may have important implications for both sea bass in a changing ocean and also for the interpretation of results from other studies that have shown resiliency in marine teleosts exposed to higher atmospheric concentrations of CO2.

  6. Is the perceived resiliency of fish larvae to ocean acidification masking more subtle effects?

    Science.gov (United States)

    Pope, E. C.; Ellis, R. P.; Scolamacchia, M.; Scolding, J. W. S.; Keay, A.; Chingombe, P.; Shields, R. J.; Wilcox, R.; Speirs, D. C.; Wilson, R. W.; Lewis, C.; Flynn, K. J.

    2013-10-01

    Ocean acidification, caused by rising concentrations of carbon dioxide (CO2), is widely considered to be a major global threat to marine ecosystems. To investigate the potential effects of ocean acidification on the early life stages of a commercially important fish species, European sea bass (Dicentrarchus labrax), 12 000 larvae were incubated from hatch through metamorphosis under a matrix of two temperatures (17 and 19 °C) and two seawater pCO2s (400 and 750 μatm) and sampled regularly for 42 days. Calculated daily mortality was significantly affected by both temperature and pCO2, with both increased temperature and elevated pCO2 associated with lower daily mortality and a significant interaction between these two factors. There was no significant pCO2 effect noted on larval morphology during this period but larvae raised at 19 °C possessed significantly larger eyes and lower carbon:nitrogen ratios at the end of the study compared to those raised under 17 °C. These results suggest that D. labrax larvae are resilient to near-future oceanic conditions. However, when the incubation was continued to post-metamorphic (juvenile) animals (day 67-69), fish raised under a combination of 19 °C and 750 μatm pCO2 were significantly heavier and exhibited lower aerobic scopes than those incubated at 19 °C and 400 μatm. Most other studies investigating the effects of near-future oceanic conditions on the early life stages of marine fish have used incubations of relatively short durations and suggested these animals are resilient to ocean acidification. We propose the durations of these other studies may be insufficient for more subtle effects, such as those observed in this study, to become apparent. These findings may have important implications for both sea bass in a changing ocean and also for the interpretation of results from other studies that have shown resiliency in marine teleosts exposed to higher atmospheric concentrations of CO2.

  7. Safety of oxytetracycline (Terramycin TM-100F) administered in feed to hybrid striped bass, walleyes, and yellow perch

    Science.gov (United States)

    Gaikowski, M.P.; Wolf, J.C.; Schleis, S.M.; Gingerich, W.H.

    2003-01-01

    Oxytetracycline (Terramycin TM-100F, a medicated premix containing oxytetracycline at 220 g/kg) is approved in the United States to control certain systemic bacterial diseases of salmon and catfish when fed at a rate of 55-82.5 mg per kilogram of bodyweight per day for 10 d. Although oxytetracycline may also control certain systemic bacterial infections in coolwater or scaled warmwater fish, no safety data for such species are available. Our objective was to determine the safety of oxytetracycline administered in feed at nominal doses of 0, 82.5, 248, or 413 mg??kg-1??d-1 to yellow perch Perca flavescens and hybrid striped bass (striped bass Morone saxatilis x white bass M. chrysops) for 10 d and to walleye Sander vitreus (formerly Stizostedion vitreum) for 20 d. Yellow perch and hybrid striped bass consumed 50% to 100% of the diet, whereas walleye feed consumption was occasionally less than 50% of the diet. Feed or fecal material was present in the gastrointestinal tract of all necropsied walleyes except for one control fish. The single growth effect was that hybrid striped bass offered a nominal dose of 413 mg??kg-1??d-1 were significantly smaller than untreated controls. Oxytetracycline-related histopathological findings were limited to walleyes and were of low severity. The histopathological findings included decreased hematopoietic-lymphopoietic (H&L) tissue in the anterior kidneys, diffuse hyperplasia of the gill filament epithelium, and a decreased prevalence of fish with eosinophilic droplets in their renal tubular epithelial cells. Although the incidence of decreased H&L tissue tended to increase in proportion to oxytetracycline dose, this finding was statistically significant only for fish that received a nominal dose of 413 mg??kg-1??d-1. Given the pathogenicity of the types of bacteria that are controlled by oxytetracycline treatment and the long history of its use in major aquaculture species, the relative risk of the minor oxytetracycline

  8. Aquatic contaminants alter genes involved in neurotransmitter synthesis and gonadotropin release in largemouth bass

    International Nuclear Information System (INIS)

    Many aquatic contaminants potentially affect the central nervous system, however the underlying mechanisms of how toxicants alter normal brain function are not well understood. The objectives of this study were to compare the effects of emerging and prevalent environmental contaminants on the expression of brain transcripts with a role in neurotransmitter synthesis and reproduction. Adult male largemouth bass (Micropterus salmoides) were injected once for a 96 h duration with control (water or oil) or with one of two doses of a single chemical to achieve the following body burdens (μg/g): atrazine (0.3 and 3.0), toxaphene (10 and 100), cadmium (CdCl2) (0.000067 and 0.00067), polychlorinated biphenyl (PCB) 126 (0.25 and 2.5), and phenanthrene (5 and 50). Partial largemouth bass gene segments were cloned for enzymes involved in neurotransmitter (glutamic acid decarboxylase 65, GAD65; tyrosine hydroxylase) and estrogen (brain aromatase; CYP19b) synthesis for real-time PCR assays. In addition, neuropeptides regulating feeding (neuropeptide Y) and reproduction (chicken GnRH-II, cGnRH-II; salmon GnRH, sGnRH) were also investigated. Of the chemicals tested, only cadmium, PCB 126, and phenanthrene showed any significant effects on the genes tested, while atrazine and toxaphene did not. Cadmium (0.000067 μg/g) significantly increased cGnRH-II mRNA while PCB 126 (0.25 μg/g) decreased GAD65 mRNA. Phenanthrene decreased GAD65 and tyrosine hydroxylase mRNA levels at the highest dose (50 μg/g) but increased cGnRH-II mRNA at the lowest dose (5 μg/g). CYP19b, NPY, and sGnRH mRNA levels were unaffected by any of the treatments. A hierarchical clustering dendrogram grouped PCB 126 and phenanthrene more closely than other chemicals with respect to the genes tested. This study demonstrates that brain transcripts important for neurotransmitter synthesis neuroendocrine function are potential targets for emerging and prevalent aquatic contaminants.

  9. Aquatic contaminants alter genes involved in neurotransmitter synthesis and gonadotropin release in largemouth bass

    Energy Technology Data Exchange (ETDEWEB)

    Martyniuk, Christopher J. [Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States); Sanchez, Brian C. [Department of Forestry and Natural Resources and School of Civil Engineering, 195 Marsteller St., Purdue University, West Lafayette, IN 47907 (United States); Szabo, Nancy J.; Denslow, Nancy D. [Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States); Sepulveda, Maria S., E-mail: mssepulv@purdue.edu [Department of Forestry and Natural Resources and School of Civil Engineering, 195 Marsteller St., Purdue University, West Lafayette, IN 47907 (United States)

    2009-10-19

    Many aquatic contaminants potentially affect the central nervous system, however the underlying mechanisms of how toxicants alter normal brain function are not well understood. The objectives of this study were to compare the effects of emerging and prevalent environmental contaminants on the expression of brain transcripts with a role in neurotransmitter synthesis and reproduction. Adult male largemouth bass (Micropterus salmoides) were injected once for a 96 h duration with control (water or oil) or with one of two doses of a single chemical to achieve the following body burdens ({mu}g/g): atrazine (0.3 and 3.0), toxaphene (10 and 100), cadmium (CdCl{sub 2}) (0.000067 and 0.00067), polychlorinated biphenyl (PCB) 126 (0.25 and 2.5), and phenanthrene (5 and 50). Partial largemouth bass gene segments were cloned for enzymes involved in neurotransmitter (glutamic acid decarboxylase 65, GAD65; tyrosine hydroxylase) and estrogen (brain aromatase; CYP19b) synthesis for real-time PCR assays. In addition, neuropeptides regulating feeding (neuropeptide Y) and reproduction (chicken GnRH-II, cGnRH-II; salmon GnRH, sGnRH) were also investigated. Of the chemicals tested, only cadmium, PCB 126, and phenanthrene showed any significant effects on the genes tested, while atrazine and toxaphene did not. Cadmium (0.000067 {mu}g/g) significantly increased cGnRH-II mRNA while PCB 126 (0.25 {mu}g/g) decreased GAD65 mRNA. Phenanthrene decreased GAD65 and tyrosine hydroxylase mRNA levels at the highest dose (50 {mu}g/g) but increased cGnRH-II mRNA at the lowest dose (5 {mu}g/g). CYP19b, NPY, and sGnRH mRNA levels were unaffected by any of the treatments. A hierarchical clustering dendrogram grouped PCB 126 and phenanthrene more closely than other chemicals with respect to the genes tested. This study demonstrates that brain transcripts important for neurotransmitter synthesis neuroendocrine function are potential targets for emerging and prevalent aquatic contaminants.

  10. Aquatic contaminants alter genes involved in neurotransmitter synthesis and gonadotropin release in largemouth bass.

    Science.gov (United States)

    Martyniuk, Christopher J; Sanchez, Brian C; Szabo, Nancy J; Denslow, Nancy D; Sepúlveda, Maria S

    2009-10-19

    Many aquatic contaminants potentially affect the central nervous system, however the underlying mechanisms of how toxicants alter normal brain function are not well understood. The objectives of this study were to compare the effects of emerging and prevalent environmental contaminants on the expression of brain transcripts with a role in neurotransmitter synthesis and reproduction. Adult male largemouth bass (Micropterus salmoides) were injected once for a 96 h duration with control (water or oil) or with one of two doses of a single chemical to achieve the following body burdens (microg/g): atrazine (0.3 and 3.0), toxaphene (10 and 100), cadmium (CdCl(2)) (0.000067 and 0.00067), polychlorinated biphenyl (PCB) 126 (0.25 and 2.5), and phenanthrene (5 and 50). Partial largemouth bass gene segments were cloned for enzymes involved in neurotransmitter (glutamic acid decarboxylase 65, GAD65; tyrosine hydroxylase) and estrogen (brain aromatase; CYP19b) synthesis for real-time PCR assays. In addition, neuropeptides regulating feeding (neuropeptide Y) and reproduction (chicken GnRH-II, cGnRH-II; salmon GnRH, sGnRH) were also investigated. Of the chemicals tested, only cadmium, PCB 126, and phenanthrene showed any significant effects on the genes tested, while atrazine and toxaphene did not. Cadmium (0.000067 microg/g) significantly increased cGnRH-II mRNA while PCB 126 (0.25 microg/g) decreased GAD65 mRNA. Phenanthrene decreased GAD65 and tyrosine hydroxylase mRNA levels at the highest dose (50 microg/g) but increased cGnRH-II mRNA at the lowest dose (5 microg/g). CYP19b, NPY, and sGnRH mRNA levels were unaffected by any of the treatments. A hierarchical clustering dendrogram grouped PCB 126 and phenanthrene more closely than other chemicals with respect to the genes tested. This study demonstrates that brain transcripts important for neurotransmitter synthesis neuroendocrine function are potential targets for emerging and prevalent aquatic contaminants. PMID:19781795

  11. Use of stable carbon and nitrogen isotopes to trace the larval striped bass food chain in the Sacramento-San Joaquin Estuary, California, April to September 1985

    Science.gov (United States)

    Rast, Walter; Sutton, J.E.

    1989-01-01

    To assess one potential cause for the decline of the striped bass fishery in the Sacramento-San Joaquin Estuary, stable carbon and nitrogen isotope ratios were used to examine the trophic structures of the larval striped bass food chain, and to trace the flux of these elements through the food chain components. Study results generally confirm a food chain consisting of the elements, phytoplankton/detritus-->zooplankton/Neomysis shrimp-->larval striped bass. The stable isotope ratios generally become more positive as one progresses from the lower to the higher trophic level food chain components, and no unusual trophic structure was found in the food chain. However, the data indicate an unidentified consumer organism occupying an intermediate position between the lower and higher trophic levels of the larval striped bass food chain. Based on expected trophic interactions, this unidentified consumer would have a stable carbon isotope ratio of about 28/mil and a stable nitrogen isotope ratio of about 8/mi. Three possible feeding stages for larval striped bass also were identified, based on their lengths. The smallest length fish seem to subsist on their yolk sac remnants, and the largest length fish subsist on Neomysis shrimp and zooplankton. The intermediate-length fish represent a transition stage between primary food sources and/or use of a mixture of food sources. (USGS)

  12. Forecasting sales of new vehicle with limited data using Bass diffusion model and Grey theory

    Science.gov (United States)

    Abu, Noratikah; Ismail, Zuhaimy

    2015-02-01

    New product forecasting is a process that determines a reasonable estimate of sales attainable under a given set of conditions. There are several new products forecasting method in practices and Bass Diffusion Model (BDM) is one of the most common new product diffusion model used in many industries to forecast new product and technology. Hence, this paper proposed a combining BDM with Grey theory to forecast sales of new vehicle in Malaysia that certainly have limited data to build a model on. The aims of this paper is to examine the accuracy of different new product forecasting models and thus identify which is the best among the basic BDM and combining BDM with Grey theory. The results show that combining BDM with Grey theory performs better than the basic BDM based on in-sample and out-sample mean absolute percentage error (MAPE). Results also reveals combining model forecast more effectively and accurately even with insufficient previous data on the new vehicle in Malaysia.

  13. Multivariate approach to gill pathology in European sea bass after experimental exposure to cadmium and terbuthylazine.

    Science.gov (United States)

    Manera, Maurizio; Sayyaf Dezfuli, Bahram; DePasquale, Joseph A; Giari, Luisa

    2016-07-01

    The combined use of guided quantitative expert analysis and of multivariate exploratory data analysis is reported as a robust, sensitive and sufficiently specific approach to study European sea bass gill secondary lamellar pathology after exposure to incremental doses of cadmium and terbuthylazine up to 48h. The following elementary pathological findings were considered: "epithelial lifting", "epithelial shrinkage", "epithelial swelling", "pillar cells coarctation", "pillar cells detachment", "channels fusion", "chloride cells swelling", and "chloride cells invasion". The relative spatial extension was determined according to exposure class and data were analyzed by means of canonical correspondence analysis (CCA), linear discriminant analysis (LDA) and canonical variates analysis (CVA). Histologically and ultrastructurally, cellular shrinkage/coarctation prevailed in cadmium exposed lamellae, whereas cellular swelling and epithelial lifting were predominant in terbuthylazine exposed lamellae compared to unexposed fish. Both CCA and CVA permit a good graphical data grouping according to exposure classes by means of the convex hull minimum polygons. This also reveals exposure dose and time gradients in CCA plot. Accordingly, epithelial swelling and epithelial shrinkage were comparatively associated to higher exposure time, whereas epithelial shrinkage and pillar cells coarctation were comparatively associated to higher exposure dose. LDA with only "epithelial shrinkage", "epithelial swelling" and "pillar cells coarctation" in the model classified correctly 87.5% of the cross-validated cases. A possible pathogenetic relationship between the discriminant elementary lesions and the toxic mode of action at the cellular level of both cadmium and terbuthylazine is also discussed. PMID:27057996

  14. Production of killed vaccine from Streptococcus sp. and its application in sea bass (Lates calcarifer

    Directory of Open Access Journals (Sweden)

    Wanman, CH.

    2007-09-01

    Full Text Available Fish with an average length of 3.0-4.0 inches vaccinated with formalin-killed vaccine of Streptococcus sp. either by intraperitoneal injection and immersion methods had a survival rate of 100% indicating that the vaccine is safe to be used with sea bass. The highest efficacy was received when the vaccine containing bacterin at 2.50x1010 CFU/ml. Injection of vaccine together with adjuvant (CFA was highly effective against Streptococcus sp. infection. The relative percent survival (RPS of fish injected with vaccine alone and vaccine plus adjuvant were 100 (10 days post vaccination, 54.06 and 92.29 (20 days post vaccination and 31.58 and 73.68 (30 days post vaccination respectively. The fish which received vaccine by hyperosmotic immersion showed higher resistance to the disease than by direct immersion with the RPS of 30.77 and 71.80 (10 days post vaccination, 9.75 and 70.73 (20 days post vaccination and 7.14 and 16.67 (30 days post vaccination for direct immersion and hyperosmotic immersion, respectively.

  15. The association of DNA damage to concentrations of mercury and radiocesium in largemouth bass

    International Nuclear Information System (INIS)

    Largemouth bass from five lakes were examined to determine levels of contamination by mercury and radiocesium and amounts of DNA damage. Concentrations of these toxicants and an index of body condition were regressed against overall DNA damage and DNA damage in individual tissues (liver, gills, and red blood cells) as indicated by the alkaline unwinding method. Sample sites showed considerable heterogeneity in concentrations of mercury and radiocesium, as well as numbers of DNA strand breaks. Generally, increased concentrations of toxicants were related to increased DNA damage. Tissues may have responded to contaminants in different manners; red blood cells generally showed the greatest DNA damage while liver tissue showed the least. Although body condition was related to DNA damage, it is unclear whether it has a direct effect or whether it is a correlated response to contamination by mercury and radiocesium. The potential for repair of DNA strand breaks and cell turnover rates may play an important role in determining the ultimate amount of DNA damage in contaminated organisms

  16. Skeletal deformities in smallmouth bass, Micropterus dolomieui, from southern Appalachian reservoirs

    Energy Technology Data Exchange (ETDEWEB)

    Van den Avyle, M.J.; Garvick, S.J.; Blazer, V.S.; Hamilton, S.J.; Brumbaugh, W.G.

    1989-09-01

    Smallmouth bass (Micropterus dolomieui) populations in two of five reservoirs sampled in the southern Appalachian Mountains contained high percentages of individuals with lordosis, kyphosis, or scoliosis. Deformities of the vertebral column occurred in several year classes and varied with fish size; they were absent in small fish, present in 25-30% of the fish 241-300 mm long, and then decreased in occurrence with increased length. Because environmental contamination is often responsible for high occurrences of deformed fish, whole-body concentrations of contaminants, bone development characteristics, and blood plasma concentrations of calcium and phosphorus in normal and deformed fish were measured and compared the results with those for fish from reservoirs where no deformities were found. Vertebrae were significantly weaker and more elastic in deformed than in normal fish, but biochemical properties of vertebrae were similar among the groups tested. Concentrations of pesticides and metals were not elevated in deformed fish, and concentrations of calcium and phosphorus in blood plasma were similar in normal and deformed groups. Most environmental contaminants that have been shown to cause fish deformities could be discounted as causative agents on the basis of these results; however, the exact cause was not determined. Further attempts to diagnose the cause of the deformities were limited by the lack of background information on relationships among bone development processes, types of stresses that cause deformities, and types of bone tissue in fish.

  17. Structure and Specificity of a Binary Tandem Domain F-Lectin from Striped Bass (Morone saxatilis)

    Energy Technology Data Exchange (ETDEWEB)

    Bianchet, M.; Odom, E; Vasta, J; Amzel, M

    2010-01-01

    The plasma of the striped bass Morone saxatilis contains a fucose-specific lectin (MsaFBP32) that consists of two F-type carbohydrate recognition domains (CRDs) in tandem. The crystal structure of the complex of MsaFBP32 with l-fucose reported here shows a cylindrical 81-A-long and 60-A-wide trimer divided into two globular halves: one containing N-terminal CRDs (N-CRDs) and the other containing C-terminal CRDs (C-CRDs). The resulting binding surfaces at the opposite ends of the cylindrical trimer have the potential to cross-link cell surface or humoral carbohydrate ligands. The N-CRDs and C-CRDs of MsaFBP32 exhibit significant structural differences, suggesting that they recognize different glycans. Analysis of the carbohydrate binding sites provides the structural basis for the observed specificity of MsaFBP32 for simple carbohydrates and suggests that the N-CRD recognizes more complex fucosylated oligosaccharides and with a relatively higher avidity than the C-CRD. Modeling of MsaFBP32 complexed with fucosylated glycans that are widely distributed in prokaryotes and eukaryotes rationalizes the observation that binary tandem CRD F-type lectins function as opsonins by cross-linking 'non-self' carbohydrate ligands and 'self' carbohydrate ligands, such as sugar structures displayed by microbial pathogens and glycans on the surface of phagocytic cells from the host.

  18. Biomarker responses in sunfish species and largemouth bass from the Saluda River, South Carolina.

    Science.gov (United States)

    Mierzejewski, Jessica; Haney, Dennis C; van den Hurk, Peter

    2014-12-01

    The upstate and Piedmont region of South Carolina is a rapidly urbanizing area as a result of a steadily growing population. This increase in population and development has the potential to negatively impact local aquatic systems like the Saluda River due to increased pollution from runoff, and effluents from industrial and wastewater treatment facilities. During the summer months of 2010, 159 fish from the Centrarchidae family (sunfish species (Lepomis) and largemouth bass - Micropterus salmoides) were collected from 13 sites along the Saluda River. A suite of biomarker assays, including ethoxyresosufin-O-deethylase, bile fluorescence, glutathione S-transferase, thiobarbituric acid reactive substances, bile estrogens, acetylcholinesterase inhibition, metallothionein and tissue metal levels were applied to investigate the impacts of diminished water quality on fish health. Results indicate that fish from the Saluda River are responding to contamination in a site specific manner, with up to four significant biomarker responses in the most impacted sites. Sampling sites in the lower portion of the Saluda watershed are less impacted by pollution than the upper and central sections. The observed biomarker responses can be explained by the proximity of urban areas, point sources and general land use, and demonstrate the applicability of biomarkers in environmental biomonitoring programs. PMID:25173848

  19. Gill Na+, K+-ATPase activity in largemouth bass (Micropterus salmoides) inhabiting reservoirs contaminated with mercury

    International Nuclear Information System (INIS)

    Active transport of Na+ and K+ for osmoregulation in fish involves gill Na+, K+-ATPase, a membrane-bound enzyme powered by hydrolysis of ATP. Na+, K+-ATPase is inhibited by many dissolved metals including Al, Cd, Cu and Hg, resulting in ionoregulatory dysfunction. However, dissolved Hg concentrations are quite low in most aquatic systems, and dietary sources are the most important contributors to Hg burdens in fish. One recent study demonstrated relationships between muscle Hg concentration and gill Na+, K+-ATPase in a marine fish, suggesting that Hg accumulated via diet can affect osmoregulation. The authors tested for such a relationship in several age-classes of a freshwater fish (Micropterus salmoides) collected from three reservoirs. Fish from Par Pond and L Lake, on the USDOE Savannah River Site in South Carolina had relatively high Hg content: for Par Pond, muscle and liver ranged from 1.58--12.01 and 1.46--23.22 microg Hg/g dry mass, respectively, and for L Lake muscle and liver ranged from 3.11--5.16 and 1.28--12.59 microg Hg/g dry mass, respectively. Bass from an offsite location, Thurmond Lake, had significantly (P +, K+-ATPase activity was not evident

  20. Characterization and Purification of Glutathione S-Transferase from the Liver and Gill Tissues of Ağrı Balık Lake Trout Salmo trutta labrax and the Effects of Heavy Metal Ions on Its Activity.

    Science.gov (United States)

    Çomaklı, Veysel; Kuzu, Muslum; Demirdağ, Ramazan

    2015-09-01

    Glutathione S-transferase (GST) from the liver and gill tissues of Ağrı Balık Lake Trout (also known as Black Sea Trout) Salmo trutta labrax was characterized and purified, and the toxic effects of some heavy metal ions on the enzyme's activity were analyzed. Liver GST was purified 930 times, resulting in 56% yield using glutathione-agarose affinity chromatography and a specific activity of 60.87 endotoxin units (EU)/mg protein. Using the same procedure, gill GST was purified 576 times, resulting in a 60% yield and specific activity of 46.8 EU/mg protein. The purity check of the purified enzymes was determined with sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE). Optimal pH, ionic strength, and stable pH were found for each tissue, and separate KM and Vmax values were determined for reduced glutathione and 2,4-dinitrochlorobenzene substrates. Heavy metal ions that have toxic effects on living organisms and are known to contribute to environmental pollution were selected, and their in vitro effects on enzyme activity were analyzed. The IC50 values and Ki constants of those metal ions showing an inhibitory effect on GST activity were determined. PMID:26075414

  1. Improving oral hygiene skills by computer-based training: a randomized controlled comparison of the modified Bass and the Fones techniques.

    Directory of Open Access Journals (Sweden)

    Daniela Harnacke

    Full Text Available BACKGROUND: Gingivitis and other plaque-associated diseases have a high prevalence in western communities even though the majority of adults report daily oral hygiene. This indicates a lack of oral hygiene skills. Currently, there is no clear evidence as to which brushing technique would bring about the best oral hygiene skills. While the modified Bass technique is often recommended by dentists and in textbooks, the Fones technique is often recommended in patient brochures. Still, standardized comparisons of the effectiveness of teaching these techniques are lacking. METHODOLOGY/PRINCIPAL FINDINGS: In a final sample of n = 56 students, this multidisciplinary, randomized, examiner-blinded, controlled study compared the effects of parallel and standardized interactive computer presentations teaching either the Fones or the modified Bass technique. A control group was taught the basics of tooth brushing alone. Oral hygiene skills (remaining plaque after thorough oral hygiene and gingivitis were assessed at baseline and 6, 12, and 28 weeks after the intervention. We found a significant group×time interaction for gingivitis (F(4/102 = 3.267; p = 0.016; ε = 0.957; η(2 = 0.114 and a significant main effect of group for oral hygiene skills (F(2/51 = 7.088; p = 0.002; η(2 = 0.218. Fones was superior to Bass; Bass did not differ from the control group. Group differences were most prominent after 6 and 12 weeks. CONCLUSIONS/SIGNIFICANCE: The present trial indicates an advantage of teaching the Fones as compared to the modified Bass technique with respect to oral hygiene skills and gingivitis. Future studies are needed to analyze whether the disadvantage of teaching the Bass technique observed here is restricted to the teaching method employed. TRIAL REGISTRATION: German Clinical Trials Register DRKS00003488.

  2. Reproductive endocrine disruption in smallmouth bass (Micropterus dolomieu) in the Potomac River basin: spatial and temporal comparisons of biological effects

    Science.gov (United States)

    Blazer, Vicki; Iwanowicz, Luke R.; Henderson, Holly; Mazik, Patricia M.; Jenkins, Jill A.; Alvarez, David A.; Young, John A.

    2012-01-01

    A high prevalence of intersex or testicular oocytes (TO) in male smallmouth bass within the Potomac River drainage has raised concerns as to the health of the river. Studies were conducted to document biomarker responses both temporally and spatially to better understand the influence of normal physiological cycles, as well as water quality and land-use influences. Smallmouth bass were collected over a 2-year period from three tributaries of the Potomac River: the Shenandoah River, the South Branch Potomac and Conococheague Creek, and an out-of-basin reference site on the Gauley River. The prevalence of TO varied seasonally with the lowest prevalence observed in July, post-spawn. Reproductive maturity and/or lack of spawning the previous spring, as well as land-use practices such as application of manure and pesticides, may influence the seasonal observations. Annual, seasonal, and site differences were also observed in the percentage of males with measurable concentrations of plasma vitellogenin, mean concentration of plasma vitellogenin in females, and plasma concentrations of 17β-estradiol and testosterone in both sexes. Bass collected in the South Branch Potomac (moderate to high prevalence of TO) had less sperm per testes mass with a lower percentage of those sperm being motile when compared to those from the Gauley River (low prevalence of TO). An inverse relationship was noted between TO severity and sperm motility. An association between TO severity and wastewater treatment plant flow, percent of agriculture, total number of animal feeding operations, the number of poultry houses, and animal density within the catchment was observed.

  3. Preliminary investigation by liquid chromatography tandem mass spectrometry of perfluorinated compounds presence in bass reared and fished in Italy

    Directory of Open Access Journals (Sweden)

    Federica Farabegoli

    2013-12-01

    Full Text Available The term perfluorinated compounds (PFCs defines synthetic fully-fluorinated compounds; since the 50s they have been largely employed in a wide range of industrial and consumer applications, due to their chemical and physical properties. Only recently, research on their potential adverse effects on both the environment and human health has been conducted, highlighting carcinogenic activity, toxic effects on reproduction, liver and kidney. Human exposure to PFCs is mainly through diet, and in particular fishery products are one of the most contaminated food. Perfluorooctane sulfonate (PFOS and perfluorooctanoic acid (PFOA are the two most important and investigated compounds of this group. The aim of this work was to carry out a preliminary monitoring on the presence of these two molecules in 50 bass muscle samples, of which 30 reared and 20 fished, collected from different Italian areas of the Mediterranean Sea. The method used was based on extraction with organic solvent followed by two purification steps: one with salts and one with dispersive solid phase. The extract was finally analysed by means of an ultra performance liquid chromatographytandem mass spectrometric system. Data showed a relevant contamination of this species and evidenced a significant difference of concentrations between fished (PFOS 112.4- >2000 ng/L and PFOA 3.3-487.0 ng/L and reared basses (PFOS 11.1-104.5 ng/L and PFOA <3-51.4 ng/L. Even if these levels of contamination are sensibly lower than those observed in several studies, fished basses could represent a more relevant source of PFCs exposure in human diet.

  4. 3-D linear inversion of gravity data: method and application to Basse-Terre volcanic island, Guadeloupe, Lesser Antilles

    Science.gov (United States)

    Barnoud, Anne; Coutant, Olivier; Bouligand, Claire; Gunawan, Hendra; Deroussi, Sébastien

    2016-04-01

    We use a Bayesian formalism combined with a grid node discretization for the linear inversion of gravimetric data in terms of 3-D density distribution. The forward modelling and the inversion method are derived from seismological inversion techniques in order to facilitate joint inversion or interpretation of density and seismic velocity models. The Bayesian formulation introduces covariance matrices on model parameters to regularize the ill-posed problem and reduce the non-uniqueness of the solution. This formalism favours smooth solutions and allows us to specify a spatial correlation length and to perform inversions at multiple scales. We also extract resolution parameters from the resolution matrix to discuss how well our density models are resolved. This method is applied to the inversion of data from the volcanic island of Basse-Terre in Guadeloupe, Lesser Antilles. A series of synthetic tests are performed to investigate advantages and limitations of the methodology in this context. This study results in the first 3-D density models of the island of Basse-Terre for which we identify: (i) a southward decrease of densities parallel to the migration of volcanic activity within the island, (ii) three dense anomalies beneath Petite Plaine Valley, Beaugendre Valley and the Grande-Découverte-Carmichaël-Soufrière Complex that may reflect the trace of former major volcanic feeding systems, (iii) shallow low-density anomalies in the southern part of Basse-Terre, especially around La Soufrière active volcano, Piton de Bouillante edifice and along the western coast, reflecting the presence of hydrothermal systems and fractured and altered rocks.

  5. Tissue distribution of organochlorine pesticides in largemouth bass (Micropterus salmoides) from laboratory exposure and a contaminated lake.

    Science.gov (United States)

    Dang, Viet D; Kroll, Kevin J; Supowit, Samuel D; Halden, Rolf U; Denslow, Nancy D

    2016-09-01

    Tissue concentrations of persistent organochlorine pesticides in laboratory-exposed largemouth bass (Micropterus salmoides) and in bass collected from Lake Apopka, FL were determined by both total mass and lipid normalized mass to better understand the bioaccumulation pathways of contaminants. In the laboratory study, male bass were orally administered a single dose of a mixture of two pesticides (p,p'-dichlorodiphenyldichloroethylene (p,p'-DDE) and dieldrin) and then fed uncontaminated food for 28 days. Gastrointestinal tract, liver, brain, gonad, kidney, spleen, and muscle were collected for chemical analysis. Different profiles were observed by total contaminant mass in tissues compared to lipid normalized mass. On a lipid normalized basis, p,p'-DDE was highest in the gastrointestinal tract followed by the liver, gonad, spleen, muscle, kidney and then brain. Dieldrin, on the other hand, was highest in the gastrointestinal tract and spleen and then followed by the gonad, muscle, liver, kidney, and brain. Distribution of the chemicals among the organs differed by their log KOW values and generally followed the blood flow path after the gastrointestinal tract. The low contaminant levels found in kidney and brain suggest insufficient time for equilibration into these tissues, especially into the brain where the blood-brain barrier may be slow to traverse. In Lake Apopka fish, dichlorodiphenyltrichloroethanes (DDXs, sum of p,p'-DDE, p,p'-DDD, and p,p'-DDT), Drins (sum of aldrin, dieldrin, and endrin), and hexachlorocyclohexanes (HCHs) were found. For DDXs, the lipid normalized concentrations in each tissue were about the same, as predicted from theory. For Drins and HCHs, the lipid normalized concentrations were similar for kidney, spleen, brain, gonad and muscle, but much lower in the gastrointestinal tract and liver, probably because of metabolism occurring in those tissues. PMID:27394080

  6. Determination of essential and toxic elements in sea bass (Centropomus sp.) and hake (Cynoscion leiarchus) consumed in the city of Sao Paulo by neutron activation analysis

    International Nuclear Information System (INIS)

    The goal was to use the Instrumental Neutron Activation Analysis (INAA) to evaluate the levels of essential and toxic elements in samples of hake (Cynoscion leiarchus) and sea bass (Centropomus sp.) that are most consumed fish in the town of some Sao Paulo. Ten specimens of hake and sea bass were acquired in Companhia de Entrepostos e Armazens Gerais de Sao Paulo (CEAGESP), main supply center for the population of the metropolitan area of Sao Paulo. After gutted and cleaned, the edible tissue was freeze-dried, ground and sieved. The elements were determined through the use of hyperpure germanium spectrometer after irradiation in the nuclear research reactor IEAR-1

  7. Active low frequency sound field control in a listening room using CABS (Controlled Acoustic Bass System) will also reduce the sound transmitted to neighbour rooms

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    is possible at modal frequencies. For that reason the modal frequencies in the source room will also have big impact on the transmission to neighbour rooms. These low frequency resonance frequencies are very audible in the source room but also in neighbour rooms as a booming bass. CABS (Controlled...... Acoustic Bass System) is a time based room correction system for reproduced sound using loudspeakers. The system can remove room modes at low frequencies, by active cancelling the reflection from at the rear wall to a normal stereo setup. Measurements in a source room using CABS and in two neighbour rooms...

  8. The potential use of legume-based diets supplemented with microbial phytase on the growth performance and feed efficiency of sea bass, Lates calcarifer

    OpenAIRE

    Erlinda S. Ganzon-Naret

    2013-01-01

    A feeding trial was conducted for 12 weeks to evaluate the potential use of legume-based diets supplemented with dietary microbial phytase on the growth performance and feed efficiency of juvenile sea bass, Lates calcarifer. Fifteen sea bass juveniles (mean initial weight of 0.96 g and mean initial total length (TL) of 4.2 cm) were stocked at three replicates into each of the twelve 100 L conical fibreglass tanks containing 90 L sea water in a closed recirculating system with filt...

  9. The potential use of legume-based diets supplemented with microbial phytase on the growth performance and feed efficiency of sea bass, Lates calcarifer

    OpenAIRE

    Erlinda S. Ganzon-Naret

    2013-01-01

    A feeding trial was conducted for 12 weeks to evaluate the potential use of legume-based diets supplemented with dietary microbial phytase on the growth performance and feed efficiency of juvenile sea bass, Lates calcarifer. Fifteen sea bass juveniles (mean initial weight of 0.96 g and mean initial total length (TL) of 4.2 cm) were stocked at three replicates into each of the twelve 100 L conical fibreglass tanks containing 90 L sea water in a closed recirculating system with ...

  10. An ovary transcriptome for all maturational stages of the striped bass (Morone saxatilis, a highly advanced perciform fish

    Directory of Open Access Journals (Sweden)

    Reading Benjamin J

    2012-02-01

    Full Text Available Abstract Background The striped bass and its relatives (genus Morone are important fisheries and aquaculture species native to estuaries and rivers of the Atlantic coast and Gulf of Mexico in North America. To open avenues of gene expression research on reproduction and breeding of striped bass, we generated a collection of expressed sequence tags (ESTs from a complementary DNA (cDNA library representative of their ovarian transcriptome. Results Sequences of a total of 230,151 ESTs (51,259,448 bp were acquired by Roche 454 pyrosequencing of cDNA pooled from ovarian tissues obtained at all stages of oocyte growth, at ovulation (eggs, and during preovulatory atresia. Quality filtering of ESTs allowed assembly of 11,208 high-quality contigs ≥ 100 bp, including 2,984 contigs 500 bp or longer (average length 895 bp. Blastx comparisons revealed 5,482 gene orthologues (E-value -3, of which 4,120 (36.7% of total contigs were annotated with Gene Ontology terms (E-value -6. There were 5,726 remaining unknown unique sequences (51.1% of total contigs. All of the high-quality EST sequences are available in the National Center for Biotechnology Information (NCBI Short Read Archive (GenBank: SRX007394. Informative contigs were considered to be abundant if they were assembled from groups of ESTs comprising ≥ 0.15% of the total short read sequences (≥ 345 reads/contig. Approximately 52.5% of these abundant contigs were predicted to have predominant ovary expression through digital differential display in silico comparisons to zebrafish (Danio rerio UniGene orthologues. Over 1,300 Gene Ontology terms from Biological Process classes of Reproduction, Reproductive process, and Developmental process were assigned to this collection of annotated contigs. Conclusions This first large reference sequence database available for the ecologically and economically important temperate basses (genus Morone provides a foundation for gene expression studies in these

  11. Spectre d'absorption de l'hydrogène atomique à très basse pression.

    OpenAIRE

    Moret-Bailly, Jacques

    2015-01-01

    Sous très basse pression, le spectre de l'hydrogène atomique devient un spectre de quasar. Spectra of quasars result primarily from interactions of natural light with atomic hydrogen. A visible absorption of a sharp and saturated spectral line in a gas requires a low pressure, so a long path without blushing as a cosmological redshift. Burbidge and Karlsson observed that redshifts of quasars result from fundamental redshifts, written 3K and 4K, that cause a shift of absorbed beta and gamma...

  12. A study on the efficiency of EFQM versus Bass method: Evidence from national land and housing organization

    Directory of Open Access Journals (Sweden)

    Abolfazl Danaei

    2013-10-01

    Full Text Available Leadership style plays essential role on the success of organizations. The proposed study of this paper compares the efficiency of leadership study based on EFQM and Bass models in national land and housing organization of Iran. The proposed study of this paper designs a questionnaire and distributes it among all managers on this organization. The study covers all different levels of management including middle and top-level management. The results of the survey indicate that the average efficiency of EFQM model is located in 2.7276

  13. Thickness and Fuel Preheating Effects on Material Flammability in Microgravity from the BASS Experiment

    Science.gov (United States)

    Ferkul, Paul V.; Olson, Sandra L.; Takahashi, Fumiaki; Endo, Makoto; Johnson, Michael C.; T'ien, James S.

    2013-01-01

    The Burning and Suppression of Solids (BASS) experiment was performed on the International Space Station. Microgravity combustion tests burning thin and thick flat samples, acrylic spheres, and candles were conducted. The samples were mounted inside a small wind tunnel which could impose air flow speeds up to 40 cms. The wind tunnel was installed in the Microgravity Science Glovebox which supplied power, imaging, and a level of containment. The effects of air flow speed, fuel thickness, fuel preheating, and nitrogen dilution on flame appearance, flame growth, and spread rates were determined in both the opposed and concurrent flow configuration. In some cases, a jet of nitrogen was introduced to attempt to extinguish the flame. Microgravity flames were found to be especially sensitive to air flow speed in the range 0 to 5 cms. The gas phase response is much faster compared to the solid and so as the flow speed is changed, the flame responds with almost no delay. At the lowest speeds examined (less than 1 cms) all the flames tended to become dim blue and very stable. However, heat loss at these very low convective rates is small so the flames can burn for a long time. At moderate flow speeds (between about 1 and 5 cms) the flame continually heats the solid fuel resulting in an increasing fuel temperature, higher rate of fuel vaporization, and a stronger, more luminous flame as time progresses. Only the smallest flames burning acrylic slabs appeared to be adversely influenced by solid conductive heat loss, but even these burned for over 5 minutes before self-extinguishing. This has implications for spacecraft fire safety since a tiny flame might be undetected for a long time. While the small flame is not particularly hazardous if it remains small, the danger is that it might flare up if the air convection is suddenly increased or if the flame spreads into another fuel source.

  14. Seismic tomography of Basse-Terre volcanic island, Guadeloupe, Lesser Antilles, using earthquake travel times and noise correlations

    Science.gov (United States)

    Barnoud, Anne; Coutant, Olivier; Bouligand, Claire; Massin, Frédérick; Stehly, Laurent

    2015-04-01

    We image the volcanic island of Basse-Terre, Guadeloupe, Lesser Antilles, using both earthquake travel times and noise correlations. (1) A new earthquake catalog was recently compiled for the Lesser Antilles by the CDSA/OVSG/IPGP (Massin et al., EGU General Assembly 2014) and allows us to perform classical travel time tomography to obtain smooth 3D body wave velocity models. The geometrical configuration of the volcanic arc controls the resolution of the model in our zone of interest. (2) Surface wave tomography using noise correlations was successfully applied to volcanoes (Brenguier et al., Geophys. Res. Lett. 2007). We use seismic noise recorded at 16 broad-band stations and 9 short-period stations from Basse-Terre over a period of six years (2007-2012). For each station pair, we extract a dispersion curve from the noise correlation to get surface wave velocity models. The inversion of the dispersion curves produces a 3D S-wave velocity model of the island. The spatial distribution of seismic stations accross the island is highly heterogeneous, leading to higher resolution near the dome of the Soufrière of Guadeloupe volcano. Resulting velocity models are compared with densities obtained by 3D inversion of gravimetric data (Barnoud et al., AGU Fall Meeting 2013). Further work should include simultaneous inversion of seismic and gravimetric datasets to overcome resolution limitations.

  15. BANYAN. VII. A New Population of Young Substellar Candidate Members of Nearby Moving Groups from the BASS Survey

    CERN Document Server

    Gagné, Jonathan; Cruz, Kelle L; Lafrenière, David; Doyon, René; Malo, Lison; Burgasser, Adam J; Naud, Marie-Eve; Artigau, Étienne; Bouchard, Sandie; Gizis, John E; Albert, Loïc

    2015-01-01

    [Abbreviated] We present the results of a near-infrared (NIR) spectroscopic follow-up survey of 182 M4-L7 low-mass stars and brown dwarfs (BDs) from the BANYAN All-Sky Survey (BASS) for candidate members of nearby, young moving groups (YMGs). We confirm signs of low-gravity for 42 new BD discoveries with estimated masses between 8-75 $M_{Jup}$ and identify previously unrecognized signs of low gravity for 24 known BDs. This allows us to refine the fraction of low-gravity dwarfs in the high-probability BASS sample to $\\sim$82%. We use this unique sample of 66 young BDs, supplemented with 22 young BDs from the literature, to construct new empirical NIR absolute magnitude and color sequences for low-gravity BDs. We obtain a spectroscopic confirmation of low-gravity for 2MASS J14252798-3650229, which is a new $\\sim$27 $M_{Jup}$, L4 $\\gamma$ bona fide member of AB Doradus. We identify a total of 19 new low-gravity candidate members of YMGs with estimated masses below 13 $M_{Jup}$, seven of which have kinematically ...

  16. The characteristics of vasa gene from Japanese sea bass ( Lateolabrax japonicas) and its response to the external hormones

    Science.gov (United States)

    Chi, Meili; Wen, Haishen; Ni, Meng; Qian, Kun; Zhang, Pei; Chai, Senhao

    2015-08-01

    The RNA helicase Vasa is an important regulator of primordial germ cell development. Its function in mature fish, especially the hormone-related differences in maturing male fish has seldom been documented. In this study, a full length cDNA sequence of the vasa gene was cloned from Japanese sea bass, Lateolabrax japonicas, and it was named jsb-vasa. Homology analysis showed that jsb-vasa was closely related to its teleost homologs. The spatial distribution of jsb-vasa indicated that it was only highly expressed in testis, showing its germ cell-specific expression pattern. During the testicular development cycle, jsb-vasa was highly expressed during early period of spermatogenesis, and reduced when spermatogenesis advanced. In addition, the jsb-vasa gene expression was significantly inhibited at 6 h, 12 h and 24 h after injecting hCG (human chorionic gonadotropin) and GnRHa (Gonadotropin-releasing hormone analogue), indicating that jsb-vasa gene may play an important role in spermatogenesis of Japanese sea bass, and be under the regulation of external sex hormones.

  17. Liver proteome response of largemouth bass (Micropterus salmoides) exposed to several environmental contaminants: Potential insights into biomarker development

    International Nuclear Information System (INIS)

    Liver proteome response of largemouth bass (Micropterus salmoides) exposed to environmental contaminants was analyzed to identify novel biomarkers of exposure. Adult male bass were exposed to cadmium chloride (CdCl2), atrazine, PCB 126, phenanthrene, or toxaphene via intraperitoneal injection with target body burdens of 0.00067, 3.0, 2.5, 50, and 100 μg/g, respectively. After a 96 h exposure, hepatic proteins were separated with two-dimensional gel electrophoresis and differentially expressed proteins (vs. controls) recognized and identified with MALDI-TOF/TOF mass spectrometry. We identified, 30, 18, eight, 19, and five proteins as differentially expressed within the CdCl2, atrazine, PCB 126, phenanthrene, and toxaphene treatments, respectively. Alterations were observed in the expression of proteins associated with cellular ion homeostasis (toxaphene), oxidative stress (phenanthrene, PCB 126), and energy production including glycolysis (CdCl2, atrazine) and ATP synthesis (atrazine). This work supports the further evaluation of several of these proteins as biomarkers of contaminant exposure in fish.

  18. Estimated loss of juvenile salmonids to predation by northern squawfish, walleyes, and smallmouth bass in John Day Reservoir, Columbia River

    International Nuclear Information System (INIS)

    The authors estimated the loss of juvenile salmonids Oncorhynchus spp. to predation by northern squawfish Ptychocheilus oregonensis, walleyes Stizostedion vitreum, and smallmouth bass Micropterus dolomieu in John Day Reservoir during 1983-1986. Their estimates were based on measures of daily prey consumption, predator numbers, and numbers of juvenile salmonids entering the reservoir during the April-August period of migration. They estimated the mean annual loss was 2.7 million juvenile salmonids. Northern squawfish were responsible for 78% of the total loss; walleyes accounted for 13% and smallmouth bass for 9%. Twenty-one percent of the loss occurred in a small area immediately below McNary Dam at the head of John Day Reservoir. The authors estimated that the three predator species consumed 14% of all juvenile salmonids that entered the reservoir. Mortality changed by month and increased late in the migration season. Monthly mortality estimates ranged from 7% in June and 61% in August. Mortality from predation was highest for chinook salmon O. tshawytscha, which migrated in July and August. Despite uncertainties in the estimates, it is clear that predation by resident fish predators can easily account for previously explained mortality of out-migrating juvenile salmonids. Alteration of the Columbia River by dams and a decline in the number of salmonids could have increased the fraction of mortality caused by predation over what is was in the past

  19. The effect of the dye Aquashade(c) on water quality, phytoplankton, zooplankton, and sunshine bass fingerling production in fertilized culture ponds

    Science.gov (United States)

    Rooted macrophytes make harvesting fingerling sunshine bass from ponds difficult because they can smother fish or tangle in the seines and increase fish stress by increasing time needed to retrieve the fingerlings from the net. Aquashade® is a dye that is used to reduce macrophyte growth by reducin...

  20. FINGERLING CULTURE OF SUNSHINE BASS MORONE CHRYSOPS X M. SAXATILIS IN TANKS WITH ALGAE PASTE-FED ROTIFERS, ARTEMIA NAUPLII AND MICROENCAPSULATED FEED AT THREE CONCENTRATIONS

    Science.gov (United States)

    Sunshine bass fingerling production occurs almost exclusively in ponds. To increase production and to maintain year-round production in temperate climates indoor tank culture is required. While tank production of fingerlings has been demonstrated, little is known about feeding requirements. Sunshi...

  1. SeaBASS Bio-optical and pigment data collected from 1979-08-22 to 2011-12-14 (NCEI Accession 0086308)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains SeaWiFS Bio-optical Archive and Storage System (SeaBASS) bio-optical, pigment, and other data collected from 1979-08-22 to 2011-12-14....

  2. Computer simulation model for the striped bass young-of-the-year population in the Hudson River. [Effects of entrainment and impingement at power plants on population dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Eraslan, A.H.; Van Winkle, W.; Sharp, R.D.; Christensen, S.W.; Goodyear, C.P.; Rush, R.M.; Fulkerson, W.

    1975-09-01

    This report presents a daily transient (tidal-averaged), longitudinally one-dimensional (cross-section-averaged) computer simulation model for the assessment of the entrainment and impingement impacts of power plant operations on young-of-the-year populations of the striped bass, Morone saxatilis, in the Hudson River.

  3. Identification of centrarchid hepcidins and evidence that 17β-estradiol disrupts constitutive expression of hepcidin-1 and inducible expression of hepcidin-2 in largemouth bass (Micropterus salmoides)

    Science.gov (United States)

    Robertson, L.S.; Iwanowicz, L.R.; Marranca, J.M.

    2009-01-01

    Hepcidin is a highly conserved antimicrobial peptide and iron-regulatory hormone. Here, we identify two hepcidin genes (hep-1 and hep-2) in largemouth bass (Micropterus salmoides) and smallmouth bass (Micropterus dolomieu). Hepcidin-1 contains a putative ATCUN metal-binding site in the amino-terminus that is missing in hepcidin-2, suggesting that hepcidin-1 may function as an iron-regulatory hormone. Both hepcidins are predominately expressed in the liver of largemouth bass, similar to other fish and mammals. Experimental exposure of pond-raised largemouth bass to 17β-estradiol and/or the bacteria Edwardsiella ictaluri led to distinct changes in expression of hep-1 and hep-2. Estradiol reduced the constitutive expression of hep-1 in the liver. Bacterial exposure induced expression of hep-2, suggesting that hepcidin-2 may have an antimicrobial function, and this induction was abolished by estradiol. To our knowledge, this is the first report of the regulation of hepcidin expression by estradiol in either fish or mammals.

  4. The effects of menhaden oil, flaxseed oil and a dairy-yeast prebiotic on growth , health , feed conversion , survival , critical maximum temperature, and body composition of sunshine bass

    Science.gov (United States)

    A 12-week feeding trial was conducted with juvenile "sunshine bass" female Morone chrysops x male M. saxatilis using four diets containing two levels of a dairy-yeast prebiotic (0 or 2%) and either menhaden fish oil or flaxseed oil as a lipid source. The objective was to determine the main and inte...

  5. Influence of reproductive status sex hormones and temperature on plasma IGF-I concentrations in sunshine bass (Morone Chrysops X Morone Saxatilis)

    Science.gov (United States)

    Insulin-like growth factor-I (IGF-I) concentrations in male and female sunshine bass (Morone chrysops X Morone saxatilis) were determined in March, early April, and late April in outdoor ponds at a commercial farm. Female fish were always larger than male fish, however plasma IGF-I concentrations w...

  6. Feeding transition of cultured largemouth bass (Micropterus salmoides, Lacépede, 1802) from an artificial pelleted feed to live prey

    Czech Academy of Sciences Publication Activity Database

    Frouzová, Jaroslava; Porak, W. F.; Johnson, W. E.

    2013-01-01

    Roč. 29, č. 6 (2013), s. 1364-1366. ISSN 0175-8659 R&D Projects: GA MZe(CZ) QH81046 Institutional support: RVO:60077344 Keywords : largemouth bass * feeding behavior * novel prey Subject RIV: GL - Fishing Impact factor: 0.903, year: 2013

  7. Comparison of two different fecal collection methods for protein digestibility and amino acid availability coefficients of three animal protein sources for sunshine bass (Morone chrysops x Morone saxatilis)

    Science.gov (United States)

    Apparent digestibility coefficients (ADCs) for protein and individual amino acid availabilities in menhaden fish meal (MEN) and two grades of poultry by-product meal (PBM) were determined for market-size (500 g) sunshine bass using two different fecal collection methods, passive netting (net) or man...

  8. Hepatic transcriptomic and metabolic responses of hybrid striped bass (Morone saxatilis×Morone chrysops) to acute and chronic hypoxic insult.

    Science.gov (United States)

    Beck, Benjamin H; Fuller, S Adam; Li, Chao; Green, Bartholomew W; Zhao, Honggang; Rawles, Steven D; Webster, Carl D; Peatman, Eric

    2016-06-01

    Striped bass (Morone saxatilis), white bass (Morone chrysops), and their hybrid are an important group of fish prized for recreational angling in the United States, and there and abroad as a high-value farmed fish. Regardless of habitat, it is not uncommon for fish of the genus Morone to encounter and cope with conditions of scarce oxygen availability. Previously, we determined that hybrid striped bass reared under conditions of chronic hypoxia exhibited reduced feed intake, lower lipid and nutrient retention, and poor growth. To better understand the molecular mechanisms governing these phenotypes, in the present study, we examined the transcriptomic profiles of hepatic tissue in hybrid striped bass exposed to chronic hypoxia (90days at 25% oxygen saturation) and acute hypoxia (6h at 25% oxygen saturation). Using high-throughput RNA-seq, we found that over 1400 genes were differentially expressed under disparate oxygen conditions, with the vast majority of transcriptional changes occurring in the acute hypoxia treatment. Gene pathway and bioenergetics analyses revealed hypoxia-mediated perturbation of genes and gene networks related to lipid metabolism, cell death, and changes in hepatic mitochondrial content and cellular respiration. This study offers a more comprehensive view of the temporal and tissue-specific transcriptional changes that occur during hypoxia, and reveals new and shared mechanisms of hypoxia tolerance in teleosts. PMID:26851735

  9. A Review. The Use of the Alto, Bass and Contrabass Clarinets in Selected Wind Band Compositions Written Between 1951 and 1972.

    Science.gov (United States)

    Heim, Norman M.

    1987-01-01

    Reviews a dissertation which examined the scoring practices for alto, bass, and contrabass clarinets in selected compositions written between 1951-1972. The study identified new practices for scoring low clarinets in wind band compositions. The study is recommended to readers seeking a good understanding of the use of clarinets in these…

  10. Assessment of Aquaflor (c), copper sulfate and potassium permanganate for control of Aeromonas hydrophila and Flavobacterium columnare infection in sunshine bass, Morone chrysops female x Morone saxatilis male

    Science.gov (United States)

    Two experiments were conducted to assess different therapeutants against a mixed infection of Aeromonas hydrophila and Flavobacterium columnare in sunshine bass (SB) (Morone chrysops female x Morone saxatilis male). Experiment 1 assessed the efficacy of copper sulfate (CuSO4), florfenicol-medicated...

  11. Lysine supplementation of commercial fishmeal-free diet in hybrid striped bass Morone chrysops x M. saxatilis affects expression of growth related genes

    Science.gov (United States)

    Our recent results in hybrid striped bass (HSB) concluded that ideal protein theory accurately predicts first-limiting amino acids in commercial diet formulations if accurate amino acid availability data are used and that appropriate levels of supplemental lysine are needed in order to improve fish ...

  12. L'activite de deplacement et le reperage de la nourriture chez le bar juvenile captif

    OpenAIRE

    Anthouard, M; Paris, J

    1983-01-01

    Movement activity and localization of food were studied dynamically with the objective of establishing the capacities of behavioral adaptation of the young Dicentrarchus labrax faced with a novel situation. The role played by previous rearing conditions was demonstrated, the level of stimulation being a sensitive intervening factor (currents associated with the food). The data show the favourable effects of such treatment, and are in agreement with work carried out on higher vertebrates, whic...

  13. Lectins with Potential for Anti-Cancer Therapy

    OpenAIRE

    Tammy Yau; Xiuli Dan; Charlene Cheuk Wing Ng; Tzi Bun Ng

    2015-01-01

    This article reviews lectins of animal and plant origin that induce apoptosis and autophagy of cancer cells and hence possess the potential of being developed into anticancer drugs. Apoptosis-inducing lectins encompass galectins, C-type lectins, annexins, Haliotis discus discus lectin, Polygonatum odoratum lectin, mistletoe lectin, and concanavalin A, fucose-binding Dicentrarchus labrax lectin, and Strongylocentrotus purpuratus lectin, Polygonatum odoratum lectin, and mistletoe lectin, Polygo...

  14. The use of alternative energies in hatcheries: an application of Life Cycle Analysis

    Directory of Open Access Journals (Sweden)

    G. De Blasi

    2010-01-01

    Full Text Available Fish production requires great efforts and energies and causes different impacts/effects on the ecosystems. The development of aquaculture is possible, in the medium and long term, only if this is done responsibly, and if the production is reached from both an economic and environmental point of view. In our study we have worked on fry production using 1.5 g sized Dicentrarchus labrax obtained rearing larvae for 120 days after the hatching of the eggs.

  15. Morphological differences between wild and farmed Mediterranean fish

    OpenAIRE

    Arechavala-Lopez, Pablo; Sanchez-Jerez, Pablo; Bayle-Sempere, Just T.; Sfakianakis, Dimitris G.; Somarakis, Stylianos

    2012-01-01

    Gilthead seabream (Sparus aurata L.) and European seabass (Dicentrarchus labrax L.) are important commercial marine fish species both for aquaculture and fisheries in the Mediterranean. It is known that farmed individuals escape from farm facilities, but the extent of escape events is not easy to report and estimate because of the difficulty to distinguish between wild and farmed individuals. In this study, significant differences provided through morphometry evidence that the cranial and bod...

  16. Effects of dietary vitamin C on fish and crustacean larvae

    OpenAIRE

    Merchie, G.; Lavens, P.; Sorgeloos, P.

    1995-01-01

    In order to assess the dietary needs for ascorbic acid (AA) at startfeeding, the AA content in the various live diets currently applied in aquaculture (algae, rotifers, Artemia ) was studied. Application of boosting techniques using ascorbyl palmitate (AP) as the vitamin C source enabled the transfer of elevated levels of bioactive vitamin C (up to 2500µg AA.g DW-1) via the live food chain into larvae of fish (Clarias gariepinus, Dicentrarchus labrax, Scophthalmus maximus), shrimp (Pennaeus v...

  17. Lectins with Potential for Anti-Cancer Therapy

    Directory of Open Access Journals (Sweden)

    Tammy Yau

    2015-02-01

    Full Text Available This article reviews lectins of animal and plant origin that induce apoptosis and autophagy of cancer cells and hence possess the potential of being developed into anticancer drugs. Apoptosis-inducing lectins encompass galectins, C-type lectins, annexins, Haliotis discus discus lectin, Polygonatum odoratum lectin, mistletoe lectin, and concanavalin A, fucose-binding Dicentrarchus labrax lectin, and Strongylocentrotus purpuratus lectin, Polygonatum odoratum lectin, and mistletoe lectin, Polygonatum odoratum lectin, autophagy inducing lectins include annexins and Polygonatum odoratum lectin.

  18. Identification and quantification of suspended solids and their effects in modern marine recirculation systems

    OpenAIRE

    Orellana, Jaime

    2007-01-01

    Die effiziente Entfernung von im Wasser suspendierten, partikulären Feststoffen ist ein Schlüsselfaktor für den erfolgreichen Betrieb von Kreislaufanlagen. In der vorliegenden Arbeit wurden die Feststoffe in einem Kreislaufsystem (Recirculating Aquaculture System, RAS) für Fische (Wolfsbarsch, Dicentrarchus labrax) qualitativ und quantitativ analysiert, wobei insbesondere die Größenverteilung der Feststoffe und die Rückhaltung in den mechanischen Filtereinheiten. Die Untersuchungen dienten de...

  19. Gene networks and toxicity pathways induced by acute cadmium exposure in adult largemouth bass (Micropterus salmoides)

    Energy Technology Data Exchange (ETDEWEB)

    Mehinto, Alvine C., E-mail: alvinam@sccwrp.org [Southern California Coastal Water Research Project, Costa Mesa, CA 92626 (United States); Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States); Prucha, Melinda S. [Department of Human Genetics, Yerkes National Primate Research Center, Emory University, Atlanta, GA 30322 (United States); Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States); Colli-Dula, Reyna C.; Kroll, Kevin J.; Lavelle, Candice M.; Barber, David S. [Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States); Vulpe, Christopher D. [Department of Nutritional Sciences and Toxicology, University of California, Berkeley, CA 94720 (United States); Denslow, Nancy D. [Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States)

    2014-07-01

    Highlights: • Low-level acute cadmium exposure elicited tissue-specific gene expression changes. • Molecular initiating events included oxidative stress and disruption of DNA repair. • Metallothionein, a marker of metal exposure, was not significantly affected. • We report effects of cadmium on cholesterol metabolism and steroid synthesis. • Diabetic complications and impaired reproduction are potential adverse outcomes. - Abstract: Cadmium is a heavy metal that can accumulate to toxic levels in the environment leading to detrimental effects in animals and humans including kidney, liver and lung injuries. Using a transcriptomics approach, genes and cellular pathways affected by a low dose of cadmium were investigated. Adult largemouth bass were intraperitoneally injected with 20 μg/kg of cadmium chloride (mean exposure level – 2.6 μg of cadmium per fish) and microarray analyses were conducted in the liver and testis 48 h after injection. Transcriptomic profiles identified in response to cadmium exposure were tissue-specific with the most differential expression changes found in the liver tissues, which also contained much higher levels of cadmium than the testis. Acute exposure to a low dose of cadmium induced oxidative stress response and oxidative damage pathways in the liver. The mRNA levels of antioxidants such as catalase increased and numerous transcripts related to DNA damage and DNA repair were significantly altered. Hepatic mRNA levels of metallothionein, a molecular marker of metal exposure, did not increase significantly after 48 h exposure. Carbohydrate metabolic pathways were also disrupted with hepatic transcripts such as UDP-glucose, pyrophosphorylase 2, and sorbitol dehydrogenase highly induced. Both tissues exhibited a disruption of steroid signaling pathways. In the testis, estrogen receptor beta and transcripts linked to cholesterol metabolism were suppressed. On the contrary, genes involved in cholesterol metabolism were highly

  20. Gene networks and toxicity pathways induced by acute cadmium exposure in adult largemouth bass (Micropterus salmoides)

    International Nuclear Information System (INIS)

    Highlights: • Low-level acute cadmium exposure elicited tissue-specific gene expression changes. • Molecular initiating events included oxidative stress and disruption of DNA repair. • Metallothionein, a marker of metal exposure, was not significantly affected. • We report effects of cadmium on cholesterol metabolism and steroid synthesis. • Diabetic complications and impaired reproduction are potential adverse outcomes. - Abstract: Cadmium is a heavy metal that can accumulate to toxic levels in the environment leading to detrimental effects in animals and humans including kidney, liver and lung injuries. Using a transcriptomics approach, genes and cellular pathways affected by a low dose of cadmium were investigated. Adult largemouth bass were intraperitoneally injected with 20 μg/kg of cadmium chloride (mean exposure level – 2.6 μg of cadmium per fish) and microarray analyses were conducted in the liver and testis 48 h after injection. Transcriptomic profiles identified in response to cadmium exposure were tissue-specific with the most differential expression changes found in the liver tissues, which also contained much higher levels of cadmium than the testis. Acute exposure to a low dose of cadmium induced oxidative stress response and oxidative damage pathways in the liver. The mRNA levels of antioxidants such as catalase increased and numerous transcripts related to DNA damage and DNA repair were significantly altered. Hepatic mRNA levels of metallothionein, a molecular marker of metal exposure, did not increase significantly after 48 h exposure. Carbohydrate metabolic pathways were also disrupted with hepatic transcripts such as UDP-glucose, pyrophosphorylase 2, and sorbitol dehydrogenase highly induced. Both tissues exhibited a disruption of steroid signaling pathways. In the testis, estrogen receptor beta and transcripts linked to cholesterol metabolism were suppressed. On the contrary, genes involved in cholesterol metabolism were highly

  1. Reproductive health of bass in the potomac, USA, drainage: Part 1. exploring the effects of proximity to wastewater treatment plant discharge

    Science.gov (United States)

    Iwanowicz, L.R.; Blazer, V.S.; Guy, C.P.; Pinkney, A.E.; Mullcan, J.E.; Alvarezw, D.A.

    2009-01-01

    Abstract-Intersex (specifically, testicular oocytes) has been observed in male smalimouth bass (SMB; Micropterus dolomieu) and other centrarchids in the South Branch of the Potomac River, USA, and forks of the Shenandoah River, USA. during the past five years. This condition often is associated with exposure to estrogenic endocrine-disrupting chemicals in some fish species, but such chemicals and their sources have yet to be identified in the Potomac. In an attempt to better understand the plausible causes of this condition, we investigated the reproductive health of bass sampled up- and downstream of wastewater treatment plant (WWTP) effluent point sources on the Potomac River in Maryland, USA. Smallmouth bass were sampled from the Conococheague Creek and the Monocacy River, and largemouth bass (LMB; Micropterus salmoides) were collected near the Blue Plains WWTP on the mainstem of the Potomac River. Chemical analyses of compounds captured in passive samplers at these locations also were conducted. A high prevalence of intersex (82-l00%) was identified in male SMB at all sites regardless of collection area. A lower prevalence of intersex (23%) was identified in male LMB collected at the Blue Plains site. When up- and downstream fish were compared, significant differences were noted only in fish from the Conococheague. Differences included condition factor, gonadosomatic index, plasma vitellogenin concentration, and estrogen to testosterone ratio. In general, chemicals associated with wastewater effluent, storm-water runoff, and agriculture were more prevalent at the downstream sampling sites. An exception was atrazine and its associated metabolites, which were present in greater concentrations at the upstream sites. It appears that proximity to effluent from WWTPs may influence the reproductive health of bass in the Potomac watershed, but inputs from other sources likely contribute to the widespread, high incidence of testicular oocytes. ?? 2009 SETAC.

  2. A biorobotic model of the suction-feeding system in largemouth bass: the roles of motor program speed and hyoid kinematics.

    Science.gov (United States)

    Kenaley, Christopher P; Lauder, George V

    2016-07-01

    The vast majority of ray-finned fishes capture prey through suction feeding. The basis of this behavior is the generation of subambient pressure through rapid expansion of a highly kinetic skull. Over the last four decades, results from in vivo experiments have elucidated the general relationships between morphological parameters and subambient pressure generation. Until now, however, researchers have been unable to tease apart the discrete contributions of, and complex relationships among, the musculoskeletal elements that support buccal expansion. Fortunately, over the last decade, biorobotic models have gained a foothold in comparative research and show great promise in addressing long-standing questions in vertebrate biomechanics. In this paper, we present BassBot, a biorobotic model of the head of the largemouth bass (Micropterus salmoides). BassBot incorporates a 3D acrylic plastic armature of the neurocranium, maxillary apparatus, lower jaw, hyoid, suspensorium and opercular apparatus. Programming of linear motors permits precise reproduction of live kinematic behaviors including hyoid depression and rotation, premaxillary protrusion, and lateral expansion of the suspensoria. BassBot reproduced faithful kinematic and pressure dynamics relative to live bass. We show that motor program speed has a direct relationship to subambient pressure generation. Like vertebrate muscle, the linear motors that powered kinematics were able to produce larger magnitudes of force at slower velocities and, thus, were able to accelerate linkages more quickly and generate larger magnitudes of subambient pressure. In addition, we demonstrate that disrupting the kinematic behavior of the hyoid interferes with the anterior-to-posterior expansion gradient. This resulted in a significant reduction in subambient pressure generation and pressure impulse of 51% and 64%, respectively. These results reveal the promise biorobotic models have for isolating individual parameters and assessing

  3. Productivity and river flux variability in response to the PETM on Atlantic margin at Bass River, NJ.

    Science.gov (United States)

    Stoll, H.; Shimizu, N.; Savain, R.; Zachos, J.; Ziveri, P.

    2009-04-01

    While the dramatic climate warming of the Paleocene-Eocene Thermal Maximum has been well characterized, changes in the hydrological cycle and the broader biogeochemical feedbacks (weathering, nutrients, productivity) are less well constrained. Here we describe new geochemical results from a coastal section on the midlatitude Atlantic margin of the U.S. at Bass River, NJ. We measured the elemental geochemistry of coccoliths to probe the productivity of these algae in response to the changing nutrient dynamics on the shelf in the time interval preceding and during the PETM. Coccoliths extracted from the siliclastic coastal section at Bass River NJ exhibit exceptionally good preservation and negligible overgrowth compared to typical ocean carbonate-rich sediments. Analysis of individual coccoliths using secondary ion mass spectrometry (SIMS) facilitates reliable trace element measurements in this low-carbonate section. Published sequence stratigraphy and microfossil analysis have revealed several third order sea level cycles in the late Paleocene including a highstand during the PETM. Consequently we extend our paleoproductivity records far below the PETM to characterize this background variability. We recognize a pattern of generally maximum productivity during lowstands and minimal productivity during highstands. Because nutrient concentrations decrease significantly with distance from the coast, highstands reduce productivity by shifting the highest nutrient levels landward, away from the site. This is likely due to greater distance from river sources as well as reduced wave turbulence which mixes nutrients into the photic zone. This general pattern is broken during the PETM, which features high productivity despite a sea level highstand. This anomalous high productivity may reflect enhanced riverine nutrient delivery, and potentially changes in wind strength and mixing intensity. Riverine nutrient delivery could increase with higher precipitation or precipitation

  4. A novel method to develop an otolith microchemistry model to determine striped bass habitat use in the San Francisco Estuary

    Energy Technology Data Exchange (ETDEWEB)

    Phillis, C C; Ostrach, D J; Gras, M; Yin, Q; Ingram, B L; Zinkl, J G; Weber, P K

    2006-06-14

    Otolith Sr/Ca has become a popular tool for hind casting habitat utilization and migration histories of euryhaline fish. It can readily identify habitat shifts of diadromous fish in most systems. Inferring movements of fish within estuarine habitat, however, requires a model of that accounts of the local water chemistry and the response of individual species to that water chemistry, which is poorly understood. Modeling is further complicated by the fact that high marine Sr and Ca concentrations results in a rapid, nonlinear increase in water Sr/Ca and {sup 87}Sr/{sup 86}Sr between fresh and marine waters. Here we demonstrate a novel method for developing a salinity-otolith Sr/Ca model for the purpose of reconstructing striped bass (Morone saxatilis) habitat use in the San Francisco Bay estuary. We used correlated Sr/Ca and {sup 87}Sr/{sup 86}Sr ratios measurements from adult otoliths from striped bass that experienced a range of salinities to infer striped bass otolith Sr/Ca response to changes in salinity and water Sr/Ca ratio. Otolith {sup 87}Sr/{sup 86}Sr can be assumed to accurately record water {sup 87}Sr/{sup 86}Sr because there is no biological fractionation of Sr isotopes. Water {sup 87}Sr/{sup 86}Sr can in turn be used to estimate water salinity based on the mixing of fresh and marine water with known {sup 87}Sr/{sup 86}Sr ratios. The relationship between adjacent analyses on otoliths of Sr/Ca and {sup 87}Sr/{sup 86}Sr by LA-ICP-MS and MC-ICP-MS (r{sup 2} = 0.65, n = 66) is used to predict water salinity from a measured Sr/Ca ratio. The nature of this non-linear model lends itself well to identifying residence in the Delta and to a lesser extent Suisun Bay, but does not do well locating residence within the more saline bays west of Carquinez Strait. An increase in the number of analyses would improve model confidence, but ultimately the precision of the model is limited by the variability in the response of individual fish to water Sr/Ca.

  5. Viral Encephalopathy and Retinopathy in groupers (Epinephelus spp. in southern Italy: a threat for wild endangered species?

    Directory of Open Access Journals (Sweden)

    Vendramin Niccolò

    2013-01-01

    Full Text Available Abstract Background Betanodaviruses are the causative agents of Viral Encephalopathy and Retinopathy (VER. To date, more than 50 species have proved to be susceptible and among them, those found in genus Epinephelus are highly represented. Clinical disease outbreaks are generally characterized by typical nervous signs and significant mortalities mainly associated with aquaculture activities, although some concerns for the impact of this infection in wild fish have been raised. In this study, the authors present the first documented report describing an outbreak of VER in wild species in the Mediterranean basin. Case presentation In late summer - early winter 2011 (September-December, significant mortalities affecting wild Dusky grouper (Epinephelus marginatus, Golden grouper (Epinephelus costae and European sea bass (Dicentrarchus labrax were reported in the municipality of Santa Maria di Leuca (Northern Ionian Sea, Italy. The affected fish showed an abnormal swimming behavior and swollen abdomens. During this epizootic, five moribund fish showing clear neurological signs were captured and underwent laboratory investigations. Analytical results confirmed the diagnosis of VER in all the specimens. Genetic characterization classified all betanodavirus isolates as belonging to the RGNNV genotype, revealing a close genetic relationship with viral sequences obtained from diseased farmed fish reared in the same area in previous years. Conclusion The close relationship of the viral sequences between the isolates collected in wild affected fish and those isolated during clinical disease outbreaks in farmed fish in the same area in previous years suggests a persistent circulation of betanodaviruses and transmission between wild and farmed stocks. Further investigations are necessary to assess the risk of viral transmission between wild and farmed fish populations, particularly in marine protected areas where endangered species are present.

  6. Assessing chronic fish health: An application to a case of an acute exposure to chemically treated crude oil.

    Science.gov (United States)

    Mauduit, F; Domenici, P; Farrell, A P; Lacroix, C; Le Floch, S; Lemaire, P; Nicolas-Kopec, A; Whittington, M; Zambonino-Infante, J L; Claireaux, G

    2016-09-01

    Human alteration of marine ecosystems is substantial and growing. Yet, no adequate methodology exists that provides reliable predictions of how environmental degradation will affect these ecosystems at a relevant level of biological organization. The primary objective of this study was to develop a methodology to evaluate a fish's capacity to face a well-established environmental challenge, an exposure to chemically dispersed oil, and characterize the long-term consequences. Therefore, we applied high-throughput, non-lethal challenge tests to assess hypoxia tolerance, temperature susceptibility and maximal swimming speed as proxies for a fish's functional integrity. These whole animal challenge tests were implemented before (1 month) and after (1 month) juvenile European sea bass (Dicentrarchus labrax) had been acutely exposed (48h) to a mixture containing 0.08gL(-1) of weathered Arabian light crude oil plus 4% dispersant (Corexit© EC9500A), a realistic exposure concentration during an oil spill. In addition, experimental populations were then transferred into semi-natural tidal mesocosm ponds and correlates of Darwinian fitness (growth and survival) were monitored over a period of 4 months. Our results revealed that fish acutely exposed to chemically dispersed oil remained impaired in terms of their hypoxia tolerance and swimming performance, but not in temperature susceptibility for 1 month post-exposure. Nevertheless, these functional impairments had no subsequent ecological consequences under mildly selective environmental conditions since growth and survival were not impacted during the mesocosm pond study. Furthermore, the earlier effects on fish performance were presumably temporary because re-testing the fish 10 months post-exposure revealed no significant residual effects on hypoxia tolerance, temperature susceptibility and maximal swimming speed. We propose that the functional proxies and correlates of Darwinian fitness used here provide a useful

  7. Bacterial vaccines for fish--an update of the current situation worldwide.

    Science.gov (United States)

    Håstein, T; Gudding, R; Evensen, O

    2005-01-01

    During the last few years, the use of vaccines for disease prevention in aquaculture has expanded both with regard to the number of fish species and number of microbial diseases. According to the responses to a questionnaire received from 41 countries, vaccination is used in the commercial aquaculture of species like Atlantic salmon (Salmo salar), rainbow trout (Oncorhynchus mykiss), sea bass (Dicentrarchus labrax), sea bream (Sparus aurata), barramundi (Lates calcarifer), tilapia (Tilapia spp), turbot (Scophthalmus maximus L.), yellowtail (Seriola quinqueradiata), purplish and gold-striped amberjack (Seriola dumereli), striped jack (Pseudocaranx dentex) and channel catfish (Ictalurus punctatus). The range of bacterial infections for which vaccines are commercially available now comprises classical vibriosis (Listonella anguillarum, Vibrio ordalii), furunculosis (Aeromonas salmonicida subsp. salmonicida), cold-water vibriosis (Vibrio salmonicida), yersiniosis (Yersinia ruckeri), pasteurellosis (Photobacterium damselae supsp. piscicida), edwardsiellosis (Edwardsiella ictaluri), winter ulcer (Moritella viscosa), and streptococcosis/lactococcosis (Streptococcus iniae, Lactococcus garviae). Furthermore, experimental vaccines are used against diseases such as infection with Vibrio harveyi and Photobacterium damsela subsp. damsela in barramundi, piscirickettsiosis and bacterial kidney disease in salmonids, as well as infection with Flexibacter maritimus (now: Tenacibaculum maritimum) in turbot. There was good agreement between the information received from different sources in the same country. Most vaccines are licensed products, but some non-licensed vaccines are also used in commercial fish farms. Most bacterial vaccines are inactivated products and recombinant vaccine technology has so far been used to a very limited extent. Salmonid fish are usually immunised with multivalent vaccines by intraperitoneal injection. In marine fish species vaccination is generally

  8. PHYTOPLANKTON COMPOSITION IN FISH FARMS ALONG THE EASTERN ADRIATIC COAST

    Directory of Open Access Journals (Sweden)

    Marija Tomec

    2006-10-01

    Full Text Available Investigations of net phytoplankton composition were performed at three fish farms situated at the northern, middle and southern part of the eastern Adriatic Sea coast, respectively. In the northern part investigations were conducted in the Limski kanal, in the middle part at the Ugljan island and in the southern part in the place Drače on the Pelješac peninsula (Figure 1. At all three localities fish culture included mostly two species: gilthead sea bream (Sparus aurata and sea bass (Dicentrarchus labrax. Beside some physico–chemical parameters (sea water temperature, salinity special attention was placed on the examination of qualitative net phytoplankton composition, which was conducted in the period of May and November 2004 and May and October 2005. Samples were collected at the depths of 0. 5 and 4 meters. According to the physico–chemical parameters, sea water temperature was influenced by the temperature of the environment. Qualitative net phytoplankton composition consisted of 153 microphytic species belonging to the systematic compartments of Cyanobacteria, Chrysophyta and Dinophyta (Table 1. The most numerous algal group were diatoms or Bacillarophyceae (84 species or 55% with relative frequencies of species from 1 to 7. Taxonomic composition of diatoms showed the community Chaetoceros–Rhizosolenia (Proboscia as the dominant one. The second numerically most dominant compartment were Dinophyta (62 species or 401% with dominant the species of the genera Ceratium and Protoperidinium. Relative frequencies of species was ranging from 1 to 7 (mass presence of specimens in the water column. From Cyanobacteria (4 species or 3%, only filamentous algae were determined, with individual presence in net phytoplankton composition. Qualitative net phytoplankton composition suggests the similarity of species composition in the water column at all investigated fish farms. From the obtained characteristics of net phytoplankton composition

  9. Reproductive and Endocrine Biomarkers in Largemouth Bass (Micropterus salmoides) and Common Carp (Cyprinus carpio) from United States Waters

    Science.gov (United States)

    Goodbred, Steven L.; Smith, Stephen B.; Greene, Patricia S.; Rauschenberger, Richard H.; Bartish, Timothy M.

    2007-01-01

    A nationwide reconnaissance investigation was initiated in 1994 to develop and evaluate a suite of reproductive and endocrine biomarkers for their potential to assess reproductive health and status in teleost (bony) fish. Fish collections were made at 119 sites, representing many regions of the country and land- and water-use settings. Collectively, this report will provide a national and regional benchmark and a basis for evaluating biomarkers of endocrine and reproductive function. Approximately 2,200 common carp (Cyprinus carpio) and 650 largemouth bass (Micropterus salmoides) were collected from 1994 through 1997. The suite of biomarkers used for these studies included: the plasma sex-steroid hormones, 17?-estradiol (E2) and 11 ketotestosterone (11KT); the ratio of E2 to 11KT (E2:11KT); plasma vitellogenin (VTG); and stage of gonadal development. This data report provides fish size, stage and reproductive biomarker data for individual fish and for site and regional summaries of these variables.

  10. Protection des ions organiques contre les dommages induits a l'ADN par les electrons de basse energie

    Science.gov (United States)

    Dumont, Ariane

    Il a ete demontre que les electrons de basse energie (EBE) peuvent induire des cassures simple brin (CSB) a l'ADN, via la formation d'anions transitoires qui decroissent par attachement dissociatif, ou dans d'autres etats electroniques dissociatifs menant a la fragmentation. Afin d'effectuer une etude complete des effets des electrons de basse energie sur la matiere biologique, il est necessaire de comprendre leur mecanismes d'interaction non seulement avec l'ADN, mais avec les constituants de son environnement. Les histones sont une composante importante de l'environnement moleculaire de l'ADN. Leur charge positive leur permet de s'associer aux groupements phosphate anionique de l'ADN. Le role principal de ces proteines basiques consiste a organiser l'ADN et l'empaqueter afin de former la chromatine. Les cations sont une autre composante importante de la cellule; ils jouent un role dans la stabilisation de la conformation B de l'ADN in vitro par leurs interactions avec les petits et grands sillons de l'ADN, ainsi qu'avec le groupement phosphate charge negativement. Avec les histones, ils participent egalement a la compaction de l'ADN pour former la chromatine. Cette etude a pour but de comprendre comment la presence d'ions organiques (sous forme de Tris et d'EDTA) a proximite de l'ADN modifie le rendement de cassures simple brin induit par les electrons de basse energie. Le Tris et l'EDTA ont-ete choisis comme objet d'etude, puisqu'en solution, ils forment le tampon standard pour solubiliser l'ADN dans les experiences in vitro (10mM Tris, 1mM EDTA). De plus, la molecule Tris possede un groupement amine alors que l'EDTA possede 4 groupements carboxyliques. Ensembles, ils peuvent se comporter comme un modele simple pour les acides amines. Le ratio molaire de 10 :1 de Tris par rapport a l'EDTA a pour but d'imiter le comportement des histones qui sont riches en arginine et lysine, acides amines possedant un groupement amine charge positivement additionnel. Des films d

  11. Deux extraits commentés des Basses Œuvres1 de ‘Abduh Khāl

    OpenAIRE

    Lagrange, Frédéric

    2014-01-01

    Le romancier saoudien ‘Abduh Khāl, dans son roman Tarmī bi‑sharar (Les Basses Œuvres) paru en 2009 et couronné par l’International Prize for Arab Fiction en 2010, tend un miroir peu flatteur au Royaume wahhabite : ce monologue d’un tortionnaire violeur au service d’un mystérieux Maître du Palais dans une Djedda déformée par l’affairisme figurant allégoriquement le régime présente un pays corrompu par sa soumission à l’absolutisme. Deux extraits sont ici commentés, en soulignant les rapports i...

  12. The applicability of Bass's model of transformational, transactional, and laissez-faire leadership in the hospital administrative environment.

    Science.gov (United States)

    Spinelli, Robert J

    2006-01-01

    The purpose of this study is to evaluate empirically in the hospital administrative environment the relationship of leadership behaviors to subordinate manager's perceived outcomes, through examination of B. M. Bass's (1985) model of transformational, transactional, and laissez-faire leadership. The author measured leadership orientation and outcome factors through subordinate managers' ratings of hospital CEOs using a questionnaire, which asked: Is there a relationship between the leadership styles of hospital CEOs and subordinate managers' self-reported willingness to exert extra effort, perception of leader effectiveness and satisfaction with their leader? Findings revealed that the relationship between transformational leadership and the outcome factors were stronger and more positive than were the transactional and laissez-faire styles. These findings are consistent with the hierarchal patterns reported and support the universality of the model. PMID:16708688

  13. Les nouveaux colzas à basse teneur en glucosilonates : composition chimique et valeur nutritive des tourteaux et graines pour le porc

    OpenAIRE

    Bourdon, D.

    1989-01-01

    Les données de valeur nutritive (valeurs énergétique et azotée) de 30 échantillons de tourteaux et graines de colza à haute (HG) et basse (BG) teneur en glucosinolates, obtenues par mesure de digestibilité directe sur porc à l’engrais, sont présentées par type de tourteau (extrait au solvant, de pression, normal et dépelliculé), de même que pour les graines traitées. Nos résultats expérimentaux sont comparés à un nombre équivalent de données bibliographiques disponibles. Ils permettent ...

  14. Etude de nano-transistors à faible pente sous le seuil pour des applications très basse consommation

    OpenAIRE

    Villalon, Anthony

    2014-01-01

    Le transistor à effet tunnel bande à bande (TFET) est une architecture PIN à grille capable d’obtenir une pente sous le seuil inférieure à 60mV/dec à température ambiante, ce qui représente un avantage par rapport au MOSFET dans le cas d’applications basse consommation. L’objectif de cette thèse est d’étudier et de caractériser des TFETs fabriqués au CEA-LETI (sur substrats SOI avec les procédés standards CMOS), afin de comprendre et d’optimiser ces dispositifs. La première génération de TFET...

  15. Electron beam irradiation, oxygen, and temperature effects on nucleotide degradation in stored aquaculture hybrid striped bass fillets

    International Nuclear Information System (INIS)

    Skinless fillets from commercially-grown aquaculture hybrid striped bass (Morone saxatilis x M. chrysops) were electron beam-irradiated in the presence of air or vacuum-packaged and stored at 4C and -20C for 14 days. A mean low dose level of 2.0 or 3.0 kGy (+/- 0.5 kGy) and high dose level of 20 kGy (+/- 4 kGy) were used for irradiated samples. Hypoxanthine (Hx) concentrations, Ki-values ([(INO + Hx)/(IMP + INO + Hx)] x 100), and H-values ([(Hx)/(IMP + INO + Hx)] x 100) indicated that irradiation did not influence the rate of nucleotide degradation compared with nonirradiated controls at either refrigerated or frozen temperatures. Vacuum packaging or freezing of stored samples resulted in lower H-values and Hx contents compared with nonirradiated controls regardless of irradiation treatment

  16. Ambient and potential denitrification rates in marsh soils of Northeast Creek and Bass Harbor Marsh watersheds, Mount Desert Island, Maine

    Science.gov (United States)

    Huntington, Thomas G.; Culbertson, Charles W.; Duff, John H.

    2012-01-01

    Nutrient enrichment from atmospheric deposition, agricultural activities, wildlife, and domestic sources is a concern at Acadia National Park on Mount Desert Island, Maine, because of the potential problems of degradation of water quality and eutrophication in estuaries. Degradation of water quality has been observed at Bass Harbor Marsh estuary in the park but only minimally in Northeast Creek estuary. Previous studies at Acadia National Park have estimated nutrient inputs to estuaries from atmospheric deposition and surface-water runoff, and have identified shallow groundwater as an additional potential source of nutrients. Previous studies at Acadia National Park have assumed that a certain fraction of the nitrogen input was removed through microbial denitrification, but rates of denitrification (natural or maximum potential) in marsh soils have not been determined. The U.S. Geological Survey, in cooperation with Acadia National Park, measured in-place denitrification rates in marsh soils in Northeast Creek and in Bass Harbor Marsh watersheds during summer 2008 and summer 2009. Denitrification was measured under ambient conditions as well as after additions of inorganic nitrogen and glucose. In-place denitrification rates under ambient conditions were similar to those reported for other coastal wetlands, although they were generally lower than those reported for salt marshes having high ambient concentrations of nitrate (NO3). Denitrification rates generally increased by at least an order of magnitude following NO3 additions, with or without glucose (as the carbohydrate) additions, compared with the ambient treatments that received no nutrient additions. The treatment that added both glucose and NO3 resulted in a variety of denitrification responses when compared with the addition of NO3 alone. In most cases, the addition of glucose to a given rate of NO3 addition resulted in higher rates of denitrification. These variable responses indicate that the amount of

  17. Effects of starvation on protein synthesis and nucleic acid metabolism in the muscle of the barred sand bass Paralabrax nebulifer

    International Nuclear Information System (INIS)

    Starvation induced different protein synthesis responses in red and white muscle of the barred sand bass Paralabrax nebulifer. Red muscle had 14C-leucine incorporation rates into total protein which were several times higher than white muscle in both the fed and starved states. Muscle was separated into a myofibrillar fraction consisting of the structural proteins and a sarcoplasmic fraction consisting of soluble proteins. Synthesis of the myofibrillar fraction of white muscle decreased by 90%, while red muscle myofibrillar synthesis remained essentially unchanged. Changes in the labeling of several enzymes purified from the sarcoplasmic fraction were different even though the overall loss of enzyme activity was similar, suggesting that changes in synthesis rates were important in maintaining appropriate relative enzyme concentrations

  18. Dworshak Dam Impact Assessment and Fishery Investigation and Trout, Bass and Forage Species: Combined Project Completion Report.

    Energy Technology Data Exchange (ETDEWEB)

    Maiolie, Melo; Statler, David P.; Elam, Steve

    1992-10-01

    The Nez Perce Tribe (NPT) and the Idaho Department of Fish and Game (IDFG) entered into separate intergovernmental agreements with the Bonneville Power Administration in a cooperative four-year effort to study impacts of Dworshak Dam operation on resident fisheries. The NPT Department of Fisheries Management focused on rainbow trout, smallmouth bass and forage fish. The IDFG's segment of the project was to document kokanee population dynamics, relate it to the changing nutrient status of the reservoir, evaluate kokanee losses through Dworshak Dam, and make kokanee management recommendations. This final report includes findings for 1990 and 1991 and relates these data to information previously presented in annual reports for 1987, 1988 and 1989.

  19. Photoperiodic Modulation of Circadian Clock and Reproductive Axis Gene Expression in the Pre-Pubertal European Sea Bass Brain

    Science.gov (United States)

    Martins, Rute S. T.; Gomez, Ana; Zanuy, Silvia; Carrillo, Manuel; Canário, Adelino V. M.

    2015-01-01

    The acquisition of reproductive competence requires the activation of the brain-pituitary-gonad (BPG) axis, which in most vertebrates, including fishes, is initiated by changes in photoperiod. In the European sea bass long-term exposure to continuous light (LL) alters the rhythm of reproductive hormones, delays spermatogenesis and reduces the incidence of precocious males. In contrast, an early shift from long to short photoperiod (AP) accelerates spermatogenesis. However, how photoperiod affects key genes in the brain to trigger the onset of puberty is still largely unknown. Here, we investigated if the integration of the light stimulus by clock proteins is sufficient to activate key genes that trigger the BPG axis in the European sea bass. We found that the clock genes clock, npas2, bmal1 and the BPG genes gnrh, kiss and kissr share conserved transcription factor frameworks in their promoters, suggesting co-regulation. Other gene promoters of the BGP axis were also predicted to be co-regulated by the same frameworks. Co-regulation was confirmed through gene expression analysis of brains from males exposed to LL or AP photoperiod compared to natural conditions: LL fish had suppressed gnrh1, kiss2, galr1b and esr1, while AP fish had stimulated npas2, gnrh1, gnrh2, kiss2, kiss1rb and galr1b compared to NP. It is concluded that fish exposed to different photoperiods present significant expression differences in some clock and reproductive axis related genes well before the first detectable endocrine and morphological responses of the BPG axis. PMID:26641263

  20. Cloning, tissue distribution and effects of fasting on pituitary adenylate cyclase-activating polypeptide in largemouth bass

    Science.gov (United States)

    Li, Shengjie; Han, Linqiang; Bai, Junjie; Ma, Dongmei; Quan, Yingchun; Fan, Jiajia; Jiang, Peng; Yu, Lingyun

    2015-03-01

    Pituitary adenylate cyclase activating polypeptide (PACAP) has a wide range of biological functions. We cloned the full-length cDNAs encoding PACAP and PACAP-related peptide (PRP) from the brain of largemouth bass ( Micropterus salmoides) and used real-time quantitative PCR to detect PRP-PACAP mRNA expression. The PRP-PACAP cDNA has two variants expressed via alternative splicing: a long form, which encodes both PRP and PACAP, and a short form, which encodes only PACAP. Sequence analysis results are consistent with a higher conservation of PACAP than PRP peptide sequences. The expression of PACAP-long and PACAP-short transcripts was highest in the forebrain, followed by the medulla, midbrain, pituitary, stomach, cerebellum, intestine, and kidney; however, these transcripts were either absent or were weakly expressed in the muscle, spleen, gill, heart, fatty tissue, and liver. The level of PACAP-short transcript expression was significantly higher than expression of the long transcript in the forebrain, cerebella, pituitary and intestine, but lower than that of the long transcript in the stomach. PACAP-long and PACAP-short transcripts were first detected at the blastula stage of embryogenesis, and the level of expression increased markedly between the muscular contraction stage and 3 d post hatch (dph). The expression of PACAP-long and PACAP-short transcripts decreased significantly in the brain following 4 d fasting compared with the control diet group. The down-regulation effect was enhanced as fasting continued. Conversely, expression levels increased significantly after 3 d of re-feeding. Our results suggest that PRP-PACAP acts as an important factor in appetite regulation in largemouth bass.

  1. VACCINATION OF HYBRID STRIPED BASS: GROWTH, IMMUNE REACTION AND GENE EXPRESSION

    Directory of Open Access Journals (Sweden)

    Mark Westerman

    2012-10-01

    Full Text Available Hybrid striped bass (42.6+4.9 g wet wt; 139.3+6.1 mm length, were randomly stocked into one of 6 tanks (n=6 tank-1 of a custom designed, recirculating life support system (RLSS. Water quality was as follows: DO2 (6.50.6 mg l-1, pH (7.70.5, TAN (0.06-1.31 mg l-1, nitrite (0.06-0.60 mg l-1 and nitrate (2.0-32.1 mg l-1, salinity 5 ppt, temperature 28±1 oC. A 12:12 photophase:scotophase was used, with a 30 min. dusk-dawn dimming of lights. Fish were fed at 4% body wt d-1 as two separate feedings (08.00 and 16.00 h. Dietary crude protein and lipid levels were 40% and 10% respectively. Tanks were randomly paired and fish either left untreated, vaccinated, or sham injected. The vaccine employed was an experimental formalin killed Streptococcus iniae oil-in-water adjuvanted bacterin. Fish were weighed and measured bimonthly for 8 wk with group weights being employed to adjust feeding rates. At trial termination, all animals were weighed and measured, and their condition factor (CF and feed conversion ratios (FCR calculated. Visceral somatic (VSI and hepatosomatic (HSI indices and intraperitoneal fat (IPF and muscle ratios (MR were also assessed. Blood was taken from anaesthetized fish and hematocrit recorded. Blood was allowed to clot overnight at 5 oC after which serum protein levels were recorded and lysozyme activity measured. Livers were prepared for microarray evaluation using standard techniques using a Danio rerio genechip to assess global changes in gene expression. No differences were observed with respect to final weights, lengths, CF, FCR, or HSI although differences (P < 0.001 were determined for VSI, which was higher in control animals. Packed cell volume and serum protein levels were similar across groups (P > 0.05. Time-course of changes in serum lysozyme activity described an initial reduction in lysozyme activity followed by a rebounding in activity which peaked 25 days post-treatments. Evaluation of lysozyme activity among time

  2. Anchoring novel molecular biomarker responses to traditional responses in fish exposed to environmental contamination

    Energy Technology Data Exchange (ETDEWEB)

    Nogueira, Patricia [CESAM and Departamento de Biologia, Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Department of Biology and Environmental Science, University of Sussex, Falmer, Brighton BN1 9QJ (United Kingdom); Pacheco, Mario [CESAM and Departamento de Biologia, Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Lourdes Pereira, M. [CICECO and Departamento de Biologia, Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Mendo, Sonia [CESAM and Departamento de Biologia, Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); Rotchell, Jeanette M., E-mail: J.Rotchell@sussex.ac.u [Department of Biology and Environmental Science, University of Sussex, Falmer, Brighton BN1 9QJ (United Kingdom)

    2010-05-15

    The responses of Dicentrarchus labrax and Liza aurata to aquatic pollution were assessed in a contaminated coastal lagoon, using both traditional and novel biomarkers combined. DNA damage, assessed by comet assay, was higher in both fish species from the contaminated sites, whereas levels of cytochrome P450 1A1 gene expression were not significantly altered. The liver histopathological analysis also revealed significant lesions in fish from contaminated sites. Alterations in ras and xpf genes were analysed and additional pollutant-responsive genes were identified. While no alterations were found in ras gene, a downregulation of xpf gene was observed in D. labrax from a contaminated site. Suppression subtractive hybridization applied to D. labrax collected at a contaminated site, revealed altered expression in genes involved in energy metabolism, immune system activity and antioxidant response. The approach and results reported herein demonstrate the utility of anchoring traditional biomarker responses alongside novel biomarker responses. - Novel molecular biomarkers of aquatic environmental contamination in fish.

  3. Comparison of zootechnical performances, welfare condition and quality traits of hybrid striped bass (Morone chrysops x Morone saxatilis reared in different Italian farms

    Directory of Open Access Journals (Sweden)

    Paolo Melotti

    2010-01-01

    Full Text Available Growth performances of sunshine bass (initial m.b.w.=200±50 g were examined in 3 different rearing conditions: concrete square basins (HSB-1; raceways (HSB-2; natural ponds (HSB-3. Fish received the same extruded feed (prot. 48.8%; lip. 17.8%. The trial lasted 16 months in HSB-1 and HSB-2 and only 12 months in HSB-3 due to unfavourable welfare status and low growth performances. At harvest (after 16 months, sunshine bass reached a satisfactory mean weight with- out significant differences between groups. HSB-2 fish were longer with a smaller circumference, prob- ably due to different hydrodynamics of the raceway. Glucose, cholesterol, triglycerides, protein, lactic dehydrogenase (LDH, aspartate aminotransferase (AST, alanine aminotransferase (ALT, alkaline phosphatase (ALP, creatine kinase (CK, glycogen of plasma or tissue were not affected by rearing conditions as well as the proximate composition and the fatty acid profile of the fillet.

  4. Organochlorine pesticides and thiamine in eggs of largemouth bass and American alligators and their relationship with early life-stage mortality

    Science.gov (United States)

    Sepulveda, M.S.; Wiebe, J.J.; Honeyfield, D.C.; Rauschenberger, H.R.; Hinterkopf, J.P.; Johnson, W.E.; Gross, T.S.

    2004-01-01

    Thiamine deficiency has been linked to early mortality syndrome in salmonids in the Great Lakes. This study was conducted to compare thiamine concentrations in American alligators (Alligator mississippiensis) and Florida largemouth bass (Micropterus salmoides floridanus) eggs from sites with high embryo mortality and high exposure to organochlorine pesticides (OCPs) (Lakes Apopka and Griffin, and Emeralda Marsh, Florida, USA) to those from sites that have historically exhibited low embryo mortality and low OCPs (Lakes Woodruff and Orange, Florida). During June-July 2000, 20 alligator clutches were collected from these sites, artificially incubated, and monitored for embryo mortality. Thiamine and OCPs were measured in one egg/clutch. During February 2002, 10 adult female bass were collected from Emeralda Marsh and Lake Woodruff and mature ovaries analyzed for thiamine and OCP concentrations. Although ovaries from the Emeralda Marsh bass contained almost 1,000-fold more OCPs compared with the reference site, Lake Woodruff, there were no differences in thiamine concentrations between sites (11,710 vs. 11,857 pmol/g). In contrast, alligator eggs from the reference site had five times the amount of thiamine compared with the contaminated sites (3,123 vs. 617 pmol/g). Similarly, clutches with > 55% hatch rates had significantly higher concentrations of thiamine compared with clutches with alligator embryo survival but not in reproductive failure and recruitment of largemouth bass. The cause(s) of this thiamine deficiency are unknown but might be related to differences in the nutritional value of prey items across the sites studied and/or to the presence of high concentration of contaminants in eggs. ?? Wildlife Disease Association 2004.

  5. One loop effects to the process e+e-→b-bass in topcolor-assisted multi-scale technicolor model

    International Nuclear Information System (INIS)

    The authors calculated the Pseudo-Goldstone bosons (technipions, top-pions) corrections to the cross-section σ of the process e+e-→b-bass in topcolor-assisted multi-scale technicolor model at LEP II energy region. The results show that, with reasonable value of the parameters, the cross-section is one order larger than that predicted by the standard model. The authors discussed the possibility of detecting this rare event at the 'B-factory'

  6. Improving oral hygiene skills by computer-based training : A randomized controlled comparison of the modified bass and the fones techniques

    OpenAIRE

    Harnacke, Daniela; Mitter, Simona; Lehner, Marc; Munzert, Jörn; Deinzer, Renate

    2012-01-01

    Background: Gingivitis and other plaque-associated diseases have a high prevalence in western communities even though the majority of adults report daily oral hygiene. This indicates a lack of oral hygiene skills. Currently, there is no clear evidence as to which brushing technique would bring about the best oral hygiene skills. While the modified Bass technique is often recommended by dentists and in textbooks, the Fones technique is often recommended in patient brochures. Still, standardize...

  7. The potential use of legume-based diets supplemented with microbial phytase on the growth performance and feed efficiency of sea bass, Lates calcarifer

    Directory of Open Access Journals (Sweden)

    Erlinda S. Ganzon-Naret

    2013-09-01

    Full Text Available A feeding trial was conducted for 12 weeks to evaluate the potential use of legume-based diets supplemented with dietary microbial phytase on the growth performance and feed efficiency of juvenile sea bass, Lates calcarifer. Fifteen sea bass juveniles (mean initial weight of 0.96 g and mean initial total length (TL of 4.2 cm were stocked at three replicates into each of the twelve 100 L conical fibreglass tanks containing 90 L sea water in a closed recirculating system with filtered and aerated sea water. Four isonitrogenous, isolipidic and isocaloric experimental diets were formulated. The control diet (C0 contained fish meal, soybean meal, shrimp meal and squid meal as major protein sources. Legume seed meals of pigeon pea (Cajanus cajan, yellow mungbeans (Phaseolus aureus, and green mungbeans (Vigna radiata were incorporated in the practical diets D1, D2 and D3 respectively at 18-20% replacing an equivalent amount of 6-7g fish meal protein and supplemented with microbial phytase at the level of 300U kg-1 diet. Growth rate, feed conversion ratio (FCR, protein efficiency ratio (PER and apparent net protein utilization (ANPU of sea bass were significantly (P < 0.05 higher in control diet than those given different legume based diets supplemented with phytase. Histological examination of the liver tissues for the different dietary treatments did not manifest any abnormalities. Phytase supplementation also improved bone ash, phosphorus (P concentration as well as P content in the carcass for fish in legume fed groups. Results from the present study showed that incorporation of dietary microbial phytase in legume based diets slightly improve the growth performance and P availability in sea bass juveniles.

  8. The potential use of legume-based diets supplemented with microbial phytase on the growth performance and feed efficiency of sea bass, Lates calcarifer

    Directory of Open Access Journals (Sweden)

    Erlinda S. Ganzon-Naret

    2013-09-01

    Full Text Available A feeding trial was conducted for 12 weeks to evaluate the potential use of legume-based diets supplemented with dietary microbial phytase on the growth performance and feed efficiency of juvenile sea bass, Lates calcarifer. Fifteen sea bass juveniles (mean initial weight of 0.96 g and mean initial total length (TL of 4.2 cm were stocked at three replicates into each of the twelve 100 L conical fibreglass tanks containing 90 L sea water in a closed recirculating system with filtered and aerated sea water. Four isonitrogenous, isolipidic and isocaloric experimental diets were formulated. The control diet (C0 contained fish meal, soybean meal, shrimp meal and squid meal as major protein sources. Legume seed meals of pigeon pea (Cajanus cajan, yellow mungbeans ((Phaseolus aureus,and green mungbeans ((Vigna radiata were incorporated in the practical diets D1, D2 and D3 respectively at 18-20% replacing an equivalent amount of 6-7g fish meal protein and supplemented with microbial phytase at the level of 300U kg-1 diet. Growth rate, feed conversion ratio (FCR, protein efficiency ratio (PER and apparent net protein utilization (ANPU of sea bass were significantly (P < 0.05 higher in control diet than those given different legume based diets supplemented with phytase. Histological examination of the liver tissues for the different dietary treatments did not manifest any abnormalities. Phytase supplementation also improved bone ash, phosphorus (P concentration as well as P content in the carcass for fish in legume fed groups. Results from the present study showed that incorporation of dietary microbial phytase in legume based diets slightly improve the growth performance and P availability in sea bass juveniles.

  9. Rates of consumption of juvenile salmonids and alternative prey fish by northern squawfish, walleyes, smallmouth bass, and channel catfish in John Day Reservoir, Columbia River

    International Nuclear Information System (INIS)

    Adult northern squawfish Ptychocheilus oregonesis, walleyes Stizostedion vitreum, smallmouth bass Micropterus dolomieu, and channel catfish Ictalurus punctatus were sampled from four regions of John Day Reservoir from April to August 1983-1986 to quantify their consumption of 13 species of prey fish, particularly seaward-migrating juvenile Pacific salmon and steelhead (Oncorhynchus spp.). Consumption rates were estimated from field data on stomach contents and digestion rate relations determined in previous investigations. For each predator, consumption rates varied by reservoir area, month, time of day, and predator size or age. The greatest daily consumption of salmonids by northern squawfish and channel catfish occurred in the upper end of the reservoir below McNary Dam. Greatest daily predation by walleyes and smallmouth bass occurred in the middle and lower reservoir. Consumption rates of all predators were highest in July, concurrent with maximum temperature and abundance of juvenile salmonids. Feeding by the predators tended to peak after dawn and near midnight. Northern squawfish below McNary Dam exhibited this pattern, but fed mainly in the morning hours down-reservoir. The daily ration of total prey fish was highest for northern squawfish over 451 mm fork length, for walleyes 201-250 mm, for smallmouth bass 176-200 mm, and for channel catfish 401-450 mm. Averaged over all predator sizes and sampling months (April-August), the total daily ration (fish plus other prey) of smallmouth bass was about twice that of channel catfish, northern squawfish, and walleyes. However, northern squawfish was clearly the major predator on juvenile salmonids

  10. Anoplastie périnéale simple pour le traitement des malformations anorectales basses chez l'adulte, à propos de deux cas

    Science.gov (United States)

    Echchaoui, Abdelmoughit; Benyachou, Malika; Hafidi, Jawad; Fathi, Nahed; Mohammadine, Elhamid; ELmazouz, Samir; Gharib, Nour-eddine; Abbassi, Abdellah

    2014-01-01

    Les malformations anorectales chez l'adulte sont des anomalies congénitales rares du tube digestif qui prédominent chez le sexe féminin. Notre étude porte sur deux observations de malformation anorectale basses vues et traitées au stade adulte par les 2 équipes (plasticiens et viscéralistes) à l'Hôpital Avicenne à Rabat. Il s'agit d'un homme de 24 ans avec une dyschésie anale l'autre cas est une femme de 18 ans avec une malformation anovulvaire Les caractéristiques cliniques combinées avec les imageries radiologiques (lavement baryté, et la manométrie anorectale) ont confirmé qu'il s'agit d'une malfomation anorectale basse. Les deux cas sont corrigés par une reconstruction sphinctérienne, réimplantation anale avec anoplastie périnéale. Les suites opératoires étaient simples, pas de souffrance cutanée ou nécrose, avec changement de pansement gras chaque jour. Le résultat fonctionnel (la continence) était favorable pour les 2 patients. La présentation des MAR à l’âge adulte est rare, d’étiologie mal connu, elles apparaissent selon le mode sporadique. Les caractéristiques cliniques, couplées à l'imagerie (lavement baryté, IRM pelvienne), l'endoscopie et la manométrie anorectale, permettent de confirmer le diagnostic et classer ces anomalies en 3 types: basses, intermédiaires, et hautes. Les formes basses sont traités d'emblée par une réimplantation anale et anoplastie périnéale simple tels nos deux cas, elles peuvent être traités dans certains cas par un abaissement anorectale associé à une plastie V-Y permettant ainsi un emplacement anatomique correct de l'anus; alors que les formes hautes ou intermédiaires relèvent d'une chirurgie complexe avec souvent une dérivation digestive transitoire. Contrairement aux autres formes, Les formes basses ont un pronostic fonctionnel favorable. PMID:25667689

  11. BANYAN. VII. A New Population of Young Substellar Candidate Members of Nearby Moving Groups from the BASS Survey

    Science.gov (United States)

    Gagné, Jonathan; Faherty, Jacqueline K.; Cruz, Kelle L.; Lafreniére, David; Doyon, René; Malo, Lison; Burgasser, Adam J.; Naud, Marie-Eve; Artigau, Étienne; Bouchard, Sandie; Gizis, John E.; Albert, Loïc

    2015-08-01

    We present the results of a near-infrared (NIR) spectroscopic follow-up survey of 182 M4-L7 low-mass stars and brown dwarfs (BDs) from the BANYAN All-Sky Survey (BASS) for candidate members of nearby, young moving groups (YMGs). We confirm signs of low gravity for 42 new BD discoveries with estimated masses between 8 and 75 {M}{Jup} and identify previously unrecognized signs of low gravity for 24 known BDs. We refine the fraction of low-gravity dwarfs in the high-probability BASS sample to ˜82%. We use this unique sample of 66 young BDs, supplemented with 22 young BDs from the literature, to construct new empirical NIR absolute magnitude and color sequences for low-gravity BDs. We show that low-resolution NIR spectroscopy alone cannot differentiate between the ages of YMGs younger than ˜120 Myr, and that the BT-Settl atmosphere models do not reproduce well the dust clouds in field or low-gravity L-type dwarfs. We obtain a spectroscopic confirmation of low gravity for 2MASS J14252798-3650229, which is a new ˜27 {M}{Jup}, L4 γ bona fide member of AB Doradus. We identify a total of 19 new low-gravity candidate members of YMGs with estimated masses below 13 {M}{Jup}, 7 of which have kinematically estimated distances within 40 pc. These objects will be valuable benchmarks for a detailed atmospheric characterization of planetary-mass objects with the next generation of instruments. We find 16 strong candidate members of the Tucana-Horologium association with estimated masses between 12.5 and 14 {M}{Jup}, a regime where our study was particularly sensitive. This would indicate that for this association there is at least one isolated object in this mass range for every {17.5}-5.0+6.6 main-sequence stellar member, a number significantly higher than expected based on standard log-normal initial mass function, however, in the absence of radial velocity and parallax measurements for all of them, it is likely that this over-density is caused by a number of young interlopers

  12. Concentrations of mercury and other metals in black bass (Micropterus spp.) from Whiskeytown Lake, Shasta County, California, 2005

    Science.gov (United States)

    May, Jason T.; Hothem, Roger L.; Bauer, Marissa L.; Brown, Larry R.

    2012-01-01

    This report presents the results of a reconnaissance study conducted by the U.S. Geological Survey (USGS) to determine mercury (Hg) and other selected metal concentrations in Black bass (Micropterus spp.) from Whiskeytown Lake, Shasta County, California. Total mercury concentrations were determined by cold-vapor atomic absorption spectroscopy (CVAAS) in fillets and whole bodies of each sampled fish. Selected metals scans were performed on whole bodies (less the fillets) by inductively coupled plasma–mass spectroscopy (ICP-MS) and inductively coupled plasma–optical emission spectroscopy (ICP-OES). Mercury concentrations in fillet samples ranged from 0.06 to 0.52 micrograms per gram (μg/g) wet weight (ww). Total mercury (HgT) in the same fish whole-body samples ranged from 0.04 to 0.37 (μg/g, ww). Mercury concentrations in 17 percent of "legal catch size" (≥305 millimeters in length) were above the U.S. Environmental Protection Agency water-quality criterion for the protection of human health of 0.30 μg/g (ww). These data will serve as a baseline for future monitoring efforts within Whiskeytown Lake.

  13. Fatty acid profile of sunshine bass: I. Profile change is affected by initial composition and differs among tissues.

    Science.gov (United States)

    Trushenski, Jesse T; Lewis, Heidi A; Kohler, Christopher C

    2008-07-01

    Fatty acid (FA) composition of fillet tissue can be tailored by transitioning fish from alternative lipid-based, low long-chain polyunsaturated fatty acid (LC-PUFA) grow-out feeds to high LC-PUFA "finishing" feeds. To address whether grow-out feed composition influences the responsiveness of fillet tissue to finishing, sunshine bass (SB, Morone chrysops x M. saxatilis) were reared to a submarketable size on grow-out feeds containing fish oil (FO) or a 50:50 blend of FO and coconut (CO), grapeseed (GO), linseed (LO), or poultry (PO) oil. For the final 8 weeks of the trial, fish were either maintained on assigned grow-out feeds or finished with the 100% FO feed. Production performance was unaffected by dietary lipid source, but fillet FA profile generally conformed to nutritional history. Regardless of grow-out regimen, finishing had a significant restorative effect on fillet FA composition; however, complete restoration of control levels of 20:5n-3, 22:6n-3, total LC-PUFA and n-3:n-6 FA ratio was achieved only among fish fed the CO-based grow-out feed. Saturated fatty acids (SFA) appear to be preferential catabolic substrates, whereas medium-chain and long-chain PUFA are selectively deposited in tissues. Provision of SFA in grow-out feeds appears to optimize selective FA metabolism and restoration of beneficial fillet FA profile during finishing. PMID:18521646

  14. Mercury in fish scales as an assessment method for predicting muscle tissue mercury concentrations in largemouth bass.

    Science.gov (United States)

    Lake, J L; Ryba, S A; Serbst, J R; Libby, A D

    2006-05-01

    The relationship between total mercury (Hg) concentration in fish scales and in tissues of largemouth bass (Micropterus salmoides) from 20 freshwater sites was developed and evaluated to determine whether scale analysis would allow a nonlethal and convenient method for predicting Hg concentrations in tissues. The relationship between total Hg concentration in untreated scale samples and muscle tissue is highly variable. Several different scale treatments were tried in an effort to increase the coefficient of determination and thereby enhance the effectiveness of this predictive technique. Washing scales with acetone, deionized (DI) water, detergent solution, and soap were used in conjunction with ultrasonication. The use of a mild soap solution with heating and ultrasonication increased the r(2) the most (from 0.69 [untreated scales] to 0.89). However, despite treatment, wide predictions of tissue Hg concentration remained. These results suggest that application of this technique as an independent method for issuance of fish advisories is inappropriate. Nevertheless, our results showed that scale analysis has potential for assessing general trends in concentration relative to a tissue criterion and for assessing Hg contamination in fish tissue as a first-level screen. PMID:16435082

  15. Ovary transcriptome profiling via artificial intelligence reveals a transcriptomic fingerprint predicting egg quality in striped bass, Morone saxatilis.

    Science.gov (United States)

    Chapman, Robert W; Reading, Benjamin J; Sullivan, Craig V

    2014-01-01

    Inherited gene transcripts deposited in oocytes direct early embryonic development in all vertebrates, but transcript profiles indicative of embryo developmental competence have not previously been identified. We employed artificial intelligence to model profiles of maternal ovary gene expression and their relationship to egg quality, evaluated as production of viable mid-blastula stage embryos, in the striped bass (Morone saxatilis), a farmed species with serious egg quality problems. In models developed using artificial neural networks (ANNs) and supervised machine learning, collective changes in the expression of a limited suite of genes (233) representing 90% of the eventual variance in embryo survival. Egg quality related to minor changes in gene expression (networks are centrally involved in regulation of early development in all vertebrates, including humans. By assessing collective levels of the relevant ovarian transcripts via ANNs we were able, for the first time in any vertebrate, to accurately predict the subsequent embryo developmental potential of eggs from individual females. Our results show that the transcriptomic fingerprint evidencing developmental dysfunction is highly predictive of, and therefore likely to regulate, egg quality, a biologically complex trait crucial to reproductive fitness. PMID:24820964

  16. The C-Band All-Sky Survey (C-BASS): Design and implementation of the northern receiver

    CERN Document Server

    King, O G; Blackhurst, E J; Copley, C; Davis, R J; Dickinson, C; Holler, C M; Irfan, M O; John, J J; Leahy, J P; Leech, J; Muchovej, S J C; Pearson, T J; Stevenson, M A; Taylor, Angela C

    2013-01-01

    The C-Band All-Sky Survey (C-BASS) is a project to map the full sky in total intensity and linear polarization at 5 GHz. The northern component of the survey uses a broadband single-frequency analogue receiver fitted to a 6.1-m telescope at the Owens Valley Radio Observatory in California, USA. The receiver architecture combines a continuous-comparison radiometer and a correlation polarimeter in a single receiver for stable simultaneous measurement of both total intensity and linear polarization, using custom-designed analogue receiver components. The continuous-comparison radiometer measures the temperature difference between the sky and temperature-stabilized cold electrical reference loads. A cryogenic front-end is used to minimize receiver noise, with a system temperature of $\\approx 30$ K in both linear polarization and total intensity. Custom cryogenic notch filters are used to counteract man-made radio frequency interference. The radiometer $1/f$ noise is dominated by atmospheric fluctuations, while th...

  17. Evaluation of heavy metal uptake in micropterus salmoides (Largemouth Bass) of Lake Austin, TX by neutron activation analysis

    International Nuclear Information System (INIS)

    Neutron activation analysis was used to investigate and quantify the level of heavy metal uptake in the marine environment of Lake Austin in Austin, TX. Specifically, the samples studied were largemouth bass, or micropterus salmoides. The presence of heavy metals in the food chain presents multiple hazards, mostly as a food hazard for those species that ingest the fish, namely humans. To measure the concentrations of heavy metals in various fish samples, the nuclear analytical technique of neutron activation analysis (NAA) was used. Both epithermal and thermal irradiations were conducted for the NAA to look for short and long-lived radioisotopes, respectively. The samples themselves consisted of liver and tissue samples for each of the fish caught. Each sample was freeze-dried and homogenized before irradiation and spectrum acquisition. The results showed that all levels of heavy metals were not sufficient enough to make the fish unsafe for eating, with the highest levels being found for iron and zinc. Gold was found to be at much higher concentrations in the younger fish and virtually non-existent in the larger of the samples. (author)

  18. MARICULTURE ON CROATIAN ISLANDS

    Directory of Open Access Journals (Sweden)

    Gordana Šarušić

    2000-09-01

    Full Text Available The first attempts of intensive mariculture in Croatia commenced at the very beginning of 1980’s. The mid-eighties brought an expansion of mariculture production, which has been continuously increasing. A few different marine organisms are intensively cultured - both fish and shellfish. Among them commercially most important and highly valued species are sea bass Dicentrarchus labrax and sea bream Sparus aurata. Mussel Mytilus galloprovincialis and oyster Ostrea edulis are the most important shellfish. Fish species such as dentex Dentex dentex, red sea bream Pagrus major and sheepshead bream Puntazzo puntazzo are reared too, but in a rather small quantities. Only recently the rearing, on-growing- of bluefin tuna Thunnus thynnus started in Croatia. The juveniles (70% are reared in a Croatian hatcheries, and 30% has to be imported mainly from Italy and France, due to a higher demand for this kind of culture among the small growers. Croatian part of Adriatic sea possesses a number of geomorfologicaly suitable sites and meteorological conditions which determined the choice - type - of intensive culture. All fish species are reared in a floating cages. The choice of cages i. e. semi off-shore or floating frames, size, rearing volume and design depend on the investors personal preference. The annual turnouf of a market size bass was about 600t and 300t bream in 1996., by 10 island farms which is 70% of total production in Croatia. Including other cultured fish species last year production was up to 1000t, and it™s being estimated to be about 1300t in the following year. The shellfish production on the islands is usually individual attempt of farmers, producing minor quantities mostly in polyculture. This production has bigger potential but it’s limited owing to the EU quality control regulations which do not allow the export, and by domestic market which has drastically decreased due to the collapse of tourism during the recent war. Almost 80

  19. Natural history of SLC11 genes in vertebrates: tales from the fish world

    Directory of Open Access Journals (Sweden)

    Castro L Filipe C

    2011-04-01

    Full Text Available Abstract Background The SLC11A1/Nramp1 and SLC11A2/Nramp2 genes belong to the SLC11/Nramp family of transmembrane divalent metal transporters, with SLC11A1 being associated with resistance to pathogens and SLC11A2 involved in intestinal iron uptake and transferrin-bound iron transport. Both members of the SLC11 gene family have been clearly identified in tetrapods; however SLC11A1 has never been documented in teleost fish and is believed to have been lost in this lineage during early vertebrate evolution. In the present work we characterized the SLC11 genes in teleosts and evaluated if the roles attributed to mammalian SLC11 genes are assured by other fish specific SLC11 gene members. Results Two different SLC11 genes were isolated in the European sea bass (Dicentrarchus. labrax, and named slc11a2-α and slc11a2-β, since both were found to be evolutionary closer to tetrapods SLC11A2, through phylogenetic analysis and comparative genomics. Induction of slc11a2-α and slc11a2-β in sea bass, upon iron modulation or exposure to Photobacterium damselae spp. piscicida, was evaluated in in vivo or in vitro experimental models. Overall, slc11a2-α was found to respond only to iron deficiency in the intestine, whereas slc11a2-β was found to respond to iron overload and bacterial infection in several tissues and also in the leukocytes. Conclusions Our data suggests that despite the absence of slc11a1, its functions have been undertaken by one of the slc11a2 duplicated paralogs in teleost fish in a case of synfunctionalization, being involved in both iron metabolism and response to bacterial infection. This study provides, to our knowledge, the first example of this type of sub-functionalization in iron metabolism genes, illustrating how conserving the various functions of the SLC11 gene family is of crucial evolutionary importance.

  20. EVALUACIÓN DE LAS TÉCNICAS DE CEPILLADO DE BASS Y VERTICAL EN UN GRUPO DE PACIENTES EN TRATAMIENTO DE ORTODONCIA CON TÉCNICA MBT

    Directory of Open Access Journals (Sweden)

    Yelitza Ivone Baracaldo Ortíz

    2012-12-01

    Full Text Available Objetivo: Evaluar la efectividad de las técnicas de Cepillado de Bass y Vertical en pacientes con aparatología ortodóntica fija tratados con la técnica MBT. Materiales y métodos: se realizó un estudio experimental “In vivo” aleatorizado doble ciego; la muestra fue de 100 personas distribuidas en dos grupos, a cada uno se le asignó una Técnica de Cepillado y se dieron instrucciones de higiene oral por medio de charlas personalizadas y por escrito. Se usó el índice de Sillnes y Löe para medir el porcentaje de placa bacteriana, el cual fue realizado por una higienista oral, cada 30 ± 3 días durante 3 meses. A los dos grupos se les realizó profilaxis con el objetivo de tener un índice inicial de placa lo más aproximado a cero. A los participantes se les entregó mensualmente los aditamentos de higiene oral que debían usar. Resultados: antes de dar instrucciones de higiene oral el 73,4% tenían índice de placa moderado, el 16,46% severo y el 10,3% incipiente. El grupo de Técnica Vertical obtuvo mayor reducción de placa en comparación con el grupo de Técnica  Bass durante la primera toma (pConclusiones: La Técnica de Cepillado Vertical es más efectiva que la Técnica Bass para disminuir la placa bacteriana en pacientes tratados ortodónticamente con la técnica MBT.  

  1. Detection of an endocrine disrupter biomarker, vitellogenin, in largemouth bass serum using AlGaN/GaN high electron mobility transistors

    Science.gov (United States)

    Chu, Byung Hwan; Chang, C. Y.; Kroll, Kevin; Denslow, Nancy; Wang, Yu-Lin; Pearton, S. J.; Dabiran, A. M.; Wowchak, A. M.; Cui, B.; Chow, P. P.; Ren, Fan

    2010-01-01

    Endocrine disrupters are known to have negative effects on the environment and human health. Real time detection of vitellogenin, an endocrine disrupter biomarker, was demonstrated using AlGaN/GaN high electron mobility transistors (HEMTs). Anti-vitellogenin antibodies were chemically anchored to the gold-coated gate area of the HEMT and immobilized with thioglycolic acid. The potential difference that occurs from the vitellogenin antigen-antibody interaction-induced caused a drain current change in the HEMT. The HEMT sensor was tested for vitellogenin detection both in phosphate buffer saline and largemouth bass serum.

  2. MORPHOLOGICAL AND ELECTROPHYSIOLOGICAL STUDIES OF HORIZONTAL CELLS IN THE BLACK BASS RETINA(Issue Commemorating the Directorship of Prof. Yoko HASHIMOTO, at the Department of Physiology)

    OpenAIRE

    UMINO, Osamu; MAEHARA, Michiyo; HASHIMOTO, Yoko; 海野, 修; 前原, 通代; 橋本, 葉子

    1997-01-01

    The purpose of this study is to examine the correlation between the morphological characteristics and spectral responses of horizontal cells in black bass retina. Three layers of horizontal cell bodies and one layer of fine processes of horizontal cell axons were recognized in the horizontal cell layer. The most distally layered H1 cells were smaller than the H2 cells which form the second layer. Both H1 and H2 cells showed a monophasic spectral response with a maximum peak for red light. In ...

  3. Studies on the nutrition of spotted sand bass, Paralabrax maculatofasciatus. Effect of the dietary protein level on growth and protein utilization in juveniles fed semipurified diets

    OpenAIRE

    Anguas Vélez, Benjamín H.; Civera Cerecedo, Roberto; Cadena Roa, Marco; Guillaume, Juan; Martínez Díaz, Sergio Francisco

    2000-01-01

    Two feeding trials were conducted to determine the digestibility of a casein-based semi­purified diet and the effects of different protein levels on growth and protein use of spotted sand bass Paralabrax maculatofascÜltUs juveniles. For trial 1, a semipurified diet with vitamin­free casein as the sole source of protein was fed three times a day to apparent satiation, for a period of 20 d. Feces were collected by siphoning each tank. The digestibility of the exper­imental diet was ...

  4. Low frequency sound field control in rectangular listening rooms using CABS (Controlled Acoustic Bass System) will also reduce sound transmission to neighbor rooms

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2011-01-01

    Sound reproduction is often taking place in small and medium sized rectangular rooms. As rectangular rooms have 3 pairs of parallel walls the reflections at especially low frequencies will cause up to 30 dB spatial variations of the sound pressure level in the room. This will take place not only at...... resonance frequencies, but more or less at all frequencies. A time based room correction system named CABS (Controlled Acoustic Bass System) has been developed and is able to create a homogeneous sound field in the whole room at low frequencies by proper placement of multiple loudspeakers. A normal setup...

  5. Modification of fillet composition and evidence of differential fatty acid turnover in sunshine bass Morone chrysops x M. saxatilis following change in dietary lipid source.

    Science.gov (United States)

    Lane, Ryan L; Trushenski, Jesse T; Kohler, Christopher C

    2006-11-01

    Marine oil-based finishing diets have been used to restore fillet FA profile in several "medium-fat" fleshed aquaculture species, and a simple dilution model describing FA turnover has been established to predict and tailor final fillet composition. We evaluated finishing diet efficacy and suitability of the dilution model to describe patterns of FA change in a lean-fleshed model, sunshine bass. Two practical diets (45% crude protein, 15% crude lipid) were formulated, respectively containing corn oil (CO) or menhaden oil (MO) as the primary lipid sources. Sunshine bass (age 1 [approximately 14 mo], 347 +/- 8.6 g, mean individual weight +/- SEM) were stocked in a recirculating system and fed the diets according to different feeding regimens during the final 28 wk of the production cycle. Control groups were fed the CO or the MO feeds exclusively; whereas, the remaining treatment groups were transitioned from the CO diet to the MO diet at 4-, 8-, or 12-wk intervals. Upon completion of the feeding trial, fish were harvested, and production performance and fillet composition were assessed. Replacing MO with CO as the primary lipid source in sunshine bass diets yielded fillets with distinctly different FA profiles; however, finishing with a MO-based diet offered significant compensation for CO-associated reductions in fillet long-chain highly unsaturated FA (LC-HUFA). Although complete restoration was not observed, we achieved significant augmentation of endogenous n-3 FA within 4 wk of feeding the MO diet, and observed a significant increase in LC-HUFA and a beneficial shift in n-3:n-6 FA ratio after 8 weeks. Simple dilution accurately predicted tissue composition for most FA; however, deviations from the model were noted, suggesting selective retention of n-3, PUFA, and LC-HUFA and preferential catabolism of saturates. We conclude marine oil-based finishing diets can rapidly augment beneficial FA levels in sunshine bass fillets; however, simple dilution models do not

  6. Report of the Inter-Benchmark Protocol on New Species (Turbot and Sea bass ; IBPNew 2012). 1-5 October 2012 Copenhagen, Denmark

    OpenAIRE

    ICES

    2012-01-01

    Inter-Benchmark Workshop on NEW species (IBPNEW) met in Copenhagen (Den-mark) from 1–5 October 2012 to perform a benchmark assessment on the stocks of turbot and sea bass. All the terms of reference were addressed. In hindsight, the five days that were available for this workshop were too short. Although most work re-garding the ToRs was finished before the end of the workshop, large parts of the report still needed to be finished at the end of the meeting, and this caused consider-able delay...

  7. Ovary transcriptome profiling via artificial intelligence reveals a transcriptomic fingerprint predicting egg quality in striped bass, Morone saxatilis.

    Directory of Open Access Journals (Sweden)

    Robert W Chapman

    Full Text Available Inherited gene transcripts deposited in oocytes direct early embryonic development in all vertebrates, but transcript profiles indicative of embryo developmental competence have not previously been identified. We employed artificial intelligence to model profiles of maternal ovary gene expression and their relationship to egg quality, evaluated as production of viable mid-blastula stage embryos, in the striped bass (Morone saxatilis, a farmed species with serious egg quality problems. In models developed using artificial neural networks (ANNs and supervised machine learning, collective changes in the expression of a limited suite of genes (233 representing 90% of the eventual variance in embryo survival. Egg quality related to minor changes in gene expression (<0.2-fold, with most individual transcripts making a small contribution (<1% to the overall prediction of egg quality. These findings indicate that the predictive power of the transcriptome as regards egg quality resides not in levels of individual genes, but rather in the collective, coordinated expression of a suite of transcripts constituting a transcriptomic "fingerprint". Correlation analyses of the corresponding candidate genes indicated that dysfunction of the ubiquitin-26S proteasome, COP9 signalosome, and subsequent control of the cell cycle engenders embryonic developmental incompetence. The affected gene networks are centrally involved in regulation of early development in all vertebrates, including humans. By assessing collective levels of the relevant ovarian transcripts via ANNs we were able, for the first time in any vertebrate, to accurately predict the subsequent embryo developmental potential of eggs from individual females. Our results show that the transcriptomic fingerprint evidencing developmental dysfunction is highly predictive of, and therefore likely to regulate, egg quality, a biologically complex trait crucial to reproductive fitness.

  8. High contaminant loads in Lake Apopka's riparian wetland disrupt gene networks involved in reproduction and immune function in largemouth bass.

    Science.gov (United States)

    Martyniuk, Christopher J; Doperalski, Nicholas J; Prucha, Melinda S; Zhang, Ji-Liang; Kroll, Kevin J; Conrow, Roxanne; Barber, David S; Denslow, Nancy D

    2016-09-01

    Lake Apopka (FL, USA) has elevated levels of some organochlorine pesticides in its sediments and a portion of its watershed has been designated a US Environmental Protection Agency Superfund site. This study assessed reproductive endpoints in Florida largemouth bass (LMB) (Micropterus salmoides floridanus) after placement into experimental ponds adjacent to Lake Apopka. LMB collected from a clean reference site (DeLeon Springs) were stocked at two periods of time into ponds constructed in former farm fields on the north shore of the lake. LMB were stocked during early and late oogenesis to determine if there were different effects of contamination on LMB that may be attributed to their reproductive stage. LMB inhabiting the ponds for ~4months had anywhere from 2 to 800 times higher contaminant load for a number of organochlorine pesticides (e.g. p, p'-DDE, methoxychlor) compared to control animals. Gonadosomatic index and plasma vitellogenin were not different between reproductively-stage matched LMB collected at reference sites compared to those inhabiting the ponds. However, plasma 17β-estradiol was lower in LMB inhabiting the Apopka ponds compared to ovary stage-matched LMB from the St. Johns River, a site used as a reference site. Sub-network enrichment analysis revealed that genes related to reproduction (granulosa function, oocyte development), endocrine function (steroid metabolism, hormone biosynthesis), and immune function (T cell suppression, leukocyte accumulation) were differentially expressed in the ovaries of LMB placed into the ponds. These data suggest that (1) LMB inhabiting the Apopka ponds showed disrupted reproduction and immune responses and that (2) gene expression profiles provided site-specific information by discriminating LMB from different macro-habitats. PMID:27397556

  9. Age, growth, mortality, and reproduction of Roughtongue bass, Pronotogrammus martinicensis 9Serranidae), in the northeastern Gulf of Mexico

    Science.gov (United States)

    McBride, Richard S.; Sulak, Kenneth J.; Thurman, Paul E.; Richardson, Adam K.

    2009-01-01

    The inaccessibility of outer continental shelf reefs has made it difficult to investigate the biology of Pronotogrammus martinicensis, a small sea bass known to be numerous and widely distributed in such habitat. This study takes advantage of a series of cruises in the northeastern Gulf of Mexico that collected 1,485 individuals. Fish were collected over or in the vicinity of reef habitats with hook and line, otter trawl, and rotenone. We present a preliminary validation of an otolith ageing method and report that P. martinicensis reached a maximum size of 143 mm standard length (SL), grew to about 50% of this size within their first year, and lived to a maximum age of 15 yr. Size at age data (n = 490) fitted to the von Bertalanffy growth model yielded the predictive equation: SLt = 106.3(1 2 e [20.641{t20.646}]), where t = age in years. Gonad histology (n = 333) was examined to confirm that P. martinicensis is a protogynous, monandric hermaphrodite. We found no evidence of simultaneous hermaphroditism, which had been tentatively proposed in a previous study. Most P. martinicensis matured as females in their second year (age 1), primary oocytes developed asynchronously into secondary oocytes, and females were batch spawners. Males were postmaturational. Seminiferous tissue formed as early as age 1, but, although the rate of sex change is unknown, most fish did not function as a male until age 3 or age 4. These data provide age-based benchmarks of a common reef fish species living on the outer continental shelf of the tropical western North Atlantic Ocean.

  10. The use of green pea (Pisum sativum as alternative protein source for fish meal in diets for Asian sea bass, Lates calcarifer

    Directory of Open Access Journals (Sweden)

    Erlinda S. Ganzon-Naret

    2013-07-01

    Full Text Available A 12-week feeding trial was conducted to investigate the effect of green pea P. sativum asalternative protein source for fish meal on the growth performance, feed utilization and phosphorusexcretion for Asian sea bass, Lates calcarifer. Four isonitrogenous (40% crude protein and isolipidic(10% lipid diets were prepared with the increasing substitution levels of green pea (GP for fish meal(FM at 0% (P0, 10% (P10, 20% (P20 and 30% (P30 with corresponding dietary protein levels at 0,2.6, 5.2 and 7.8% respectively in a 40% protein diet. The weight gain (WG of fish (19.69 g fed P0 diet(control without GP meal was comparable to fish fed P10 diet (17.75 g but significantly (p 0.05 werefound in the percentage of lipid among the different treatments. The peak time for phosphorus excretionwas observed after the first feeding at the end of 8 hrs. Fish fed P0 diet had the highest phosphorusexcretion which was attributed to its high level of FM component whereas fish fed P30 diet had thelowest. It appears that green pea can replace fish meal at the level of 10% in diets for sea bass withoutadverse effects on growth, feed utilization or body composition and this may also contribute toenvironmental protection as well as reduce feed cost to sustain aquaculture.

  11. Are endocrine and reproductive biomarkers altered in contaminant-exposed wild male Largemouth Bass (Micropterus salmoides) of Lake Mead, Nevada/Arizona, USA?

    Science.gov (United States)

    Goodbred, Steven L; Patiño, Reynaldo; Torres, Leticia; Echols, Kathy R; Jenkins, Jill A; Rosen, Michael R; Orsak, Erik

    2015-08-01

    Male Largemouth Bass were sampled from two locations in Lake Mead (USA), a site influenced by treated municipal wastewater effluent and urban runoff (Las Vegas Bay), and a reference site (Overton Arm). Samples were collected in summer (July '07) and spring (March '08) to assess general health, endocrine and reproductive biomarkers, and compare contaminant body burdens by analyzing 252 organic chemicals. Sperm count and motility were measured in spring. Contaminants were detected at much higher frequencies and concentrations in fish from Las Vegas Bay than Overton Arm. Those with the highest concentrations included PCBs, DDTs, PBDEs, galaxolide, and methyl triclosan. Fish from Las Vegas Bay also had higher Fulton condition factor, hepatosomatic index, and hematocrit, and lower plasma 11-ketotestosterone concentration (KT). Gonadosomatic index (GSI) and sperm motility did not differ between sites, but sperm count was lower by nearly 50% in fish from Las Vegas Bay. A positive association between KT and GSI was identified, but this association was nonlinear. On average, maximal GSI was reached at sub-maximal KT concentrations. In conclusion, the higher concentration of contaminant body burdens coupled with reduced levels of KT and sperm count in fish from Las Vegas Bay suggest that male reproductive condition was influenced by contaminant exposures. Also, the nonlinear KT-GSI association provided a framework to understand why GSI was similar between male bass from both sites despite their large difference in KT, and also suggested the existence of post-gonadal growth functions of KT at high concentrations. PMID:25733205

  12. Ecological characterization of two species of exotic fish, pumpkinseed sunfish (Lepomis gibbosus and largemouth bass (Micropterus salmoides in the international Minho river

    Directory of Open Access Journals (Sweden)

    Ana Cristina Lages

    2015-11-01

    Full Text Available The introduction of exotic species is considered the main cause for the decline of native species. The largemouth bass (Micropterus salmoides and pumpkinseed sunfish (Lepomis gibbosus are two native species from North America, introduced in Portugal to enhance sport fishing. However, their diet and great adaptability made them considered predatory and harmful. In order to understand the ecological impact of M. salmoides and L. gibbosus in the international section of the Minho River, three sampling sites were selected: two in Vila Nova de Cerveira and one in Lapela, at distance of the mouth of the river of 17 and 45 Km, respectively. The fish were gathered using fyke nets and trammel nets, electric fishing and fishing rod, with performed samplings since July 2014 until October 2015. For all fish caught the biometric data (weight, total and fork length, gonad and liver weight, sex, stomach contents analysis were registered as well as collection of otoliths and scales for age reading. Both species feed on small macroinvertebrates specially the juveniles while adults of largemouth bass and pumpkinseed sunfish prefer eat fish and gastropods, respectively. Because L. gibbosus is a recent introduction in the Minho river estuary its abundance increased a lot in the last two years and it was possible verify the increase of the fish population average length. With this work it is intended to evaluate the impact in the Minho River estuary of both exotic species studying the population structure, trophic webs and reproduction.

  13. High prevalence of buccal ulcerations in largemouth bass, Micropterus salmoides (Centrarchidae from Michigan inland lakes associated with Myzobdella lugubris Leidy 1851 (Annelida: Hirudinea

    Directory of Open Access Journals (Sweden)

    Faisal M.

    2011-02-01

    Full Text Available Widespread mouth ulcerations were observed in largemouth bass collected from eight inland lakes in the Lower Peninsula of Michigan during the summer months of 2002 and 2003. These ulcerations were associated with, and most likely caused by, leech parasitism. Through the use of morphological dichotomous keys, it was determined that all leeches collected are of one species: Myzobdella lugubris. Among the eight lakes examined, Lake Orion and Devils Lake had the highest prevalence of leech parasitism (34% and 29%, respectively and mouth ulcerations (53% and 68%, respectively. Statistical analyses demonstrated that leech and ulcer prevalence varied significantly from one lake to the other. Additionally, it was determined that the relationship between the prevalence of ulcers and the prevalence of leech attachment is significant, indicating that leech parasitism is most likely the cause of ulceration. The ulcers exhibited deep hemorrhagic centers and raised irregular edges. Affected areas lost their epithelial lining and submucosa, with masses of bacteria colonizing the damaged tissues. Since largemouth bass is a popular global sportfish and critical to the food web of inland lakes, there are concerns that the presence of leeches, damaged buccal mucosa, and general unsightliness may negatively affect this important sportfishery.

  14. Denitrification rates in marsh soils and hydrologic and water quality data for Northeast Creek and Bass Harbor Marsh watersheds, Mount Desert Island, Maine

    Science.gov (United States)

    Huntington, Thomas G.; Culbertson, Charles W.; Duff, John H.

    2011-01-01

    Nutrient enrichment from atmospheric deposition, agricultural activities, wildlife, and domestic sources is a concern at Acadia National Park because of the potential problem of water-quality degradation and eutrophication in estuaries. Water-quality degradation has been observed at the park's Bass Harbor Marsh estuary but minimal degradation is observed in Northeast Creek estuary. Previous studies at Acadia National Park have estimated nutrient inputs to estuaries from atmospheric deposition and surface-water runoff, and have identified shallow groundwater as an additional potential nutrient source. Previous studies at Acadia National Park have assumed that a certain fraction of the nitrogen input was removed through microbial denitrification, but rates of denitrification (natural or maximum potential) in marsh soils have not been determined. The U.S. Geological Survey, in cooperation with Acadia National Park, measured in situ denitrification rates in marsh soils in Northeast Creek and Bass Harbor Marsh watersheds during the summer seasons of 2008 and 2009. Denitrification was measured under ambient conditions and following inorganic nitrogen and glucose additions. Laboratory incubations of marsh soils with and without acetylene were conducted to determine average ratios of nitrous oxide (N2O) to nitrogen (N2) produced during denitrification. Surface water and groundwater samples were analyzed for nutrients, specific conductance, temperature, and dissolved oxygen. Water level was recorded continuously during the growing season in Fresh Meadow Marsh in the Northeast Creek Watershed.

  15. EFFECT OF FISH-MEAL REPLACEMENT WITH POULTRY BY-PRODUCT MEAL ON THE GROWTH, TISSUE COMPOSITION AND HEMATOLOGICAL PARAMETERS OF LARGEMOUTH BASS (MICROPTERUS SALMOIDES) FED DIETS CONTAINING DIFFERENT LIPIDS

    Science.gov (United States)

    We previously showed that growth of largemouth bass (LMB) fed a diet containing different lipid (canola, chicken, or fish oil) or combination of lipids (canola + chicken oil (1:1) or menhaden fish oil + chicken oil (1:1)) was comparable to growth of LMB fed a commercial trout diet when protein in th...

  16. Regulation of endocrine and paracrine sources of insulin-like growth factors and growth hormone receptor during compensatory growth in hybrid striped bass (Morone chrysops x Morone saxatilis)

    DEFF Research Database (Denmark)

    Picha, Matthew E; Turano, Marc J; Tipsmark, Christian K; Borski, Russell J

    2008-01-01

    Compensatory growth (CG) is a period of growth acceleration that exceeds normal rates after animals are alleviated of certain growth-stunting conditions. In hybrid striped bass (HSB, Morone chrysops x M. saxatilis), 3 weeks of complete feed restriction results in a catabolic state that, when...

  17. The influence of protein and energy density in commercial diets on growth, body composition, and nutrient retention of sunshine bass Morone chrysops x Morone saxatilis reared at extreme temperature

    Science.gov (United States)

    Three growth trials were conducted with juvenile sunshine bass reared at temperatures typical of winter or summer pond culture in the Southeastern United States. The trials were designed to determine if there was an advantage to feeding a commercial high-protein/high-fat diet during winter and a lo...

  18. A comparison of two fecal collection methods for protein and amino acid digestibility coefficients for menhaden fish meal and two grades of pultry-by-product meals in market-size sunshine bass (Morone chrysops X M. saxatilis)

    Science.gov (United States)

    Apparent digestibility and availability coefficients for protein and amino acids in menhaden fish meal (MEN), pet-food grade (PBM-pet,) and feed-grade poultry by-product meal (PBM-feed) were determined for market-size (500 g) sunshine bass using passive netting or manual stripping of feces. A refer...

  19. A comparison of mercury burdens between St. Marks National Wildlife Refuge and St. Andrew Bay, Florida: Evaluation of fish body burdens and physiological responses in largemouth bass, spotted seatrout, striped mullet, and sunfish

    Science.gov (United States)

    Huge, D.H.; Rauschenberger, R.H.; Wieser, F.M.; Hemming, J.M.

    2011-01-01

    Musculature from the dorsal region of 130 largemouth bass (Micropterus salmoides), 140 sunfish (Lepomis sp.), 41 spotted seatrout (Cynoscion nebulosus) and 67 striped mullet (Mugil cephalus) were collected from five estuarine and five freshwater sites within the St. Marks National Wildlife Refuge and two estuarine and two freshwater sites from St. Andrew Bay, Florida, United States of America. Musculature was analyzed for total mercury content, sagittal otoliths were removed for age determination and physiological responses were measured. Largemouth bass and sunfish from the refuge had higher mercury concentrations in musculature than those from the bay. Male spotted seatrout, male striped mullet, male and female sunfish and female largemouth bass had mercury burdens positively correlated with length. The majority of all four species of fish from both study areas contained mercury levels below 1.5 part per million, the limit for safe consumption recommended the Florida Department of Health. In comparison, a significant percentage of largemouth bass and sunfish from several sampled sites, most notably Otter Lake and Lake Renfroe within St. Marks National Wildlife Refuge, had mercury levels consistent with the health department's guidelines of 'limited consumption' or 'no consumption guidelines.'

  20. Efficacy of florfenicol, copper sulfate and potassium permanganate in controlling a natural infection of Aeromonas hydrophila and Flavobacterium columnare in sunshine bass, Morone chrysops female x Morone saxatilis male

    Science.gov (United States)

    Sunshine bass (Morone chrysops female ' Morone saxatilis male) naturally infected with Aeromonas hydrophila and Flavobacterium columnare were randomly assigned to six treatments: 1) two treatments of waterborne exposures to copper sulfate (CuSO4), at 2.1 and at 4.2 mg/L (approximately one and two pe...

  1. Isolation of TDA-producing Phaeobacter strains from sea bass larval rearing units and their probiotic effect against pathogenic Vibrio spp. in Artemia cultures

    DEFF Research Database (Denmark)

    Grotkjær, Torben; Bentzon-Tilia, Mikkel; D'Alvise, Paul;

    2016-01-01

    V. harveyi, which is the major bacterial pathogen in crustaceans and Mediterranean sea bass larvae cultures. Concomitantly, they significantly improved survival of V. harveyi-infected brine shrimp. 16S rRNA gene sequence homology identified the antagonists as Phaeobacter sp., and in silico DNA...

  2. A digital terrain model of bathymetry and shallow-zone bottom-substrate classification for Spednic Lake and estimates of lake-level-dependent habitat to support smallmouth bass persistence modeling

    Science.gov (United States)

    Dudley, Robert W.; Schalk, Charles W.; Stasulis, Nicholas W.; Trial, Joan G.

    2011-01-01

    In 2009, the U.S. Geological Survey entered into a cooperative agreement with the International Joint Commission, St. Croix River Board to do an analysis of historical smallmouth bass habitat as a function of lake level for Spednic Lake in an effort to quantify the effects, if any, of historical lake-level management and meteorological conditions (from 1970 to 2009) on smallmouth bass year-class failure. The analysis requires estimating habitat availability as a function of lake level during spawning periods from 1970 to 2009, which is documented in this report. Field work was done from October 19 to 23, and from November 2 to 10, 2009, to acquire acoustic bathymetric (depth) data and acoustic data indicating the character of the surficial lake-bottom sediments. Historical lake-level data during smallmouth bass spawning (May-June) were applied to the bathymetric and surficial-sediment type data sets to produce annual historic estimates of smallmouth-bass-spawning-habitat area. Results show that minimum lake level during the spawning period explained most of the variability (R2 = 0.89) in available spawning habitat for nearshore areas of shallow slope (less than 10 degrees) on the basis of linear correlation. The change in lake level during the spawning period explained most of the variability (R2 = 0.90) in available spawning habitat for areas of steeper slopes (10 to 40 degrees) on the basis of linear correlation. The next step in modeling historic smallmouth bass year-class persistence is to combine this analysis of the effects of lake-level management on habitat availability with meteorological conditions.

  3. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from Surface underway observations using Barometric pressure sensor, Carbon dioxide (CO2) gas analyzer and other instruments from Trans Future 5 in the Bass Strait, Coral Sea and others from 2006-06-27 to 2006-12-09 (NCEI Accession 0144357)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0144357 includes Surface underway data collected from Trans Future 5 in the Bass Strait, Coral Sea, North Pacific Ocean, Philippine Sea, Solomon Sea,...

  4. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from underway - surface observations using Carbon dioxide (CO2) gas analyzer, Shower head chamber equilibrator for autonomous carbon dioxide (CO2) measurement and other instruments from the SOUTHERN SURVEYOR in the Bass Strait, Coral Sea and others from 2008011 to 2010-10-31 (NODC Accession 0115181)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115181 includes chemical, meteorological, physical and underway - surface data collected from SOUTHERN SURVEYOR in the Bass Strait, Coral Sea, Great...

  5. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from underway - surface observations using Carbon dioxide (CO2) gas analyzer, Shower head chamber equilibrator for autonomous carbon dioxide (CO2) measurement and other instruments from the Natalie Schulte in the Bass Strait, North Pacific Ocean and others from 2010-10-01 to 2012-06-21 (NODC Accession 0108233)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0108233 includes chemical, meteorological, physical and underway - surface data collected from Natalie Schulte in the Bass Strait, North Pacific...

  6. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from underway - surface observations using Carbon dioxide (CO2) gas analyzer, Shower head chamber equilibrator for autonomous carbon dioxide (CO2) measurement and other instruments from the Trans Future 5 in the Bass Strait, Coral Sea and others from 2006-06-27 to 2011-08-05 (NODC Accession 0081048)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0081048 includes chemical, meteorological, physical and underway - surface data collected from Trans Future 5 in the Bass Strait, Coral Sea, Inland...

  7. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from Surface underway observations using Barometric pressure sensor, Carbon dioxide (CO2) gas analyzer and other instruments from Trans Future 5 in the Bass Strait, Coral Sea and others from 2012-01-16 to 2012-12-07 (NCEI Accession 0144347)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0144347 includes Surface underway data collected from Trans Future 5 in the Bass Strait, Coral Sea, East China Sea (Tung Hai), Inland Sea (Seto...

  8. Production vivrière et accès à la terre dans un village de basse Côte d'Ivoire

    OpenAIRE

    Biarnès, Anne; Colin, Jean-Philippe

    1987-01-01

    Cet article présente les systèmes de culture vivriers pratiqués dans un village en basse Côte d'Ivoire et quelques-uns de leurs déterminants. Sont d'abord évoquées les modalités de l'insertion spatiale des cultures vivrières dans l'agriculture de plantation; puis, après la présentation d'une typologie des systèmes de culture vivriers, sont analysées la fonction économique des principales cultures (autoconsommation ou vente) et l'incidence des contraintes culturales et foncières sur la product...

  9. Implementation of a non-lethal biopsy punch monitoring program for mercury in smallmouth bass, Micropterus dolomieu Lacepède, from the Eleven Point River, Missouri

    Science.gov (United States)

    Ackerson, J.R.; Schmitt, C. J.; McKee, M.J.; Brumbaugh, W.G.

    2013-01-01

    A non-lethal biopsy method for monitoring mercury (Hg) concentrations in smallmouth bass (Micropterus dolomieu; smallmouth) from the Eleven Point River in southern Missouri USA was evaluated. A biopsy punch was used to remove a muscle tissue plug from the area immediately below the anterior dorsal fin of 31 smallmouth. An additional 35 smallmouth (controls) were held identically except that no tissue plug was removed. After sampling, all fish were held in a concrete hatchery raceway for 6 weeks. Mean survival at the end of the holding period was 97 % for both groups. Smallmouth length, weight and Fulton’s condition factor at the end of the holding period were also similar between plugged and non-plugged controls, indicating that the biopsy procedure had minimal impact on growth under these conditions. Tissue plug Hg concentrations were similar to smallmouth Hg data obtained in previous years by removing the entire fillet for analysis.

  10. Molecular Characterization and Functional Regulation of Melanocortin 2 Receptor (MC2R) in the Sea Bass. A Putative Role in the Adaptation to Stress

    Science.gov (United States)

    Agulleiro, Maria Josep; Sánchez, Elisa; Leal, Esther; Cortés, Raúl; Fernández-Durán, Begoña; Guillot, Raúl; Davis, Perry; Dores, Robert M.; Gallo-Payet, Nicole; Cerdá-Reverter, José Miguel

    2013-01-01

    The activation of melanocortin 2 receptor (MC2R) by ACTH mediates the signaling cascade leading to steroid synthesis in the interrenal tissue (analogous to the adrenal cortex in mammals) of fish. However, little is known about the functional regulation of this receptor in fish. In this work described, we cloned sea bass MC2R from a liver cDNA. SbMC2R requires the melanocortin 2 receptor accessory protein (MRAP) for its functional expression. Dietary cortisol but not long-term stress protocols downregulated interrenal sbMC2R expression. Data suggest the existence of a negative feedback on interrenal sbMC2R expression imposed by local or systemic glucocorticoids. This feedback could be involved in long-term stress adaptation by regulating interrenal sensitivity to ACTH. ACTH-induced MC2R activation stimulates hepatic lipolysis, suggesting that ACTH may mediate stress-induced effects upstream of cortisol release. PMID:23724142

  11. Differential regulation of cystic fibrosis transmembrane conductance regulator and Na+,K+ -ATPase in gills of striped bass, Morone saxatilis: effect of salinity and hormones

    DEFF Research Database (Denmark)

    Madsen, Steffen; Jensen, Lars Nørholm; Tipsmark, Christian Kølbaek;

    2007-01-01

    Effects of salinity and hormones on cystic fibrosis transmembrane conductance regulator (CFTR) and alpha-subunit Na(+),K(+) -ATPase (alpha-NKA) mRNA (analysed by semi-quantitative PCR) and protein expression (analysed by western blotting and immunocytochemistry) were investigated in gills of...... striped bass. Freshwater (FW) to seawater (SW) transfer induced a disturbance in serum [Na(+)]. Gill CFTR protein, mRNA level and Na(+),K(+) -ATPase activity were unaffected by SW transfer, whereas alpha-NKA mRNA increased after transfer. CFTR immunoreactivity was observed in large cells in FW and SW gill...... filaments at equal intensity. Cortisol decreased serum [Na(+)] in FW fish, but had no effect on gill Na(+),K(+) -ATPase activity, alpha-NKA and CFTR mRNA levels. Incubation of gill tissue with cortisol (24 h, >0.01 micro g/ml) and epidermal growth factor (EGF 10 micro g/ml) decreased CFTR mRNA levels...

  12. Analysis of EST database for two subspecies of largemouth bass%大口黑鲈两个亚种EST数据库分析

    Institute of Scientific and Technical Information of China (English)

    景燕娟; 白俊杰; 李胜杰; 于凌云; 蔡磊

    2012-01-01

    应用新一代高通量测序技术Roche 454对大口黑鲈(Micropterus salmoides)北方亚种和佛罗里达亚种进行转录组测序并建立ESTs数据库,结果得到北方亚种ESTs序列468 671条,佛罗里达亚种ESTs序列332 322条,两亚种ESTs序列的平均长度分别为306.5bp和304.4bp。将得到的高质量序列进行拼接,大口黑鲈北方亚种和佛罗里达亚种共得到contig序列总数分别为42 056条和35 743条,平均长度分别为612.6bp和588.2bp。将大口黑鲈北方亚种和佛罗里达亚种的数据库合并,通过与蛋白数据库比对后,共78 938条EST序列被注释,根据Gene Ontology(GO)信息,对序列按照分子功能、细胞组成、生物学过程进行分类。通过对大口黑鲈合并的EST库信息进行大通量SSR和SNP位点的发掘,发现了含SSRs和SNPs的序列分别为25 469和8 547条。从EST数据库中随机选取75条contigs进行北方亚种和佛罗里达亚种的序列比较,结果表明两个亚种EST序列同源性为99.2%。%In this study,Roche 454 high-throughput technology was used to conduct transcriptome sequencing and establish ESTs database of the largemouth bass northern subspecies and Florida subspecies.The results showed that a total of 468 671 and 332 322 ESTs were generated from northern subspecies and Florida subspecies.The average length was 306.5 bp and 304.4 bp,respectively.Assembly of the largemouth bass northern subspecies and Florida subspecies' high quality ESTs resulted in 42 056 and 35 743 contigs.The average length was 612.6 bp and 588.2 bp,respectively.EST database of largemouth bass northern subspecies and Florida subspecies was merged and then compared with known protein databases.78 938 EST sequences in total were annotated.By exploring the merged largemouth bass EST library,over 25 469 and 8 547 putative SSRs and SNPs were identified.Comparison of the northern subspecies and Florida subspecies sequence was made by randomly selecting 75 contigs from

  13. Anoplastie périnéale simple pour le traitement des malformations anorectales basses chez l'adulte, à propos de deux cas

    OpenAIRE

    Abdelmoughit ECHCHAOUI; Benyachou, Malika; Hafidi, Jawad; Fathi, Nahed; Mohammadine, Elhamid; ELmazouz, Samir; Gharib, Nour-eddine; Abbassi, Abdellah

    2014-01-01

    Les malformations anorectales chez l'adulte sont des anomalies congénitales rares du tube digestif qui prédominent chez le sexe féminin. Notre étude porte sur deux observations de malformation anorectale basses vues et traitées au stade adulte par les 2 équipes (plasticiens et viscéralistes) à l'Hôpital Avicenne à Rabat. Il s'agit d'un homme de 24 ans avec une dyschésie anale l'autre cas est une femme de 18 ans avec une malformation anovulvaire Les caractéristiques cliniques combinées avec le...

  14. Étude des performances du télescope gamma Fermi à basse énergie et impact sur la science

    OpenAIRE

    Desgardin, Thibaut

    2015-01-01

    Le satellite \\textit{Fermi}, lancé en juin 2008 par la NASA, observe le ciel dans le domaine des hautes énergies. Son instrument principal: le \\textit{Large Area Telescope} (LAT), récolte des données à partir de $\\sim 20$ MeV jusqu'à plus de 300 GeV. Une amélioration majeure de ses algorithmes a permis récemment la mise à disposition d'un nouveau jeu de données, Pass 8. Pass 8 jette un nouvel éclairage sur le domaine méconnu de la basse énergie (E

  15. Contribution à la conception de circuits intégrés analogiques en technologie CMOS basse tension pour application aux instruments d'observation de la Terre

    OpenAIRE

    Standarovski, Denis

    2005-01-01

    Le présent mémoire de thèse s'inscrit dans la problématique d'intégration de chaînes pour traitement du signal vidéo issu d'un capteur CCD dédiées aux instruments d'observation de la Terre. La solution présentée à travers cette étude consiste à concevoir des circuits intégrés spécifiques (ASIC) analogiques avec des technologies CMOS sub-microniques basse-tension, principalement développées pour les circuits numériques complexes. Dans une première partie, nous présentons le contexte de l'étude...

  16. Implementation of a non-lethal biopsy punch monitoring program for mercury in smallmouth bass, Micropterus dolomieu Lacepède, from the Eleven Point River, Missouri.

    Science.gov (United States)

    Ackerson, J R; McKee, M J; Schmitt, C J; Brumbaugh, W G

    2014-02-01

    A non-lethal biopsy method for monitoring mercury (Hg) concentrations in smallmouth bass (Micropterus dolomieu; smallmouth) from the Eleven Point River in southern Missouri USA was evaluated. A biopsy punch was used to remove a muscle tissue plug from the area immediately below the anterior dorsal fin of 31 smallmouth. An additional 35 smallmouth (controls) were held identically except that no tissue plug was removed. After sampling, all fish were held in a concrete hatchery raceway for 6 weeks. Mean survival at the end of the holding period was 97 % for both groups. Smallmouth length, weight and Fulton's condition factor at the end of the holding period were also similar between plugged and non-plugged controls, indicating that the biopsy procedure had minimal impact on growth under these conditions. Tissue plug Hg concentrations were similar to smallmouth Hg data obtained in previous years by removing the entire fillet for analysis. PMID:24196376

  17. Effet des additifs sur la structure cristalline du polyéthylène à basse densité (PEBD) irradiés par des rayonnements UV

    OpenAIRE

    Cheloufi T; Berranem M; Gasmi A; Benaissa S

    2014-01-01

    L’effet des rayons U V sur les propriétés physico-chimiques et mécaniques du polyéthylène à basse densité (PEBD) et pigmenté avec des additifs dans différentes formulations ont été étudiées. Les échantillons ont été exposés au rayonnement U V émis par une lampe à xénon d’une puissance de 6000 W à une température de 46 °C pour différents temps. Un échantillon de référence a été pris pour la comparaison. A l’aide de la spectroscopie infrarouge FTIR et l’essai de traction, on a pu suivre les cha...

  18. Cristallisation du polyéthylène basse densité : mesures rhéologiques et calorimétriques

    OpenAIRE

    Peiti, Christian; Vergnes, Bruno; Haudin, Jean-Marc

    2008-01-01

    Deux polyéthylènes basse densité, obtenus par procédé tubulaire et procédé autoclave, ont été caractérisés par chromatographie d'exclusion stérique. Leur masse molaire moyenne en masse est sensiblement identique, mais le matériau autoclave présente une queue de plus fortes masses. Ceci induit des différences notables sur les conditions de cristallisation. Les mesures de spectrométrie mécanique effectuées en fréquence et température mettent en évidence que le facteur de glissement suit une loi...

  19. Isolation and characterization of Ff1 and Gsdf family genes in European sea bass and identification of early gonadal markers of precocious puberty in males.

    Science.gov (United States)

    Crespo, Berta; Gómez, Ana; Mazón, María José; Carrillo, Manuel; Zanuy, Silvia

    2013-09-15

    Puberty represents the transition from an immature to a mature reproductive stage. The mechanisms underlying the onset of normal or precocious puberty have not yet been elucidated. With the goal of gaining an understanding of early events that occur in the testes of precocious animals during this process, a hemigonadectomy was performed on male juvenile sea bass and expression levels of candidate mRNAs were determined through quantitative real-time RT-PCR. For this purpose, the gonadal soma-derived factors gsdf1 and gsdf2, the nuclear receptor 5 subfamily members nr5a1a (ff1b), nr5a1b (ff1d), nr5a2 (ff1a) and nr5a5 (ff1c) and the proliferating cell nuclear antigen or pcna, genes with a putative role in the beginning of spermatogenesis, were isolated and cloned. Hemigonadectomy proved to be a suitable strategy for the study of gonadal stages prior to the appearance of histological differences between precocious and non-precocious fish, as it allowed the subsequent classification of these gonads. The upregulation of the gene encoding the steroidogenic acute regulatory protein (Star) in precocious testes indicates that sex steroids could play a role in the onset of spermatogenesis in sea bass. In contrast, the downregulation observed in ff1b expression indicates that this initial surge in star expression is not the result of Ff1b transactivation, suggesting an alternative pathway for this transcriptional activation. Finally, a decrease in gsdf1 expression in precocious animals suggests that this gene may play a role in the onset of puberty, while its correlation with ff1b expression points to gsdf1 as a putative target for Ff1b-mediated transactivation. PMID:23791759

  20. Isolation of TDA-producing Phaeobacter strains from sea bass larval rearing units and their probiotic effect against pathogenic Vibrio spp. in Artemia cultures.

    Science.gov (United States)

    Grotkjær, Torben; Bentzon-Tilia, Mikkel; D'Alvise, Paul; Dourala, Nancy; Nielsen, Kristian Fog; Gram, Lone

    2016-05-01

    Fish-pathogenic Vibrio can cause large-scale crashes in marine larval rearing units and, since the use of antibiotics can result in bacterial antibiotic resistance, new strategies for disease prevention are needed. Roseobacter-clade bacteria from turbot larval rearing facilities can antagonize Vibrio anguillarum and reduce mortality in V. anguillarum-infected cod and turbot larvae. In this study, it was demonstrated that antagonistic Roseobacter-clade bacteria could be isolated from sea bass larval rearing units. In addition, it was shown that they not only antagonized V. anguillarum but also V. harveyi, which is the major bacterial pathogen in crustaceans and Mediterranean sea bass larvae cultures. Concomitantly, they significantly improved survival of V. harveyi-infected brine shrimp. 16S rRNA gene sequence homology identified the antagonists as Phaeobacter sp., and in silico DNA-DNA hybridization indicated that they could belong to a new species. The genomes contained genes involved in synthesis of the antibacterial compound tropodithietic acid (TDA), and its production was confirmed by UHPLC-TOFMS. The new Phaeobacter colonized live feed (Artemia) cultures and reduced Vibrio counts significantly, since they reached only 10(4)CFUmL(-1), as opposed to 10(8)CFUmL(-1) in non-Phaeobacter treated controls. Survival of V. anguillarum-challenged Artemia nauplii was enhanced by the presence of wild type Phaeobacter compared to challenged control cultures (89±1.0% vs 8±3.2%). In conclusion, TDA-producing Phaeobacter isolated from Mediterranean marine larviculture are promising probiotic bacteria against pathogenic Vibrio in crustacean live-feed cultures for marine fish larvae. PMID:26922490

  1. The technique of autoradiography at very low temperature; Technique d'autoradiographie a tres basse temperature

    Energy Technology Data Exchange (ETDEWEB)

    Pellerin, P. [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    ferme. Le developpement a lieu a temperature ordinaire et la sensibilite de l'emulsion n'est pas appreciabdement modifiee. Cette technique permet de maintenir le bloc tres au-dessous de la temperature de congelation, des la mort de l'animal jusqu'au developpement; toute diffusion chimique est supprimee et la repartition de la substance radioactive saisie sur l'autoradiographie a l'instant exact de la mort par congelation. Des fraisages successifs permettent d'etudier la repartition de la substance radioactive, a toutes les profondeurs. L'absence d'effets pseudo-radiographiques est totale. Enfin, le renforcement des couleurs naturelles des elements anatomiques par cette tres basse temperature est considerable, ce qui permet de realigner l'autoradiographie en couleurs de le coupe processus de coloration. (auteur)

  2. Dicty_cDB: Contig-U00805-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U00805-1 no gap 803 6 3153267 3154070 PLUS 3 3 U00805 0 0 0 0 0 0 2 0 0 0 1 0 0 0 Show Co ... 4 ( FM027090 ) Dicentrarchus labrax EST, clone cDN34P 0004P 02, 5'... 34 4.8 2 ( BH149975 ) ENTQK08TR Enta ... 5_1( AB002405 |pid:none) Homo sapiens mRNA for LAK-4p , comp... 49 2e-04 BC018346_1( BC018346 |pid:none) ...

  3. FITOPLANKTONSKI SASTAV NA UZGAJALIŠTU RIBA U UVALI MASLINOVA (OTOK BRAČ)

    OpenAIRE

    SKEJIĆ, Sanda; Marasović, Ivona; NINČEVIĆ GLADAN, Živana

    2012-01-01

    Cilj ovog rada je utvrditi sastav fitoplanktona na uzgajalištu komarči (Sparus aurata) i lubina (Dicentrarchus labrax) u srednjem Jadranu. Istraživanje je provedeno u razdoblju od rujna 2005. do rujna 2006. godine na postaji smještenoj u uvali Maslinova na otoku Braču. Promatrajući cijelo istraživano razdoblje, dijatomeje su općenito prevladavale svojom brojnošću, dok su dinoflagelati bili brojniji u lipnju. Broj vrsta dijatomeja i dinoflagelata kroz istraživano razdoblje bio je sličan. Z...

  4. SASTAV FITOPLANKTONA NA UZGAJALIŠTU RIBA I ŠKOLJKAŠA U UVALI KALDONTA (OTOK CRES)

    OpenAIRE

    Tomec, M.

    2004-01-01

    Uvala Kaldonta nalazi se na jugozapadnoj obali otoka Cresa u Lošinjskom kanalu na području bez većeg utjecaja opće morske struje. U uvali su postavljena 44 plutajuća kaveza veličine 5x10 metara u kojima se uspješno proizvodi oko 70 tona morske ribe: komarča (Sparus aurata), lubin (Dicentrarchus labrax), pic (Diplodus puntazzo) i zubatac (Dentex dentex). Uz neke fizikalnokemijske pokazatelje (temperatura mora, prozirnost, salinitet), posebna je pozornost posvećena kvalitativnom sastavu mrežnog...

  5. Dicty_cDB: FC-IC0710 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 807676_1( FJ807676 |pid:none) Dicentrarchus labrax cathepsin L m... 54 2e-06 KHCH...ne proteinase [Entamoeba histolytica, HM-1, Genomic/mRNA, 933 nt]. 52 0.003 1 CD451153 |CD451153.1 USDA-FP_103216 Adult Ala...evis MGC81823 protein, m... 54 1e-06 BT050087_1( BT050087 |pid:none) Salmo salar...naqhdphcp*SLIGVWYEVQSTVRVDVGAGVVGAGVVGFGVVGAG VVGFGVVGAG--- Translated Amino Acid sequence (All Fram...b: 0.00 m_ : 0.00 48.0 %: nuclear 28.0 %: cytoplasmic 12.0 %: mitochondrial 8.0 %

  6. Dicty_cDB: FC-IC1508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t Alate Brown Citrus Aphid Toxoptera citricida cDNA clone WHWTC-42_H04 5', mRNA sequence. 52 0.011 1 AC13869...e Frame C: hi**gneiqvlhy*qmpnmirivldlllelgmksnll*elmlglvllglvllvle*lelv wlvlewlelvllvlgwlelvllvle**elxwxaigv...kssmxyw--- ---hi**gnxxqvlhy*qmpnmirivldlllexgxksnxx*xlmlglvllglvllvlx*l xlvwlvlew...precurs... 52 2e-05 FJ807676_1( FJ807676 |pid:none) Dicentrarchus labrax cathepsin L m... 52 3e-05 AY336797_...1( AY336797 |pid:none) Rhipicephalus haemaphysaloides hae... 51 3e-05 KHCHL( S000

  7. Effets de pollutions par hydrocarbures sur les capacités de défense d'organismes marins

    OpenAIRE

    Bado Nilles, Anne

    2008-01-01

    Les effets des HAPs, parmi les plus toxiques de la liste de l'Agence de Protection Environnementale Américaine, sont testés in vitro et in vivo sur deux espèces commerciales des Pertuis Charentais (Charente-Maritime, France) : le bar commun, Dicentrarchus labrax, et l'huître creuse, Crassostrea gigas. Cette étude, réalisée dans le cadre du projet européen EROCIPS, recherche de nouveaux descripteurs immunologiques d'une pollution occasionnelle par hydrocarbures. Lors d'expérimentations in vitr...

  8. The use of high rate algal ponds for the treatment of marine effluent from a recirculating fish rearing system

    OpenAIRE

    Pagand, Pascal; Blancheton, Jean-Paul; Lemoalle, J; Casellas, C.

    2000-01-01

    A high rate algal pond (HRAP) system was used to treat effluent from a recirculating sea water aquaculture system in southern France. Dicentrarchus labrax L. were farmed at a high density, with effluents containing an average of 10 mg L-1 dissolved inorganic nitrogen (DIN) and 1.3 mg L-1 reactive phosphorus (RP). On a yearly basis, the algal pond removed 59% of the dissolved nitrogen and 56% of the phosphorus input, which was converted into 3.3 kg DW m(-2) algae. Green macroalgae were dominan...

  9. KVALITETA MESA LUBINA TIJEKOM POHRANE NA LEDU

    OpenAIRE

    Bojanić, Krunoslav; Kozačinski, Lidija; Filipović, Ivana; Zdolec, Nevijo; Njari, Bela

    2009-01-01

    Cilj ovog rada bio je odrediti održivost mesa lubina tijekom njegove pohrane na ledu u trajanju od 12 dana pracenjem senzornih, fizikalno-kemijskih i mikrobioloških parametara kakvoce i higijenske ispravnosti. U tu je svrhu pretraženo 30 lubina 2., 4., 6., 9. i 12. dana pohrane na ledu na 3º C. Senzorna ocjena kvalitete ocijenjena je Quality Index Method testom (QIM) izra!enom za lubina, Dicentrarchus labrax (Icelandic Fisheries Laboratories) i Market testom. Uzorci ri...

  10. Shelf-life extension of refrigerated sea bass slices wrapped with fish protein isolate/fish skin gelatin-ZnO nanocomposite film incorporated with basil leaf essential oil.

    Science.gov (United States)

    Arfat, Yasir Ali; Benjakul, Soottawat; Vongkamjan, Kitiya; Sumpavapol, Punnanee; Yarnpakdee, Suthasinee

    2015-10-01

    Microbiological, chemical and sensory changes of sea bass slices wrapped with fish protein isolate (FPI)/fish skin gelatin (FSG) films incorporated with 3 % ZnO nanoparticles (ZnONP) (w/w, based on protein content) and 100 % basil leaf essential oil (BEO) (w/w, based on protein content) during storage of 12 days at 4 °C were investigated. Sea bass slices wrapped with FPI/FSG-ZnONP-BEO film had the lowest growth of psychrophilic bacteria, lactic acid bacteria and spoilage microorganisms including Pseudomonas , H2S-producing bacteria and Enterobacteriaceae throughout storage of 12 days in comparison with those wrapped with FPI/FSG-BEO, FPI/FSG-ZnONP, FPI/FSG film, polypropylene film (PP film) and the control (without wrapping), respectively (P control (6 days) (P < 0.05). PMID:26396365

  11. Record Of Both Tectonic Related Vertical Motions and Global Sea Level Rise by Marine Terraces along an Active Arc Volcano. Example of Basse-Terre, Lesser Antilles (French West-Indies).

    Science.gov (United States)

    Fabre, M.; Moysan, M.; Graindorge, D.; Jean-Frederic, L.; Philippon, M. M.; Marcaillou, B.; Léticée, J. L.

    2015-12-01

    Volcano-tectonic history of the Caribbean plate provides direct insight onto the dynamic of the North American Plate westward subduction. Basse-Terre Island is a volcanic chain that belongs to the Lesser Antilles active volcanic arc with a southward decreasing age of volcanism from 3 Ma to present day.We investigate records of vertical motion along Basse-Terre through a morphostructural analysis of the Pleistocene-Holocene shallow-water carbonate platforms and associated terraces that surround Basse-Terre Island. This study is based on new high-resolution bathymetric and dense seismic data acquired during the GEOTREF oceanographic survey (2015, February). Our bathymetric and topographic Digital Terrain Model together with the "Litto3D" Lidar data (IGN/SHOM) images the island topography and the platform bathymetry to a depth of 200m with horizontal and vertical resolutions of 5m and ~cm respectively. This detailed study highlights the morphostructure of terraces built during the last transgression in order to identify and quantify their vertical motions. We analyze inherited morphology and structures of the forearc that affect the platform to discuss effects of the regional tectonics context. A particular emphasis is put on the influence of the NW-SE arc parallel transtensive Montserrat-Bouillante fault system onto the platform geometry. At last, the distribution of Basse-Terre terraces is compared with terraces distribution around other Lesser Antilles island and the Bahamas stable margin platform. We aim at discriminating the influence of the Pleistocene global sea-level rise from the one of tectonic vertical deformations.

  12. Comunicato stampa della IARC N°238: "L’ ESPOSIZIONE A BASSE DOSI DI RADIAZIONI IONIZZANTI AUMENTA IL RISCHIO DI MORTE A CAUSA DI TUMORI SOLIDI". Pubblicato il 21 ottobre 2015

    OpenAIRE

    Fellone, Lucio

    2016-01-01

    Versione autorizzata in italiano del Comunicato Stampa della IARC N°238 pubblicato il 21 ottobre 2015: "L’ ESPOSIZIONE A BASSE DOSI DI RADIAZIONI IONIZZANTI AUMENTA IL RISCHIO DI MORTE A CAUSA DI TUMORI SOLIDI". Documento originale all'indirizzo: http://www.iarc.fr/en/media-centre/pr/2015/pdfs/pr238_E.pdf Authorized Italian version of the IARC Press Release N°238 published on 21 October 2015: Low doses of ionizing radiation increase risk of death from solid cancers...

  13. Branchial expression and localization of the insulin-like growth factor 1 (IGF-1) receptor and changes in plasma IGF-1 and IGF-1 binding protein in striped bass during salinity acclimation

    DEFF Research Database (Denmark)

    Tipsmark, Christian Kølbæk; Madsen, Steffen; Borski, Russell

    acclimation. In the present study, primers for the IGF type 1 receptor from striped bass (Morone saxatilis) were designed for a real-time quantitative PCR assay. Two salinity transfer experiments were performed and the time-course of gill IGF-1R expression was examined in parallel with changes in plasma IGF-1...... in the striped bass. Transfer from freshwater (FW) to seawater (SW) induced an overall increase in gill IGF-1R mRNA expression (P<0.01). Plasma IGF-1 concentration decreased significantly after SW transfer (1 and 4 days).  Transfer from SW to FW had no overall effect on gill IGF-1R expression, while...... regulation of gill ion transport in striped bass. The plasma IGF-1 responses indicate, in accordance with previous data showing a rapid negative effect of IGF-1 on SW acclimation, that IGF-1 has a role in hyperosmoregulation in this species. The increased level of IGFBP-3 in SW-acclimated fish may buffer the...

  14. Fish genomes provide novel insights into the evolution of vertebrate secretin receptors and their ligand.

    Science.gov (United States)

    Cardoso, João C R; Félix, Rute C; Trindade, Marlene; Power, Deborah M

    2014-12-01

    The secretin receptor (SCTR) is a member of Class 2 subfamily B1 GPCRs and part of the PAC1/VPAC receptor subfamily. This receptor has long been known in mammals but has only recently been identified in other vertebrates including teleosts, from which it was previously considered to be absent. The ligand for SCTR in mammals is secretin (SCT), an important gastrointestinal peptide, which in teleosts has not yet been isolated, or the gene identified. This study revises the evolutionary model previously proposed for the secretin-GPCRs in metazoan by analysing in detail the fishes, the most successful of the extant vertebrates. All the Actinopterygii genomes analysed and the Chondrichthyes and Sarcopterygii fish possess a SCTR gene that shares conserved sequence, structure and synteny with the tetrapod homologue. Phylogenetic clustering and gene environment comparisons revealed that fish and tetrapod SCTR shared a common origin and diverged early from the PAC1/VPAC subfamily group. In teleosts SCTR duplicated as a result of the fish specific whole genome duplication but in all the teleost genomes analysed, with the exception of tilapia (Oreochromis niloticus), one of the duplicates was lost. The function of SCTR in teleosts is unknown but quantitative PCR revealed that in both sea bass (Dicentrarchus labrax) and tilapia (Oreochromis mossambicus) transcript abundance is high in the gastrointestinal tract suggesting it may intervene in similar processes to those in mammals. In contrast, no gene encoding the ligand SCT was identified in the ray-finned fishes (Actinopterygii) although it was present in the coelacanth (lobe finned fish, Sarcopterygii) and in the elephant shark (holocephalian). The genes in linkage with SCT in tetrapods and coelacanth were also identified in ray-finned fishes supporting the idea that it was lost from their genome. At present SCTR remains an orphan receptor in ray-finned fishes and it will be of interest in the future to establish why SCT was

  15. PHYTOPLANKTON COMPOSITION AT THE FISH AND SHELLFISH FARM IN THE KALDONTA BAY (CRES ISLAND

    Directory of Open Access Journals (Sweden)

    Marija Tomec

    2004-12-01

    Full Text Available The Kaldonta Bay is situated at the south–western coast of the Cres island in the Lošinj channel, rather protected from larger influence of general sea water current. In the Bay there are installed 44 floating cages of 5 by 10 m dimensions. The cages are used for the culture of about 70 tons of sea water fish: gilthead sea bream (Sparus aurata, sea bass (Dicentrarchus labrax, sharp–snouted sparus (Diplodus puntazzo and dentex (Dentex dentex. Besides some physico–chemical parameters (sea water temperature, transparence and salinity, special attention has been paid to the qualitative composition of net phytoplankton. Investigations were performed in the period of May, September and December 2003 and February 2004 at five locations in the Kaldonta Bay (Figure 1 at the depths of 0.5 m, 5 m, 10 m and 1 m from the bottom. According to the physico–chemical parameters, sea water temperature was influenced by the temperature of the environment, and the transparence suggested to the oligotrophic situation in the investigated aquatorium. Qualitative composition of net phytoplankton comprised 161 microphytic species belonging to the systematic compartments of Cyanobacteria, Chrysophyta and Dinophyta (Table 1. The most numerous algal group were diatoms or Bacillarophyceae (98 species or 61%, with relative frequencies of species from 1 to 7. Taxonomic composition of diatoms showed Chaetoceros–Rhizosolenia (Proboscia to be the dominant community. Diatom species was the most abundant in late autumn period (beginning of December. The second most important comparatment were Dinophyta (55 species or 34.1%, with the dominant genera Ceratium and Protoperidinium. During the investigation, the representatives of Dinophyta did not show large variety of species in the water column. Relative frequency of the species was 1, rarely 2 and 3. Dinophyts were the most abundant in September. From Cyanobacteria (5 species or 3.1% only filamentous algae were determined

  16. 低音提琴的演奏及其效果提升的路径分析%An Analysis of the Performance and Effect Promotion Path of Double Bass

    Institute of Scientific and Technical Information of China (English)

    张晗

    2014-01-01

    低音提琴声部是管弦乐队中的一个重要的和声基础,整个管弦乐队演奏出的美妙的、立体式的音响效果,不单单是指挥、高中音乐器、打击乐器等对作品的音乐表达,而是低音提琴声部与其他高中音乐器、其他低音声部乐器等共同创造出来的。如果低音提琴的演奏效果不到位,将会直接影响整个乐队对于演奏作品的表达。从低音提琴的演奏动作及其规范问题、气息的调整与多种弓法的熟练掌握、演奏者之间的交流和专业沟通三个方面分析强化基础训练与提升演奏效果的关系,指出感知与领会乐曲是增强乐曲演奏感染力的重要环节,并从把握乐曲本身所反映的内涵和情感、将演奏者的感情融入到作品中去、增强团队精神和协奏意识等方面进行论述。%Double bass is an important basic harmony in an orchestra .A wonderful and three-dimensional sound from the whole orchestra is obtained not only by the conductor ,the treble and alto musical instru-ment and percussion instrument ,but also by a combination of the double bass with other treble ,alto and bass musical instruments .It is believed that if the double bass is not performed in place ,expression of the works will be directly affected .In this article ,the relationship between strengthening basic training and upgrading the performance effect is analyzed from three aspects :performance gesture and regulatory issues in the double bass ,breath control and proficiency in a variety of bowing and professional communication between performers .Perception and understanding play an important role in enhancement of music appeal . Moreover ,how to accurately reflect meaning and emotion of works ,how to integrate performer's senti-ment to the work and how to enhance team spirits and concerto consciousness are also discussed .

  17. Condition of larval and early juvenile Japanese temperate bass Lateolabrax japonicus related to spatial distribution and feeding in the Chikugo estuarine nursery ground in the Ariake Bay, Japan

    Science.gov (United States)

    Islam, Md. Shahidul; Hibino, Manabu; Nakayama, Kouji; Tanaka, Masaru

    2006-02-01

    The present study investigates feeding and condition of larval and juvenile Japanese temperate bass Lateolabrax japonicus in relation to spatial distribution in the Chikugo estuary (Japan). Larvae were collected in a wide area covering the nursery grounds of the species in 2002 and 2003. Food habits of the fish were analysed by examining their gut contents. Fish condition was evaluated by using morphometric (the length-weight relationship and condition factor) and biochemical (the RNA:DNA ratio and other nucleic acid based parameters) indices and growth rates. The nucleic-acid contents in individually frozen larvae and juveniles were quantified by standard fluorometric methods. Two distinct feeding patterns, determined by the distribution of prey copepods, were identified. The first pattern showed dependence on the calanoid copepod Sinocalanus sinensis, which was the single dominant prey in low-saline upper river areas. The second pattern involved a multi-specific dietary habit mainly dominated by Acartia omorii, Oithona davisae, and Paracalanus parvus. As in the gut contents analyses, two different sets of values were observed for RNA, DNA, total protein, growth rates and for all the nucleic acid-based indices: one for the high-saline downstream areas and a second for the low-saline upstream areas, which was significantly higher than the first. The proportion of starving fish was lower upstream than downstream. Values of the allometric coefficient ( b) and the condition factor ( K) obtained from the length-weight relationships increased gradually from the sea to the upper river. Clearly, fish in the upper river had a better condition than those in the lower estuary. RNA:DNA ratios correlated positively with temperature and negatively with salinity. We hypothesise that by migration to the better foraging grounds of the upper estuary (with higher prey biomass, elevated temperature and reduced salinity), the fish reduce early mortality and attain a better condition

  18. A contribution to the theory of nuclear matter at low density; Contribution a la theorie de la matiere nucleaire a basse densite

    Energy Technology Data Exchange (ETDEWEB)

    Madan, L. M. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1961-07-01

    A combination of the variational method using special momentum conserving canonical transformations and the method of resummation of the infinite series of dominating terms in the low density limit is used to study a strongly interacting N particle system. Under the hypothesis that the excitation energy E{sub k} is convex and everywhere positive after the special canonical transformation minimising the average value of the energy has been performed, we have shown that the t-matrix obtained by the summation of the ascending ladders is free from all singularities. Some particular examples are studied in detail. (author) [French] Une combinaison de la methode variationnelle utilisant des transformations canoniques speciales conservant l'impulsion, et de la methode de resommation infinie des termes dominants a basse densite est utilisee pour etudier l'etat fondamental d'un systeme a N particules en interaction forte. Sous reserve de l'hypotnese que l'energie d'excitation E{sub k} est convexe et partout positive, nous avons demontre la regularite de la matrice t obtenue en resommant des echelles montantes une fois effectuee la transformation canonique speciale qui minimise la valeur moyenne de l'energie. Quelques exemples particuliers sont etudies en detail. (auteur)

  19. ANTILISTERIAL ACTYVITY OF LACTIC ACID BACTERIA ISOLATED FROM GILTHEAD BREAMS AND SEA BASSES FILLETS PACKAGED MAP AGAINST PRIMITIVE STRAINS OF LISTERIA MONOCYTOGENES

    Directory of Open Access Journals (Sweden)

    M. Barile

    2011-04-01

    Full Text Available Listeria monocytogenes is the causative agent of listeriosis typically caused by ready-to-eat processed food that have a refrigerated shelf-life, but lightly preserved fish products also belong to a high-risk category. Aim of the work was to evaluate antimicrobial activity linked bacteriocin-producing of LAB isolated from gilthead breams and sea basses fillets packaged in modified atmospheres. Fifty-five LAB strains were screened against 21 strains of Listeria monocytogenes, 1 Listeria innocua held in the culture collection of Department of Zootechnical Sciences and Food Ispection (SIA and submitted to antagonistic activity using the spot on lawn and the agar well diffusion assay. Lactococcus lactis sub. lactis Sa31 was able to produce bacteriocin in agar and different broth medium. The bacteriocin man31 showed sensitivity to trypsin, pronase E and papain, inactivation at temperatures ≥ 100°C, bactericidal mode of action and antilisterial act, rapidly. The bacteriocin man31 caused a reduction of L. monocytogenes ½ c growth about log10 > 3 UFC/ml, when was applied on indicator strain at 20,480 AU/ml concentration, in vitro.

  20. Glucose turnover in kelp bass (Paralabrax sp.): in vivo studies with [6-3H,6-14C]glucose

    International Nuclear Information System (INIS)

    [6-3H,6-14C]glucose was injected via an indwelling arterial cannula in free-swimming, fed, and fasted kelp bass to determine hepatic glucose production, peripheral glucose uptake, minimal glucose mass, mean transit time, and the percent of carbon recycling under the two different nutritional states. Mean plasma glucose levels remained unchanged in fed and fasted fish (48 +- 8 vs. 43 +- 8 mg/100 ml). During steady-state conditions, glucose replacement rates of fed and fasted fish determined with [6-3H]glucose are similar (0.035 +- 0.006 vs. 0.025 +- 0.003 mg/min per 100 g) and do not differ from rates determined with [6-14C]glucose (0.035 +- 0.005 vs. 0.026 +- 0.002). The minimal glucose masses and the mean transit times determined with both isotopes are also similar suggesting that plasma glucose levels and glucose turnover are maintained in fish fasted up to 40 days with no apparent increase in carbon recycling. Nonsteady-state isotope experiments suggest that these fish can alter rates of hepatic glucose production and peripheral uptake in response to hyper- and hypoglycemia