
Sample records for basil ocimum gratissimum

  1. Effects of aqueous extract of Ocimum gratissimum on ...

    African Journals Online (AJOL)



    Apr 29, 2008 ... called African basil. It is a shrub commonly found in gardens and around village huts2. Scientifically, it is called. Ocimum gratissimum. It is widely distributed in tropical and warm temperature regions. It is used commonly in folk medicine to treat different diseases such as upper respiratory tract infections ...

  2. Basil (Ocimum basilicum L.) oils (United States)

    Basil (Ocimum basilicum) is one of the most popular and healthy culinary herbs in the world. Essential oil derived from basil (basil oil) through steam distillation has traditionally been used for a wide range of applications such as cooking spices, aromatherapy, perfumery, medicinal treatments, pes...

  3. Germination and vigor of clove basil seeds (Ocimum gratissimum L. submitted to accelerated aging/ Germinação e vigor de sementes de alfavaca-cravo (Ocimum gratissimum L. submetidas ao envelhecimento acelerado

    Directory of Open Access Journals (Sweden)

    Nair Mieko Takaki Bellettini


    Full Text Available The present work had as objective to verify the effect of treatment with fungicide on the germination and vigor of four lots of clove basil seeds, submitted to the traditional aging and with saturated salt solution, for periods of 36, 48, 60 and 72 hours, at 42ºC. After these periods, the seeds were evaluated by the germination test, using the first count of the number of normal seedlings as vigor indicative. The vigor and the germination of the seeds decreased as increased the time of aging. In the use of saturated salt solution, the seeds water content was lower and more uniform. The fungicide treatment increased the percentage average of germination, without provoking significant modifications in the contrasts among the lots. The periods of 36 and 48 hours were efficient in evaluating of the physiologic quality of the clove basil seeds.O presente trabalho teve como objetivo verificar o efeito do período de exposição, tipos de solução e tratamento com fungicida sobre a germinação e o vigor de quatro lotes de sementes de alfavaca-cravo, submetidas ao teste de envelhecimento acelerado tradicional e com uso de solução saturada de NaCl, por períodos de 36, 48, 60 e 72 horas na temperatura de 42ºC. Após estes períodos, as sementes foram avaliadas pelo teste de germinação, utilizando-se a primeira contagem do teste de germinação como indicativo de vigor. Tanto o vigor quanto a germinação das sementes analisadas, diminuíram conforme se aumentou o tempo de envelhecimento. Na utilização de solução salina, o teor e a variabilidade de água das sementes foram menores. O tratamento fungicida aumentou a média percentual de germinação, mas não provocou modificações acentuadas nos contrastes entre os lotes. Os períodos de 36 e 48 horas foram eficientes na avaliação da qualidade fisiológica das sementes de alfavaca-cravo.

  4. Antimicrobial activity of leaf extracts of Ocimum gratissimum on ...

    African Journals Online (AJOL)

    The antibacterial activity of different extracts from the leaves of Ocimum gratissimum was tested against Staphylococcus aureus, Escherichia coli, Salmonella typhi and Salmonella typhimurium, pathogenic bacteria that cause diarrhea. These extracts evaluated include cold water extract (CWE), hot water extract (HWE) and ...

  5. The Effect Of Ocimum Gratissimum (Ram Tulsi) On Sexual ...

    African Journals Online (AJOL)

    The suspension of the extract of Ocimum gratissimum Linn. was administered orally at the dose of 100, 250, and 500 mg / kg body weight, to different groups of male rats (n = 6) once a day for seven days. The female Swiss Albino mice involved in mating were made receptive by hormonal treatment. The general mating ...

  6. In vitro multiplication of Ocimum gratissimum L. through direct ...

    African Journals Online (AJOL)

    The objective of this study was to develop a rapid system for regeneration of the important medicinal plant, Ocimum gratissimum L, from nodal explant. Single node explants were inoculated on basal MS (Murashige and Skoog, 1962) medium containing 3% (w/v) sucrose, supplemented with different concentrations and ...

  7. Determinação de óleos essenciais de alfavaca (Ocimum gratissimum L., orégano (Origanum vulgare L. e tomilho (Thymus vulgaris L. Determination of essential oils of basil (Ocimum gratissimum L., oregano (Ocimum gratissimum L. and thyme (Thymus vulgaris L.

    Directory of Open Access Journals (Sweden)

    A.M. Borges


    apresentam potencial para o enriquecimento dos alimentos ou para a obtenção dos óleos essenciais.This study aimed to characterize commercial fresh and dry medicinal plants (basil, oregano and thyme, to obtain essential oil by the steam distillation method and to quantify chemical compounds by means of GC/MS. The fresh and dry plants were subjected to the following analyses moisture, ether extract, protein, crude fiber, ash, non-nitrogenous extract, caloric value, essential oil content and identification of major compounds by gas chromatography-mass spectrometry. Considering the obtained characterization, the following results on dry basis proved promising: protein and ash content in commercial dry basil with 17.34 g 100 g-1 and 8.12 g 100 g-1, respectively; crude fiber in commercial dry oregano with 15.65 g 100 g-1; ether extract, non-nitrogenous extract and caloric value in commercial dry thyme with 9.30 g 100 g-1, 52.72 g 100 g-1 and 356.74 Kcal 100 g-1, respectively. The highest essential oil yield was obtained for commercial dry basil with 1.02% and the lowest yield was obtained for fresh basil with only 0.13%. Chromatography indicated 87.38% eugenol and 6.27% thymol in fresh basil. For commercial dry basil, the chromatogram showed a reduction in eugenol (71.12% and an increase in thymol (13.28%. Four peaks were quantified for fresh oregano the γ-terpinene (33.45%, 4-terpineol (25.59%, thymol (14.21% and carvacrol (2.30%. For the essential oil of commercial dry oregano, there was a decrease in γ-terpinene (28.73% and an increase in 4-terpineol (27.58%, thymol (19.71% and carvacrol (3.67%. In the chromatogram of the essential oil of fresh thyme, three peaks were quantified: borneol (66.66%, thymol (13.41% and linalool (3.24%. On the other hand, in the chromatogram of the essential oil of commercial dry thyme, there was a decrease in borneol (37.90% and an increase in thymol (20.61% and linalool (10.34%. It can be concluded that commercial dry leaves of basil, oregano

  8. Resistance Against Basil Downy Mildew in Ocimum Species. (United States)

    Ben-Naim, Yariv; Falach, Lidan; Cohen, Yigal


    Downy mildew, caused by the oomycete Peronospora belbahrii, is a devastating disease of sweet basil. In this study, 113 accessions of Ocimum species (83 Plant Introduction entries and 30 commercial entries) were tested for resistance against downy mildew at the seedling stage in growth chambers, and during three seasons, in the field. Most entries belonging to O. basilicum were highly susceptible whereas most entries belonging to O. americanum, O. kilimanadascharicum, O. gratissimum, O. campechianum, or O. tenuiflorum were highly resistant at both the seedling stage and the field. Twenty-seven highly resistant individual plants were each crossed with the susceptible sweet basil 'Peri', and the F1 progeny plants were examined for disease resistance. The F1 plants of two crosses were highly resistant, F1 plants of 24 crosses were moderately resistant, and F1 plants of one cross were susceptible, suggesting full, partial, or no dominance of the resistance gene(s), respectively. These data confirm the feasibility of producing downy mildew-resistant cultivars of sweet basil by crossing with wild Ocimum species.

  9. Antibacterial activity of Ocimum gratissimum L. essential oil

    Directory of Open Access Journals (Sweden)

    Celso Vataru Nakamura


    Full Text Available The essential oil (EO of Ocimum gratissimum inhibited Staphylococcus aureus at a concentration of 0.75 mg/ml. The minimal inhibitory concentrations (MICs for Shigella flexineri, Salmonella enteritidis, Escherichia coli, Klebsiella sp., and Proteus mirabilis were at concentrations ranging from 3 to 12 mg/ml. The endpoint was not reached for Pseudomonas aeruginosa (>=24 mg/ml. The MICs of the reference drugs used in this study were similar to those presented in other reports. The minimum bactericidal concentration of EO was within a twofold dilution of the MIC for this organism. The compound that showed antibacterial activity in the EO of O. gratissimum was identified as eugenol and structural findings were further supported by gas chromatography/mass spectra retention time data. The structure was supported by spectroscopic methods.

  10. Herb yield and chemical composition of basil ( Ocimum basilicum L ...

    African Journals Online (AJOL)

    Background: Ocimum basilicum L., commonly known as sweet basil, is an important aromatic plant cultivated in many parts of the world for its essential oil. Basil does not show natural distribution in Turkey but they are cultivated as medicinal, seasoning or oil plants especially in the western and southern Anatolia.

  11. Armazenamento de sementes de Alfavaca-cravo (Ocimum gratissimum L.

    Directory of Open Access Journals (Sweden)

    J.R Martins


    Full Text Available A espécie Ocimum gratissimum L. é um subarbusto aromático, pertencente à família Lamiaceae, considerado como importante produtor de óleo essencial e largamente utilizado na medicina popular. Devido à escassez de informações sobre a conservação das sementes dessa espécie o presente estudo objetivou analisar a longevidade das sementes submetidas a diferentes condições de armazenamento, por 12 meses, através de avaliações do potencial germinativo e da capacidade de formação de plântulas normais. As sementes foram armazenadas em três tipos de embalagens: sacos de papel, sacos de papel aluminizado, e frascos de vidro, e nas seguintes condições ambientais: balcão de laboratório, geladeira, e câmara fria. Aos 6, 8, 10 e 12 meses de armazenamento foram avaliados os seguintes parâmetros: umidade, porcentagem de germinação, índice de velocidade de germinação e porcentagem de plântulas normais. Durante o período de armazenamento a manutenção da umidade nas sementes foi mantida, bem como a porcentagem de germinação e de plântulas normais em todos os tratamentos avaliados. As sementes armazenadas apresentaram maiores valores de IVG quando comparadas com as recém-colhidas.

  12. The effect of fresh leaf Ocimum gratissimum and dried buds Eugenia ...

    African Journals Online (AJOL)

    Bulletin of Animal Health and Production in Africa ... Abstract. The use of antibiotics has lead to antibiotic resistance and residual effects among others in fish tissue thus necessitate the advocate for alternative natural plants for ... Keywords: Antimicrobial, aquaculture, Eugenia caryophyllata, extracts, Ocimum gratissimum ...

  13. Food preservative potential of essential oils and fractions from Cymbopogon citratus, Ocimum gratissimum and Thymus vulgaris against mycotoxigenic fungi

    DEFF Research Database (Denmark)

    Nguefack, J.; Dongmo, J. B. Lekagne; Dakole, C. D.


    The food preservative potential of essential oils from three aromatic plants Cymbopogon citratus, Ocimum gratissimum and Thymus vulgaris and their fractions was investigated against two mycotoxigenic strains each of Aspergillus ochraceus, Penicillium expansum and P. verrucosum. The fungicidal...

  14. The antimicrobial properties of Ocimum gratissimum extracts on ...

    African Journals Online (AJOL)

    , flavonoids saponin, anthraquinone, cardiac glycoside, steroidal ring, steroidal terpens and carbohydrates at different concentrations. The findings from this study seem to provide the in vitro evidence that might justify O. gratissimum as a good ...

  15. Hepatoprotective effect of basil ( Ocimum basilicum L.) on CCl 4 ...

    African Journals Online (AJOL)

    The hepatoprotective effect of basil (Ocimum basilicum) extract against liver fibrosis-induced by carbon tetrachloride (CCl4) was studied in rats. Rats were allocated into five groups: Group I (control group); Group II [CCl4 group; rats were injected subcutaneously with CCl4 (1 ml/kg b.w.) twice weekly for 4 weeks ...

  16. A comparative study of therestorative effects of Ocimum gratissimum ...

    African Journals Online (AJOL)

    This study was to assess the curative potential of the methanol extract of two different ... O. canum and O. gratissimum on alcohol induced hepatotoxicity in albino rats. ... Thus from the result obtained we conclude that MEOG and MEOC could ...

  17. Treatment with methanolic extract of Ocimum gratissimum (Linn ...

    African Journals Online (AJOL)


    Jan 10, 2017 ... effects can be achieved using a potent antioxidant. Engaging ... experimental evidence on the effects of Ocimum ... animal (Wistar rat) model of drug-induced kidney injury. ...... cyclophosphamide-induced reproductive toxicity.

  18. Essential oil from Ocimum basilicum (Omani Basil): a desert crop. (United States)

    Al-Maskri, Ahmed Yahya; Hanif, Muhammad Asif; Al-Maskari, Masoud Yahya; Abraham, Alfie Susan; Al-sabahi, Jamal Nasser; Al-Mantheri, Omar


    The focus of the present study was on the influence of season on yield, chemical composition, antioxidant and antifungal activities of Omani basil (Ocimum basilicum) oil. The present study involved only one of the eight Omani basil varieties. The hydro-distilled essential oil yields were computed to be 0.1%, 0.3% and 0.1% in the winter, spring and summer seasons, respectively. The major components identified were L- linalool (26.5-56.3%), geraniol (12.1-16.5%), 1,8-cineole (2.5-15.1%), p-allylanisole (0.2-13.8%) and DL-limonene (0.2-10.4%). A noteworthy extra component was beta- farnesene, which was exclusively detected in the oil extracted during winter and spring at 6.3% and 5.8%, respectively. The essential oil composition over the different seasons was quite idiosyncratic, in which the principal components of one season were either trivial or totally absent in another. The essential oil extracted in spring exhibited the highest antioxidant activity (except DPPH scavenging ability) in comparison with the oils from other seasons. The basil oil was tested against pathogenic fungi viz. Aspergillus niger, A. fumigatus, Penicillium italicum and Rhizopus stolonifer using a disc diffusion method, and by determination of minimum inhibitory concentration. Surprisingly high antifungal values were found highlighting the potential of Omani basil as a preservative in the food and medical industries.

  19. Chemical Diversity in Basil (Ocimum sp.) Germplasm (United States)

    da Costa, Andréa Santos; Arrigoni-Blank, Maria de Fátima; de Carvalho Filho, José Luiz Sandes; de Santana, Aléa Dayane Dantas; Santos, Darlisson de Alexandria; Alves, Péricles Barreto; Blank, Arie Fitzgerald


    The present study aimed to chemically characterize 31 accessions and seven cultivars of basil. The percentage composition of the essential oils of the accessions and cultivars was based on the 14 most abundant constituents: 1,8-cineole, linalool, methyl chavicol, neral, nerol, geraniol, geranial, methyl cinnamate, β-bourbonene, methyl eugenol, α-trans-bergamotene, germacrene-D, epi-α-cadinol, and δ-cadinene. The genetic materials were classified into eight clusters according to the chemical composition of the essential oils: Cluster 1—mostly linalool and 1,8-cineole; Cluster 2—mostly linalool, geraniol, and α-trans-bergamotene; Cluster 3—mostly linalool, methyl chavicol, methyl cinnamate, and β-bourbonene; Cluster 4—mostly linalool, methyl chavicol, epi-α-cadinol, and α-trans-bergamotene; Cluster 5—mainly linalool, methyl eugenol, α-trans-bergamotene, and epi-α-cadinol; Cluster 6—mainly linalool, geraniol, and epi-α-cadinol; Cluster 7—mostly linalool and methyl chavicol; Cluster 8—mainly geranial and neral. PMID:25629084

  20. Chemical Diversity in Basil (Ocimum sp. Germplasm

    Directory of Open Access Journals (Sweden)

    Andréa Santos da Costa


    Full Text Available The present study aimed to chemically characterize 31 accessions and seven cultivars of basil. The percentage composition of the essential oils of the accessions and cultivars was based on the 14 most abundant constituents: 1,8-cineole, linalool, methyl chavicol, neral, nerol, geraniol, geranial, methyl cinnamate, β-bourbonene, methyl eugenol, α-trans-bergamotene, germacrene-D, epi-α-cadinol, and δ-cadinene. The genetic materials were classified into eight clusters according to the chemical composition of the essential oils: Cluster 1—mostly linalool and 1,8-cineole; Cluster 2—mostly linalool, geraniol, and α-trans-bergamotene; Cluster 3—mostly linalool, methyl chavicol, methyl cinnamate, and β-bourbonene; Cluster 4—mostly linalool, methyl chavicol, epi-α-cadinol, and α-trans-bergamotene; Cluster 5—mainly linalool, methyl eugenol, α-trans-bergamotene, and epi-α-cadinol; Cluster 6—mainly linalool, geraniol, and epi-α-cadinol; Cluster 7—mostly linalool and methyl chavicol; Cluster 8—mainly geranial and neral.

  1. Inhibitory effect of leaves extracts of Ocimum basilicum and Ocimum gratissimum on two key enzymes involved in obesity and hypertension in vitro

    Directory of Open Access Journals (Sweden)

    Emmanuel Anyachukwu Irondi


    Full Text Available Aim: To evaluate the phenolics composition and inhibitory effect of the leaves extracts of Ocimum basilicum (O. basilicum and Ocimum gratissimum (O. gratissimum on two key enzymes [pancreatic lipase (PL and angiotensin 1-converting enzyme (ACE] involved in obesity and hypertension in vitro. Methods: The phenolics (flavonoids and phenolic acids were quantified using high performance liquid chromatrography coupled with diode array detection (HPLC-DAD. PL and ACE inhibitory effects; and DPPH* and ABTS*+ scavenging activities of the extracts were tested using Spectrophotometric methods. Results: O. basilicum had the following major phenolics: rutin, quercetin and quercitrin (flavonoids; caffeic, chlorogenic and gallic acids (phenolic acids; while O. gratissimum had the following major phenolics: rutin, quercitrin and luteolin (flavonoids; ellagic and chlorogenic acids (phenolic acids. Extracts of both plants inhibited PL and ACE; and scavenged DPPH* in a dose-dependent manner. O. gratissimum extract was more potent in inhibiting PL (IC50: 20.69 μg/mL and ACE (IC50: 29.44 μg/mL than O. basilicum (IC50: 52.14 μg/mL and IC50: 64.99 μg/mL, against PL and ACE, respectively. O. gratissimum also scavenged DPPH* and ABTS*+ more than O. basilicum. Conclusion: O. basilicum and O. gratissimum leaves could be used as functional foods for the management of obesity and obesity-related hypertension. However, O. gratissimum may be more effective than O. basilicum. [J Complement Med Res 2016; 5(4.000: 396-402

  2. Transfer of Downy Mildew Resistance from Wild Basil (Ocimum americanum) to Sweet Basil (O. basilicum). (United States)

    Ben-Naim, Yariv; Falach, Lidan; Cohen, Yigal


    Sweet basil (Ocimum basilicum) is susceptible to downy mildew caused by the oomycete foliar pathogen Peronospora belbahrii. No resistant varieties of sweet basil are commercially available. Here, we report on the transfer of resistance gene Pb1 from the highly resistant tetraploid wild basil O. americanum var. americanum (PI 500945, 2n = 4x = 48) to the tetraploid susceptible O. basilicum 'Sweet basil' (2n = 4x = 48). F1 progeny plants derived from the interspecific hybridization PI 500945 × Sweet basil were resistant, indicating that the gene controlling resistance (Pb1) is dominant, but sterile due to the genetic distance between the parents. Despite their sterility, F1 plants were pollinated with the susceptible parent and 115 first backcross generation to the susceptible parent (BCs1) embryos were rescued in vitro. The emerging BCs1 plants segregated, upon inoculation, 5:1 resistant/susceptible, suggesting that resistance in F1 was controlled by a pair of dominant genes (Pb1A and Pb1A'). Thirty-one partially fertile BCs1 plants were self-pollinated to obtain BCs1-F2 or were backcrossed to Sweet basil to obtain the second backcross generation to the susceptible parent (BCs2). In total, 1 BCs1-F2 and 22 BCs2 progenies were obtained. The BCs1-F2 progeny segregated 35:1 resistant/susceptible, as expected from a tetraploid parent with two dominant resistant genes. The 22 BCs2 progenies segregated 1:1 resistant/susceptible (for a BCs1 parent that carried one dominant gene for resistance) or 5:1 (for a BCs1 parent that carried two dominant genes for resistance) at a ratio of 4:1. The data suggest that a pair of dominant genes (Pb1A and Pb1A') residing on a two homeologous chromosomes is responsible for resistance of PI 500945 against P. belbahrii.

  3. First report of Alfalfa mosaic virus infecting basil (Ocimum basilicum L.) in California. (United States)

    Basil (Ocimum basilicum L.) plants collected from a field in Imperial County, CA in May, 2011 were found to exhibit yellowing, chlorotic sectors and spots on leaves, resulting in plants being unmarketable. Total nucleic acid was extracted from plants and tested by RT-PCR for the presence of Alfalfa...

  4. Organic versus conventional fertilization effects on sweet basil (Ocimum basilicum L.) growth in a greenhouse system (United States)

    Ocimum basilicum L. (sweet basil) is an essential oil producing crop used in culinary and fragrance applications. The objective of this controlled environment study was to evaluate the effects of organic and conventional fertilization, (applied at two nitrogen rates, 150 and 250 kg N/ha), on plant g...

  5. Phytochemical investigation of dichloromethanic fraction on Ocimum gratissimum L. extract/ Estudo químico da fração diclorometânica do extrato de Ocimum gratissimum L.

    Directory of Open Access Journals (Sweden)

    José Roberto Pinto de Souza


    Full Text Available Previous studies showed that ethanolic extract of Ocimum gratissimum inhibited growth of Penicillium chrysogenum, Rhizoctonia sp, Aspergillus niger and Alternaria sp, isolated from tomato and carrot. The aim of this study was to identify the chemical constituents of Ocimum gratissim. Aerial parts of the plant were treated with hexane-dichloromethane-ethanol mixture (1:3:1 at room temperature. The obtained extract was chromatographed on silica gel column eluted with hexane, dichloromethane and ethanol. Fractions eluted with dichloromethane were rechromatographed on a column of silica gel to yield alyphatic hydrocarbon mixture (C31, C33, C34 e C35, eugenol, caryophyllene oxide and a mixture of stigmasterol and sitosterol. The structures of the compounds were deduced by spectral data analysis and by comparison with literature values. Recent studies showed that eugenol is probably one of the responsibles for antifungal activity of O. gratissimum.Ensaios anteriores de atividade antifúngica do extrato etanólico de Ocimum gratissimum, utilizando a técnica de difusão em meio sólido, evidenciaram a inibição do crescimento de Penicillium chrysogenum, Rhizoctonia sp, Aspergillus niger e de duas espécies de Alternaria sp isoladas de tomate e de cenoura. O objetivo deste trabalho foi identificar os possíveis constituintes químicos responsáveis pela atividade antifúngica da planta, por meio de estudo químico do extrato hexano-diclorometano-etanol (1:3:1 das partes aéreas de O. gratissimum. O extrato foi cromatografado em coluna de sílica gel, eluída com hexano, diclorometano e etanol. A purificação em coluna cromatográfica de sílica gel das frações eluídas com diclorometano (5,9g resultou na obtenção de quatro constituintes: uma mistura de hidrocarbonetos saturados de cadeia longa (C31, C33, C34 e C35, eugenol, óxido de cariofileno e uma mistura de estigmasterolsitosterol. Os constituintes foram identificados através das an

  6. Effects of nitrogen fertilization on the phenolic composition and antioxidant properties of basil (Ocimum basilicum L.). (United States)

    Nguyen, Phuong M; Niemeyer, Emily D


    Many herbs and spices have been shown to contain high levels of polyphenolic compounds with potent antioxidant properties. In the present study, we explore how nutrient availability, specifically nitrogen fertilization, affects the production of polyphenolic compounds in three cultivars (Dark Opal, Genovese, and Sweet Thai) of the culinary herb, basil ( Ocimum basilicum L.). Nitrogen fertilization was found to have a significant effect on total phenolic levels in Dark Opal ( p basil with statistically higher phenolic contents observed when nutrient availability was limited at the lowest (0.1 mM) applied nitrogen treatment. Similarly, basil treated at the lowest nitrogen fertilization level generally contained significantly higher rosmarinic ( p = 0.001) and caffeic ( p = 0.001) acid concentrations than basil treated at other nitrogen levels. Nitrogen fertilization also affected antioxidant activity ( p = 0.002) with basil treated at the highest applied nitrogen level, 5.0 mM, exhibiting lower antioxidant activity than all other nitrogen treatments. The anthocyanin content of Dark Opal basil was not affected by applied nitrogen level, but anthocyanin concentrations were significantly impacted by growing season ( p = 0.001). Basil cultivar was also determined to have a statistically significant effect on total phenolic levels, rosmarinic and caffeic acid concentrations, and antioxidant activities.

  7. Effect of Irrigation Intervals on Some Morphophysiological Traits of Basil (Ocimum basilicum L. Ecotypes

    Directory of Open Access Journals (Sweden)

    M Goldani


    Full Text Available In order to determine the effect of different irrigation intervals on some morphophysiological traits of basil (Ocimum basilicum L., an experiment was conducted as factorial based on randomized complete block design with three replications under greenhouse conditions during 2010. Treatments included five irrigation intervals with 4, 8, 12, 16 and 20 days intervals and two ecotypes of basil (green and purple. The results showed that by increasing irrigation interval plant height, spike number, spike weight and shoot dry weight between irrigation intervals decreased. Purple basil was more tolerant than basil green ecotype to drought stress. Interaction between irrigation intervals and ecotypes showed that the best treatment related to four days irrigation interval and purple basil ecotype. The effect of irrigation intervals on root area, root diameter mean, total length, root volume and dry weight of root was significant. In all irrigation intervals, purple basil had better performance compared to green ecotype. The results showed that by increasing in irrigation interval decreased root surface area, but increased total root length. It was concluded that increasing irrigation interval up to 12 days decreased shoot and root surface areas. Increasing irrigation interval decreased chlorophyll- a, b and increased prolin amino acid content of basil leaf.

  8. Immunomodulatory Role of Ocimum gratissimum and Ascorbic Acid against Nicotine-Induced Murine Peritoneal Macrophages In Vitro

    Directory of Open Access Journals (Sweden)

    Santanu Kar Mahapatra


    Full Text Available The aim of this present study was to evaluate the immune functions and immune responses in nicotine-induced (10 mM macrophages and concurrently establish the immunomodulatory role of aqueous extract of Ocimum gratissimum (Ae-Og and ascorbic acid. In this study, nitrite generations and some phenotype functions by macrophages were studied. Beside that, release of Th1 cytokines (TNF-α, IL-12 and Th2 cytokines (IL-10, TGF-β was measured by ELISA, and the expression of these cytokines at mRNA level was analyzed by real-time PCR. Ae-Og, at a dose of 10 μg/mL, significantly reduced the nicotine-induced NO generation and iNOSII expression. Similar kinds of response were observed with supplementation of ascorbic acid (0.01 mM. The administration of Ae-Og and ascorbic acid increased the decreased adherence, chemotaxis, phagocytosis, and intracellular killing of bacteria in nicotine-treated macrophages. Ae-Og and ascorbic acid were found to protect the murine peritoneal macrophages through downregulation of Th1 cytokines in nicotine-treated macrophages with concurrent activation of Th2 responses. These findings strongly enhanced our understanding of the molecular mechanism leading to nicotine-induced suppression of immune functions and provide additional rationale for application of anti-inflammatory therapeutic approaches by O. gratissimum and ascorbic acid for different inflammatory disease prevention and treatment during nicotine toxicity.

  9. Utilization of heavy metal-rich tannery sludge for sweet basil (Ocimum basilicum L.) cultivation. (United States)

    Chand, Sukhmal; Singh, Shweta; Singh, Vinay Kumar; Patra, D D


    Unlike food crops, essential oil-bearing crops in which the oil is extracted through hydro-distillation can be a suitable crop to be grown in heavy metal-polluted soils as the oil does not carry any heavy metal. In a field experiment conducted at CIMAP, Lucknow, India during 2011 and 2012, influence of six doses of tannery sludge viz 0, 10, 20, 30, 40, and 50 t ha(-1) were tested, taking sweet basil (Ocimum basilicum) as the test crop. Maximum herb yield was obtained with the application of sludge at 20 t ha(-1). While in root, accumulation of Cd and Pb increased significantly up to 20 t ha(-1), Cr accumulation increased with increasing the dose of tannery sludge reaching maximum at 50 t ha(-1). Essential oil yield of basil (Ocimum basilicum) was significantly affected due to sludge application. Quality of essential oil, in term of chemical constituents, however, was marginally influenced due to tannery sludge application.

  10. Agronomic and physiological impacts of irrigation frequency on green basil (Ocimum basilicum L.)


    Gao, Peng; Dodd, Ian


    Water scarcity is a major factor restricting agricultural production and irrigation globally, with sustainable agricultural development calling for less irrigation water use and more production per unit of water applied. Improved understanding of plant physiological responses to water stress, and the effect of irrigation frequency on plant biomass production and quality, may help to optimize irrigation scheduling. Glasshouse-grown basil (Ocimum basilicum L.) received three different irrigatio...

  11. Yield and oil composition of 38 basil (Ocimum basilicum L.) accessions grown in Mississippi. (United States)

    Zheljazkov, Valtcho D; Callahan, Amber; Cantrell, Charles L


    A field experiment was conducted to assess yield, oil content, and composition of 38 genotypes of sweet basil ( Ocimum basilicum L.). Overall, biomass yields were high and comparable to those reported in the literature. However, basil genotypes differed significantly with respect to oil content and composition. Oil content of the tested accessions varied from 0.07% to 1.92% in dry herbage. On the basis of the oil composition, basil accessions were divided into seven groups: (1) high-linalool chemotype [19-73% (-)-linalool], (2) linalool-eugenol chemotype [six chemotypes with 28-66% (-)-linalool and 5-29% eugenol], (3) methyl chavicol chemotype [six accessions with 20-72% methyl chavicol and no (-)-linalool], (4) methyl chavicol-linalool chemotype [six accessions with 8-29% methyl chavicol and 8-53% (-)-linalool], (5) methyl eugenol-linalool chemotype [two accessions with 37% and 91% methyl eugenol and 60% and 15% (-)-linalool], (6) methyl cinnamate-linalool chemotype [one accession with 9.7% methyl cinnamate and 31% (-)-linalool], and (7) bergamotene chemotype [one accession with bergamotene as major constituent, 5% eucalyptol, and basil could be a viable essential oil crop in Mississippi. The availability of various chemotypes offers the opportunity for production of basil to meet the market requirements of specific basil oils or individual compounds such as (-)-linalool, eugenol, methyl chavicol, methyl cinnamate, or methyl eugenol.

  12. Effect of methyl jasmonate on secondary metabolites of sweet basil (Ocimum basilicum L.). (United States)

    Kim, Hyun-Jin; Chen, Feng; Wang, Xi; Rajapakse, Nihal C


    The effect of methyl jasmonate (MeJA) in terms of its induction of inherent bioactive chemicals in sweet basil (Ocimum basilicum L.) was evaluated after MeJA was sprayed on healthy basil plants. The total phenolic content of the sweet basil significantly increased after 0.1 and 0.5 mM MeJA treatments compared with the control not subjected to MeJA. Two phenolic compounds, rosmarinic acid (RA) and caffeic acid (CA), were identified as strong antioxidant constituents of the sweet basil. Their amounts also significantly increased after the MeJA treatment. In addition, eugenol and linalool increased 56 and 43%, respectively, by the 0.5 mM MeJA treatment. Due to the accumulation of RA, CA, and eugenol, which possess strong 2,2-diphenyl-1-picrylhydrazyl (DPPH*) free radical scavenging activities, the antioxidant activity of the sweet basil extract was 2.3-fold greater than that of the control after the 0.5 mM MeJA treatment. In the DPPH* assay, the EC50 values of RA, CA, and eugenol were determined as 23, 46, and 59 microM, respectively, which indicated they were 6-, 3-, and 2.4-fold more efficient than BHT (140 microM). Besides, an unidentified HPLC peak in the methanolic extract of the sweet basil was 4.3-fold higher than that of the control after the 0.5 mM MeJA treatment.

  13. Antifungal activities of basil ( Ocimum basilicum L.) extract on ...

    African Journals Online (AJOL)

    ... and 29.27%, respectively) whereas other investigated Fusarium species exhibited much lower sensitivity. The basil extract completely inhibited the growth of investigated Fusarium spp. at the concentration of 1.50% (v/v). Higher concentrations (0.35 and 0.70% (v/v)) reduced growth of aerial mycelium in all tested species.

  14. Extraction of basil leaves (ocimum canum) oleoresin with ethyl acetate solvent by using soxhletation method (United States)

    Tambun, R.; Purba, R. R. H.; Ginting, H. K.


    The goal of this research is to produce oleoresin from basil leaves (Ocimum canum) by using soxhletation method and ethyl acetate as solvent. Basil commonly used in culinary as fresh vegetables. Basil contains essential oils and oleoresin that are used as flavouring agent in food, in cosmetic and ingredient in traditional medicine. The extraction method commonly used to obtain oleoresin is maceration. The problem of this method is many solvents necessary and need time to extract the raw material. To resolve the problem and to produce more oleoresin, we use soxhletation method with a combination of extraction time and ratio from the material with a solvent. The analysis consists of yield, density, refractive index, and essential oil content. The best treatment of basil leaves oleoresin extraction is at ratio of material and solvent 1:6 (w / v) for 6 hours extraction time. In this condition, the yield of basil oleoresin is 20.152%, 0.9688 g/cm3 of density, 1.502 of refractive index, 15.77% of essential oil content, and the colour of oleoresin product is dark-green.

  15. Biodiesel production by lipase-catalyzed transesterification of Ocimum basilicum L. (sweet basil) seed oil

    International Nuclear Information System (INIS)

    Amini, Zeynab; Ong, Hwai Chyuan; Harrison, Mark D.; Kusumo, Fitranto; Mazaheri, Hoora; Ilham, Zul


    Highlights: • Need for alternative energy has led to explore new feedstock. • Ocimum basilicum seeds oil was used as biodiesel feedstock. • Biodiesel was produced via lipase-catalyzed transesterification by Novozym. • Artificial neural network with genetic algorithm modelling was employed. - Abstract: The increasing global demand for fuel, limited fossil fuel resources, and increasing concern about the upturn in gaseous CO_2 emissions are the key drivers of research and development into sources of renewable liquid transport fuels, such as biodiesel. In the present work, we demonstrate biodiesel production from Ocimum basilicum (sweet basil) seed oil by lipase-catalyzed transesterification. Sweet basil seeds contain 22% oil on a dry weight basis. Artificial neural network with genetic algorithm modelling was used to optimize reaction. Temperature, catalyst concentration, time, and methanol to oil molar ratio were the input factors in the optimization study, while fatty acid methyl ester (FAME) yield was the key model output. FAME composition was determined by gas chromatography mass spectrometry. The optimized transesterification process resulted in a 94.58% FAME yield after reaction at 47 °C for 68 h in the presence of 6% w/w catalyst and a methanol to oil ratio of 10:1. The viscosity, density, calorific value, pour point, and cloud point of the biodiesel derived from sweet basil seed oil conformed to the EN 14214 and ASTM D6751 standard specifications. The antioxidant stability of the biodiesel did not meet these specifications but could be improved via the addition of antioxidant.

  16. Antioxidant and antimicrobial properties of traditional green and purple "Napoletano" basil cultivars (Ocimum basilicum L.) from Campania region (Italy). (United States)

    Tenore, Gian Carlo; Campiglia, Pietro; Ciampaglia, Roberto; Izzo, Luana; Novellino, Ettore


    The present study is the first effort to a comprehensive evaluation of the antioxidant and antimicrobial activities of 'Napoletano' green and purple basil (Ocimum basilicum L.) varieties. The results obtained revealed that the basil sample extracts were characterised by a generally higher polyphenolic concentration than those reported elsewhere for other more conventional and geographically different basil varieties. Napoletano purple basil revealed higher radical-scavenging and ferric-reducing capacities than the green one probably due to its relevant anthocyanin content. As regards the antimicrobial properties, both basil varieties exhibited activity against a broad spectrum of food-borne and human pathogenic micro-organisms, revealing not only a moderate to high natural preserving capacity, but also potentially beneficial influence on human health. Results indicated Napoletano green and purple basils as a good source of antioxidants of potential nutraceutical interest.

  17. Essential-Oil Variability in a Collection of Ocimum basilicum L. (Basil) Cultivars. (United States)

    Maggio, Antonella; Roscigno, Graziana; Bruno, Maurizio; De Falco, Enrica; Senatore, Felice


    Ocimum basilicum L. (Lamiaceae) is an aromatic plant of great tradition in the Mediterranean area. Its economic importance is growing up determining an expansion of cultivation. This paper evaluated the morphological traits, the chemical profiles, and antibacterial activity of 21 cultivars of basil belonging to 'Genovese', 'Napoletano', and 'Purple basil' types. The cultivars were characterized by different growth rate and morphological traits. The chemical composition of the oils analyzed by GC and GC/MS analysis, supported by the PCA analysis, underlined the strong influence of chemotype. It is noteworthy that estragole, never present in Genovese and purple basil types, occurred in Napoletano type. The high presence of eugenol, methyl eugenol, and linalool in the majority of cultivars, belonging both to Genovese and to Napoletano types was registered. Of great interest resulted the composition of the purple basil 'Opal'. All the samples tested exhibited similar antibiotic profiles with moderate antibacterial activity. The results enhanced the importance of determination of essential-oil profile in the selection of cultivars characterized by diverse morphological traits and are useful for different purposes. © 2016 Wiley-VHCA AG, Zürich.

  18. Basil (Ocimum basilicum L. essential oil and extracts obtained by supercritical fluid extraction

    Directory of Open Access Journals (Sweden)

    Zeković Zoran P.


    Full Text Available The extracts obtained from sweet basil (Ocimum basilicum L. by hydrodistillation and supercritical fluid extraction (SFE were qualitative and quantitative analyzed by GC-MS and GC-FID. Essential oil (EO content of basil sample, determined by an official method, was 0.565% (V/w. The yields of basil obtained by SFE were from 0.719 to 1.483% (w/w, depending on the supercritical fluid (carbon dioxide density (from 0.378 to 0.929 g mL-1. The dominant compounds detected in all investigated samples (EO obtained by hydrodistillation and different SFE extracts were: linalool, as the major compound of basil EO (content from 10.14 to 49.79%, w/w, eugenol (from 3.74 to 9.78% and ä-cardinene (from 3.94 to 8.07%. The quantitative results of GC-MS from peak areas and by GC-FID using external standard method involving main standards, were compared and discussed. [Projekat Ministarstva nauke Republike Srbije, br. TR 31013

  19. Anatomia e ultraestrutura foliar de Ocimum gratissimum sob diferentes níveis de radiação luminosa

    Directory of Open Access Journals (Sweden)

    Valéria Ferreira Fernandes


    Full Text Available Espécies vegetais são capazes de ajustar suas características fisiológicas, anatômicas e ultraestruturais aos fatores ambientais, como, por exemplo, a disponibilidade de radiação luminosa incidente. O objetivo deste estudo foi avaliar a influência de diferentes níveis de radiação luminosa na anatomia e ultraestrutura foliar de Ocimum gratissimum L. (Lamiaceae. As plantas foram cultivadas por 93 dias em quatro níveis de radiação fotossinteticamente ativa (20, 11, 7 e 4mol m-2 d-1. O incremento da intensidade de luz proporcionou aumento no espessamento dos parênquimas paliçádico e esponjoso e do limbo foliar, entretanto, a espessura da epiderme não foi alterada. Em relação aos aspectos ultraestruturais, verificou-se aumento no tamanho dos cloroplastos e grãos de amido e um aumento do empilhamento dos tilacoides com a redução da intensidade de luz. As variações anatômicas e ultraestruturais verificadas confirmam a plasticidade fenotípica dessa espécie em função da intensidade de radiação luminosa.

  20. Sublethal Effects of Essential Oils From Eucalyptus staigeriana (Myrtales: Myrtaceae), Ocimum gratissimum (Lamiales: Laminaceae), and Foeniculum vulgare (Apiales: Apiaceae) on the Biology of Spodoptera frugiperda (Lepidoptera: Noctuidae). (United States)

    Cruz, G S; Wanderley-Teixeira, V; Oliveira, J V; Lopes, F S C; Barbosa, D R S; Breda, M O; Dutra, K A; Guedes, C A; Navarro, D M A F; Teixeira, A A C


    Spodoptera frugiperda (Smith 1797) (Lepidoptera: Noctuidae) is a major pest of maize, Zea mays L. Its control is often achieved through repeated applications per season of insecticides, which may lead to adverse effects on the ecosystem. Thus, the study of alternative methods with less environmental impact has expanded to include the use of essential oils. These oils are products of the secondary metabolism in plants, and their insecticidal activity has been widely demonstrated in populations of many pest insects. This study evaluated the insecticidal activities of essential oils from Eucalyptus staigeriana, Ocimum gratissimum, and Foeniculum vulgare on Spodoptera frugiperda. Gas chromatography–mass spectrometry profiles and contact toxicity of these oils as well as their sublethal effects on larvae and reproductive parameters in adults were evaluated. All three oils had sublethal effects on S. frugiperda; however, the oil of O. gratissimum showed the best results at all doses tested. These essential oils may have promise for control of S. frugiperda.

  1. First report of tomato chlorotic spot virus in sweet basil (Ocimum basilicum) and purslane (Portulaca oleracea) in Florida (United States)

    Tomato chlorotic spot virus (TCSV) has been recently detected in tomato, pepper, hoya and vinca in Florida. Observations of additional crops in 2016 and 2017 revealed TCSV-like symptoms. Testing of these symptomatic plants identified three new hosts of TCSV in Florida: sweet basil (Ocimum basilicu...

  2. Growth, yield, plant quality and nutrition of basil (Ocimum basilicum L. under soilless agricultural systems

    Directory of Open Access Journals (Sweden)

    Subhrajit Saha


    Full Text Available Traditional agricultural systems are challenged by globally declining resources resulting from climate change and growing population. Alternative agricultural practices such as aquaponics (includes crop plant and aquatic species and hydroponics (includes crop plant only have the potential to generate high yield per unit area using limited land, water, and no soil. A soilless agricultural study was conducted at the Georgia Southern University, Statesboro, GA, USA from August to November, 2015. The growth, yield, quality, and nutrition of basil (Ocimum basilicum L. cultivar Aroma 2, were compared between aquaponic and hydroponic systems using crayfish (Procambarus spp. as the aquatic species. Non-circulating floating raft systems were designed using 95 L polyethylene tanks. Equal amounts of start-up fertilizer dose were applied to both systems. The objective was to understand how the additional nutritional dynamics associated with crayfish influence the basil crop. Both fresh and dry basil plant weights were collected after harvest, followed by leaf nutrient analysis. Leaf chlorophyll content, water pH, nitrogen and temperature were measured periodically. Aquaponic basil (AqB showed 14%, 56%, and 65% more height, fresh weight, and dry weight, respectively, compared to hydroponic basil (HyB. It is logical to assume that crayfish waste (excreta and unconsumed feed has supplied the additional nutrients to AqB, resulting in greater growth and yield. The chlorophyll content (plant quality or leaf nutrients, however, did not differ between AqB and HyB. Further research is needed to investigate aquaponic crayfish yield, overall nutritional dynamics, cost-benefit ratio, and other plant characteristics under soilless systems.

  3. Potencial da otencial planta medicinal Ocimum gratissimum no controle de Bipolaris sorokiniana em sementes de trigo = Potential of Ocimum gratissimum medicinal plant on Bipolaris sorokiniana control in the wheat seeds

    Directory of Open Access Journals (Sweden)

    Érica dos Anjos Rodrigues


    Full Text Available Avaliou-se o efeito, in vitro, do extrato bruto (EB, autoclavado e esterilizado por filtração, da planta medicinal Ocimum gratissimum e do fungicida iprodione+thiram no crescimento micelial e na esporulação de Bipolaris sorokiniana. Além disso, sementes de trigo naturalmente infectadas com B. sorokiniana foram submetidas aos seguintes tratamentos: 1 fumigação com óleo essencial, 2 imersão em EB autoclavado e 3 não-autoclavado em diferentes concentrações (1%,5%, 10%, 15%, 20%, 25% e 50% m/v, 4 polvilhamento com folhas secas e com fungicida iprodione+thiram. O EB autoclavado proporcionou maior inibição, ainda que parcial, do crescimento micelial em todas as concentrações testadas (1%, 5%, 10%, 15%, 20% e 50% m/v, quando comparado ao EB esterilizado por filtração. Em casa-de-vegetação, as sementes fumigadas por 7 dias apresentaram velocidade de emergência (VE estatisticamente igual à da testemunha (água. Com relação ao tratamento por imersão, não houve diferença estatística entre os parâmetros analisados (VE, porcentagem de emergência, altura, massa fresca e seca e taxa de transmissão (Tt e a testemunha. Sementes tratadas com pó de folhas secas não diferiram estatisticamente do controle químico, em relação aos parâmetros anteriores, mas apresentaram maior Tt do patógeno. Em laboratório, as sementes submetidas à fumigação apresentaram maior número de sementes sadias doque a testemunha, enquanto os tratamentos com imersão em EB e polvilhamento não diferiram em relação ao mesmo parâmetro.The in vitro effect of Ocimum gratissimum medicinal plant CE(autoclaved and sterilized by filtration as well as the iprodione+thiram fungicide on the mycelial growth and sporulation of B. sorokiniana was evaluated. Besides, wheat seeds naturally infected with B. sorokiniana were submitted to the following treatments: 1 fumigation with essential oil; 2 immersion with autoclaved CE and; 3 non autoclaved CE at different

  4. Light Quality Dependent Changes in Morphology, Antioxidant Capacity, and Volatile Production in Sweet Basil (Ocimum basilicum). (United States)

    Carvalho, Sofia D; Schwieterman, Michael L; Abrahan, Carolina E; Colquhoun, Thomas A; Folta, Kevin M


    Narrow-bandwidth light treatments may be used to manipulate plant growth, development and metabolism. In this report LED-based light treatments were used to affect yield and metabolic content of sweet basil (Ocimum basilicum L. cv "Ceasar") grown in controlled environments. This culinary herb produces an aroma highly appreciated by consumers, primarily composed of terpenes/terpenoids, phenylpropanoids, and fatty-acid- derived volatile molecules. Basil plants were grown under narrow-bandwidth light conditions, and leaf area, height, mass, antioxidant capacity and volatile emissions were measured at various time points. The results indicate reproducible significant differences in specific volatiles, and in biochemical classes of volatiles, compared to greenhouse grown plants. For example, basil plants grown under blue/red/yellow or blue/red/green wavelengths emit higher levels of a subset of monoterpenoid volatiles, while a blue/red/far-red treatment leads to higher levels of most sesquiterpenoid volatile molecules. Specific light treatments increase volatile content, mass, and antioxidant capacity. The results show that narrow-bandwidth illumination can induce discrete suites of volatile classes that affect sensory quality in commercial herbs, and may be a useful tool in improving commercial production.

  5. Photoprotection by foliar anthocyanins mitigates effects of boron toxicity in sweet basil (Ocimum basilicum). (United States)

    Landi, Marco; Guidi, Lucia; Pardossi, Alberto; Tattini, Massimiliano; Gould, Kevin S


    Boron (B) toxicity is an important agricultural problem in arid environments. Excess edaphic B compromises photosynthetic efficiency, limits growth and reduces crop yield. However, some purple-leafed cultivars of sweet basil (Ocimum basilicum) exhibit greater tolerance to high B concentrations than do green-leafed cultivars. We hypothesised that foliar anthocyanins protect basil leaf mesophyll from photo-oxidative stress when chloroplast function is compromised by B toxicity. Purple-leafed 'Red Rubin' and green-leafed 'Tigullio' cultivars, grown with high or negligible edaphic B, were given a photoinhibitory light treatment. Possible effects of photoabatement by anthocyanins were simulated by superimposing a purple polycarbonate filter on the green leaves. An ameliorative effect of light filtering on photosynthetic quantum yield and on photo-oxidative load was observed in B-stressed plants. In addition, when green protoplasts from both cultivars were treated with B and illuminated through a screen of anthocyanic protoplasts or a polycarbonate film which approximated cyanidin-3-O-glucoside optical properties, the degree of photoinhibition, hydrogen peroxide production, and malondialdehyde content were reduced. The data provide evidence that anthocyanins exert a photoprotective role in purple-leafed basil mesophyll cells, thereby contributing to improved tolerance to high B concentrations.

  6. Phenylpropanoid biosynthesis in leaves and glandular trichomes of basil (Ocimum basilicum L.). (United States)

    Deschamps, Cícero; Simon, James E


    Basil (Ocimum basilicum L.) essential oil phenylpropenes are synthesized and accumulate in peltate glandular trichomes and their content and composition depend on plant developmental stage. Studies on gene expression and enzymatic activity indicate that the phenylpropene biosynthetic genes are developmentally regulated. In this study, the methylchavicol accumulation in basil leaves and the enzyme activities and gene expression of both chavicol O-methyltransferase (CVOMT) and eugenol O-methyltransferase (EOMT) were investigated in all leaves at four plant developmental stages. Methylchavicol accumulation decreased over time as leaves matured. There was a significant correlation between methylchavicol accumulation and CVOMT (r(2) = 0.88) enzyme activity, suggesting that the levels of biosynthetic enzymes control the essential oil content. CVOMT and EOMT transcript expression levels, which decreased with leaf age, followed the same pattern in both whole leaves and isolated glandular trichomes, providing evidence that CVOMT transcript levels are developmentally regulated in basil glandular trichomes themselves and that differences in CVOMT expression observed in whole leaves are not solely the result of differences in glandular trichome density.


    Directory of Open Access Journals (Sweden)

    Marisol Ronzón Ortega


    Full Text Available In order to promote sustainable aquaculture in production units and to take care of the water resource is needed to integrate biotechnology tools to the activity, as is the aquaponics. In the present study we evaluated the production efficiency of a crop of basil (Ocimum basilicum in a hydroponic system (SH vs. acuaponic system (SA associated with the semi-intensive culture of Malaysian prawn (Macrobrachium rosenbergii. The production of basil was conducted in two geomembrane plastic rectangular tanks (4.0 m long x 0.80 m wide and 0.30 m high, divided into two sections: in the first section setting of the seedlings were done in a substrate of silica sand and volcanic rock , whereas in the second were seeded into plastic containers using the same substrate. SH plants got their nutrients from the metabolites derived from the cultivation of 800 postlarval shrimp in two circular tanks of 25 m3 (16 organisms m-2 (Pond 1: initial weight 0.13 g, Pond 2: 2.19 g; while in the SH was used a commercial nutrient solution (1.5 g L. The results indicate that SH plants initially had higher survival (90%, height and number of leaves per plant (p

  8. The Effectiveness of Extracts Basil Leaves (Ocimum sanctum Linn) against Saprolegnia sp. by in Vitro (United States)

    Sudarno; Luthfi Hakim, Muhammad; Kusdarwati, Rahayu


    Saprolegnia SP. is a fungi which is opportunistic and generally as a secondary pathogen on fish. Saprolegnia sp. infects epidermis tissue that begins at the head or fins and can spread over the entire surface of the body. The result of the using of chemicals to control infections of Saprolegnia spp. can cause pollution of the environment and harm the consumer. The purpose of this research was to determine the potential and the minimum concentration of extracts basil leaves (Ocimum sanctum Linn) as antifungi against the growth of Saprolegnia sp. by vitro. The research was held in Fish Quarantine Kelas I Juanda Suarabaya in January 2015. A positive result was obtained in the test of the effectiveness of basil leaves in inhibiting the growth of the fungus Saprolegnia sp. Concentration of the extract given to treatment 90% and 100% was able to inhibit the growth of Saprolegnia sp., indicated by the formation of the inhibitory zones at a concentration of treatment, and had the best results on the concentration of 100%.

  9. Effect of essential oil from fresh leaves of Ocimum gratissimum L. on mycoflora during storage of peanuts in Benin. (United States)

    Adjou, Euloge S; Kouton, Sandrine; Dahouenon-Ahoussi, Edwige; Soumanou, Mohamed M; Sohounhloue, Dominique C K


    The aim of this study was to evaluate the effect of essential oil from fresh leaves of Sweet Fennel (Ocimum gratissimum) on mycoflora and Aspergillus section Flavi populations in stored peanuts. Aspergillus, Fusarium and Mucor spp. were the most common genera identified from peanuts at post-harvest in Benin by using a taxonomic schemes primarily based on morphological characters of mycelium and conidia. The isolated fungi include Aspergillus niger, A. parasiticus, A. flavus, A. ochraceus, Fusarium graminearum, F. solani, F. oxysporum and Mucor spp. The most prevalent fungi recorded were A. niger (94.18 %), A. flavus (83.72 %), A. parasiticus (77.90 %), A. ochraceus (72.09 %), F. graminearum (59.30 %) and F. oxysporum (51.16 %). Antifungal assay, performed by the agar medium assay, indicated that essential oil exhibited high antifungal activity against the growth of A. flavus, A. parasiticus, A. ochraceus and F. oxysporium. The minimal inhibitory concentration (MIC) of the essential oil was found to be 7.5 μl/ml for A. flavus and A. parasiticus and 5.5 μl/ml for A. ochraceus and F. oxysporium. The minimal fungicidal concentration (MFC) was recorded to be 8.0 μl/ml for A. flavus and A. parasiticus, 6,5 μl/ml for A. ochraceus and 6.0 μl/ml for F. oxysporium. The essential oil was found to be strongly fungicidal and inhibitory to aflatoxin production. Chemical analysis by GC/MS of the components of the oil led to the identification of 31 components characterized by myrcene (6.4 %), α-thujene (8.2 %), p-cymene (17.6 %), γ-terpinene (20.0 %), and thymol (26.9 %) as major components. The essential oil of Sweet Fennel, with fungal growth and mycotoxin inhibitory properties, offers a novel approach to the management of storage, thus opening up the possibility to prevent mold contamination in stored peanuts.

  10. Creams formulated with Ocimum gratissimum L. and Lantana camara L. crude extracts and fractions as mosquito repellents against Aedes aegypti L. (Diptera: Culicidae). (United States)

    Keziah, Ezeike Amarachi; Nukenine, Elias Nchiwan; Danga, Simon Pierre Yinyang; Younoussa, Lame; Esimone, Charles Okechukwu


    Mosquitoes are the most deadly vectors of parasites that cause diseases such as malaria, yellow fever, and filariasis. In view of the recent increased interest in developing plant origin insecticides as an alternative to chemical insecticides, the objective of this study was to determine the repellent activity of creams formulated with methanol crude extract (MCE), hexane fraction (HF), and ethyl acetate fractions (EAFs) of Ocimum gratissimum and Lantana camara leaves in single and combined actions against female Aedes aegypti. Evaluation was carried out in the net cages (30 by 30 by 30 cm) containing 60 blood-starved female mosquitoes each and were assayed in the laboratory condition following World Health Organization 2009 protocol. All formulations (single and mixture) were applied at 2, 4, 6, and 8 mg/cm(2) in the exposed area of human hands. Only acetone + white soft paraffin served as negative control and odomos (12% DEET) as positive control. All the formulations presented good protection against mosquito bites without any allergic reaction by the human volunteers. The repellent activity was dependent on the strength of the extracts and fractions. Among the tested formulations, the maximum protection time was observed in MCE (120 min) and EAF (150 min) of O. gratissimum; MCE:MCE (150 min) and HF:HF (120 min) mixtures of both plants. In addition, MCE:MCE and HF:HF mixtures from both plants showed possible synergistic effect. From the results, the combination of O. gratissimum and L. camara to formulate natural mosquito repellent using small amount of extracts can be encouraging to be an alternative to conventional DEET. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  11. Effects of various organic and chemical fertilizers on growth indices of basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    S.M.K. Tahami


    Full Text Available In order to develop the high intensive agriculture, more chemical fertilizers are applied to the soil that resulting in soil degradation and environment deterioration. Application of organic manure is an important approach for maintaining and improving the soil fertility and increasing fertilizer use efficiency. Therefore, in order to evaluate the effect of organic manures and chemical fertilizer on growth indices and biological yield of basil (Ocimum basilicum L., an experiment was conducted at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, during growing season of 2008-2009. A complete randomized block design with six treatments and three replications was used. The treatments were: cow manure, sheep manure, chicken manure, vermicompost, chemical NPK fertilizers and control (no fertilizer. The results showed that the use of organic fertilizers significantly increased seed and biological yield of basil compared with chemical fertilizer and control. The maximum and the minimum dry weights were observed at 105 days after planting, in sheep and cow manures, respectively. Gradually during the period of plant growth and development to reproduction phase percent of stem decreased and dry weight of inflorescence increased. The highest and the lowest leaf area index were observed at 90 days after planting, in cow manure and control, respectively, and then decreased in all treatments. The maximum crop growth rate in most of treatments at 90 days after planting was obtained, except the control which plant growth rate was lowest. Net assimilation rate (NAR in most treatments increased until 75 days after planting and then declined. While the highest and the lowest NAR were observed at 75 days after planting in chicken manure and chemical treatment, respectively.

  12. Comparing the Effects of Benzyladenine and meta-Topolin on Sweet Basil (Ocimum basilicum Micropropagation

    Directory of Open Access Journals (Sweden)

    Szidónia KŐSZEGHI


    Full Text Available Micropropagation of aromatic plants reveals an effective way of obtaining high volume, virus-free plant material of uniform quality. The application of meta-Topolin (mT (N6-(2-hydroxybenzyl adenine-9-riboside and aromatic cytokinin as Benzyladenine (BAP in the micro propagation of sweet basil (Ocimum basilicum L. was tested for the first time and plant growth parameters assessed to determine the optimum level of these cytokinins. Additionally, the rate of root-growth inhibition due to these two cytokinins was also assessed. Our results show that 1 mg/l (4.43 mM BAP and 0.5 mg/l (2.07 mMmT produced the most favourable effects on new shoot developments. Meta-Topolin was shown to increase the quality of the plants and in comparison with BAP fewer distortions were observed. No significant differences in root-growth inhibition between the mT and BAP were detected.  

  13. Effect of Salt Stress and Irrigation Water on Growth and Development of Sweet Basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Caliskan Omer


    Full Text Available This study was conducted to assess the influence of different salinity and irrigation water treatments on the growth and development of sweet basil (Ocimum basilicum L.. Five salinity levels (0.4, 1.00, 2.50, 4.00 and 8.00 dSm-1 and three different irrigation water regimes (80, 100, 120% of full irrigation were applied in a factorial design with three replications. Dry root weight, aerial part dry weight and aerial part/root ratio were determined and evaluated as experimental parameters at the end of growing period. Results revealed significant decreases in yields with increasing salinity levels. However, basil managed to survive high salt stress. With increasing salinity levels, decreases in growth were higher in roots than in leaves. Changes in the amount of irrigation water also significantly affected the evaluated parameters.

  14. α-Linalool - a marker compound of forged/synthetic sweet basil (Ocimum basilicum L.) essential oils. (United States)

    Radulović, Niko S; Blagojević, Polina D; Miltojević, Ana B


    Ocimum basilicum L. (sweet basil) is known to occur as several chemotypes or cultivars that differ in their essential oil composition. The surprising discovery of 3,7-dimethylocta-1,7-dien-3-ol, the rare α isomer of the well-known monoterpene alcohol β-linalool (3,7-dimethylocta-1,6-dien-3-ol), in samples of Serbian basil oil provoked an investigation of the origin of α-linalool in these samples. Three scenarios were considered, namely (a) the existence of a new natural chemotype, (b) an artefactual formation during the isolation procedure and (c) the case of a synthetic/forged oil. Noteworthy amounts (15.1-16.9%) of pure α-linalool were isolated from a commercial sample of basil oil, and detailed spectral analyses (MS, IR, (1) H and (13) C NMR) unequivocally confirmed its identity. The analysis by GC and GC/MS of an additional 20 samples of different O. basilicum oils commercially available on the Serbian market or isolated from plant material cultivated in Serbia resulted in the identification of 149 compounds. The obtained compositional data were compared using multivariate statistical analysis to reveal the possible existence of a new basil chemotype. The results of the chemical and statistical analyses give more pro arguments for the synthetic/forged oil hypothesis and suggest that α-linalool could be used as a marker compound of such O. basilicum oils. © 2013 Society of Chemical Industry.

  15. Modeling of extraction process of crude polysaccharides from Basil seeds (Ocimum basilicum l.) as affected by process variables. (United States)

    Salehi, Fakhreddin; Kashaninejad, Mahdi; Tadayyon, Ali; Arabameri, Fatemeh


    Basil seed (Ocimum basilicum L.) has practical amounts of gum with good functional properties. In this work, extraction of gum from Basil seed was studied. Effect of pH, temperature and water/seed ratio on the kinetic and thermodynamic parameters; entropy, enthalpy and free energy of extraction were investigated. The maximum gum yield was 17.95 % at 50 °C for pH=7 and water/seed ratio 30:1. In this study, the experimental data were fitted to a mathematical model of mass transfer and equations constants were obtained. The kinetic of Basil seed gum extraction was found to be a first order mass transfer model. Statistical results indicated that the model used in this study will be able to predict the gum extraction from Basil seed adequately. It also found that ΔH and ΔS were positive and ΔG was negative indicating that the extraction process was spontaneous, irreversible and endothermic. The ΔH, ΔS and ΔG values were 0.26-7.87 kJ/mol, 8.12-33.2 J/mol K and 1.62-4.42 kJ/mol, respectively.

  16. Antibacterial properties of essential oils and methanol extracts of sweet basil Ocimum basilicum occurring in Bangladesh. (United States)

    Hossain, M Amzad; Kabir, M J; Salehuddin, S M; Rahman, S M Mizanur; Das, A K; Singha, Sandip Kumar; Alam, Md Khorshed; Rahman, Atiqur


    The antibacterial potential of essential oils and methanol extracts of sweet basil Ocimum basilicum L. (Lamiaceae) was evaluated for controlling the growth range of food-borne pathogenic bacteria. Essential oils extracted by hydrodistillation from the leaves and stems were analyzed by GC-MS. Fifty-seven compounds representing 94.9 and 96.1% of the total leaf and stem oils, respectively, were identified, of which methyl chavicol (36.7 and 29.9%), gitoxigenin (9.3 and 10.2%), trimethoquinol (10.3 and 8.4%), beta-guaiene (3.7 and 4.1%), aciphyllene (3.4 and 3.0%), alizarin (3.2 and 4.4%), naphthaline (2.2 and 3.8%), (-)-caryophyllene (2.0 and 1.9%), and mequinol (1.6 and 1.8%) were the major compounds. The essential oils (10 microL/disc of 1:5, v/v dilution with methanol) and methanol extracts (300 microg/disc) of O. basilicum displayed a great potential of antibacterial activity against Bacillius cereus, B. subtilis, B. megaterium, Staphylococcus aureus, Listeria monocytogenes, Escherichia coli, Shigella boydii, S. dysenteriae, Vibrio parahaemolyticus, V. mimicus, and Salmonella typhi with their respective zones of inhibition of 11.2-21.1 mm and MIC values of 62.5-500 microg/mL. The results of this study suggest that the natural products derived from O. basilicum may have potential use in the food and/or pharmaceutical industries as antimicrobial agents.

  17. Supercritical CO2 Extracts and Volatile Oil of Basil (Ocimum basilicum L. Comparison with Conventional Methods

    Directory of Open Access Journals (Sweden)

    José Coelho


    Full Text Available Interest in new products from aromatic plants as medical and nutritional compounds is increasing. The aim of this work was to apply different extraction methods, including the use of supercritical carbon dioxide extraction, and to test the antioxidant activity of basil (Ocimum basilicum L. extracts. In vitro efficacy assessments were performed using enzymatic assays. Essential oil obtained by hydrodistillation and volatile oil obtained from supercritical fluid extraction were analyzed by gas chromatography to quantify components. The total phenolic content in the extracts ranged from 35.5 ± 2.9 to 85.3 ± 8.6 mg of gallic acid equivalents and the total flavonoid content ranged from 35.5 ± 2.9 to 93.3 ± 3.9 micromole catechin equivalents per gram of dry weight of extract. All the extracts showed an antioxidant activity with 2,2-diphenyl-1-picrylhydrazyl (DPPH, 2,2-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid (ABTS, and the reducing power test. Extracts obtained from methanol had a higher antioxidant capacity per the DPPH test results (IC50 = 3.05 ± 0.36 mg/mL and the reducing power test assay 306.8 ± 21.8 μmol of trolox equivalents per gram of extract (TE/g compared with ethanolic or supercritical fluid extracts. However, using the ABTS assay, the extract obtained by supercritical fluid extraction had a higher antioxidant capacity with an IC50 of 1.74 ± 0.05 mg/mL. Finally, the examined extracts showed practically no acetylcholinesterase (AChE inhibitory capacity and a slight inhibitory activity against tyrosinase.

  18. Chemical composition of the essential oil of basil (Ocimum basilicum L. Lamiaceae)


    Jelačić Slavica Ć.; Beatović Damir V.; Prodanović Slaven A.; Tasić Slavoljub R.; Moravčević Đorđe Ž.; Vujošević Ana M.; Vučković Savo M.


    In Serbia basil has been grown traditionally as a decorative, medicinal, seasoning and ritual herb, and there is a variety of different populations of basil. Basil is considered to have been brought to Serbia in the 12th century by monks returning from their pilgrimages. Essential oils isolated from herb of ten basil populations traditionally grown on the territory of the Republic of Serbia have been analyzed. The selected populations have been designated under codes from T-1 to T-10 an...

  19. Response of Basil (Ocimum basilicum L. to Type and Amount of Organic Fertilizer Applications in Intercropping with Sesame (Sesamum indicum L.

    Directory of Open Access Journals (Sweden)

    Alaleh Mottaghian


    Full Text Available To investigate the effect of organic fertilizer applications on yield and competition indices of basil (Ocimum basilicum L. in different combinations of intercropping with sesame (Sesamum indicum L., an experiment was carried out in split plot based on randomized complete block design with three replicates in 2011. The main plots were six fertilizer treatments consisted of 20 and 40 Mg ha-1 of vermicompost and sewage sludge plus 50% recommended chemical fertilizer, chemical fertilizer alone (100 kg ha-1 of urea, triple super phosphate and potassium sulfate and control (no fertilizer application. Subplots were different planting ratios (sole cropping of basil and sesame, 75% + 25%, 50% + 50 %, 25% + 75% of basil+sesame. In this experiment, the 25% basil+75% sesame and 50% basil + 50%sesame under40 Mg. ha-1 of enriched sewage sludge application had the highest economical yield (up to 3097.47 kg ha-1 with a land equivalent ratio (up to 1.24. According to the aggressivity coefficient estimates of two plant species basil incombination of 25% basil + 75% sesame and sesame in 50% basil + 50% sesame and 75% basil + 25% sesame under organic fertilizer application would be dominant species competitave in ranges of 0.12 to 0.30 and 0.11 to 0.57, respectively.

  20. Anti-Diabetic Potential of Ocimum gratissimum Leaf Fractions in Fortified Diet-Fed Streptozotocin Treated Rat Model of Type-2 Diabetes

    Directory of Open Access Journals (Sweden)

    Stanley I. R. Okoduwa


    Full Text Available Background: Ocimum gratissimum (OG is used in the traditional management of diabetes in Nigeria. This study investigated the anti-diabetic potential of OG leaf fractions (OGLF in a rat model of Type-2 diabetes (T2D. Method: Methanol crude extract of OG leaf was fractionated with solvents of increasing order of polarity (n-hexane, chloroform, ethyl-acetate, n-butanol and water. The anti-diabetic potential of the fractions was evaluated in vivo. T2D was induced in Albino Wistar rats and treated with OGLF. Result: The T2D rats showed significant elevation in serum levels of fasting blood glucose (FBG, liver and kidney function biomarkers. At 4-weeks of intervention with OGLF, the untreated diabetic control group maintained severe hyperglycaemia in the presence of 61.7% serum insulin, 17.3% pancreatic β-cell function (HOMA-β and 51.5% Insulin sensitivity. The glucose tolerance ability was enhanced in the n-butanol-fraction (OGb treated group. With 74.8% available serum insulin and 38.6% improvement in insulin sensitivity, the OGb treated group had a 63.5% reduction in FBG and it was found to be most effective as it ameliorates a majority of the changes caused in the studied parameters in diabetic rats. Conclusions: The data from this study suggest that OGb fraction is a potential candidate for the development of an effective drug for the management of T2D.

  1. Antibacterial Activities of Green Basil (Ocimum Violaceum Essential Oil and Derivatives By MAOS (Microwave Assisted Organic Synthesis Against Staphyllococus Aureus and Escherichia Coli

    Directory of Open Access Journals (Sweden)

    Dwiarso Rubiyanto


    Full Text Available Green basil (Ocimum violaceum , Linn. plantis part of the varieties of basil (Ocimum basilicum, Linn.. Green basil essential oil (GBEO contain chemical compounds that have an anti- bacterial activities . Methyl eugenol and methyl chavikol are in green basil oil has the potential to be used as a material which is biologically active. Conversion reaction of the compounds in GBEO with MAOS methods (microwave assisted organic synthesis aims to obtain properties of the main chemical component in a wider sweet basil oil, and are also useful in an attempt to gain more valuable compounds for commercial and higher. The results showed that the optimum reaction conditions on the conversion reaction of compounds in GBEO with MAOS method with ethylene glycol as a solvent is 10 % KF/Al2O3as catalyst and reaction time 3 minutes , while the solvent is glycerol 10 % KF/Al2O3as catalyst and reaction time 2 minutes . Comparison of anti-bacterial activity resulting from this research are : the inhibitory activity to the growth of S. aureus bacteria have the following order : GBEO > green basilEG10-3 > green basil G10-2> amoxicillin with each inhibition zone diameter amounted to 30.7 mm, 21.1 mm, 18.2 mm and 13.4 mm. While the inhibitory activity to the growth of E.coli bacteria are : GBEO> green basil G10-2 >green basil EG10-3 > amoxicillin with each inhibition zone diameter of 21.1 mm, 15.6 mm , 15.2 mm and 7.9 mm . GBEO and its derivatives have minimal inhibitory concentrations below 1.25 %. From the results of the study found that the main derivates obtained are p-methoxy anisaldehyde , caryophyllene oxide , 3-methoxy cinnamaldehyde , humulena oxide and delta cadinol

  2. Lipid and protein oxidation in the internal part of italian type salami containing basil essential oil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Alexandre José Cichoski


    Full Text Available Different concentrations of basil essential oil (Ocimum basilicum L. (0.19; 0.38; 0.75; 1.87; 3.75 and 6.00 mg.g-1 were evaluated in relation to their antioxidant activity using the DPPH● radical methodology. From the IC50 obtained data, the concentrations of 0.19; 0.38; 0.75; 1.87; 3.75; 6.00 and 12.00 mg.mL-1 were applied directly to the product and these were sensorially evaluated by the test of control difference. The concentrations related to the highest acceptability (0.19; 0.38 and 0.75 mg.g-1 were tested for antioxidant activity in the internal part of Italian type salami - during the processing and after 30 days of storage, in terms of lipid and protein oxidation. The oxidation of lipids was determined using the method of TBARS. The method of carbonyl compounds was employed for proteins oxidation. Five different formulations of salami were elaborated: blank (without the use of antioxidant; control (using sodium eritorbate as antioxidant; and adding 0.19; 0.38 and 0.75 mg.g-1 of basil essential oil. The product was kept between 25 ºC and 18 ºC and UR between 95% and 70%, for 28 days. Analyses were carried out on the processing day and after 2, 7, 14, 21 and 28 days, and also following 30 days of storage. The basil essential oil in vitro presented an antioxidant activity of IC50 12 mg.mL-1. In the internal part of the Italian type salami the commercial antioxidant (control and the formulation containing 0.75 mg.g-1 of basil essential oil presented antioxidant activity in relation to the lipids, but not to the proteins - during processing and storage.

  3. Evaluation of replacement intercropping of soybean (Glycine max L. with sweet basil (Ocimum basilicum L. and borage (Borago officinalis L. under weed infestation

    Directory of Open Access Journals (Sweden)

    M. Bagheri Shirvan


    Full Text Available In order to evaluate intercropping of soybean (Glycine max L. cv. JK with sweet basil (Ocimum basilicum L. and borage (Borago officinalis L. with weed interference, an experiment was performed in randomized complete block design with 12 treatments and three replications at a field located 10 km of Shirvan during year of 2011. The treatments were included 75% soybean: 25%sweet basil, 50%soybean: 50% sweet basil, 25% soybean: 75% sweet basil, 75% soybean: 25% borage, 50% soybean: 50% borage and 25% soybean: 75% borage under weed infestation, in addition sole cropping of plants under weed control and weed interference. Intercropped plants had more success in reduction of weed density and biomass compared to monoculture. Soybean50: sweet basil50, reduced the weed density by 47.95% and 52.9%, and reduced the weed biomass by 68.91% and 61.87% more than sweet basil and soybean pure stand, respectively. Investigation of dry matter accumulation showed that increasing of plant proportion in intercropping caused increasing of plant dry matter. The height of soybean and borage was increased in intercropping and weed interference, while the highest height of sweet basil was observed in monoculture at second harvest. Biological and economical yield of soybean in intercropping with sweet basil was higher than intercropping with borage. The highest harvest index was related to 50:50 soybean: sweet basil ratio. In this ratio, the harvest index increased 4.9% compared to soybean monoculture. Yield of sweet basil and borage decreased with increasing of soybean rows in intercropping. Based on area-time equivalent ratio, soybean 75% with sweet basil and borage 25% (based on borage seed yield had 3% and 4% advantage compared to monoculture.

  4. Alterations in blood pressure, antioxidant status and caspase 8 expression in cobalt chloride-induced cardio-renal dysfunction are reversed by Ocimum gratissimum and gallic acid in Wistar rats. (United States)

    Akinrinde, A S; Oyagbemi, A A; Omobowale, T O; Asenuga, E R; Ajibade, T O


    The protective abilities of the chloroform extract of Ocimum gratissimum (COG) and gallic acid against cobalt chloride (CoCl2) - induced cardiac and renal toxicity were evaluated. Rats were exposed to CoCl2 (350ppm) for 7 days, either alone, or in combination with COG (100 and 200mg/kg) or gallic acid (120mg/kg). CoCl2 given alone, caused significant increases (pgallic acid treatment significantly reduced (pgallic acid by modulation of CoCl2-induced alterations in blood pressure, antioxidant status and pro-apoptotic caspase 8 in Wistar rats. Copyright © 2016 Elsevier GmbH. All rights reserved.

  5. The Effect of Static Magnetic Forces on Water Contents and Photosynthetic Pigments in Sweet Basil Ocimum basilicum L. (Lamiaceae)

    Energy Technology Data Exchange (ETDEWEB)

    Taia, Wafaa K; Kotbi, Abeer M [Alexandria Univ., Faculty of Science, Botany Dept., Alexandria (Egypt); AlZahrani, Hassan S [Faculty of Science, King AbdulAziz Univ., Biology Dept., Jeddah (Saudi Arabia)


    Three different magnetic regimes; aerial, surface and buried; each with three different forces, have been used to investigate their effects on the water contents and photosynthetic pigments of sweet basil plants (Ocimum basilicum L.). Two groups of sweet basil seeds, Ocimum basilicum L. have been cultivated, one under normal conditions and the second has been subdivided into three portion (aerial, surface and buried) to examine the effect of different magnetic forces coming from the three directions on the resulted plants. At all directions of magnets, water contents have been significantly affected by the magnetic forces. Chlorophyll A and carotene contents have been affected, as well, according to the three magnetic forces coming from soil surface regime only. Chlorophyll B did not significantly affected by differences magnetic forces in the three regimes, but it is affected by magnetism wherever its direction or force. But all the photosynthetic pigments contents (Chlorophyll A, B and Carotenes) decreased significantly than the control in the three magnetic regimes., but without any effect according to differences in the magnetic force in the aerial and burried regimes of magnetism. It was concluded that magnetism affects both water absorption and retention , the most influenced regime was the aerial magnets followed by the surface and buried ones. This result can be interpreted by the ionization of water which makes water ions respond to magnetic forces. Photosynthetic pigments have been decreased significantly by the exposure to magnetic fields, irrespective to its direction or force and this may be due to the effect of magnetic fields on the reduction in plastids inside the cells. (author)

  6. The Effect of Static Magnetic Forces on Water Contents and Photosynthetic Pigments in Sweet Basil Ocimum basilicum L. (Lamiaceae)

    International Nuclear Information System (INIS)

    Taia, Wafaa K; Kotbi, Abeer M; AlZahrani, Hassan S


    Three different magnetic regimes; aerial, surface and buried; each with three different forces, have been used to investigate their effects on the water contents and photosynthetic pigments of sweet basil plants (Ocimum basilicum L.). Two groups of sweet basil seeds, Ocimum basilicum L. have been cultivated, one under normal conditions and the second has been subdivided into three portion (aerial, surface and buried) to examine the effect of different magnetic forces coming from the three directions on the resulted plants. At all directions of magnets, water contents have been significantly affected by the magnetic forces. Chlorophyll A and carotene contents have been affected, as well, according to the three magnetic forces coming from soil surface regime only. Chlorophyll B did not significantly affected by differences magnetic forces in the three regimes, but it is affected by magnetism wherever its direction or force. But all the photosynthetic pigments contents (Chlorophyll A, B and Carotenes) decreased significantly than the control in the three magnetic regimes., but without any effect according to differences in the magnetic force in the aerial and burried regimes of magnetism. It was concluded that magnetism affects both water absorption and retention , the most influenced regime was the aerial magnets followed by the surface and buried ones. This result can be interpreted by the ionization of water which makes water ions respond to magnetic forces. Photosynthetic pigments have been decreased significantly by the exposure to magnetic fields, irrespective to its direction or force and this may be due to the effect of magnetic fields on the reduction in plastids inside the cells. (author)

  7. Effect of drip irrigation on yield, evapotranspiration and water use efficiency of sweet basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Pejić Borivoj


    Full Text Available The experiments showing the effect of drip irrigation on yield, evapotranspiration and water productivity of sweet basil (Ocimum basilicum L. were conducted at the experimental field of the Alternative Crops Department, Institute of Field and Vegetable Crops, Novi Sad. Irrigation was scheduled on the basis of the water balance method. Daily evapotranspiration (ETd was computed from the reference evapotranspiration (ETo and crop coefficient (kc in May, June, July and August of 0.5, 0.6, 1.1 and 1.0, respectively. ETo was calculated using Hargreaves equation. The irrigation depth was restricted to the soil depth of 0.3 m. In other words, irrigation started when readily available water in the soil layer of 0.3 m was completely depleted by plants. The irrigation rate was 30 mm (30 l m-2 while the amount of water added by irrigation during the season was 140 mm. Basil sensitivity to water stress was determined using a yield response factor (Ky. According to the results, the yield of fresh herb of basil under irrigation (32.015 t ha-1 was higher by 9% compared to non-irrigated, control variant (29.364 t ha-1. Worthy of note, basil essential oil yield was significantly affected by irrigation (35.329/28.766 kg ha-1. The content of essential oil was significantly higher in irrigated (6.45 g kg-1 than in non-irrigated variant (5.33 g kg-1 in the first harvest, while no significant difference between irrigated and non-irrigated variants was obtained in the second harvest (6.83 and 6.62 g kg-1 , respectively. Water used on evapotranspiration in irrigation conditions (ETm was 431 mm and 270 mm in non-irrigated, control variant (ETa. The values of irrigation water use efficiency (Iwue and evapotranspiration water use efficiency (ETwue were 1.89 kg m-3 and 1.65 kg m-3 respectively. Ky value (0.22 exhibits all essential characteristics of climate conditions of 2016 rainy year. These preliminary results could be used as a good platform for basil growers in the

  8. The relationship between growth stages and aroma composition of lemon basil Ocimum citriodorum Vis


    Al-Kateb, H.; DONALD, M.


    Plants produce volatiles depending on the season, growth cycle and time of year. Lemon basil “Ocmium basilicum var.citrodorum” possesses three growth stages; pre-flowering, full flowering and post-flowering. The volatiles of lemon basil infusions either increased or decreased throughout the growth cycle. Oxygenated compounds were the predominant class detected. Volatiles such as citral (neral+geranial), eucalyptol and estragole contribute to the flavor profile and may contribute in the plant ...

  9. Composição química, atividade antibacteriana in vitro e toxicidade em Artemia salina do óleo essencial das inflorescências de Ocimum gratissimum L., Lamiaceae Chemical composition, antibacterial activity in vitro and brine-shrimp toxicity of the essential oil from inflorescences of Ocimum gratissimum L., Lamiaceae.

    Directory of Open Access Journals (Sweden)

    Lenise L. Silva


    Full Text Available O óleo essencial das inflorescências de Ocimum gratissimum L., Lamiaceae foi obtido por hidrodestilação e analisado por CG/EM. Os constituintes majoritários identificados foram eugenol (81,94% e γ-muuroleno (12,58%. O óleo essencial das inflorescências demonstrou atividade antibacteriana frente a todas as cepas bacterianas testadas pelo método de microdiluição em caldo. Merece destaque a atividade verificada frente às cepas resistentes de Enterococcus faecalis, Staphylococcus aureus e Escherichia coli. Os valores obtidos de concentração inibitória mínima (CIM e a concentração bactericida mínima (CBM variaram, respectivamente, entre 0,5-2 mg/mL e 1-4 mg/mL. Valores de CL50 de 233,8 (200,7-272,0 µg/mL para o óleo essencial e 186,1 (144,1-228,5 µg/mL para o eugenol, utilizado como controle positivo, foram observados frente à Artemia salina L.The essential oil obtained by hydrodistillation of the inflorescences of Ocimum gratissimum L. was analyzed by GC/MS. The main constituents were eugenol (81.94% and γ-muurolene (12.58%. Antibacterial activity was shown against all assayed strains by the broth microdilution method. It's worth noting the activity against resistant strains of Enterococcus faecalis, Staphylococcus aureus and Escherichia coli. Minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC values ranged between 0.5-2 mg/mL and 1-4 mg/mL, respectively. Preliminary toxicity assayed by the brine-shrimp (Artemia salina L. test showed LC50 values of 233.8 (200.7 - 272.0 µg/mL and 186.1 (144.1 - 228.5 µg/mL, respectively for the essential oil and eugenol (positive control.

  10. The response of sweet basil (Ocimum basilicum L. to the application of growth stimulators and forecrops

    Directory of Open Access Journals (Sweden)

    Cezary A. Kwiatkowski


    Full Text Available A field experiment in growing sweet basil was carried out in the period 2008-2010 in Fajsławice (Lublin region, on podzolic soil. The study evaluated the biometric traits of the plants, yield, the qualitative parameters of herbal raw material and weed infestation of the crop in dependence on growth simulators (Asahi SL, Bio-algeen, Titanit and the forecrop (winter wheat or spring barley + white mustard cover crop. Plots without foliar application of the growth stimulators were the control treatment. Tillage, mineral NPK fertilization as well as mechanical and chemical weed control were typical for this plant species and consistent with the recommendations for herbal plant protection. A hypothesis was made that the application of growth stimulators would have a positive effect on basil productivity, raw material quality and weed infestation of the basil crop. It was also assumed that the phytosanitary and fertilizing effects of the cover crop would result in higher and qualitatively better yield compared to the cereal forecrop alone (winter wheat. The best quantitative parameters of sweet basil raw material and the highest reduction in air-dry weight of weeds in the crop were observed after the application of the growth stimulators. The forecrop - spring barley + a white mustard cover crop that is ploughed in - also had a beneficial effect on yield and weed infestation of the plant in question. The traditional crop protection method used in the basil crop, without the application of the growth stimulators, resulted in a lower plant height and a smaller number of shoots per plant. This caused higher weed infestation of the crop and a decrease in yield. The positive side of the non-application of growth stimulators was a better chemical composition of basil raw material. Asahi SL and Tytanit yielded the best growth and productivity of the basil plants.

  11. Antimicrobial activity of basil (Ocimum basilicum) oil against Salmonella enteritidis in vitro and in food. (United States)

    Rattanachaikunsopon, Pongsak; Phumkhachorn, Parichat


    Nine essential oils were examined for antimicrobial activity against reference and clinical strains of Salmonella Enteritidis. Based on the size of the inhibition zone and the minimal inhibitory concentration, basil oil had the strongest antimicrobial activity against all the tested bacteria, and S. Enteritidis SE3 was the most sensitive strain to all the tested oils. Gas chromatography/mass spectrometry analysis revealed that the major constituents of the oil were linalool (64.35%), 1,8-cineole (12.28%), eugenol (3.21%), germacrene D (2.07%), alpha-terpineol (1.64%), and rho-cymene (1.03%). When applied in nham, a fermented pork sausage, experimentally inoculated with S. Enteritidis SE3 and stored at 4 degrees C, basil oil inhibited the bacterium in a dose-dependent fashion. Basil oil at a concentration of 50 ppm reduced the number of bacteria in the food from 5 to 2log cfu/g after storage for 3 d. An unmeasurable level of the bacterium in the food was observed at days 2 and 3 of storage when 100 and 150 ppm of basil oil was used, respectively. Sensory evaluation suggested that the addition of 100 but not of 150 ppm to nham would be acceptable to consumers. The results from this study confirm the potential use of basil oil as an antimicrobial agent to control S. Enteritidis in food.

  12. Formulation and Evaluation of Edible Film from Basil Leaves Extract (Ocimum americanum L. as Mouth Freshener

    Directory of Open Access Journals (Sweden)

    Fifi Harmely


    Full Text Available A research on formulation of edible film from basil leaves extract as mouth freshener has been done. The extract of basil leaves were used in various concentrations which are 2.5%, 5% and 7.5%. The products were evaluated for some parameters such as organoleptic, friability, drying shrinkage, pH, thickness, flavonoid contents and respondents preference. The results of evaluation showed that edible filmsfrom basil leaves extract meet requirements as required by Standard Nasional Indonesia (SNI and have such quality as product in the market. Statistical analysis using Kruskal Wallis test showed that respondents preferred for the F0 formulation in term of their appearance and taste while as mouth freshener, respondents preferred the F3 formulation.

  13. Phytochemical screening and antioxidant activity of ethanolic extract and ethyl acetate fraction from basil leaf (Ocimum basilicum L.) by DPPH radical scavenging method (United States)

    Warsi; Sholichah, A. R.


    Basil leaf (Ocimum basilicum L.) contains various compounds such as flavonoid, alkaloid, phenol and essential oil, so it needs to be fractionated to find out the flavonoid compound with the greatest potential as an antioxidant. This research was aimed to know the chemical compound, antioxidant potential of ethanolic extract and ethyl acetate fraction from basil leaf. The basil leaf was extracted by maceration using ethanol 70 %. The crude extract was fractionated with ethyl acetate. The ethanolic extract and ethyl acetate fraction were screened of phytochemical content including identification of flavonoids, alkaloids and polyphenolics. The antioxidant activity of the ethanolic extract and ethyl acetate fraction were tested qualitatively with 2,2-diphenyl-1-picrylhydrazyl (DPPH) and phosphomolybdate. Its antioxidant activity was determined quantitatively using DPPH radical scavenging method. Phytochemical screening test showed that ethanolic extract and ethyl acetate fraction from basil leaf contain flavonoids, polyphenolics, and alkaloids. The qualitative analysis of antioxidant activity of ethanolic extract and ethyl acetate fraction from basil leaf showed an antioxidant activity. The IC50 value of ethanolic extract, ethyl acetate fraction and quercetin were 1,374.00±6.20 389.00±1.00 2.10±0.01μg/mL, respectively. The research showed that antioxidant activity of the ethyl acetate fraction more potential than the ethanol extract of the basil leaf, but less than quercetin.

  14. Chemical composition of the essential oil of basil (Ocimum basilicum L. Lamiaceae

    Directory of Open Access Journals (Sweden)

    Jelačić Slavica Ć.


    Full Text Available In Serbia basil has been grown traditionally as a decorative, medicinal, seasoning and ritual herb, and there is a variety of different populations of basil. Basil is considered to have been brought to Serbia in the 12th century by monks returning from their pilgrimages. Essential oils isolated from herb of ten basil populations traditionally grown on the territory of the Republic of Serbia have been analyzed. The selected populations have been designated under codes from T-1 to T-10 and deposited in the Plant Genes Bank at Serbia and at the Institute for Crop Sciences of the Faculty of Agriculture in Belgrade. Essential oils of all tested basil populations were light yellow and had a specific aromatic scent. The composition of essential oil in the dry herb of the tested populations ranged from 0.87 to 1.84%. The results of gas chromatographic analysis of essential oils in tested basil populations pointed to their complex chemical composition and to the fact that they belong to the most appreciated European chemotype. In total thirty three components have been identified in the essential oils. The most common fraction of components in all tested oils was terpenoides. The predominant component in all essential oils is monoterpen linalol, ranging from 51.52 to 74.73%. Phenylpropranoid methylchavicol ranged from 2.49 to 18.97%. Essential oils of populations T-6, T-7, T-8 and T-10 were characterized by elevated 1.8-cineol (4.44, 3.70, 4.01 and 3.43%, respectively. Populations T-3 and T-4 in essential oil contained higher percent of geraniol (4.27 and 3.31%, respectively. In all ten essential oils sesquiterpen fraction consisted of greater number of components, with germacrene having special significance as it was found in high percentage in all populations. The highest content of germacrene was registered in population T-9 (4.30%, T-10 (4.18%, while in others it ranged from 2.17 to 3.69%. Basil populations traditionally grown in Serbia have


    Directory of Open Access Journals (Sweden)



    Full Text Available Basil is a popular medicinal and culinary herb, and its essential oils have been used extensively for many years in food products, perfumery, dental and oral products. Basil essential oils and their principal constituents were found to exhibit antimicrobial activity against a wide range of Gram-negative and Gram-positive bacteria, yeast, and mould. The essential oils obtained from aerial parts of three different species of Ocimum comprising twenty one germplasm lines were investigated for their essential oil composition and antimicrobial activity during 2010. Essential oils from seventeen germplasm lines in Ocimum basilicum and two each in Ocimum tenuiflorum and Ocimum gratissimum were investigated for anti-microbial activity against four bacterial strains (Staphylococcus aureus, Bacillus sps., Escherichia coli and Pseudomonas aeruginosa. The morpho-chemotypes exhibited wide variability for morphological and chemical traits. Anti-bacterial activity was found to be high for Staphylococcus aureus, moderate for Escherichia coli, low for Bacillus and Pseudomonas aeruginosa was highly resistant. The essential oils of Pale Green-Broad Leaves (O. basilicum and CIM Ayu (O. gratissimum exhibited significant antibacterial activity against both S. aureus and E. coli signifying them promising for anti-bacterial activity. No relationship was observed between chemotype specificity and anti-bacterial activity, indicating that apart from major components of essential oil, minor components and other factors may be responsible for anti-microbial activities.

  16. Surface coating changes the physiological and biochemical impacts of nano-TiO2 in basil (Ocimum basilicum) plants. (United States)

    Tan, Wenjuan; Du, Wenchao; Barrios, Ana C; Armendariz, Raul; Zuverza-Mena, Nubia; Ji, Zhaoxia; Chang, Chong Hyun; Zink, Jeffrey I; Hernandez-Viezcas, Jose A; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L


    Little is known about the effects of surface coating on the interaction of engineered nanoparticles (ENPs) with plants. In this study, basil (Ocimum basilicum) was cultivated for 65 days in soil amended with unmodified, hydrophobic (coated with aluminum oxide and dimethicone), and hydrophilic (coated with aluminum oxide and glycerol) titanium dioxide nanoparticles (nano-TiO 2 ) at 125, 250, 500, and 750 mg nano-TiO 2 kg -1 soil. ICP-OES/MS, SPAD meter, and UV/Vis spectrometry were used to determine Ti and essential elements in tissues, relative chlorophyll content, carbohydrates, and antioxidant response, respectively. Compared with control, hydrophobic and hydrophilic nano-TiO 2 significantly reduced seed germination by 41% and 59%, respectively, while unmodified and hydrophobic nano-TiO 2 significantly decreased shoot biomass by 31% and 37%, respectively (p ≤ 0.05). Roots exposed to hydrophobic particles at 750 mg kg -1 had 87% and 40% more Ti than the pristine and hydrophilic nano-TiO 2 ; however, no differences were found in shoots. The three types of particles affected the homeostasis of essential elements: at 500 mg kg - 1 , unmodified particles increased Cu (104%) and Fe (90%); hydrophilic increased Fe (90%); while hydrophobic increased Mn (339%) but reduced Ca (71%), Cu (58%), and P (40%). However, only hydrophobic particles significantly reduced root elongation by 53%. Unmodified, hydrophobic, and hydrophilic particles significantly reduced total sugar by 39%, 38%, and 66%, respectively, compared with control. Moreover, unmodified particles significantly decreased reducing sugar (34%), while hydrophobic particles significantly reduced starch (35%). Although the three particles affected basil plants, coated particles impacted the most its nutritional quality, since they altered more essential elements, starch, and reducing sugars. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. The Influence of Cultivars and Phenological Phases on the Accumulation of Nevadensin and Salvigenin in Basil (Ocimum basilicum). (United States)

    Bernhardt, Botond; Bernáth, Jenő; Gere, Attila; Kókai, Zoltán; Komáromi, Bonifác; Tavaszi-Sárosi, Szilvia; Varga, László; Sipos, László; Szabó, Krisztina


    According to the earlier literature the optimum harvest time for basil is at the full flowering stage if accumulation of essential oil is taken into account. In this research we have investigated our gene-bank stored basil accessions to determine whether the harvest timing is variety specific or not considering their flavonoid accumulation pattern. In our work we have determined by HPLC the content of two main flavonoid compounds, salvigenin and nevadensin, of eight different gene bank accessions from 2013 of Ocimum basilicum L. Data were analysed with the nonparametric Kruskal-Wallis test. Multiple pairwise comparisons were made using the Conover-Iman procedure where the significance level was 5%. We have observed that the optimum harvest time is at the full flowering stage in the case of accessions 'Genovese' and 'Piros', but this was not verified for the others. The result of our experiment has shown that the maximum salvigenin and nevadensin content was detected both at the full- and early flowering period. Almost in all phenological phases the accession 'M. Grünes' accumulated the highest level of nevadensin, while accession 'Lengyel' produced the lowest results in all phenological phases. Generally it could be observed that compared with nevadensin more salvigenin is accumulated, and it is independent of the phenological phases. In the case of salvigenin, 'M. Grünes' accession produced the largest quantity and accession 'Dark Opal' showed the lowest values. Our analyses demonstrated that harvest at different phenological phases may result in different amounts of active agents according to the cultivar.

  18. Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) protect against sodium arsenite-induced hepatotoxicity in Wistar rats. (United States)

    Gbadegesin, M A; Odunola, O A


    We evaluated the effects of aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) on sodium arsenite-induced hepatotoxicity in Wistar rats. We observed that treatment of the animals with the extracts before or just after sodium arsenite administration significantly (p < 0.05) reduced mean liver and serum γ-Glutamyl transferase (γGT), and serum alkaline phosphatase (ALP) activities when compared with the group administered the toxin alone. In addition, treatments of the animals with aqueous or ethanolic extract of O. basilicum before the administration of sodium arsenite resulted in the attenuation of the sodium arsenite-induced aspartate and alanine aminotransferase activities: ALT (from 282.6% to 167.7% and 157.8%), AST (from 325.1% to 173.5% and 164.2%) for the group administered sodium arsenite alone, the aqueous extracts plus sodium arsenite, and ethanolic extracts plus sodium arsenite respectively, expressed as percentage of the negative control. These findings support the presence of hepatoprotective activity in the O.basilicum extracts.

  19. Foliar Exposure of Cu(OH)2 Nanopesticide to Basil ( Ocimum basilicum): Variety-Dependent Copper Translocation and Biochemical Responses. (United States)

    Tan, Wenjuan; Gao, Qin; Deng, Chaoyi; Wang, Yi; Lee, Wen-Yee; Hernandez-Viezcas, Jose A; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L


    In this study, low and high anthocyanin basil ( Ocimum basilicum) varieties (LAV and HAV) were sprayed with 4.8 mg Cu/per pot from Cu(OH) 2 nanowires, Cu(OH) 2 bulk (CuPro), or CuSO 4 and cultivated for 45 days. In both varieties, significantly higher Cu was determined in leaves of CuSO 4 exposed plants (691 and 672.6 mg/kg for LAV and HAV, respectively); however, only in roots of HAV, Cu was higher, compared to control ( p ≤ 0.05). Nanowires increased n-decanoic, dodecanoic, octanoic, and nonanoic acids in LAV, but reduced n-decanoic, dodecanoic, octanoic, and tetradecanoic acids in HAV, compared with control. In HAV, all compounds reduced eugenol (87%), 2-methylundecanal (71%), and anthocyanin (3%) ( p ≤ 0.05). In addition, in all plant tissues, of both varieties, nanowires and CuSO 4 reduced Mn, while CuPro increased chlorophyll contents, compared with controls ( p ≤ 0.05). Results suggest that the effects of Cu(OH) 2 pesticides are variety- and compound-dependent.

  20. UV‐B is Required for Normal Development of Oil Glands in Ocimum basilicum L. (Sweet Basil) (United States)



    Plants of Ocimum basilicum L. grown under glass were exposed to short treatments with supplementary UV‐B. The effect of UV‐B on volatile essential oil content was analysed and compared with morphological effects on the peltate and capitate glandular trichomes. In the absence of UV‐B, both peltate and capitate glands were incompletely developed in both mature and developing leaves, the oil sacs being wrinkled and only partially filled. UV‐B was found to have two main effects on the glandular trichomes. During the first 4 d of treatment, both peltate and capitate glands filled and their morphology reflected their ‘normal’ mature development as reported in the literature. During the following days there was a large increase in the number of broken oil sacs among the peltate glands as the mature glands broke open, releasing volatiles. Neither the number of glands nor the qualitative or quantitative composition of the volatiles was affected by UV‐B. There seems to be a requirement for UV‐B for the filling of the glandular trichomes of basil. PMID:12324268

  1. Comparison the effect of organic and chemical fertilizers on yield and essential oil percentage of Basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    S.M.K. Tahami


    Full Text Available In order to have a sustainable agriculture it is necessary to use environmental friendly inputs to improve ecological aspects of environment. Basil (Ocimum basilicum L. is a medicinal and vegetable crop which is cultivated in different parts of the world. An experiment was conducted at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, in year 2009. A complete randomized block design with six treatments, and three replications was used. The treatments were: control (no fertilizer, cow manure, sheep manure, hen manure, vermin-compost and NPK fertilizers. Results showed that all studied organic manures were high in measured characters in compare with chemical fertilizer. The highest plant height, leaf yield, fresh and dry matter were obtained at vermicompost. Treatments have no significant affect on Essential oil percentage. The highest essential oil yield was obtained in cow manure treatments. Third cut and the first cut had the maximum and the minimum of leaf yield, fresh and dry shoot yield, respectively. Essential oil percentage in the first cut was significantly more than other cuts, but essential oil yield, were the highest in third cut because this cut produced highest leaf yield. There was no significant difference between chemical fertilizers and control treatment in all characters except green area index and fresh and dry leaf weight in a plant.

  2. Efficiency of n-octyl-acetate, 2-heptanone and citronellal in repelling bees from basil (Ocimum sellowii - Labiatae

    Directory of Open Access Journals (Sweden)

    Darclet Teresinha Malerbo-Souza


    Full Text Available The objective of this study was to test repellent substances for honey bees, Apis mellifera, for basil, Ocimum sellowii, and to study the most frequent insects in this crop as well as its behaviors. The frequency of honey bees did not decrease with the application of n.octyl.acetate, citronellal and 2.heptanone, used as repellents, in the concentrations 2.5, 5.0, 7.5 and 10.0% diluted in water. However, when the products (20% were diluted in water (75% and glycerine (5% were effective in repelling those bees of the basil flowers for a period of 20 minutes. The flower lasted, on average, 30 h from the bud phase until the flower withered. The flowers number opened by inflorescence was, on average, 5.65 flowers, and the inflorescence presented, on average, 160 flowers-buds. The basil was visited mainly for the honey bee (98.0%, followed by Augochloropsis electra bee - Halictidae (2.0% and visits sporadics of Diptera and Lepidoptera, collected only nectar. The honey bee frequency increased during the day to 14:00, decreasing soon after, accompanying the curve of the temperature sets registered in the experiment days.O objetivo do experimento foi estudar a polinização em manjericão (Ocimum sellowii, a fim de verificar sua atratividade para as abelhas Apis mellifera, os insetos mais freqüentes, bem como seus comportamentos e testar substâncias repelentes para as abelhas A. mellifera. A flor durou, em média, 30 horas, desde sua abertura até o murchamento. O número de flores abertas por inflorescência foi, em média, 5,65 flores, sendo que a inflorescência possuía, em média, 160 botões florais. O manjericão foi visitado quase que exclusivamente pela abelha A. mellifera africanizada (98,0%, seguida pela abelha Augochloropsis electra-Halictidae (2,0% e visitas esporádicas de dípteros e lepidópteros, sendo que todos coletavam apenas néctar. A freqüência da abelha africanizada aumentou no decorrer do dia até às 14 horas, diminuindo em

  3. Avaliação das estruturas secretoras de Ocimum gratissimum var. macrophyllum Briq. (Lamiaceae após extração dos constituintes voláteis Evaluation of secretory structures of Ocimum gratissimum var. macrophyllum Briq. (Lamiaceae after extraction of volatile compounds

    Directory of Open Access Journals (Sweden)

    A.S. Alvarez


    Full Text Available O impacto provocado nas estruturas secretoras de folhas adultas de Ocimum gratissimum var. macrophyllum após extração dos componentes voláteis utilizando-se diferentes métodos de extração foi investigado através de microscopia eletrônica de varredura (MEV. Secções transversais do ápice, da nervura central, e da margem mostraram superfície com cutícula estriada, estômatos diacíticos, tricomas tectores simples, filiformes, e glandulares peltados. Os peltados, com estrutura envolta por uma cutícula contendo o exsudado celular, variaram de 60 a 80µm de diâmetro sendo formados por uma porção apical multicelular com disposição radial formada por dois círculos concêntricos com 9 a 16 células. Na região central do ápice do tricoma peltado se identificou a presença de 4 células em forma de vértice dispostas sobre o pedúnculo, sendo esta a região mais externa formada por número variável de células. Os componentes voláteis das folhas adultas foram extraídos por hidrodestilação (HD, destilação-extração simultânea (DES, e solvente (SO. Os dados obtidos evidenciaram que o maior impacto nas estruturas secretoras ocorreu após extração por hidrodestilação quando comparado aos outros métodos utilizados. A porcentagem dos principais constituintes químicos, timol e γ-terpineno variaram de acordo com o método de extração: timol (HD = 25,4%, SO = 18,2%, DES = 54,8% e γ-terpineno (HD = 38,2%, SO = ausente, DES = 13,7%.The impact on the secretory structures of mature leaves of Ocimum gratissimum var. macrophyllum, after extraction of the volatile compounds using different extraction methods, was investigated by scanning electron microscopy (SEM. Cross-sections of the apex, the midrib and the margin showed surface with striated cuticle, diacitic stomata, single tector, filiform and glandular peltate trichomes. The peltate trichomes with a structure surrounded by cuticle containing the celllular exudate ranged from

  4. Effect of silica Nanoparticles on Basil (Ocimum basilicum Under Salinity Stress

    Directory of Open Access Journals (Sweden)

    Manizheh Kalteh


    Full Text Available Application of nanofertilizers is one of the promising methods for increasing resources use efficiency and reducing environmental pollutions. Uncontrolled application of chemical fertilizer and pesticides has caused many problems to human health and domestic animals. Nanofertilizers application could be a suitable way to reduce these problems. Accordingly, in order to assess the silicon nanoparticles effect on some vegetative features of basil under salinity stress, a factorial experiment based on a completely randomized design with three replications was conducted in greenhouse condition. Treatments included different levels of silicon fertilizer (without silicon, normal silicon fertilizer and silicon nanoparticles and salinity stress (1, 3 and 6 ds/m. Physiological traits (chlorophyll and proline content of leaves and morphological traits (shoot fresh weight and dry weight were investigated in this study. Results showed a significant reduction in growth and development indices due to the salinity stress.  Leaf dry and fresh weight reduced by increment in NaCl concentration while significantly (P≤0.01 increased with silicon nanoparticles application. The chlorophyll content reduced in salinity stress, but increased by silicon nanoparticles treatment. Proline content increased under salinity stress which was a response to stress. Moreover, proline increased by silicon nanoparticles which was due to tolerance induction in plant. Silicon nanoparticles application reduced the pollution effects originated from salinity in Basil.

  5. Influence of the harvesting time, temperature and drying period on basil (Ocimum basilicum L. essential oil

    Directory of Open Access Journals (Sweden)

    José Luiz S. Carvalho Filho

    Full Text Available Ocimum basilicum L. essential oil with high concentration of linalool is valuable in international business. O. basilicum essential oil is widely used as seasoning and in cosmetic industry. To assure proper essential oil yield and quality, it is crucial to determine which environmental and processing factors are affecting its composition. The goal of our work is to evaluate the effects of harvesting time, temperature, and drying period on the yield and chemical composition of O. basilicum essential oil. Harvestings were performed 40 and 93 days after seedling transplantation. Harvesting performed at 8:00 h and 12:00 h provided higher essential oil yield. After five days drying, the concentration of linalool raised from 45.18% to 86.80%. O. basilicum should be harvested during morning and the biomass dried at 40ºC for five days to obtain linalool rich essential oil.

  6. The effect of essential oil of basil (Ocimum basilicum L.) on UV-induced mutagenesis in Escherichia coli and Saccharomyces cerevisiae

    Energy Technology Data Exchange (ETDEWEB)

    Stanojević, Jasna; Berić, Tanja; Opačić, Biljana; Vuković-Gačić, Branka; Simić, Draga; Knežević-Vukčević, Jelena [Institute of Botany, Faculty of Biology, University of Belgrade, 11000 Belgrade (Serbia)


    The antimutagenic potential of essential oil (EO) of basil (Ocimum basilicum L.) and its major constituent linalool were studied with the E. coli K12 and S. cerevisiae D7 assays. In the E. coli assay, EO and linalool inhibited UV-induced mutagenesis in a repair-proficient strain, but had no effect on spontaneous mutagenesis in repair-proficient, nucleotide excision repair-deficient, and mismatch-deficient strains. By testing participation of different mechanisms involved in antimutagenesis, it was concluded that the antimutagenic effect against UV-induced mutagenesis involved decrease of protein synthesis and cell proliferation which led to increased efficiency of nucleotide excision repair. An antimutagenic effect of basil derivatives in S. cerevisiae was not detected. (author)

  7. The effect of essential oil of basil (Ocimum basilicum L.) on UV-induced mutagenesis in Escherichia coli and Saccharomyces cerevisiae

    International Nuclear Information System (INIS)

    Stanojević, Jasna; Berić, Tanja; Opačić, Biljana; Vuković-Gačić, Branka; Simić, Draga; Knežević-Vukčević, Jelena


    The antimutagenic potential of essential oil (EO) of basil (Ocimum basilicum L.) and its major constituent linalool were studied with the E. coli K12 and S. cerevisiae D7 assays. In the E. coli assay, EO and linalool inhibited UV-induced mutagenesis in a repair-proficient strain, but had no effect on spontaneous mutagenesis in repair-proficient, nucleotide excision repair-deficient, and mismatch-deficient strains. By testing participation of different mechanisms involved in antimutagenesis, it was concluded that the antimutagenic effect against UV-induced mutagenesis involved decrease of protein synthesis and cell proliferation which led to increased efficiency of nucleotide excision repair. An antimutagenic effect of basil derivatives in S. cerevisiae was not detected. (author)

  8. Effects of the exposure of TiO2 nanoparticles on basil (Ocimum basilicum) for two generations. (United States)

    Tan, Wenjuan; Du, Wenchao; Darrouzet-Nardi, Anthony J; Hernandez-Viezcas, Jose A; Ye, Yuqing; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L


    There is a lack of information about the transgenerational effects of titanium dioxide nanoparticles (nano-TiO 2 ) in plants. This study aimed to evaluate the impacts of successive exposure of nano-TiO 2 with different surface properties to basil (Ocimum basilicum). Seeds from plants exposed or re-exposed to pristine, hydrophobic, or hydrophilic nano-TiO 2 were cultivated for 65 days in soil unamended or amended with 750 mg·kg -1 of the respective particles. Plant growth, concentration of titanium and essential elements, as well as content of carbohydrates and chlorophyll were evaluated. There were no differences on Ti concentration in roots of plants sequentially exposed to pristine or hydrophobic nano-TiO 2 , or in roots of plants exposed to the corresponding particle, only in the second cycle. However, sequential exposure to hydrophilic particles resulted in 65.2% less Ti in roots, compared to roots of plants exposed the same particles, only in the second cycle. The Ti concentrations in shoots were similar in all treatments. On the other hand, pristine and hydrophilic particles reduced Mg in root by 115% and 81%, respectively, while pristine and hydrophobic particles reduced Ni in shoot by 84% and 75%, respectively, compared to unexposed plants in both cycles. Sequential exposure to pristine nano-TiO 2 increased stomatal conductance (214%, p ≤ 0.10), compared to plants that were never exposed. Hydrophobic and hydrophilic nano-TiO 2 reduced chlorophyll b (52%) and total chlorophyll (30%) but increased total sugar (186%) and reducing sugar (145%), compared to unexposed plants in both cycles. Sequential exposure to hydrophobic or hydrophilic nano-TiO 2 resulted in more adverse effects on photosynthesis but in positive effects on plant growth, compared to pristine nano-TiO 2 . Copyright © 2018 Elsevier B.V. All rights reserved.

  9. Regulation of Floral Terpenoid Emission and Biosynthesis in Sweet Basil (Ocimum basilicum). (United States)

    Jiang, Yifan; Ye, Jiayan; Li, Shuai; Niinemets, Ülo


    Past studies have focused on the composition of essential oil of Ocimum basilicum leaves, but data on composition and regulation of its aerial emissions, especially floral volatile emissions are scarce. We studied the chemical profile, within-flower spatial distribution (sepals, petals, pistils with stamina and pedicels), diurnal emission kinetics and effects of exogenous methyl jasmonate (MeJA) application on the emission of floral volatiles by dynamic headspace collection and identification using gas chromatography-mass spectrometry (GC-MS) and proton transfer reaction mass spectrometry (PTR-MS). We observed more abundant floral emissions from flowers compared with leaves. Sepals were the main emitters of floral volatiles among the flower parts studied. The emissions of lipoxygenase compounds (LOX) and monoterpenoids, but not sesquiterpene emissions, displayed a diurnal variation driven by light. Response to exogenous MeJA treatment of flowers consisted of a rapid stress response and a longer-term acclimation response. The initial response was associated with enhanced emissions of fatty acid derivatives, monoterpenoids, and sesquiterpenoids without variation of the composition of individual compounds. The longer-term response was associated with enhanced monoterpenoid and sesquiterpenoid emissions with profound changes in the emission spectrum. According to correlated patterns of terpenoid emission changes upon stress, highlighted by a hierarchical cluster analysis, candidate terpenoid synthases responsible for observed diversity and complexity of released terpenoid blends were postulated. We conclude that flower volatile emissions differ quantitatively and qualitatively from leaf emissions, and overall contribute importantly to O. basilicum flavor, especially under stress conditions.

  10. Regulation of Floral Terpenoid Emission and Biosynthesis in Sweet Basil (Ocimum basilicum) (United States)

    Jiang, Yifan; Ye, Jiayan; Li, Shuai; Niinemets, Ülo


    Past studies have focused on the composition of essential oil of Ocimum basilicum leaves, but data on composition and regulation of its aerial emissions, especially floral volatile emissions are scarce. We studied the chemical profile, within-flower spatial distribution (sepals, petals, pistils with stamina and pedicels), diurnal emission kinetics and effects of exogenous methyl jasmonate (MeJA) application on the emission of floral volatiles by dynamic headspace collection and identification using gas chromatography-mass spectrometry (GC-MS) and proton transfer reaction mass spectrometry (PTR-MS). We observed more abundant floral emissions from flowers compared with leaves. Sepals were the main emitters of floral volatiles among the flower parts studied. The emissions of lipoxygenase compounds (LOX) and monoterpenoids, but not sesquiterpene emissions, displayed a diurnal variation driven by light. Response to exogenous MeJA treatment of flowers consisted of a rapid stress response and a longer-term acclimation response. The initial response was associated with enhanced emissions of fatty acid derivatives, monoterpenoids, and sesquiterpenoids without variation of the composition of individual compounds. The longer-term response was associated with enhanced monoterpenoid and sesquiterpenoid emissions with profound changes in the emission spectrum. According to correlated patterns of terpenoid emission changes upon stress, highlighted by a hierarchical cluster analysis, candidate terpenoid synthases responsible for observed diversity and complexity of released terpenoid blends were postulated. We conclude that flower volatile emissions differ quantitatively and qualitatively from leaf emissions, and overall contribute importantly to O. basilicum flavor, especially under stress conditions. PMID:29367803

  11. Analysis of Caffeic Acid Extraction From Ocimum gratissimum Linn. by High Performance Liquid Chromatography and its Effects on a Cervical Cancer Cell Line

    Directory of Open Access Journals (Sweden)

    Je-Chiuan Ye


    Conclusion: This paper shows that high performance liquid chromatography is a suitable analytical method for determining caffeic acid levels in O. gratissimum, Ju ZenTa, and several vegetable oils. Caffeic acid can suppress the proliferation of HeLa cells.

  12. Extraction optimization of mucilage from Basil (Ocimum basilicum L.) seeds using response surface methodology. (United States)

    Nazir, Sadaf; Wani, Idrees Ahmed; Masoodi, Farooq Ahmad


    Aqueous extraction of basil seed mucilage was optimized using response surface methodology. A Central Composite Rotatable Design (CCRD) for modeling of three independent variables: temperature (40-91 °C); extraction time (1.6-3.3 h) and water/seed ratio (18:1-77:1) was used to study the response for yield. Experimental values for extraction yield ranged from 7.86 to 20.5 g/100 g. Extraction yield was significantly ( P  < 0.05) affected by all the variables. Temperature and water/seed ratio were found to have pronounced effect while the extraction time was found to have minor possible effects. Graphical optimization determined the optimal conditions for the extraction of mucilage. The optimal condition predicted an extraction yield of 20.49 g/100 g at 56.7 °C, 1.6 h, and a water/seed ratio of 66.84:1. Optimal conditions were determined to obtain highest extraction yield. Results indicated that water/seed ratio was the most significant parameter, followed by temperature and time.

  13. Characterization of new biodegradable edible film made from basil seed (Ocimum basilicum L.) gum. (United States)

    Khazaei, Naimeh; Esmaiili, Mohsen; Djomeh, Zahra Emam; Ghasemlou, Mehran; Jouki, Mohammad


    It is well known that the market for edible films is experiencing remarkable growth and expected to continue. This study investigated the using of basil seed gum (BSG) as a new film-forming material under the influence of addition of glycerol (GLY) as plasticizer. Edible films based on BSG and three different concentrations of GLY (25%, 35%, and 50% w/w BSG) were developed, and their water vapor permeability (WVP), as well as physical, thermal and mechanical properties were measured. The addition of glycerol significantly increased water vapor permeability and solubility of the film (p<0.05). As expected, the increase in GLY concentration from 25% to 50% (w/w) increased the extensibility, but decreased tensile strength. This suggests weaker mechanical strength and higher mobility of polymer chains by plasticizing effect of GLY. The color measurement values showed that increasing the glycerol concentration in polymer matrix caused the b and L values increased while ΔE value decreased. The electron scanning micrograph showed plasticized films as smooth, and uniform which lacked pores or cracks compared with those were not plasticized. This study revealed that the BSG had a good potential to be used in producing edible films for various food applications. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Biosynthesis of estragole and methyl-eugenol in sweet basil (Ocimum basilicum L). Developmental and chemotypic association of allylphenol O-methyltransferase activities. (United States)

    Lewinsohn, E; Ziv-Raz, I; Dudai, N; Tadmor, Y; Lastochkin, E; Larkov, O; Chaimovitsh, D; Ravid, U; Putievsky, E; Pichersky, E; Shoham, Y


    Sweet basil (Ocimum basilicum L., Lamiaceae) is a common herb, used for culinary and medicinal purposes. The essential oils of different sweet basil chemotypes contain various proportions of the allyl phenol derivatives estragole (methyl chavicol), eugenol, and methyl eugenol, as well as the monoterpene alcohol linalool. To monitor the developmental regulation of estragole biosynthesis in sweet basil, an enzymatic assay for S-adenosyl-L-methionine (SAM):chavicol O-methyltransferase activity was developed. Young leaves display high levels of chavicol O-methyltransferase activity, but the activity was negligible in older leaves, indicating that the O-methylation of chavicol primarily occurs early during leaf development. The O-methyltransferase activities detected in different sweet basil genotypes differed in their substrate specificities towards the methyl acceptor substrate. In the high-estragole-containing chemotype R3, the O-methyltransferase activity was highly specific for chavicol, while eugenol was virtually not O-methylated. In contrast, chemotype 147/97, that contains equal levels of estragole and methyl eugenol, displayed O-methyltransferase activities that accepted both chavicol and eugenol as substrates, generating estragole and methyl eugenol, respectively. Chemotype SW that contains high levels of eugenol, but lacks both estragole and methyl eugenol, had apparently no allylphenol dependent O-methyltransferase activities. These results indicate the presence of at least two types of allylphenol-specific O-methyltransferase activities in sweet basil chemotypes, one highly specific for chavicol; and a different one that can accept eugenol as a substrate. The relative availability and substrate specificities of these O-methyltransferase activities biochemically rationalizes the variation in the composition of the essential oils of these chemotypes.

  15. Effect of different concentrations of cadmium growth and morphological changes in basil (ocimum basilicum)

    International Nuclear Information System (INIS)

    Nazarian, M.; Amouzgar, D.; Sedghianzadeh, H.


    This study was conducted on four treatments (0, 3, 5 and 10 milligrams per liter of cadmium nitrate solution) and three replications in a completely randomized design. The morphological characteristics including fresh weight, dry weight, stem length, root length, leaf weight ratio, measuring index of the imposed stress, specific leaf area and water availability per unit leaf area, and the amount of cadmium in stems and roots were measured. By increasing cadmium treatment at 10 ppm concentration, the root growth varied between 3.47 and 1.93 cm and the lowest root growth belonged to the treatment at 10 ppm concentration measured 1.93 ± 0.4 cm. The rising stem growth was also indicated. Fresh and dry weight analysis indicates their descending growth. The growth reduction was observed by increasing cadmium treatment at 10 ppm concentration in the study of the trait of weight and specific leaf area. Relative water content (RWC) of the leaves varies between 81 to 89 percent which represents the greatest amount of stress in the treatment at 10 ppm concentration. A notable decline in transport from the root to stem and a significant reduction in plant tolerance index were observed through the analysis of transfer factor and tolerance index in plants. The process of reducing metal transition from the root to stem has become slower by increasing the substance concentration. Basil can absorb and accumulate cadmium and its root is able to accumulate more quantity of the metal than its stem. The morphological signs of cadmium toxicity are remarkable through discolored roots, shortening the distance between nodes, creating an amorphous spots on the leaves, reducing the leaves extent and a slight pallor of the leaves. (author)

  16. Essential oil composition of sweet basil (Ocimum basilicum L.) in symbiotic relationship with Piriformospora indica and paclobutrazol application under salt stress. (United States)

    Keramati, Sara; Pirdashti, Hemmatollah; Babaeizad, Valliollah; Dehestani, Ali


    Essential oil content and oil composition of paclobutrazol treated sweet basil (Ocimum basilicum L.) plant inoculated with Piriformospora indica under salt stress were investigated by GC-MS. The results show a slight increase in essential oil content when basil plants subjected to moderate salinity stress (3 dS m -1 of NaCl). It decreased signifiicantly with increasing salinity level to 9 dS m -1 . The findings revealed that leaf area, above ground and leaf dry weights, essential oil content and yield were significantly affected by P. indica inoculation, however paclobutrazol application significantly influenced essential oil yield but not content. Fungal symbiosis as well as paclobutrazol application ameliorated the negative effects of salinity on dry matter and essential oil yield. The main constituents found in the volatile oil of O. basilicum in control treatment were Geranial (26.03%), Neral (24.88%) and Estragole (24.78%). The compounds concentrations showed some differences in P. indica and paclobutrazol treatments. The results demonstrate that micorrhiza-like fungi concomitantly increase essential oil production and biomass in sweet basil, a medicinal herb rich in commercially valuable essential oils.

  17. Fibroblast and keratinocyte gene expression following exposure to the extracts of holy basil plant (Ocimum tenuiflorum, malabar nut plant (Justicia adhatoda, and emblic myrobalan plant (Phyllanthus emblica

    Directory of Open Access Journals (Sweden)

    Takao Someya


    Full Text Available This data article provides gene expression profiles, determined by using real-time PCR, of fibroblasts and keratinocytes treated with 0.01% and 0.001% extracts of holy basil plant (Ocimum tenuiflorum, sri lankan local name “maduruthala”, 0.1% and 0.01% extracts of malabar nut plant (Justicia adhatoda, sri lankan local name “adayhoda” and 0.003% and 0.001% extracts of emblic myrobalan plant (Phyllanthus emblica, sri lankan local name “nelli”, harvested in Sri Lanka. For fibroblasts, the dataset includes expression profiles for genes encoding hyaluronan synthase 1 (HAS1, hyaluronan synthase 2 (HAS2, hyaluronidase-1 (HYAL1, hyaluronidase-2 (HYAL2, versican, aggrecan, CD44, collagen, type I, alpha 1 (COL1A1, collagen, type III, alpha 1 (COL3A1, collagen, type VII, alpha 1 (COL7A1, matrix metalloproteinase 1 (MMP1, acid ceramidase, basic fibroblast growth factor (bFGF, fibroblast growth factor-7 (FGF7, vascular endothelial growth factor (VEGF, interleukin-1 alpha (IL-1α, cyclooxygenase-2 (cox2, transforming growth factor beta (TGF-β, and aquaporin 3 (AQP3. For keratinocytes, the expression profiles are for genes encoding HAS1, HAS2, HYAL1, HYAL2, versican, CD44, IL-1α, cox2, TGF-β, AQP3, Laminin5, collagen, type XVII, alpha 1 (COL17A1, integrin alpha-6 (ITGA6, ceramide synthase 3 (CERS3, elongation of very long chain fatty acids protein 1 (ELOVL1, elongation of very long chain fatty acids protein 4 (ELOVL4, filaggrin (FLG, transglutaminase 1 (TGM1, and keratin 1 (KRT1. The expression profiles are provided as bar graphs. Keywords: Real-time PCR, Gene expression profile, Fibroblast, Keratinocyte, Holy basil extract, Ocimum tenuiflorum, Maduruthala, Malabar nut plant extract, Justicia adhatoda, Adayhoda, Emblic myrobalan extract, Phyllanthus emblica, Nelli

  18. Investigation the Vertical Distribution of Leaf Area and Dry Matter of Sweet Basil (Ocimum basilicum L., Borage (Borago officinalis L. and Cover Crops in Competition with Weeds

    Directory of Open Access Journals (Sweden)

    zeinab shirzadi margavi


    Full Text Available Introduction Distribution of leaf area and dry matter are the effective factors that influence on absorption the radiation, evaporation and transpiration of canopy and eventually dry matter accumulation and grain yield in plants. Plant canopy is the spatial arrangement of shoots in a plant population. In plant canopy, leaves are responsible for radiation absorption and gas exchange with the outside. Stem and branches arrange photosynthetic organs somehow, which gas exchange and light distribution best done. The effect of canopy structure on gas exchange and absorption of radiation in plant communities caused detailed study of the canopy structure to be more important. Materials and methods In order to investigate the vertical distribution of leaf area and dry matter of borage and sweet basil in competition with weeds by cover crops treatments, a field experiment was carried out in a randomized complete block design with 8 treatments and 3 replications in Agricultural Sciences and Natural Resources University of Sari in 2013. Treatments were cover crops mung bean (Vigna radiata L. and Persian clover (Trifolium resupinatum L. in the rows between the sweet basil (Ocimum basilicum L. and borage (Borago officinalis L.. Moreover, in order to evaluate the effectiveness of cover crops to control weeds, pure stand of sweet basil and borage in terms of weeding and no weed controls per replicates were used. Each plot was included 5 rows of medicinal plants. Cover crop inter-seeded simultaneously in the main crop. Estimation of leaf area and dry matter of each plant in different canopy layers (0-20, 20-40, 40-60, 80.100, 100-120 and 120-140 cm were done after 75 planting days, with 1 m × 1 m quadrate per plot. For this purpose a vertical card board frame marked in 20-cm increments was used in the field as a guide to cut standing plants (crops, cover crops and weeds into 20-cm strata increments (Mosier & Oliver, 1995. All samples were transferred to the

  19. Extraction of bioactive compounds and free radical scavenging activity of purple basil (Ocimum basilicum L.) leaf extracts as affected by temperature and time. (United States)

    Pedro, Alessandra C; Moreira, Fernanda; Granato, Daniel; Rosso, Neiva D


    In the current study, response surface methodology (RSM) was used to assess the effects of extraction time and temperature on the content of bioactive compounds and antioxidant activity of purple basil leaf (Ocimum basilicum L.) extracts. The stability of anthocyanins in relation to temperature, light and copigmentation was also studied. The highest anthocyanin content was 67.40 mg/100 g extracted at 30 °C and 60 min. The degradation of anthocyanins with varying temperatures and in the presence of light followed a first-order kinetics and the activation energy was 44.95 kJ/mol. All the extracts exposed to light showed similar half-lives. The extracts protected from light, in the presence of copigments, showed an increase in half-life from 152.67 h for the control to 856.49 and 923.17 h for extract in the presence of gallic acid and phytic acid, respectively. These results clearly indicate that purple basil is a potential source of stable bioactive compounds.

  20. A first linkage map and downy mildew resistance QTL discovery for sweet basil (Ocimum basilicum) facilitated by double digestion restriction site associated DNA sequencing (ddRADseq). (United States)

    Pyne, Robert; Honig, Josh; Vaiciunas, Jennifer; Koroch, Adolfina; Wyenandt, Christian; Bonos, Stacy; Simon, James


    Limited understanding of sweet basil (Ocimum basilicum L.) genetics and genome structure has reduced efficiency of breeding strategies. This is evidenced by the rapid, worldwide dissemination of basil downy mildew (Peronospora belbahrii) in the absence of resistant cultivars. In an effort to improve available genetic resources, expressed sequence tag simple sequence repeat (EST-SSR) and single nucleotide polymorphism (SNP) markers were developed and used to genotype the MRI x SB22 F2 mapping population, which segregates for response to downy mildew. SNP markers were generated from genomic sequences derived from double digestion restriction site associated DNA sequencing (ddRADseq). Disomic segregation was observed in both SNP and EST-SSR markers providing evidence of an O. basilicum allotetraploid genome structure and allowing for subsequent analysis of the mapping population as a diploid intercross. A dense linkage map was constructed using 42 EST-SSR and 1,847 SNP markers spanning 3,030.9 cM. Multiple quantitative trait loci (QTL) model (MQM) analysis identified three QTL that explained 37-55% of phenotypic variance associated with downy mildew response across three environments. A single major QTL, dm11.1 explained 21-28% of phenotypic variance and demonstrated dominant gene action. Two minor QTL dm9.1 and dm14.1 explained 5-16% and 4-18% of phenotypic variance, respectively. Evidence is provided for an additive effect between the two minor QTL and the major QTL dm11.1 increasing downy mildew susceptibility. Results indicate that ddRADseq-facilitated SNP and SSR marker genotyping is an effective approach for mapping the sweet basil genome.

  1. Improvement in Flavonoids and Phenolic Acids Production and Pharmaceutical Quality of Sweet Basil (Ocimum basilicum L.) by Ultraviolet-B Irradiation. (United States)

    Ghasemzadeh, Ali; Ashkani, Sadegh; Baghdadi, Ali; Pazoki, Alireza; Jaafar, Hawa Z E; Rahmat, Asmah


    Sweet basil (Ocimum basilicum Linnaeus) is aromatic herb that has been utilized in traditional medicine. To improve the phytochemical constituents and pharmaceutical quality of sweet basil leaves, ultraviolet (UV)-B irradiation at different intensities (2.30, 3.60, and 4.80 W/m²) and durations (4, 6, 8, and 10-h) was applied at the post-harvest stage. Total flavonoid content (TFC) and total phenolic content (TPC) were measured using spectrophotometric method, and individual flavonoids and phenolic acids were identified using ultra-high performance liquid chromatography. As a key enzyme for the metabolism of flavonoids, chalcone synthase (CHS) activity, was measured using a CHS assay. Antioxidant activity and antiproliferative activity of extracts against a breast cancer cell line (MCF-7) were evaluated using 1,1-diphenyl-2-picrylhydrazyl (DPPH) assays and MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) assays, respectively. UV-B irradiation at an intensity of 3.60 W/m² increased TFC approximately 0.85-fold and also increased quercetin (0.41-fold), catechin (0.85-fold), kaempferol (0.65-fold) rutin (0.68-fold) and luteolin (1.00-fold) content. The highest TPC and individual phenolic acid (gallic acid, cinnamic acid and ferulic acid) was observed in the 3.60 W/m² of UV-B treatment. Cinnamic acid and luteolin were not detected in the control plants, production being induced by UV-B irradiation. Production of these secondary metabolites was also significantly influenced by the duration of UV-B irradiation. Irradiation for 8-h led to higher TFC, TPC and individual flavonoids and phenolic acids than for the other durations (4, 8, and 10-h) except for cinnamic acid, which was detected at higher concentration when irradiated for 6-h. Irradiation for 10-h significantly decreased the secondary metabolite production in sweet basil leaves. CHS activity was induced by UV-B irradiation and highest activity was observed at 3.60 W/m² of UV-B irradiation. UV

  2. Improvement in Flavonoids and Phenolic Acids Production and Pharmaceutical Quality of Sweet Basil (Ocimum basilicum L. by Ultraviolet-B Irradiation

    Directory of Open Access Journals (Sweden)

    Ali Ghasemzadeh


    Full Text Available Sweet basil (Ocimum basilicum Linnaeus is aromatic herb that has been utilized in traditional medicine. To improve the phytochemical constituents and pharmaceutical quality of sweet basil leaves, ultraviolet (UV-B irradiation at different intensities (2.30, 3.60, and 4.80 W/m2 and durations (4, 6, 8, and 10-h was applied at the post-harvest stage. Total flavonoid content (TFC and total phenolic content (TPC were measured using spectrophotometric method, and individual flavonoids and phenolic acids were identified using ultra-high performance liquid chromatography. As a key enzyme for the metabolism of flavonoids, chalcone synthase (CHS activity, was measured using a CHS assay. Antioxidant activity and antiproliferative activity of extracts against a breast cancer cell line (MCF-7 were evaluated using 1,1-diphenyl-2-picrylhydrazyl (DPPH assays and MTT (3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide assays, respectively. UV-B irradiation at an intensity of 3.60 W/m2 increased TFC approximately 0.85-fold and also increased quercetin (0.41-fold, catechin (0.85-fold, kaempferol (0.65-fold rutin (0.68-fold and luteolin (1.00-fold content. The highest TPC and individual phenolic acid (gallic acid, cinnamic acid and ferulic acid was observed in the 3.60 W/m2 of UV-B treatment. Cinnamic acid and luteolin were not detected in the control plants, production being induced by UV-B irradiation. Production of these secondary metabolites was also significantly influenced by the duration of UV-B irradiation. Irradiation for 8-h led to higher TFC, TPC and individual flavonoids and phenolic acids than for the other durations (4, 8, and 10-h except for cinnamic acid, which was detected at higher concentration when irradiated for 6-h. Irradiation for 10-h significantly decreased the secondary metabolite production in sweet basil leaves. CHS activity was induced by UV-B irradiation and highest activity was observed at 3.60 W/m2 of UV-B irradiation. UV

  3. Studies on production techniques of some herb plants: I Effect of Agryl P17 mulching on herb yield and volatile oils of basil (Ocimum basilicum L. and marjoram (Origanum majorana L.

    Directory of Open Access Journals (Sweden)

    S. Hälvä


    Full Text Available Agryl P17 fiber-mulching of cold-sensitive herbal plants, basil (Ocimum basilicum L. and marjoram (Origanum majorana L., were studied at three locations in Finland (1984—1985. The growing sites were Helsinki (60° 14' N, Sahalahti (61° 28' N, and Inari (69° 04' N for both species in 1984, and Helsinki for marjoram in 1985. Agryl P17 mulching increased basil yield at all locations. The uncovered basil yielded approximately 54 kg/100 m2 and when grown under the mulch, more than three fold, 191 kg/ 100m2. In the north (Inari, however, basil and marjoram did not give practically any yield. Marjoram did not benefit from mulching either in the south: the yield was 96 kg without and 80 kg/100m2 with mulching. The vegetation under the mulch was severely affected by fungus diseases. The volatile oil content in the dried basil herb ranged from 0.46 to 0.93 %. There were no significant differences in the total oil content whether basil was grown with or without Agryl P17. The oil content in marjoram ranged from 1.94 to 2.55 % the total content being significantly higher when grown under the cover.

  4. The impact of arbuscular mycorrhizal fungi in mitigating salt-induced adverse effects in sweet basil (Ocimum basilicum L.). (United States)

    Elhindi, Khalid M; El-Din, Ahmed Sharaf; Elgorban, Abdallah M


    Salinity is one of the serious abiotic stresses adversely affecting the majority of arable lands worldwide, limiting the crop productivity of most of the economically important crops. Sweet basil ( Osmium basilicum ) plants were grown in a non-saline soil (EC = 0.64 dS m -1 ), in low saline soil (EC = 5 dS m -1 ), and in a high saline soil (EC = 10 dS m -1 ). There were differences between arbuscular mycorrhizal ( Glomus deserticola ) colonized plants (+AMF) and non-colonized plants (-AMF). Mycorrhiza mitigated the reduction of K, P and Ca uptake due to salinity. The balance between K/Na and between Ca/Na was improved in +AMF plants. Growth enhancement by mycorrhiza was independent from plant phosphorus content under high salinity levels. Different growth parameters, salt stress tolerance and accumulation of proline content were investigated, these results showed that the use of mycorrhizal inoculum (AMF) was able to enhance the productivity of sweet basil plants under salinity conditions. Mycorrhizal inoculation significantly increased chlorophyll content and water use efficiency under salinity stress. The sweet basil plants appeared to have high dependency on AMF which improved plant growth, photosynthetic efficiency, gas exchange and water use efficiency under salinity stress. In this study, there was evidence that colonization with AMF can alleviate the detrimental salinity stress influence on the growth and productivity of sweet basil plants.

  5. The impact of arbuscular mycorrhizal fungi in mitigating salt-induced adverse effects in sweet basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Khalid M. Elhindi


    Full Text Available Salinity is one of the serious abiotic stresses adversely affecting the majority of arable lands worldwide, limiting the crop productivity of most of the economically important crops. Sweet basil (Osmium basilicum plants were grown in a non-saline soil (EC = 0.64 dS m−1, in low saline soil (EC = 5 dS m−1, and in a high saline soil (EC = 10 dS m−1. There were differences between arbuscular mycorrhizal (Glomus deserticola colonized plants (+AMF and non-colonized plants (−AMF. Mycorrhiza mitigated the reduction of K, P and Ca uptake due to salinity. The balance between K/Na and between Ca/Na was improved in +AMF plants. Growth enhancement by mycorrhiza was independent from plant phosphorus content under high salinity levels. Different growth parameters, salt stress tolerance and accumulation of proline content were investigated, these results showed that the use of mycorrhizal inoculum (AMF was able to enhance the productivity of sweet basil plants under salinity conditions. Mycorrhizal inoculation significantly increased chlorophyll content and water use efficiency under salinity stress. The sweet basil plants appeared to have high dependency on AMF which improved plant growth, photosynthetic efficiency, gas exchange and water use efficiency under salinity stress. In this study, there was evidence that colonization with AMF can alleviate the detrimental salinity stress influence on the growth and productivity of sweet basil plants.

  6. Phytochemical screening and evaluation of cardioprotective activity of ethanolic extract of Ocimum basilicum L. (basil) against isoproterenol induced myocardial infarction in rats (United States)


    Background and the purpose of the study The objectives of the present study were phytochemical screening and study of the effects of ethanolic extract of aerial parts of Ocimum basilicum (basil) on cardiac functions and histopathological changes in isoproterenol-induced myocardial infarction (MI). Methods The leaves of the plant were extracted with ethanol by maceration and subjected to colorimetry to determine flavonoids and phenolic compounds. High-performance TLC analysis and subsequent CAMAG's TLC scanning were performed to quantify rosmarinic acid content. Wistar rats were assigned to 6 groups of normal control, sham, isoproterenol, and treatment with 10, 20, and 40 mg/kg of the extract two times per day concurrent with MI induction. A subcutaneous injection of isoproterenol (100 mg/kg/day) for 2 consecutive days was used to induce MI. Results Phytochemical screening indicated the presence of phenolic compounds (5.36%) and flavonoids (1.86%). Rosmarinic acid was the principal phenolic compound with a 15.74% existence. The ST-segment elevation induced by isoproterenol was significantly suppressed by all doses of the extract. A severe myocardial necrosis and fibrosis with a sharp reduction in left ventricular contractility and a marked increase in left ventricular end-diastolic pressure were seen in the isoproterenol group, all of which were significantly improved by the extract treatment. In addition to in-vitro antioxidant activity, the extract significantly suppressed the elevation of malondialdehyde levels both in the serum and the myocardium. Conclusion The results of the study demonstrate that Ocimum basilicum strongly protected the myocardium against isoproterenol-induced infarction and suggest that the cardioprotective effects could be related to antioxidative activities. PMID:23351503

  7. Phytochemical Screening and Evaluation of Cardioprotective Activity of Ethanolic Extract of Ocimum Basilicum L. (Basil Against Isoproterenol Induced Myocardial Infarction in Rats

    Directory of Open Access Journals (Sweden)

    Hamid Soraya


    Full Text Available Background and the purpose of the study: The objectives of the present study were phytochemical screening and study of the effects of ethanolic extract of aerial parts of Ocimum basilicum (basil on cardiac functions and histopathological changes in isoproterenol-induced myocardial infarction (MI.Methods: The leaves of the plant were extracted with ethanol by maceration and subjected to colorimetry to determine flavonoids and phenolic compounds. High-performance TLC analysis and subsequent CAMAG's TLC scanning were performed to quantify rosmarinic acid content. Wistar rats were assigned to 6 groups of normalcontrol, sham, isoproterenol, and treatment with 10, 20, and 40 mg/kg of the extract two times per day concurrent with MI induction. A subcutaneous injection of isoproterenol (100 mg/kg/day for 2 consecutive days was used to induce MI.Results: Phytochemical screening indicated the presence of phenolic compounds (5.36% and flavonoids (1.86%.Rosmarinic acid was the principal phenolic compound with a 15.74% existence. The ST-segment elevation induced by isoproterenol was significantly suppressed by all doses of the extract. A severe myocardial necrosis and fibrosis with a sharp reduction in left ventricular contractility and a marked increase in left ventricular end-diastolic pressure were seen in the isoproterenol group, all of which were significantly improved by the extract treatment. In addition to in-vitro antioxidant activity, the extract significantly suppressed the elevation of malondialdehyde levels both inthe serum and the myocardium.Conclusion: The results of the study demonstrate that Ocimum basilicum strongly protected the myocardium against isoproterenol-induced infarction and suggest that the cardioprotective effects could be related to antioxidative activities.

  8. Phytochemical screening and evaluation of cardioprotective activity of ethanolic extract of Ocimum basilicum L. (basil against isoproterenol induced myocardial infarction in rats

    Directory of Open Access Journals (Sweden)

    Fathiazad Fatemeh


    Full Text Available Abstract Background and the purpose of the study The objectives of the present study were phytochemical screening and study of the effects of ethanolic extract of aerial parts of Ocimum basilicum (basil on cardiac functions and histopathological changes in isoproterenol-induced myocardial infarction (MI. Methods The leaves of the plant were extracted with ethanol by maceration and subjected to colorimetry to determine flavonoids and phenolic compounds. High-performance TLC analysis and subsequent CAMAG's TLC scanning were performed to quantify rosmarinic acid content. Wistar rats were assigned to 6 groups of normal control, sham, isoproterenol, and treatment with 10, 20, and 40 mg/kg of the extract two times per day concurrent with MI induction. A subcutaneous injection of isoproterenol (100 mg/kg/day for 2 consecutive days was used to induce MI. Results Phytochemical screening indicated the presence of phenolic compounds (5.36% and flavonoids (1.86%. Rosmarinic acid was the principal phenolic compound with a 15.74% existence. The ST-segment elevation induced by isoproterenol was significantly suppressed by all doses of the extract. A severe myocardial necrosis and fibrosis with a sharp reduction in left ventricular contractility and a marked increase in left ventricular end-diastolic pressure were seen in the isoproterenol group, all of which were significantly improved by the extract treatment. In addition to in-vitro antioxidant activity, the extract significantly suppressed the elevation of malondialdehyde levels both in the serum and the myocardium. Conclusion The results of the study demonstrate that Ocimum basilicum strongly protected the myocardium against isoproterenol-induced infarction and suggest that the cardioprotective effects could be related to antioxidative activities.

  9. Hypoglycemic effect of basil (Ocimum basilicum) aqueous extract is mediated through inhibition of α-glucosidase and α-amylase activities: an in vitro study. (United States)

    El-Beshbishy, Ha; Bahashwan, Sa


    The present study investigated the in vitro hypoglycemic activity of basil (Ocimum basilicum) aqueous extract. Preliminary phytochemical screening of the extract revealed the presence of reducing sugars, cardiac glycosides, tannins, saponins, glycosides, flavonoids and steroids. The total polyphenols content (TPC), flavonoids content (FC), percentage diphenylpicrylhydrazyl (DPPH( · )) radical inhibition and total antioxidant status (TAS) were estimated. The FC was 41 ± 2.2 rutin/g dry extract, the TPC was 146 ± 5.26 mg catechin/g dry extract and the TAS was 5.12 ± 0.7 mmol/L. The %DPPH( · ) free radical inhibition was 60%, 54%, 49% and 43%, respectively, for different extract concentrations; 20, 18.2, 16.3 and 14.5 mg/ml, respectively. The extract elicited significant dose-dependent pattern against rat intestinal sucrase (RIS; IC(50) = 36.72 mg/ml), rat intestinal maltase (RIM; IC(50) = 21.31 mg/ml) and porcine pancreatic α-amylase (PPA; IC(50) = 42.50 mg/ml) inhibitory activities. The inhibition was greater against maltase compared with sucrase. These effects may be attributed to the high TPC and FC levels. The linear regression analysis revealed strong significant positive correlations between %DPPH( · ) radical inhibition and each of %RIS, %RIM and %PPA inhibiting activity. Also, strong significant positive correlations between %RIS and either %RIM or %PPA inhibition activity were observed. We concluded therefore that basil aqueous extract via antioxidant and possibly α-glucosidase and α-amylase inhibiting activities, offered positive benefits to control diabetes.

  10. Elevated CO2 induces a global metabolic change in basil (Ocimum basilicum L.) and peppermint (Mentha piperita L.) and improves their biological activity. (United States)

    Al Jaouni, Soad; Saleh, Ahmed M; Wadaan, Mohammed A M; Hozzein, Wael N; Selim, Samy; AbdElgawad, Hamada

    Many studies have discussed the influence of elevated carbon dioxide (eCO 2 ) on modeling and crop plants. However, much less effort has been dedicated to herbal plants. In this study, a robust monitoring for the levels of 94 primary and secondary metabolites and minerals in two medicinal herbs, basil (Ocimum basilicum L.) and peppermint (Mentha piperita L.), grwon under both ambient (aCO 2 , 360 ppm) and eCO 2 (620 ppm) was performed. We also assessed how the changes in herbal tissue chemistry affected their biological activity. Elevated CO 2 significantly increased herbal biomass, improved the rates of photosynthesis and dark respiration, and altered the tissue chemistry. Principal Component Analysis of the full data set revealed that eCO 2 induced a global change in the metabolomes of the two plants. Moreover, Hierarchical Clustering Analyses showed quantitative differences in the metabolic profiles of the two plants and in their responsiveness to eCO 2 . Out of 94 metabolites, 38 and 31 significantly increased in basil and peppermint, respectively, as affected by eCO 2 . Regardless of the plant species, the levels of non-structural carbohydrates, fumarate, glutamine, glutathione, ascorbate, phylloquinone (vitamin K1), anthocyanins and a majority of flavonoids and minerals were significantly improved by eCO 2 . However, some metabolites tended to show species specificity. Interestingly, eCO 2 caused enhancement in antioxidant, antiprotozoal, anti-bacterial and anticancer (against urinary bladder carcinoma; T24P) activities in both plants, which was consequent with improvement in the levels of antioxidant metabolites such as glutathione, ascorbate and flavonoids. Therefore, this study suggests that the metabolic changes triggered by eCO 2 in the target herbal plants improved their biological activities. Copyright © 2018 Elsevier GmbH. All rights reserved.

  11. Comparative Study of Essential Oils Extracted from Egyptian Basil Leaves (Ocimum basilicum L.) Using Hydro-Distillation and Solvent-Free Microwave Extraction. (United States)

    Chenni, Mohammed; El Abed, Douniazad; Rakotomanomana, Njara; Fernandez, Xavier; Chemat, Farid


    Solvent-free microwave extraction (SFME) and conventional hydro-distillation (HD) were used for the extraction of essential oils (EOs) from Egyptian sweet basil (Ocimum basilicum L.) leaves. The two resulting EOs were compared with regards to their chemical composition, antioxidant, and antimicrobial activities. The EO analyzed by GC and GC-MS, presented 65 compounds constituting 99.3% and 99.0% of the total oils obtained by SFME and HD, respectively. The main components of both oils were linalool (43.5% SFME; 48.4% HD), followed by methyl chavicol (13.3% SFME; 14.3% HD) and 1,8-cineole (6.8% SFME; 7.3% HD). Their antioxidant activity were studied with the 2,2-diphenyl-1-picrylhydrazyl (DPPH(•)) radical scavenging method. The heating conditions effect was evaluated by the determination of the Total Polar Materials (TPM) content. The antimicrobial activity was investigated against five microorganisms: two Gram-positive bacteria, Staphylococcus aureus and Bacillus subtilis, two Gram-negative bacteria, Escherichia coli and Pseudomonas aeruginosa, and one yeast, Candida albicans. Both EOs showed high antimicrobial, but weak antioxidant, activities. The results indicated that the SFME method may be a better alternative for the extraction of EO from O. basilicum since it could be considered as providing a richer source of natural antioxidants, as well as strong antimicrobial agents for food preservation.

  12. Changes in visual quality, physiological and biochemical parameters assessed during the postharvest storage at chilling or non-chilling temperatures of three sweet basil (Ocimum basilicum L.) cultivars. (United States)

    Fratianni, Florinda; Cefola, Maria; Pace, Bernardo; Cozzolino, Rosaria; De Giulio, Beatrice; Cozzolino, Autilia; d'Acierno, Antonio; Coppola, Raffaele; Logrieco, Antonio Francesco; Nazzaro, Filomena


    Leaves of three different sweet basil (Ocimum basilicum L.) cultivars (Italico a foglia larga, Cammeo, and Italiano classico) packed in macro-perforated polyethylene bags were stored at chilling (4°C) or non-chilling temperature (12°C) for 9days. During storage, visual quality, physiological (respiration rate, ethylene production, ammonium content) and chemical (antioxidant activity, total polyphenols and polyphenol profile) parameters were measured. Detached leaves stored at chilling temperature showed visual symptoms related to chilling injury, while ethylene production and ammonium content resulted associated to cultivar sensibility to damage at low temperature. Storage at 4°C caused a depletion in polyphenols content and antioxidant capability, which was preserved at 12°C. Regarding the polyphenols profile, stressful storage conditions did not enhance the phenolic metabolism. However, leaves stored at 12°C did not loss a significant amount of metabolites respect to fresh leaves, suggesting the possibility to extend the storability after the expiration date, for a possible recovery of bioactive compounds. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Ecologically acceptable usage of derivatives of essential oil of sweet basil, Ocimum basilicum, as antifeedants against larvae of the gypsy moth, Lymantria dispar. (United States)

    Popović, Zorica; Kostić, Miroslav; Stanković, Sladjan; Milanović, Slobodan; Sivčev, Ivan; Kostić, Igor; Kljajić, Petar


    Abstract Ethanol solutions of five fractions obtained from essential oil of sweet basil Ocimum basilicum L. (Lamiales: Lamiaceae) (F1-F5) were tested for their antifeedant properties against 2(nd) instar gypsy moth larvae, Lymantria dispar L. (Lepidoptera: Lymantriidae), in laboratory non-choice and feeding-choice experiments. Prior to bioassays, the chemical composition of each fraction was determined by gas chromatography analyses. Significant larval deterrence from feeding was achieved by application of tested solutions to fresh leaves of the host plant. The most effective were were F1 (0.5%), F4 (0.05, 0.1, and 0.5%), and F5 (0.1 and 0.5%), which provided an antifeedant index > 80% after five days. A low rate of larval mortality was observed in no-choice bioassay. In situ screening of chlorophyll fluorescence as an indicator of plant stress level (assessed by the induced fluorometry) confirmed that the tested compounds did not cause alternations in the photosynthetic efficiency of treated leaves.

  14. Comparing the Effects of Benzyladenine and meta-Topolin on Sweet Basil (Ocimum basilicum Micropropagation

    Directory of Open Access Journals (Sweden)

    Szidónia KŐSZEGHI


    Full Text Available Micropropagation of aromatic plants reveals an effective way of obtaining high volume, virus-free plant material of uniform quality. The application of meta-Topolin (mT (N6-(2-hydroxybenzyl adenine-9-riboside and aromatic cytokinin as Benzyladenine (BAP in the micro propagation of sweet basil (Ocimum basilicum L. was tested for the first time and plant growth parameters assessed to determine the optimum level of these cytokinins. Additionally, the rate of root-growth inhibition due to these two cytokinins was also assessed. Our results show that 1 mg/l (4.43 mM BAP and 0.5 mg/l (2.07 mMmT produced the most favourable effects on new shoot developments. Meta-Topolin was shown to increase the quality of the plants and in comparison with BAP fewer distortions were observed. No significant differences in root-growth inhibition between the mT and BAP were detected.

  15. Atividade antifúngica e possível mecanismo de ação do óleo essencial de folhas de Ocimum gratissimum (Linn. sobre espécies de Candida

    Directory of Open Access Journals (Sweden)


    Full Text Available RESUMO A espécie Ocimum gratissimum (Linn., popularmente conhecida como alfavaca-cravo, é muito utilizada na medicina popular. A planta apresenta inúmeros compostos, sendo o eugenol o constituinte majoritário do seu óleo essencial e o provável responsável pela sua atividade antimicrobiana. O objetivo deste estudo foi determinar o potencial antifúngico e o possível mecanismo de ação do óleo essencial extraído das folhas de O. gratissimum L. (OEOg sobre cepas-padrão de Candida. Para avaliação da atividade antimicrobiana foi determinada a Concentração Inibitória Mínima (CIM, o efeito do tempo de exposição, o efeito modulador na atividade de antifúngicos (ATF de uso clínico e a ação do OEOg nas fases de crescimento exponencial e estacionário de leveduras do gênero Candida. O mecanismo de ação do OEOg foi verificado por captação do cristal violeta e avaliação da morfologia microbiana pela técnica de microcultivo. Também foi avaliada a toxicidade do OEOg sobre hemácias humanas. O OEOg apresentou boa atividade antifúngica sobre cepas de Candida, sendo capaz de reduzir a taxa de crescimento das cepas de Candida a partir de quatro horas de exposição, além de ter modulado positivamente a atividade do cetoconazol para C. tropicalis ATCC 13803 e reduzir o número de células viáveis em todas as fases de crescimento microbiano. O OEOg foi capaz de promover o aumento discreto da captação do cristal violeta e provocou alterações na micromorfologia das células de Candida spp., sugerindo que seu alvo de ação seja o envoltório celular. Observou-se baixa toxicidade do OEOg sobre hemácias humanas. Os resultados encontrados mostraram que o OEOg possui boa atividade sobre o gênero Candida, com mecanismo de ação mediado possivelmente pela ocorrência de danos no envoltório celular, além de ter sido observada baixa toxicidade, indicando do OEOg é promissor no desenvolvimento e elaboração de um novo fármaco com

  16. Stomatal density and metabolic determinants mediate salt stress adaptation and water use efficiency in basil (Ocimum basilicum L.). (United States)

    Barbieri, Giancarlo; Vallone, Simona; Orsini, Francesco; Paradiso, Roberta; De Pascale, Stefania; Negre-Zakharov, Florence; Maggio, Albino


    Increasing salinity tolerance and water-use efficiency in crop plants are two major challenges that agriculture must face in the next decades. Many physiological mechanisms and molecular components mediating crop response to environmental stresses have been identified. However, the functional inter-links between stress adaptation responses have not been completely understood. Using two basil cultivars (Napoletano and Genovese) with contrasting ability to respond to salt stress, here we demonstrate that reduced stomatal density, high ascorbate level and polyphenol oxidase (PPO) activity coordinately contribute to improve basil adaptation and water use efficiency (WUE) in saline environment. The constitutively reduced stomatal density was associated with a "delayed" accumulation of stress molecules (and growth inhibiting signals) such as abscisic acid (ABA) and proline, in the more tolerant Genovese. Leaf volatile profiling also revealed cultivar-specific patterns, which may suggest a role for the volatile phenylpropanoid eugenol and monoterpenes in conferring stress tolerance via antioxidant and signalling functions. Copyright © 2012 Elsevier GmbH. All rights reserved.

  17. Effect of cultivar on phenolic levels, anthocyanin composition, and antioxidant properties in purple basil (Ocimum basilicum L.). (United States)

    Flanigan, Patrick M; Niemeyer, Emily D


    In this study, we determined the effect of cultivar on total and individual anthocyanin concentrations and phenolic acid levels in eight purple basil varieties and examined the relationship between anthocyanin content, phenolic acid composition, and antioxidant properties. Cultivar had a significant influence on total anthocyanin concentrations as well as individual anthocyanin composition. The four major basil anthocyanins (labelled A-D) were quantified and cultivar had a statistically significant effect on anthocyanins B (p<0.01), C (p<0.01), and D (p<0.01), but not on anthocyanin A (p=0.94). Cultivar did not have a significant effect on total phenolic levels, although it did influence the concentration of some individual phenolic acids, including caftaric (p=0.03) and chicoric (p=0.04) acids. Although total phenolic and anthocyanin levels correlated with measured FRAP antioxidant capacities, for some cultivars the individual phenolic acid and anthocyanin composition was also an important factor affecting the antioxidant properties. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Superação de dormência em sementes de manjericão (Ocimum basilicum L. Overcoming dormancy in seeds of basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    H.T.R. Amaro


    Full Text Available O objetivo do trabalho foi avaliar a eficiência de tratamentos pré-germinativos na superação da dormência de sementes de manjericão, produzidas no Horto de Plantas Medicinais da Unimontes, em fevereiro de 2011. Foram realizadas as seguintes determinações para avaliação da qualidade fisiológica das sementes: teor de água, germinação, primeira contagem de germinação, emergência de plântulas e índice de velocidade de emergência. O delineamento experimental utilizado foi inteiramente casualizado com quatro repetições de 50 sementes por tratamento, sendo T1- testemunha; T2 - pré esfriamento das sementes em câmara tipo BOD sob temperatura de 10ºC por 4 dias; T3 - embebição das sementes em água destilada por 24 horas; T4 - embebição das sementes em solução contendo KNO3 a 0,2 % por 5 minutos e T5 - sementes submetidas em água destilada a temperatura de 70ºC por 5 minutos. Os dados foram submetidos à análise de variância e as médias comparadas pelo teste Scott - Knott a 5% de probabilidade. O tratamento pré esfriamento em câmara tipo BOD a 10ºC por 4 dias reduz a dormência e promove incrementos na qualidade fisiológica das sementes do manjericão.Aiming in order to assess the effectiveness of treatments to overcome dormancy in seeds of basil, an experiment was conducted at the Laboratory of Seed Analysis of Unimontes. Following determinations were performed to evaluate the physiological quality of seeds, water content, germination, first count germination, seedling emergence and emergence speed index. The experimental design was completely randomized design with four replications of 50 seeds per treatment, which consisted of: T1 - control, T2 - pre-cooling of the seed chamber BOD at a temperature of 10ºC for 4 days, T3 - soaking the seeds in water distilled for 24 hours, T4 - soaking the seeds in a solution containing 0,2% for 5 minutes and T5 - submitted seeds in distilled water at 70ºC for 5 minutes. Data

  19. Chemical composition of the essential oil from basil (Ocimum basilicum Linn.) and its in vitro cytotoxicity against HeLa and HEp-2 human cancer cell lines and NIH 3T3 mouse embryonic fibroblasts. (United States)

    Kathirvel, Poonkodi; Ravi, Subban


    This study examines the chemical composition and in vitro anticancer activity of the essential oil from Ocimum basilicum Linn. (Lamiaceae), cultivated in the Western Ghats of South India. The chemical compositions of basil fresh leaves were identified by GC-MS: 11 components were identified. The major constituents were found to be methyl cinnamate (70.1%), linalool (17.5%), β-elemene (2.6%) and camphor (1.52%). The results revealed that this plant may belong to the methyl cinnamate and linalool chemotype. A methyl thiazol tetrazolium assay was used for in vitro cytotoxicity screening against the human cervical cancer cell line (HeLa), human laryngeal epithelial carcinoma cell line (HEp-2) and NIH 3T3 mouse embryonic fibroblasts. The IC(50) values obtained were 90.5 and 96.3 µg mL(-1), respectively, and the results revealed that basil oil has potent cytotoxicity.

  20. The effect of drought stress on the expression of key genes involved in the biosynthesis of phenylpropanoids and essential oil components in basil (Ocimum basilicum L.). (United States)

    Abdollahi Mandoulakani, Babak; Eyvazpour, Elham; Ghadimzadeh, Morteza


    Basil (Ocimum basilicum L.), a medicinal plant of the Lamiaceae family, is used in traditional medicine; its essential oil is a rich source of phenylpropanoids. Methylchavicol and methyleugenol are the most important constituents of basil essential oil. Drought stress is proposed to enhance the essential oil composition and expression levels of the genes involved in its biosynthesis. In the current investigation, an experiment based on a completely randomized design (CRD) with three replications was conducted in the greenhouse to study the effect of drought stress on the expression level of four genes involved in the phenylpropanoid biosynthesis pathway in O. basilicum c.v. Keshkeni luvelou. The genes studied were chavicol O-methyl transferase (CVOMT), eugenol O-methyl transferase (EOMT), cinnamate 4-hydroxylase (C4H), 4-coumarate coA ligase (4CL), and cinnamyl alcohol dehydrogenase (CAD). The effect of drought stress on the essential oil compounds and their relationship with the expression levels of the studied genes were also investigated. Plants were subjected to levels of 100%, 75%, and 50% of field capacity (FC) at the 6-8 leaf stage. Essential oil compounds were identified by gas chromatography/mass spectrometry (GC-MS) at flowering stage and the levels of gene expression were determind by real time PCR in plant leaves at the same stage. Results showed that drought stress increased the amount of methylchavicol, methyleugenol, β-Myrcene and α-bergamotene. The maximum amount of these compounds was observed at 50% FC. Real-time PCR analysis revealed that severe drought stress (50% FC) increased the expression level of CVOMT and EOMT by about 6.46 and 46.33 times, respectively, whereas those of CAD relatively remained unchanged. The expression level of 4CL and C4H reduced under drought stress conditions. Our results also demonstrated that changes in the expression levels of CVOMT and EOMT are significantly correlated with methylchavicol (r = 0.94, P ≤ 0

  1. Salinity Stress Does Not Affect Root Uptake, Dissemination and Persistence of Salmonella in Sweet-basil (Ocimum basilicum). (United States)

    Bernstein, Nirit; Sela Saldinger, Shlomo; Dudai, Nativ; Gorbatsevich, Elena


    Crop produce can be contaminated in the field during cultivation by bacterial human pathogens originating from contaminated soil or irrigation water. The bacterial pathogens interact with the plant, can penetrate the plant via the root system and translocate and survive in above-ground tissues. The present study is first to investigate effects of an abiotic stress, salinity, on the interaction of plants with a bacterial human pathogen. The main sources of human bacterial contamination of plants are manures and marginal irrigation waters such as treated or un-treated wastewater. These are often saline and induce morphological, chemical and physiological changes in plants that might affect the interaction between the pathogens and the plant and thereby the potential for plant contamination. This research studied effects of salinity on the internalization of the bacterial human pathogen Salmonella enterica serovar Newport via the root system of sweet-basil plants, dissemination of the bacteria in the plant, and kinetics of survival in planta . Irrigation with 30 mM NaCl-salinity induced typical salt-stress effects on the plant: growth was reduced, Na and Cl concentrations increased, K and Ca concentrations reduced, osmotic potential and anti-oxidative activity were increased by 30%, stomatal conductance was reduced, and concentrations of essential-oils in the plants increased by 26%. Despite these physical, chemical and morphological changes in the plants, root internalization of the bacteria and its translocation to the shoot were not affected, and neither was the die-off rate of Salmonella in planta . The results demonstrate that the salinity-induced changes in the sweet-basil plants did not affect the interaction between Salmonella and the plant and thereby the potential for crop contamination.

  2. Kinetics of drying of basil leaves (Ocimum basilicum L. in the infrared Cinética de secagem de folhas de manjericão (Ocimum basilicum L. via infravermelho

    Directory of Open Access Journals (Sweden)

    Renata C. dos Reis


    Full Text Available The objective of this paper was to model the drying curves of the leaves of basil (Ocimum basilicum L. in the infrared at temperatures of 50, 60, 70 and 80 ºC and to evaluate the influence of drying temperature on the color of dried leaves. Drying was conducted in infrared dryer with temperature and greenhouse air circulation. Experimental data were fitted to eight mathematical models. The magnitude of the coefficient of determination (R², the mean relative error (P, the estimated mean error (SE and chisquare test (χ2 were used to verify the degree of fitness of the models. From the study it was concluded that: a the behavior of the drying curves of basil leaves was similar to most agricultural products, the drying times in the infrared were less than the drying times in an oven with air circulation, b the mathematical drying model proposed by Midilli et al. (2002 was the one which best adjusted to the experimental data, c the diffusion coefficient ranged from 9.10 x 10-12 to 2.92 x 10-11 m² s-1 and d the color of the samples was highly influenced by drying, becoming darker due to loss of chlorophyll with increasing temperature.Objetivou-se, neste trabalho, determinar, modelar as curvas de secagem das folhas de Manjericão (Ocimum basilicum L. por infravermelho nas temperaturas de 50, 60, 70 e 80 ºC e avaliar a influência das temperaturas de secagem na cor das folhas desidratadas. A secagem foi conduzida em secador infravermelho com controle de temperatura e em estufa com circulação de ar. Aos dados experimentais foram ajustados oito modelos matemáticos. As magnitudes do coeficiente de determinação (R², do erro médio relativo (P, do erro médio estimado (SE e do teste do qui-quadrado (χ² foram utilizadas para verificar o grau de ajuste dos modelos. Do estudo concluiu-se que: a o comportamento das curva s de secagem das folhas de manjericão foi semelhante ao da maioria dos produtos agrícolas; os tempos de secagem no infravermelho

  3. Phenolic Substances from Ocimum Species Enhance Glucose- Stimulated Insulin Secretion and Modulate the Expression of Key Insulin Regulatory Genes in Mice Pancreatic Islets

    DEFF Research Database (Denmark)

    Casanova, Livia Marques; Gu, Wenqian; Costa, Sônia Soares


    ABSTRACT: Ocimum gratissimum and Ocimum basilicum are plants ethnopharmacologically used to treat diabetes mellitus, a life-threatening disease that affects millions of people worldwide. In order to further understand their antidiabetic potential, which has been previously demonstrated in animal...

  4. Chemical composition and antimicrobial activity of the essential oil of Ocimum basilicum L. (sweet basil) from Western Ghats of North West Karnataka, India. (United States)

    Joshi, Rajesh K


    Ocimum basilicum L. (Lamiaceae) commonly known as sweet basil, has been used as a traditional medicinal plant for the treatment of headaches, coughs, diarrhea, constipation, warts, worms, and kidney malfunctions. The essential oil of the flowering aerial parts of O. basilicum growing in the Western Ghats region of North West Karnataka, India, was obtained by hydro-distillation and analyzed by gas chromatography equipped with flame ionization detector and gas chromatography coupled to mass spectrometry (GC-MS). The oil was tested against six Gram-positive, eight Gram-negative bacteria, and three fungi by the tube-dilution method at a concentration range of 5.00-0.009 mg/mL. Twenty-five constituents were identified in the essential oil of O. basilicum. The major constituents were identified as methyl eugenol (39.3%) and methyl chavicol (38.3%), accounting for 98.6% of the total oil. The oil was found to be active against Gram-positive, Gram-negative bacteria, and fungi with minimal bactericidal concentration values in the range of 0.143 ± 0.031 to 0.572 ± 0.127 mg/mL, 0.781 ± 0.382 to 1.875 ± 0.684 mg/mL, and 0.312 ± 0.171 to 0.442 ± 0.207 mg/mL, respectively. The essential oil of O. basilicum of this region contains methyl eugenol/methyl chavicol chemotype and has bactericidal properties.

  5. Molecular characterisation and similarity relationships among iranian basil (Ocimum basilicum L. accessions using inter simple sequence repeat markers Caracterização molecular de acessos de Ocimum basilicum L. por meio de marcadores ISSR

    Directory of Open Access Journals (Sweden)

    Mohammad Aghaei


    Full Text Available The study of genetic relationships is a prerequisite for plant breeding activities as well as for conservation of genetic resources. In the present study, genetic diversity among 50 Iranian basil (Ocimum basilicum L. accessions was determined using inter simple sequence repeat (ISSR markers. Thirty-eight alleles were generated at 12 ISSR loci. The number of alleles per locus ranged from 1 to 5 with an average of 3.17. The maximum number of alleles was observed at the A7, 818, 825 and 849 loci, and their size ranged from 300 to 2500 bp. A similarity matrix based on Jaccard's coefficient for all 50 basil accessions gave values from 1.00-0.60. The maximum similarity (1.00 was observed between the "Urmia" and "Shahr-e-Rey II" accessions as well as between the "Urmia" and "Qazvin II" accessions. The lowest similarity (0.60 was observed between the "Tuyserkan I" and "Gom II" accessions. The unweighted pair- group method using arithmetique average UPGMA clustering algorithm classified the studied accessions into three distinct groups. All of the basil accessions, with the exception of "Babol III", "Ahvaz II", "Yazd II" and "Ardebil I", were placed in groups I and II. Leaf colour was a specific characteristic that influenced the clustering of Iranian basil accessions. Because of this relationship, the results of the principal coordinate analysis (PCoA approximately corresponded to those obtained through cluster analysis. Our results revealed that the geographical distribution of genotypes could not be used as a basis for crossing parents to obtain high heterosis, and therefore, it must be carried out by genetic studies.O estudo das relações genéticas é um pré-requisito para atividades em reprodução de plantas assim como para conservação de recursos genéticos. Neste trabalho a diversidade genética entre 50 acessos de Manejericão Iraniano (Ocimum basilicum L. foram determinadas usando marcadores de Seqüência Simples Repetida Interna (ISSR

  6. In vitro inhibition of the bovine viral diarrhoea virus by the essential oil of Ocimum basilicum (basil) and monoterpenes. (United States)

    Kubiça, Thaís F; Alves, Sydney H; Weiblen, Rudi; Lovato, Luciane T


    The bovine viral diarrhoea virus (BVDV) is suggested as a model for antiviral studies of the hepatitis C virus (HCV). The antiviral activity of the essential oil of Ocimum basilicum and the monoterpenes camphor, thymol and 1,8-cineole against BVDV was investigated. The cytotoxicities of the compounds were measured by the MTT (3-(4.5-dimethylthiazol-2-yl)-2.5-diphenyltetrazolium bromide) test, and the antiviral activities were tested by the plaque reduction assay. The oil or compounds were added to the assay in three different time points: a) pre-treatment of the virus (virucidal assay); b) pre-treatment of the cells; or c) post-treatment of the cells (after virus inoculation). The percentage of plaques inhibition for each compound was determined based on the number of plaques in the viral control. The results were expressed by CC50 (50% cytotoxic concentration), IC50 (inhibitory concentration for 50% of plaques) and SI (selectivity index = CC50/IC50). Camphor (CC50 = 4420.12 μg mL(-1)) and 1,8-cineole (CC50 = 2996.10 μg mL(-1)) showed the lowest cytotoxicities and the best antiviral activities (camphor SI = 13.88 and 1,8-cineol SI = 9.05) in the virucidal assay. The higher activities achieved by the monoterpenes in the virucidal assay suggest that these compounds act directly on the viral particle.

  7. Evaluation of Some Morphological Characteristics, Water Use Efficiency and Essential Oil of Basil (Ocimum basilicum var. keshkeni luvelou under Application of Malva Leaves and Superabsorbent Polymer

    Directory of Open Access Journals (Sweden)

    S. Beigi


    Full Text Available Introduction: Medicinal plants are rich in active substances and primarily have been used in the manufacture of many drugs. Basil (Ocimum basilicum L. is one of the important medicinal plants whichbelongs to the Lamiaceae family. Basil essential oil content (between 0.5 to 1.5 percent varies according to climatic conditions of habitat location. Basilneeds a lot of water during growth period and it is very sensitive to water stress and shows wilting symptoms very soon after water shortage. Iran is located in an arid and semi-arid region which has little precipitation that is not enough for crop water requirements. Nowadays, the use of superabsorbent polymers is one of the ways to create sustainable agriculture and increase irrigation efficiency. They can store high water or aqueous solutions in root zone of plants and to reduce negative effects of drought stress. So, improvement of plant growth, increasing of irrigation intervals, reducing water loss and costs of irrigation is due to the application of superabsorbent polymers. Mucilages are also the herbal polysaccharides, soluble in water, and commonly include carbohydrates and can be used as hydrophilic polymers. The aims of this investigation were to study the effects of hydrophilic polymers on water use efficiency, morphological characteristics (dry matter, leaf area, and leaf number, essential oil quantity and yield of basil to harden plant to drought stress and to evaluate its potential to cultivate in arid regions. In addition, taking steps forward towards sustainable agriculture, by reducing the cost of agricultural production, helps protecting the environment. Materials and Methods: This research was conducted as a pot experiment at the department of Horticultural Science‚ college of Agricultural‚ Ferdowsi University of Mashhad‚ Iran, during 2012-2013.The research was set out in a factorial experiment on the basis of completely randomized block design with three replications

  8. Selective extraction of high-value phenolic compounds from distillation wastewater of basil (Ocimum basilicum L.) by pressurized liquid extraction. (United States)

    Pagano, Imma; Sánchez-Camargo, Andrea Del Pilar; Mendiola, Jose Antonio; Campone, Luca; Cifuentes, Alejandro; Rastrelli, Luca; Ibañez, Elena


    During the essential oil steam distillation from aromatic herbs, huge amounts of distillation wastewaters (DWWs) are generated. These by-products represent an exceptionally rich source of phenolic compounds such as rosmarinic acid (RA) and caffeic acid (CA). Herein, the alternative use of dried basil DWWs (dDWWs) to perform a selective extraction of RA and CA by pressurized liquid extraction (PLE) employing bio-based solvent was studied. To select the most suitable solvent for PLE, the theoretical modelling of Hansen solubility parameters (HSP) was carried out. This approach allows reducing the list of candidate to two solvents: ethanol and ethyl lactate. Due to the composition of the sample, mixtures of water with those solvents were also tested. An enriched PLE extract in RA (23.90 ± 2.06 mg/g extract) with an extraction efficiency of 75.89 ± 16.03% employing a water-ethanol mixture 25:75 (% v/v) at 50°C was obtained. In the case of CA, a PLE extract with 2.42 ± 0.04 mg/g extract, having an extraction efficiency of 13.86 ± 4.96% using ethanol absolute at 50°C was achieved. DWWs are proposed as new promising sources of natural additives and/or functional ingredients for cosmetic, nutraceutical, and food applications. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Correlated accumulation of anthocyanins and rosmarinic acid in mechanically stressed red cell suspensions of basil (Ocimum basilicum). (United States)

    Strazzer, Pamela; Guzzo, Flavia; Levi, Marisa


    A red basil cell line (T2b) rich in rosmarinic acid (RA) was selected for the stable production of anthocyanins (ACs) in the dark. Cell suspension cultures were subjected to mechanical stress through increased agitation (switch from 90 to 150 rpm) to determine the relationship between AC and RA accumulation. Cell extracts were analyzed by HPLC and LC-MS, and the resulting data were processed with multivariate statistical analysis. MS and MS/MS spectra facilitated the putative annotation of several complex cyanidin-based ACs, which were esterified with coumaric acid and, in some cases, also with malonic acid. It was also possible to identify various RA-related molecules, some caffeic and coumaric acid derivatives and some flavanones. Mechanical stress increased the total AC and RA contents, but reduced biomass accumulation. Many metabolites were induced by mechanical stress, including RA and some of its derivatives, most ACs, hydroxycinnamic acids and flavonoids, whereas the abundance of some RA dimers was reduced. Although AC and RA share a common early biosynthetic pathway (from phenylalanine to 4-coumaroyl-CoA) and could have similar or overlapping functions providing antioxidant activity against stress-generated reactive oxygen species, there appeared to be no competition between their individual pathways. Copyright © 2010 Elsevier GmbH. All rights reserved.

  10. Reduction of microbial contamination and improvement of germination of sweet basil (Ocimum basilicum L.) seeds via surface dielectric barrier discharge (United States)

    Ambrico, Paolo F.; Šimek, Milan; Morano, Massimo; De Miccolis Angelini, Rita M.; Minafra, Angelantonio; Trotti, Pasquale; Ambrico, Marianna; Prukner, Václav; Faretra, Francesco


    Naturally contaminated basil seeds were treated by a surface dielectric barrier discharge driven in the humid air by an amplitude modulated AC high voltage to avoid heat shock. In order to avoid direct contact of seeds with microdischarge filaments, the seeds to be treated were placed at sufficient distance from the surface discharge. After treatment, the seeds were analyzed in comparison with control samples for their microbial contamination as well as for the capability of germination and seedling growth. Moreover, chemical modification of seed surface was observed through the elemental energy dispersive x-ray analysis and wettability tests. We found that treatment applied at 20% duty cycle (effective discharge duration up to 20 s) significantly decreases microbial load without reducing the viability of the seeds. On the other side, seedling growth was considerably accelerated after the treatment, and biometric growth parameters of seedlings (total length, weight, leaf extension) considerably increased compared to the controls. Interestingly, scanning electron microscopy images taken for the different duration of treatment revealed that seed radicle micropylar regions underwent significant morphological changes while the coat was substantially undamaged. Inside the seed, the embryo seemed to be well preserved while the endosperm body was detached from the epithelial tegument. A total of 9 different genera of fungi were recovered from the analyzed seeds. Scanning electron microscopy images revealed that conidia were localized especially in the micropylar region, and after plasma treatment, most of them showed substantial damages. Therefore, the overall effect of the treatment of naturally contaminated seeds by reactive oxygen and nitrogen species produced by plasma and the consequent changes in surface chemistry and microbial load can significantly improve seed vigor.

  11. Reduction of microbial contamination and improvement of germination of sweet basil ( Ocimum basilicum L.) seeds via surface dielectric barrier discharge

    International Nuclear Information System (INIS)

    Ambrico, Paolo F; Ambrico, Marianna; Šimek, Milan; Prukner, Václav; Morano, Massimo; De Miccolis Angelini, Rita M; Trotti, Pasquale; Faretra, Francesco; Minafra, Angelantonio


    Naturally contaminated basil seeds were treated by a surface dielectric barrier discharge driven in the humid air by an amplitude modulated AC high voltage to avoid heat shock. In order to avoid direct contact of seeds with microdischarge filaments, the seeds to be treated were placed at sufficient distance from the surface discharge. After treatment, the seeds were analyzed in comparison with control samples for their microbial contamination as well as for the capability of germination and seedling growth. Moreover, chemical modification of seed surface was observed through the elemental energy dispersive x-ray analysis and wettability tests. We found that treatment applied at 20% duty cycle (effective discharge duration up to 20 s) significantly decreases microbial load without reducing the viability of the seeds. On the other side, seedling growth was considerably accelerated after the treatment, and biometric growth parameters of seedlings (total length, weight, leaf extension) considerably increased compared to the controls. Interestingly, scanning electron microscopy images taken for the different duration of treatment revealed that seed radicle micropylar regions underwent significant morphological changes while the coat was substantially undamaged. Inside the seed, the embryo seemed to be well preserved while the endosperm body was detached from the epithelial tegument. A total of 9 different genera of fungi were recovered from the analyzed seeds. Scanning electron microscopy images revealed that conidia were localized especially in the micropylar region, and after plasma treatment, most of them showed substantial damages. Therefore, the overall effect of the treatment of naturally contaminated seeds by reactive oxygen and nitrogen species produced by plasma and the consequent changes in surface chemistry and microbial load can significantly improve seed vigor. (paper)

  12. Rice weevil response to basil oil fumigation (United States)

    Basil oil, Ocimum basilicum L., is a volatile plant essential oil that is known to have insecticidal activity against stored product pests such as rice weevil, Sitophilus oryzae (L.). Basil oil was diluted in acetone and applied to a sponge held inside a tea strainer for fumigations in containers wi...

  13. Effects of a wax organogel and alginate gel complex on holy basil (Ocimum sanctum) in vitro ruminal dry matter disappearance and gas production. (United States)

    Templeman, James R; Rogers, Michael A; Cant, John P; McBride, Brian W; Osborne, Vern R


    The objectives of this study were to: (a) select an ideal organogel for the oil phase of a novel gel encapsulation technology, (b) optimize the formulation of an organogel and sodium alginate-based gel complex, and (c) examine the rumen protective ability of the gel by measuring 48-h in vitro ruminal dry matter disappearance and gas production from encapsulated dried and ground holy basil leaves. A rice-bran wax and canola oil organogel was selected for the oil phase of the gel complex as this combination had a 48-h dry matter disappearance of 6%, the lowest of all organogels analyzed. The gel complex was formulated by homogenizing the organogel with a sodium alginate solution to create a low-viscosity oil-in-water emulsion. Average dry matter disappearance of gel-encapsulated holy basil was 19%, compared to 42% for the free, unprotected holy basil. However, gel encapsulation of holy basil stimulated gas production. Specifically, gas production of encapsulated holy basil was four times higher than the treatment with holy basil added on top of the gel prior to incubation rather than encapsulated within the gel. Although the gel itself was highly degradable, it is speculated encapsulation thwarted holy basil's antimicrobial activity. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

  14. Murcha do manjericão (Ocimum basilicum no Brasil: agente causal, círculo de plantas hospedeiras e transmissão via semente Sweet basil (Ocimum basilicum wilt in Brazil: causal agent, host range and seed transmission

    Directory of Open Access Journals (Sweden)

    Ailton Reis


    representam o mais provável veículo de introdução e potencial disseminação deste patógeno no Brasil.Sweet basil (Ocimum basilicum L is one of the most important vegetable crops in the family Lamiaceae, being employed mainly as a source of essential oils for the pharmaceutical industry. Samples of plants showing symptoms of wilt, stem blight and collar root rot were collected during the 2005 hot rainy season in the rural area of Brazlândia (Federal District in central Brazil. Two other samples displaying identical symptoms were collected under greenhouse and field conditions in Ponte Alta (DF. The fungus Fusarium oxysporum was consistently isolated in all samples. Pathogenicity tests were conducted using seedlings and stem cuttings of the O. basilicum cultivars 'Dark Opal' and 'Italian Large Leaf' as well as accessions of the species O. americanum L, O. campechianum Mill., Origanum manjorana L., O. vulgare L., Mentha arvensis L., Coleus blumei Benth., Leonorus sibiricus L. and Leonotis nepetaefolia (L. W.T. Aiton. All isolates were highly virulent on O. basilicum cultivars, whereas O. campechianum and O. americanum cultivars reacted with a slight vascular browning and with a very mild reduction in plant growth rate. All isolates were considered avirulent to O. manjorana, O. vulgaris, M. arvensis, C. blumei, L. sibiricus and L. nepetaefolia accessions. The experimental data indicated that the causal agent of this disease is the fungus F. oxysporum f. sp. basilici. This is the first formal report of this pathogen in Brazil. The remaining seeds from commercial lots that were sowed in the areas where the pathogen was first described were evaluated for the presence of F. oxysporum f. sp. basilici. This fungus was detected in four out of six seed lots and the seed-derived isolates were able to induce similar set of symptoms in the same group of plant accessions. This result strongly suggests that this new disease in Brazil was most likely introduced into the country via

  15. Germination and accelerated aging in the analysis of the physiological quality of seeds of wild basilGerminação e envelhecimento acelerado na análise da qualidade fisiológica de sementes de alfavaca-cravo

    Directory of Open Access Journals (Sweden)

    Natália de Almeida Batista


    Full Text Available The study aimed to contribute to establish parameters for analyzing the physiological quality of seed-clove basil (Ocimum gratissimum L., since the species is not among those described in the Rules for Testing Seeds. Seeds of basil, clove, gathered on the campus of UENP-CLM, Bandeirantes, PR, analyzed for water content, germination, accelerated aging water and saline tetrazolium and seedling emergence. The temperature of 30 ° C for the germination test and the sand substrate for the emergence test are conditions and procedures for evaluating the physiological quality of seeds of O. gratissimum. The aging test, regardless of the type of solution used, the test is correlated with seedling emergence in soil. The low germination and seed viability of O. gratissimum occurring due to deterioration and lack of internal tissue.O estudo teve como propósito contribuir para o estabelecimento de parâmetros para análise da qualidade fisiológica de sementes de alfavaca-cravo (Ocimum gratissimum L., uma vez que a referida espécie não se encontra entre as descritas nas Regras para Análise de Sementes. Foram utilizadas sementes de alfavaca-cravo, colhidas no Campus da UENP-CLM, Bandeirantes-PR, submetidas a análises de teor de água, germinação, envelhecimento acelerado com água e solução salina, tetrazólio e emergência de plântulas. A temperatura de 30 ºC para o teste de germinação e o substrato areia para o teste de emergência de plântulas são condições e procedimentos apropriados para avaliação da qualidade fisiológica de sementes de O. gratissimum. O teste de envelhecimento, independente do tipo de solução utilizada, apresenta correlação com o teste de emergência de plântulas em solo. O baixo potencial germinativo e viabilidade das sementes de O. gratissimum ocorrem em função da deterioração e ausência dos tecidos internos.

  16. The effect of different solvents and number of extraction steps on the polyphenol content and antioxidant capacity of basil leaves (Ocimum basilicum L.) extracts. (United States)

    Złotek, Urszula; Mikulska, Sylwia; Nagajek, Małgorzata; Świeca, Michał


    The objectives of this study were to determine best conditions for the extraction of phenolic compounds from fresh, frozen and lyophilized basil leaves. The acetone mixtures with the highest addition of acetic acid extracted most of the phenolic compounds when fresh and freeze-dried material have been used. The three times procedure was more effective than once shaking procedure in most of the extracts obtained from fresh basil leaves - unlike the extracts derived from frozen material. Surprisingly, there were not any significant differences in the content of phenolics between the two used procedures in the case of lyophilized basil leaves used for extraction. Additionally, the positive correlation between the phenolic compounds content and antioxidant activity of the studied extracts has been noted. It is concluded that the acetone mixtures were more effective than the methanol ones for polyphenol extraction. The number of extraction steps in most of the cases was also a statistically significant factor affecting the yield of phenolic extraction as well as antioxidant potential of basil leaf extracts.

  17. Effect of jasmonic acid elicitation on the yield, chemical composition, and antioxidant and anti-inflammatory properties of essential oil of lettuce leaf basil (Ocimum basilicum L.). (United States)

    Złotek, Urszula; Michalak-Majewska, Monika; Szymanowska, Urszula


    The effect of elicitation with jasmonic acid (JA) on the plant yield, the production and composition of essential oils of lettuce leaf basil was evaluated. JA-elicitation slightly affected the yield of plants and significantly increased the amount of essential oils produced by basil - the highest oil yield (0.78±0.005mL/100gdw) was achieved in plants elicited with 100μM JA. The application of the tested elicitor also influenced the chemical composition of basil essential oils - 100μM JA increased the linalool, eugenol, and limonene levels, while 1μM JA caused the highest increase in the methyl eugenol content. Essential oils from JA-elicited basil (especially 1μM and 100μM) exhibited more effective antioxidant and anti-inflammatory potential; therefore, this inducer may be a very useful biochemical tool for improving production and composition of herbal essential oils. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Chemistry and bioactivities of essential oils of some Ocimum species: an overview

    Directory of Open Access Journals (Sweden)

    Abhay Kumar Pandey


    Full Text Available Essential oils of different species of the genus Ocimum are natural flavouring materials of commercial importance. The data given in current literature are pertaining to the chemical composition of essential oils of different Ocimum species viz., Ocimum basilicum Linn. (alt. Ocimum basilicum var. minimum, Ocimum basilicum var. purpurience, Ocimum campechianum Mill., Ocimum canum Sims. (Ocimum americanum, Ocimum citriodorum, Ocimum gratissimum Linn., Ocimum kilimandscharicum Linn., Ocimum micranthum Willd., Ocimum sanctum Linn., (alt. Ocimum tenuiflorum Linn., Ocimum selloi Benth., Ocimum trichodon, Ocimum utricifolium from different geographical regions. A considerable difference in chemical composition of a particular species is found, which may be due to their occurrence in different eco-climatic zones and changes in edaphic factors. Attention is also focused on the biological properties of Ocimum oils which are related to their various interesting applications as antimicrobial, antioxidant, repellent, insecticidal, larvicidal, nematicidal and therapeutic (anti-inflammatory, antinociceptive, antipyretic, antiulcer, analgesic, anthelmintic, anticarcinogenic, skin permeation enhancer, immunomodulatory, cardio-protective, antilipidemic agents.

  19. The effects of kale (Brassica oleracea ssp. acephala), basil (Ocimum basilicum) and thyme (Thymus vulgaris) as forage material in organic egg production on egg quality. (United States)

    Hammershøj, M; Steenfeldt, S


    1. In organic egg production, forage material as part of the diet for laying hens is mandatory. The purpose of the present study was to examine the effect of feeding with forage materials including maize silage, herbs or kale on egg production and various egg quality parameters of the shell, yolk colour, egg albumen, sensory properties, fatty acid and carotenoid composition of the egg yolk. 2. A total of 5 dietary treatments were tested for 5 weeks, consisting of a basal organic feed plus 120 g/hen.d of the following forage materials: 1) maize silage (control), 2) maize silage incl. 15 g/kg basil, 3) maize silage incl. 30 g/kg basil, 4) maize silage incl. 15 g/kg thyme, or 5) fresh kale leaves. Each was supplied to three replicates of 20 hens. A total of 300 hens was used. 3. Feed intake, forage intake and laying rate did not differ with treatment, but egg weight and egg mass produced increased significantly with the kale treatment. 4. The egg shell strength tended to be higher with the kale treatment, and egg yolk colour was significantly more red with the kale treatment and more yellow with basil and kale treatments. The albumen DM content and albumen gel strength were lowest with the thyme treatment. By sensory evaluation, the kale treatment resulted in eggs with less sulphur aroma, higher yolk colour score, and more sweet and less watery albumen taste. Furthermore, the eggs of the kale treatment had significantly higher lutein and β-carotene content. Also, violaxanthin, an orange xanthophyll, tended to be higher in kale and eggs from hens receiving kale. 5. In conclusion, forage material, especially basil and kale, resulted in increased egg production and eggs of high and differentiable quality.

  20. Evaluation of Some Agroecological Characteristics of Basil (Ocimum basilicum L. as Affected by Simultaneous Application of Water-Saving Superabsorbent Hydrogel in Soil and Foliar Application of Humic Acid under Different Irrigation Intervals in a Low Inp

    Directory of Open Access Journals (Sweden)

    M. Jahan


    Full Text Available Introduction: Basil (Ocimum basilicum L. is an annual herbaceous plant that belongs to lamiaceae family. This plant is native of India country and other countries in south of Asia. Nowadays, the use of water superabsorbent polymers is increased in agriculture and their role in reducing the drought stress and increasing the crops production has been demonstrated in many researches. Superabsorbent polymers can absorb lots of water and keep it in their structure and give it to plant under drought stress conditions (9. Humic substances are a group of heterogeneous molecules that are bonded together by weak forces, therefore they have high chemical stability. Humic acid comprise 65 to 80 percent of total soil organic matter (6. According to medicinal importance of Basil and its roles in the food and pharmaceutical industries, beside the limited water resources and need to increase water use efficiency through using ecological inputs, this study designed and conducted aimed to evaluate agroecological characteristics of Basil as affected by application of water-saving superabsorbent and humic acid under irrigation intervals. Materials and Methods: In order to evaluate the effects of different amounts of water-saving superabsorbent and foliar application of humic acid and irrigation intervals on some quantitative characteristics of basil (Ocimum basilicum L., a split strip plot experiment was conducted based on RCBD design with three replications at The Research Farm of Ferdowsi University of Mashhad, Iran during growing season of 2012-13. Experimental factors included three levels of water-saving superabsorbent (0, 40 and 80 kg ha-1 as the main plot factor, two levels of humic acid (0 and 3 kg ha-1 as the sub plot factor and two levels of irrigation interval (5 and 10 days as the strip plot factor. Studied traits were seed number and weight per plant, plant height, number of lateral branches per plant, seed yield, biological yield and harvest index

  1. AKTIVITAS ANTIOKSIDAN DAN ANTIBAKTERI EKSTRAK POLAR DAN NON POLAR BIJI SELASIH (Ocimum sanctum Linn [Antioxidant and Antibacterial Activities from Polar and Non Polar Basil (Ocimum sanctum Linn Seed Extracts

    Directory of Open Access Journals (Sweden)

    Agustina D. R. Nurcahyanti1*


    Full Text Available The aims of this study were to determine total phenolic content, antioxidant activity and antibacterial activity of polar and nonpolar extracts of basil (O. sanctum L. seed. Seeds of basil (O. sanctum L. were extracted using a soxhlet extractor using four types organic solvent, i.e. chloroform, ethyl acetate, acetone, and methanol for eight hours each. The total phenolic content was determined using Folin Ciocalteu method, antioxidant activity was determined using reducing power and DPPH (1,1-diphenyl,2-picrylhydrazyl scavenging activity methods, while antibacterial activity was tested using agar diffusion method. The result showed that the highest total phenolic content and antioxidant activity was obtained in methanol extract with 3.63 ± 0.21 mgGAE/g phenolic total, 58.39 ± 3.81 ek/g using reducing power method and 85.73 ± 0.86% free radical scavenging activity. Furthermore the result of antibacterial activity testing showed that the highest diameter of inhibition zone was observed in ethyl acetate extract inhibition on E.coli, P.aeruginosa, B.subtilis, and S.aureus where its inhibition zone were 13.53 ± 0.63; 10.67 ± 1.05; 14.93 ± 0.80, and 13.46 ± 0.79 mm, respectively. This result suggests that both polar and nonpolar basil seed extracts possess specific biological activity. This data provide valuable and strong database for exploration of natural antibacterial agents and antioxidant for food and health industry application.

  2. Quality of four basil types after storage at 3 to 10 C (United States)

    Sweet basil (Ocimum basilicum) has global culinary use as a fresh herb. Basil can also be dried and extracted for its essential oils and grows extremely well in the warm climate of Oklahoma. Several cultivars of sweet basil are known to be chill sensitive when stored below 7 C. In this study, fou...

  3. Characterization of Peronospora belbahrii on basil under light and scanning electron microscopy (United States)

    Basil (Ocimum spp.) downy mildew caused by Peronsoora belbahrii is a major yield-limiting disease of sweet basil (O. basilicum) production worldwide. In this study, sweet basil was grown in a soilless potting mix in plant growth chambers and inoculated with sporangia of P. belbahrii harvested from p...

  4. Effects of water stress and inoculation with plant growth promoting rhizobacteria (PGPR on antioxidant status and photosynthetic pigments in basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Mostafa Heidari


    Full Text Available Effects of water stress and inoculation with plant growth promoting rhizobacteria (PGPR on antioxidant activity and photosynthetic pigments were studied in basil plants. A field experiment was conducted at the University of Zabol in Iran during 2010 growing season. The experiment laid out as split plot based on randomized complete block design with three replications. Three levels of water stress W1 = 80 (control, W2 = 60 and W3 = 40% of the field capacity (FC as main plots and four levels of bacterial species consisting of S1 = Pseudomonades sp., S2 = Bacillus lentus, S3 = Azospirillum brasilens, S4 = combination of three bacterial species and S5 = control (without use of bacterial as sub plots. The results revealed that water stress caused a significant change in the antioxidant activity. The highest concentration CAT and GPX activity were in W3 treatments. By increasing water stress from control to W3, chlorophyll content in leaves was increased but Fv/Fm and APX activity decreased. Application of rhizobacteria under water stress improved the antioxidant and photosynthetic pigments in basil plants. S1 = Pseudomonades sp. under water stress, significantly increased the CAT enzyme activity, but the highest GPX and APX activity and chlorophyll content in leaves under water stress were in S4 = combination of three bacterial species.

  5. Application of response surface methodology to optimize pressurized liquid extraction of antioxidant compounds from sage (Salvia officinalis L.), basil (Ocimum basilicum L.) and thyme (Thymus vulgaris L.). (United States)

    Hossain, M B; Brunton, N P; Martin-Diana, A B; Barry-Ryan, C


    The present study optimized pressurized liquid extraction (PLE) conditions using Dionex ASE® 200, USA to maximize the antioxidant activity [Ferric ion Reducing Antioxidant Power (FRAP)] and total polyphenol content (TP) of the extracts from three spices of Lamiaceae family (sage, basil and thyme). Optimal conditions with regard to extraction temperature (66-129 °C) and solvent concentration (32-88% methanol) were identified using response surface methodology (RSM). For all three spices, results showed that 129 °C was the optimum temperature with regard to antioxidant activity. Optimal methanol concentrations with respect to the antioxidant activity of sage and basil extracts were 58% and 60% respectively. Thyme showed a different trend with regard to methanol concentration and was optimally extracted at 33%. Antioxidant activity yields of the optimal PLE were significantly (p < 0.05) higher than solid/liquid extracts. Predicted models were highly significant (p < 0.05) for both total phenol (TP) and FRAP values in all the spices with high regression coefficients (R(2)) ranging from 0.651 to 0.999.

  6. Wound healing properties of ointment formulations of Ocimum ...

    African Journals Online (AJOL)

    present work evaluated the phyto-constituents and wound healing properties of ointments formulated with the n-hexane crude bark extract of a plant used folklorically in wound healing, Ocimum gratissimum. The excision wound model was employed in the wound healing studies. The air-dried, size-reduced barks were ...

  7. Microbiological analysis of pre-packed sweet basil (Ocimum basilicum) and coriander (Coriandrum sativum) leaves for the presence of Salmonella spp. and Shiga toxin-producing E. coli. (United States)

    Delbeke, Stefanie; Ceuppens, Siele; Jacxsens, Liesbeth; Uyttendaele, Mieke


    Enteric pathogens, such as Salmonella spp. and pathogenic Escherichia coli, have been detected and associated with food borne outbreaks from (imported) fresh leafy herbs. Screening on imported herbs from South East Asian countries has been described. However, limited information on prevalence of these pathogens is available from other sourcing regions. Therefore, fresh pre-packed basil and coriander leaves from a Belgian trading company were investigated for the presence of Salmonella spp., Shiga toxin-producing E. coli (STEC), generic E. coli and coliforms. In total 592 samples were collected originating from Belgium, Israel and Cyprus during 2013-2014. Multiplex PCR followed by further culture confirmation was used for the detection of Salmonella spp. and STEC, whereas the Petrifilm Select E. coli and VRBL-agar were used, respectively, for the enumeration of E. coli and coliforms. Salmonella was detected in 10 out of 592 samples (25g) (1.7%; 5 from basil and 5 from coriander), of which two samples were sourced from Israel and eight from Cyprus. The presence of STEC was suspected in 11 out of 592 samples (25g) (1.9%; 3 basil and 8 coriander), due to the detection of stx and eae genes, of which one sample originated from Belgium, four from Israel and six from Cyprus. No STEC was isolated by culture techniques, but in three samples a serotype (O26, O103 or O111) with its most likely associated eae-variant (β or θ) was detected by PCR. Generic E. coli was enumerated in 108 out of 592 samples, whereby 55, 32 and 13 samples respectively between 10-100, 100-1000 and 1000-10,000cfu/g and 8 samples exceeding 10,000cfu/g. Coliforms were enumerated in all herb samples at variable levels ranging from 1.6 to 7.5logcfu/g. Further statistics indicate that the E. coli class (categorized by level) was significantly correlated with the presence of Salmonella (pbasil and coriander sourced from different cultivation regions, may contain enteric pathogens and potentially pose a

  8. Influência da temperatura e velocidade do ar na secagem de manjericão (Ocimum basilicum L. com relação aos teores de óleos essenciais e de linalol Influence of drying temperature and air velocity related to essential oil and linalol contents of the basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Rilvaynia Dantas Soares


    Full Text Available Neste trabalho, objetivou-se estudar a influência de quatro temperaturas de ar de secagem (40, 50, 60 e 70 ºC, em camada fina, e duas velocidades do ar (0,9 e 1,9 m/s sobre o teor de linalol do manjericão (Ocimum basilicum L. Utilizou-se um secador de bandejas especialmente desenvolvido, no laboratório de Secagem da UESB, Campus de Itapetinga-BA. Foram feitas quatro repetições, com 100 g de folhas frescas em cada uma das cinco bandejas da câmara de secagem. Na extração do óleo essencial, utilizou-se um sistema de destilação por arraste a vapor e a análise do óleo essencial foi realizada em um cromatógrafo conectado a um e espectrômetro de massa (CG-MS. Os maiores rendimentos de óleos essenciais de manjericão foram obtidos no processo de secagem com temperatura do ar igual a 40 ºC e 1,9 m/s de velocidade do ar. Os maiores rendimentos de linalol foram obtidos com temperatura do ar de secagem na faixa de 50 a 60 ºC e 1,9 m/s de velocidade do ar (2,23 e 2,47 ppm, respectivamente. Por análise de regressão, estimou-se que a temperatura de 54,4 ºC e a velocidade de 1,9 m/s forneceriam o maior rendimento de linalol. Concluiu-se que a composição química do óleo essencial do manjericão é afetada tanto pela temperatura como pela velocidade do ar de secagem.This work aimed to study the influence of four thin layer drying temperatures (40, 50, 60 and 70 ºC and two air velocities (0.9 and 1.9 m/s in the content of linalol of the Basil (Ocimum basilicum L.. It was used a tray dryer specially built for this experiment in the drying laboratory of the UESB at the "Campus de Itapetinga-Ba". There were made four repetitions with 100 g of fresh leaves in each one of the five trays in the dry chamber In the extraction of the essential oil, a vapor hauling system was used and the oil analysis was made in a gas chromatographer that was connected to a mass spectrometer (CG-MS. The greatest extracted profits of basil's essential oil were

  9. Effects of Foliar Application of Nano Zinc Chelate and Zinc Sulfate on Zinc Content, Pigments and Photosynthetic Indices of Holy Basil (Ocimum sanctum(

    Directory of Open Access Journals (Sweden)

    Zohreh Moghimi pour


    Full Text Available Introduction: Holy basil is a perennial plant belongs to Lamiaceae family. The plant is a perennial and thrives well in the hot and humid climate. Its aerial parts have been in use for food, pharmaceuticals, cosmetics and perfumery industries. Leaves contain 0.5-1.5% essential oil and main oil components are eugenol, methyl eugenol, carvacrol, methyl chavicol and1,8-cineole. A balanced fertilization program with macro and micronutrients is very important in producing high quality yield. Zinc is involved in IAA production, chlorophyll biosynthesis, carbon assimilation, saccharids accumulation, reactive oxygen radicals scavenging and finally carbon utilization in volatile oil biosynthesis. Material and methods: In order to evaluate the effect on zinc foliar application on zinc content of leaves, photosynthetic indices and pigments of holy basil, an experiment was carried out in 2013 at a research farm of Horticultural Science, Shahid Chamran University (31°20'N latitude and 48°40'E longitude and 22.5 m mean sea level, Ahvaz (Iran, a region characterized by semi-dry climate. The experiment was arranged based on Randomized Complete Block Design (RCBD with six treatments and three replications. The treatments were nano zinc chelate (0, 0.5, 1 and 1.5 g.l-1 and zinc sulfate (1 and 1.5 g.l-1 fertilizers. Land preparation includes disking and the formation of raising beds (15cm high and 45cm wide across the top using a press-pan-type bed shaper. Holy basil seeds were sown on two rows on each bed, with 15 cm in-row and 40 cm between-row spacing. The plants were irrigated weekly as needed. Foliar application of zinc fertilizers was done at six-eight leaf stage and were repeated with interval 15 days until full bloom stage. Zinc content, stomata conductance (gs, CO2 under stomata (Ci, transpiration rate (E, net photosynthesis (Pn, light use efficiency (LUE, water use efficiency (WUE and also chlorophyll a, chlorophyll b, chlorophyll a+b and carotenoid

  10. Variation in the volatile terpenoids of two industrially important basil (Ocimum basilicum L.) cultivars during plant ontogeny in two different cropping seasons from India. (United States)

    Verma, Ram Swaroop; Padalia, Rajendra Chandra; Chauhan, Amit


    Two Ocimum basilicum cultivars, 'Vikarsudha' and 'CIM-Saumya', grown in the Kumaon region of western Himalaya were evaluated for their essential oil yield and composition at different stages of plant growth during two distinct cropping seasons (spring-summer and rain-autumn). The highest yield of essential oil was obtained at full bloom stage in both cultivars in both cropping seasons. The essential oils obtained from different stages in two cropping seasons were analysed by capillary gas chromatography with flame ionisation detection, and gas chromatography-mass spectrometry. The major component of cultivar 'Vikarsudha' was methyl chavicol (84.3-94.3%), while for cultivar 'CIM-Saumya' the main components were methyl chavicol (62.5-77.6%) and linalool (14.4-34.1%). This study clearly indicated that cultivar, cropping season, plant ontogeny and plant part had significant effects on the yield and quality of the essential oil of O. basilicum. Further, the amount of methyl chavicol in the cultivars grown in this region was higher than in cultivars from other parts of India. Copyright © 2011 Society of Chemical Industry.

  11. Chemical composition, acute toxicity, and antinociceptive activity of the essential oil of a plant breeding cultivar of basil (Ocimum basilicum L.). (United States)

    Venâncio, Antônio Medeiros; Onofre, Alexandre Sherlley; Lira, Amintas Figueiredo; Alves, Péricles Barreto; Blank, Arie Fitzgerald; Antoniolli, Angelo Roberto; Marchioro, Murilo; Estevam, Charles dos Santos; de Araujo, Brancilene Santos


    Ocimum basilicum L. is an aromatic herb used in Brazil to treat illnesses such as respiratory and rheumatic problems, vomiting, and pain. In the present study, the chemical composition, acute toxicity, and antinociceptive effects of the essential oil (EO) of the cultivar "Maria Bonita" obtained from O. basilicum L. PI 197442 genotype were evaluated in Swiss mice (20-35 g each). Lethal dose to cause 50 % death (LD50) was calculated from a dose-response curve (100-5000 mg/kg body wt.; n = 6) as 532 mg/kg body wt. In the acetic acid-induced writhing test (0.6 % i. p.), EO (50, 100, and 200 mg/kg body wt., n = 8, s. c.) was effective in reducing the abdominal contractions at all doses (48-78 %). In the hot-plate test, EO significantly increased the latency at 50 mg/kg body wt. at all times (37-52 %, n = 8, s. c.). However, the effects of morphine and EO at 50 mg/kg were reverted in the presence of naloxone, an opioid antagonist. In the formalin test, EO significantly reduced paw licking time in the first and second phases of pain at 200 mg/kg body wt. (38 and 75 %, respectively, n = 8, s. c.). The results suggested that the peripheral and central antinociceptive effects of EO are related to the inhibition of the biosynthesis of pain mediators, such as prostaglandins and prostacyclins, and its ability to interact with opioid receptors. © Georg Thieme Verlag KG Stuttgart · New York.

  12. Variation in essential oil composition within individual leaves of sweet basil (Ocimum basilicum L.) is more affected by leaf position than by leaf age. (United States)

    Fischer, Ravit; Nitzan, Nadav; Chaimovitsh, David; Rubin, Baruch; Dudai, Nativ


    The aroma in sweet basil is a factor affecting the commercial value of the crop. In previous studies leaf age was considered to be a factor that influences the composition of essential oil (EO). In this study it was hypothesized that a single observation of the EO content in leaves from different positions on the main stem (young vs old) could predict the developmental changes in the plant during its life cycle. Plants harvested at week 16 demonstrated an exponential increase (R(2) = 0.92) in EO concentration in leaves on the main stem and lateral shoots, indicating higher EO concentrations in younger than in older leaves. Eugenol and methyleugenol predominated (28-77%) in the extract. Eugenol levels were higher in younger leaves (∼53%), and methyl-eugenol levels predominated in older leaves (∼68%). Linalool was lower in mature leaves than in younger leaves. This suggested that eugenol converted into methyleugenol and linalool decreased as leaf mature. However, in weekly monitored plants, the levels of these compounds in the EO had limited variation in the maturing leaf regardless of its position on the stem. This proposed that the EO composition in an individual leaf is mostly affected by the leaf position on the stem and not by its maturation process. Because leaf position is related to plant development, it is probable that the plant's physiological age at the time of leaf formation from the primordial tissue is the factor affecting the EO composition. It was concluded that interpretation of scientific observations should be carried out with caution and that hypotheses should be tested utilizing multifaceted approaches.

  13. Evaluation the effects of organic, biological and chemical fertilizers on morphological traits, yield and yield components of Basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    S. M.K Tahhami Zarandi


    Full Text Available The use of organic manure and biofertilizers containing beneficial microorganisms instead of chemical fertilizers are known to improve plant growth through supply of plant nutrients and can help sustain environmental health and soil productivity. Because of special priority of the medicinal plants production in sustainable agricultural systems and lack of studies on assessment of different sources of fertilizer on basil plants, an experiment was conducted at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, in 2009. A complete randomize block design with ten treatments, and three replications was used. The treatments were: 1cow manure, 2sheep manure, 3hen manure, 4compost 5vermicompost, 6biological fertilizer nitroxin (consisting of Azotobacter and Azospirillum, 7biological fertilizer consisting of Phosphate Solubilizing Bacteria (Pseudomonas and Bacillus, 8mixture of biological fertilizer nitroxin and Phosphate Solubilizing Bacteria 9NPK fertilizers, and 10control (no fertilizer. Results showed plant height in sheep manure was higher than other treatments. Number of branches in vermicompost and number of inflorescence in cow manure were significantly higher than other treatments. The number of whorled flowers in compost, sheep and cow manure were more than other treatments. Highest leaf and green area index was observed in nitroxin treatment and biological yield in sheep manure have significant difference with other treatments (except cow manure. The highest seed yield were obtained from plants treated with compost (1945 kg/h and the lowest of that observed in NPK fertilizer and control treatments. In all measured traits (except number of inflorescence NPK fertilizer and control treatment did not have any significant difference.

  14. The Effect of Biofertilizers and Winter Cover Crops on Essential Oil Production and Some Agroecological Characteristics of Basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    M Jahan


    basil in an ecological production system framework.

  15. Efeito de diferentes lâminas de irrigação na produção de óleo essencial do manjericão (Ocimum basilicum L. = Effect of different water depths in basil (Ocimum basilicum L. oil production

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Pravuschi


    Full Text Available O manjericão (Ocimum basilicum L. é uma planta aromática de importância econômica no Brasil, muito usado como tempero na preparação de alimentos. É também utilizado para a obtenção de óleo essencial, importante na indústria de perfumaria. O objetivo deste experimento foi analisar o efeito de cinco lâminas de irrigação, bem como uma análise da viabilidade econômica da aplicação da irrigação na produção do manjericão. O experimento foi conduzido no período de março a outubro de 2007. As lâminas foram baseadas na evaporação do Tanque Classe A (ECA sendo: 0, 50, 75, 100 e 150% ECA. As variáveis analisadas foram matéria seca das folhas e inflorescências, teor de óleo essencial, massa seca e comprimento de raízes. Foram calculadas a produtividade de óleo essencial e a receita líquida. A terceira colheita foi viável somente utilizando irrigação. A irrigação diáriaexcessiva prejudicou o desenvolvimento da planta. A lâmina de irrigação equivalente a 100% ECA promoveu a máxima produtividade de matéria seca (4.248,67 kg ha-1, assim como a máxima produtividade de óleo essencial (58,26 kg ha-1, apresentando receita líquida anualde R$ 2.543,82 ha-1.Basil (Ocimum basilicum L. is an aromatic plant of economic importance in Brazil, very used as a spice for food preparation. It is also used to obtain essential oil, which important in the perfume industry. The purpose of this experiment was to analyze the effect of five irrigation water depths, as well as an economic viability analysis of the application of irrigation in basil production. The experiment was carried out from March to October 2007. The water depths were based in the cumulative class A pan evaporation (CPE: 0, 50, 75, 100 and 150% CPE. The analyzed variables were dry weight for leaves and flowers, content of essential oil, and dry mass and length of root zone. The essential oil yield and net return were calculated. The third harvest was possible only

  16. Basil oil fumigation increases radiation sensitivity in adult Sitophilus oryzae (Coleoptera: Curculionidae). (United States)

    The biological activity of basil (Ocimum basilicum L.) oil was tested against the stored product pest rice weevil, Sitophilus oryzae(L.). Adult weevils were exposed to seven different concentrations of basil oil ranging from 0.12 µl/ml-0.60 µl/ml in Petri dishes and mortality was assessed at 3,4 and...

  17. Anti-diabetic Potential of the Aqueous Leaf Extracts of Ocimum ...

    African Journals Online (AJOL)

    The anti-diabetic potential of aqueous extracts of leaves of both Ocimum gratissimum and Vernonia amygdalina were investigated in rabbits. Ten female rabbits were grouped into five groups (1-5) of two rabbits each. Group 1 is the control. Groups (2-5) was alloxan induced diabetic. Group 3 was then treated with 200mg/kg ...

  18. Acaricidal Effect of Foam Soap Containing Essential Oil of Ocimum ...

    African Journals Online (AJOL)

    Acaricidal effect of foam soap containing essential oil of Ocimum gratissimum leaves was tested on Rhipicephalus lunulatus in western highland of Cameroon. Five doses of essential oil (0.00; 0.04; 0.06; 0.08; 0.10 μl/g) with four replications for each dose were tested in vitro. Each replication consisted of 10 ticks in Petri dish ...

  19. The Effects of Ocimum Gratissimum Leaf Extract on Cardiovascular ...

    African Journals Online (AJOL)

    At the end of the period the blood pressure, heart rate, packed cell volume ... Also determined were the urine output, urine flow rate and urinary excretion of ... No significant histological changes were observed in renal cortical tissue of O.

  20. The antimicrobial properties of Ocimum gratissimum extracts on ...

    African Journals Online (AJOL)



    Nov 16, 2006 ... The plant is extensively cultivated in and around town and villages in Nigeria, tropical regions of Asia, Africa, central and South America (Bailey, 1924). ..... ritual aspects of traditional therapy using drugs dried from human body. Chinese Science. Exploration of an Ancient Tradition, Shigeru. Makayoma and ...

  1. Antimicrobial activity of essential oils of Ocimum gratissimum l. from ...

    African Journals Online (AJOL)

    ) of 13 populations of different silvicultural zones were evaluated for antimicrobial activity against Gram positive (Staphylococcus aereus, Bacillus spp.) and Gram negative (Escherichia coli, Pseudomonas aeruginosa, Samonella typhi, ...

  2. Effects of aqueous leaves extract of Ocimum gratissimum on blood ...

    African Journals Online (AJOL)



    Sep 19, 2007 ... African Journal of Biotechnology Vol. 6 (18), pp. ... Full Length Research Paper. Effects of ... blood glucose level (P<0.05) of the diabetic rats by 81.3% after 24 h of extract administration. ..... The endocrine pancreas and the.

  3. Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet ...

    African Journals Online (AJOL)

    We evaluated the effects of aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) on sodium arsenite-induced hepatotoxicity in Wistar rats. We observed that treatment of the animals with the extracts before or just after sodium arsenite administration significantly (p < 0.05) reduced mean liver and serum ...

  4. Étude ethnobotanique, phytochimique et écotoxicologique de ...

    African Journals Online (AJOL)

    ... Plante Médicinale a caractère de Légumes feuilles, gage de bonne santé et de Développement Durable. Mots clés: Ocimum gratissimum ; Légume feuille ; Plante médicinale ; Ethnobotanique ; Cotonou ; Bénin. English Abstract. Objective: The use of Ocimum gratissimum Lamiaceae (African Basil) is widespread in Benin.

  5. Variation of Ursolic Acid Content in Eight Ocimum Species from Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Selene M. Morais


    Full Text Available Ursolic acid is a very important compound due to its biological potential as an anti-inflammatory, trypanocidal, antirheumatic, antiviral, antioxidant and antitumoral agent. This study presents the HPLC analysis of ursolic acid (UA content in eight different Ocimum species: O. americanum L., O. basilicum L, O. basilicum var purpurascens Benth, O. basilicum var. minimum L, O. gratissimum L, O. micranthum Willd, O. selloi Benth. and O. tenuiflorum L. grown in Northeastern Brazil. In these Ocimum species, UA was detected in different yields, with O. tenuiflorum showing the highest content (2.02%. This yield is very significant when compared with other sources of UA.

  6. Oxygen amendment on growth and nitrogen-use efficiency of flooded Italian Basil (United States)

    Flooding is a frequent and often unavoidable cause of stress, in vegetable production in Florida. Flooding results in hypoxia i.e., oxygen deficiency. This study was conducted with traditional Italian basil (Ocimum basilicum L.), cv. Genovese OG, treated with either a fast- or slow-release solid oxy...

  7. In-vivo study for anti-hyperglycemic potential of aqueous extract of Basil seeds (Ocimum basilicum Linn) and its influence on biochemical parameters, serum electrolytes and haematological indices. (United States)

    Chaudhary, Sachin; Semwal, Amit; Kumar, Hitesh; Verma, Harish Chandra; Kumar, Amit


    The study introduced anti-hyperglycemic influence of aqueous extract of Ocimum basilicum seeds (AEOBS) in Streptozotocin (STZ) induced diabetic rats and estimating its potential to ameliorate altered level of biochemical parameters, serum electrolytes level and haematological indices along with its effect on body weight of treated rats. The albino rats were selected to observe oral glucose tolerance test by oral intake of aq. glucose solution (4g/kg, body weight) in normal rats and estimation of blood glucose level after administration of AEOBS at 250mg/kg, 500mg/kg and standard drug glibenclamide at 0.6mg/kg, body weight. Antidiabetic activity was evaluated in chronic study models by STZ induced diabetes in rats followed by blood glucose estimation. Chronic study model was selected to carry out further studies to evaluate the effect of AEOBS at 250mg/kg, 500mg/kg and standard drug on body weight, alterations in biochemical parameters including AST, ALT, ALP, total bilirubin and total protein, alterations in serum electrolytes like Na + , K + , Cl - , HCO 3 - along with estimation of haematological indices like red blood cells (RBC), white blood cells (WBC), hemoglobin (Hb), lymphocytes, neutrophils, eosinophils, monocytes and basophils. AEOBS significantly reduced the blood glucose level of diabetic rats at both doses. Body weight was also improved significantly. Similarly, the levels of biochemical parameters, serum electrolytes, and haematological indices were significantly ameliorated at both doses of AEOBS. The histopathological results revealed reconstitution of pancreatic islets towards normal cellular architecture in rats treated with AEOBS. The results illustrated that AEOBS have eminent antidiabetic potential in STZ effectuated diabetes in rats and can be extensively used for the treatment of diabetes mellitus-II and its associated complications including anaemia, diabetic nephropathy, liver dysfunction, and immunosuppression. Copyright © 2016 Elsevier

  8. Bactericidal activity of herbal volatile oil extracts against multidrug resistant Acinetobacter baumannii


    Amornrat Intorasoot; Piyaorn Chornchoem; Siriwoot Sookkhee; Sorasak Intorasoot


    Aim: To investigate the antibacterial activity of ten volatile oils extracted from medicinal plants, including galangal (Alpinia galanga Linn.), ginger (Zingiber officinale), plai (Zingiber cassumunar Roxb.), lime (Citrus aurantifolia), kaffir lime (Citrus hystrix DC.), sweet basil (Ocimum basilicum Linn.), tree basil (Ocimum gratissimum), lemongrass (Cymbopogon citratus DC.), clove (Syzygium aromaticum) and cinnamon (Cinnamomum verum) against four standard strains of Staphylococcus aureus, E...

  9. Utilization of Basil Extract as a Radioprotector in Male Rats

    Energy Technology Data Exchange (ETDEWEB)

    Farag, M. F.S. [Food Irradiation Research Dep. National Centre for Radiation Research and Technology, Atomic Energy Authority, Cairo (Egypt)


    Man is exposed to natural radiations from cosmic or terrestrial origins. Furthermore, it is well known that the gamma irradiation-induced biochemical alteration depends mostly on oxidative stress. Basil or sweet basil (Ocimum basilicum) is known to have numerous pharmacological activities. Therefore, the present study was carried out to investigate the radioprotective activity of basil in albino rats. The effect of basil aqueous extract (BAE) was evaluated on hepatic marker enzymes, sex hormones, lipid profile and antioxidant status. The results showed that - rays caused a significant increase in serum level of alanine and aspartate aminotransferase, alkaline phosphatase, gamma glutamyl transpeptidase (ALT, AST, ALP and GT), cholesterol (TC), triglyceride (TG), low and very low density lipoprotein cholesterol (LDL-C and VLDL-C) and thiobarbituric acid reactive substances (TBARS). A significant decrease in high density lipoprotein cholesterol (HDL-C), reduced glutathione (GSH), superoxide dismutase (SOD) and catalase (CAT) in serum was observed, compared with control group. Moreover, - rays induced a significant drop in the serum sex hormones levels testosterone (T), follicle stimulating hormone (FSH) and luteinizing hormone (LH). The BAE administered orally to rats has significantly modulated all the radiation-induced biochemical alterations. These findings showed that basil would exert a radioprotective properties.

  10. Utilization of Basil Extract as a Radioprotector in Male Rats

    International Nuclear Information System (INIS)

    Farag, M.F.S.


    Man is exposed to natural radiations from cosmic or terrestrial origins. Furthermore, it is well known that the gamma irradiation-induced biochemical alteration depends mostly on oxidative stress. Basil or sweet basil (Ocimum basilicum) is known to have numerous pharmacological activities. Therefore, the present study was carried out to investigate the radioprotective activity of basil in albino rats. The effect of basil aqueous extract (BAE) was evaluated on hepatic marker enzymes, sex hormones, lipid profile and antioxidant status. The results showed that - rays caused a significant increase in serum level of alanine and aspartate aminotransferase, alkaline phosphatase, gamma glutamyl transpeptidase (ALT, AST, ALP and GT), cholesterol (TC), triglyceride (TG), low and very low density lipoprotein cholesterol (LDL-C and VLDL-C) and thiobarbituric acid reactive substances (TBARS). A significant decrease in high density lipoprotein cholesterol (HDL-C), reduced glutathione (GSH), superoxide dismutase (SOD) and catalase (CAT) in serum was observed, compared with control group. Moreover, - rays induced a significant drop in the serum sex hormones levels testosterone (T), follicle stimulating hormone (FSH) and luteinizing hormone (LH). The BAE administered orally to rats has significantly modulated all the radiation-induced biochemical alterations. These findings showed that basil would exert a radioprotective properties.

  11. Acaricidal activity of five essential oils of Ocimum species on Rhipicephalus (Boophilus) microplus larvae. (United States)

    Hüe, T; Cauquil, L; Fokou, J B Hzounda; Dongmo, P M Jazet; Bakarnga-Via, I; Menut, C


    The aim of this study was to evaluate the acaricidal activity on the cattle tick Rhipicephalus (Boophilus) microplus of essential oils from three Ocimum species. Acaricidal activity of five essential oils extracted from Ocimum gratissimum L. (three samples), O. urticaefolium Roth, and O. canum Sims was evaluated on 14- to 21-day-old Rhipicephalus microplus tick larvae using larval packet test bioassay. These essential oils were analyzed by gas chromatography (GC) and gas chromatography-mass spectrometry (GC/MS) showing great variations of their chemical compositions according to the botanical species and even within the O. gratissimum species; the acaricidal activity of their main compounds was also evaluated. The essential oils of O. urticaefolium and O. gratissimum collected in Cameroon were the most efficient with respective LC50 values of 0.90 and 0.98%. The two essential oils obtained from O. gratissimum collected in New Caledonia were partially active at a dilution of 5% while the essential oil of O. canum collected in Cameroon showed no acaricidal activity. The chemical analysis shows five different profiles. Whereas the essential oils of O. urticaefolium from Cameroon and O. gratissimum from New Caledonia contain high amounts of eugenol (33.0 and 22.3-61.0%, respectively), 1,8-cineole was the main component of the oil of an O. canum sample from Cameroon (70.2%); the samples of O. gratissimum oils from New Caledonia are also characterized by their high content of (Z)-β-ocimene (17.1-49.8%) while the essential oil of O. gratissimum collected in Cameroon is mainly constituted by two p-menthane derivatives: thymol (30.5%) and γ-terpinene (33.0%). Moreover, the essential oil of O. urticaefolium showed the presence of elemicin (18.1%) as original compound. The tests achieved with the main compounds confirmed the acaricidal activity of eugenol and thymol with residual activity until 0.50 and 1%, respectively, and revealed the acaricidal property of elemicin

  12. Phenolic composition of basil plants is differentially altered by plant nutrient status and inoculation with mycorrhizal fungi (United States)

    Four cultivars of basil (Ocimum basilicum ‘Cinnamon’, ‘Siam Queen’, ‘Sweet Dani’, and ‘Red Rubin’) were inoculated or not with the arbuscular mycorrhizal fungus (AMF), Rhizophagus intraradices, and grown with a fertilizer containing either 64 mg/l P (low-P) or 128 mg/l P (high-P) to assess whether (...

  13. Characterization of organic and conventional sweet basil leaves using chromatographic and flow-injection mass spectrometric (FIMS) fingerprints combined with principal component analysis (United States)

    Lu, Yingjian; Gao, Boyan; Chen, Pei; Charles, Denys; Yu, Liangli (Lucy)


    Sweet basil, Ocimum basilicum., is one of the most important and wildly used spices and has been shown to have antioxidant, antibacterial, and anti-diarrheal activities. In this study, high performance liquid chromatographic (HPLC) and flow-injection mass spectrometric (FIMS) fingerprinting techniques were used to differentiate organic and conventional sweet basil leaf samples. Principal component analysis (PCA) of the fingerprints indicated that both HPLC and FIMS fingerprints could effectively detect the chemical differences in the organic and conventional sweet basil leaf samples. This study suggested that the organic basil sample contained greater concentrations of almost all the major compounds than its conventional counterpart on a per same botanical weight basis. The FIMS method was able to rapidly differentiate the organic and conventional sweet basil leaf samples (1 min analysis time), whereas the HPLC fingerprints provided more information about the chemical composition of the basil samples with a longer analytical time. PMID:24518341

  14. Study on Corrosion Inhibition Efficiency of Stem Alkaloid Extract of Different Varieties of Holy Basil on Aluminium in HCl Solution

    Energy Technology Data Exchange (ETDEWEB)

    Kumpawat, Nutan; Chaturvedi, Alok; Upadhyay, R. K. [Synthetic and Surface Science Laboratory, Ajmer (India)


    Corrosion inhibition efficiencies of holy basil on Al in HCl solution were studied by weight loss and thermometric methods in presence and in absence of stem extract of three different varieties of holy basil viz. ocimum basilicum (E{sub B}), ocimum canum (E{sub C}) and ocimum sanctum (E{sub S}). Inhibition efficiency increases with the increasing concentration of stem extract and decreases with increases in acid strength. Results show that all varieties under study are good corrosion inhibitors, among which, E{sub B} is most effective. Maximum inhibition efficiency was found 97.09% in 0.5N HCl solution with 0.6% stem extract. The Langmuir adsorption isotherm indicates that surface coverage also increases with increasing in the concentration of extract of stem in HCl solution.

  15. Study on Corrosion Inhibition Efficiency of Stem Alkaloid Extract of Different Varieties of Holy Basil on Aluminium in HCl Solution

    International Nuclear Information System (INIS)

    Kumpawat, Nutan; Chaturvedi, Alok; Upadhyay, R. K.


    Corrosion inhibition efficiencies of holy basil on Al in HCl solution were studied by weight loss and thermometric methods in presence and in absence of stem extract of three different varieties of holy basil viz. ocimum basilicum (E B ), ocimum canum (E C ) and ocimum sanctum (E S ). Inhibition efficiency increases with the increasing concentration of stem extract and decreases with increases in acid strength. Results show that all varieties under study are good corrosion inhibitors, among which, E B is most effective. Maximum inhibition efficiency was found 97.09% in 0.5N HCl solution with 0.6% stem extract. The Langmuir adsorption isotherm indicates that surface coverage also increases with increasing in the concentration of extract of stem in HCl solution

  16. Komposisi Kimia dan Uji Aktivitas Antibakteri Minyak Kemangi (Ocimum americanum L. Terhadap Bakteri Escherichia coli, Shigella sonnei, dan Salmonella enteritidis

    Directory of Open Access Journals (Sweden)

    Asep Kadarohman


    Full Text Available The chemical composition and antibacterial activity of basil oil (Ocimum americanum L. against Escherichia coli, Shigellasonnei and Salmonella enteritidis have been determined. Basil oils were isolated from leaves and stems of basil (Ocimum americanumL. with percolation method and analyzed by FTIR and GC-MS spectrometry. The antibacterial activity of basil oils were obtained byAgar diffusion method with various concentration (v/v 2, 4, 6, 8, and 10% with ethanol p.a. as negative control, thiamfenicol, andtetracycline 500 mg as positive control. The produces essential oils from leaves and stems of basil by percolation are 1.06 and 0.22%,respectively. There are 22 components of basil oil were identifi ed, with a major component are citral (35.58% and neral (29.56% .Basil oil has not effectively against Escherichia coli and Shigella sonnei but effectively against Salmonella enteritidis at concentration 8 and 10%, with inhibition zone diameter are 10.25 and 10.93 mm respectively.

  17. Morphological and chemical variability of Ocimum basilicum L. (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Renata Nurzyńska-Wierdak


    Full Text Available Morphological features of 17 sweet basil cultivars as well as essential oil content and composition were determined. The study clearly indicated great variability of Ocimum basilicumL. The content of essential oil in the dried herb was high and varied from 0.75% (O. basilicumvar. piperita to 1.89% (O. basilicumvar. cinnamon. Based of the primary components, three chemotypes were distinguished: citral (‘Lime’, ‘Lemon’ and var. citriodorum, E-methyl cinnamate/linalool (‘Licorice’, var. cinnamon and methyl chavicol (‘Tai’.

  18. Population structure, genetic diversity and downy mildew resistance among Ocimum species germplasm. (United States)

    Pyne, Robert M; Honig, Josh A; Vaiciunas, Jennifer; Wyenandt, Christian A; Simon, James E


    The basil (Ocimum spp.) genus maintains a rich diversity of phenotypes and aromatic volatiles through natural and artificial outcrossing. Characterization of population structure and genetic diversity among a representative sample of this genus is severely lacking. Absence of such information has slowed breeding efforts and the development of sweet basil (Ocimum basilicum L.) with resistance to the worldwide downy mildew epidemic, caused by the obligate oomycete Peronospora belbahrii. In an effort to improve classification of relationships 20 EST-SSR markers with species-level transferability were developed and used to resolve relationships among a diverse panel of 180 Ocimum spp. accessions with varying response to downy mildew. Results obtained from nested Bayesian model-based clustering, analysis of molecular variance and unweighted pair group method using arithmetic average (UPGMA) analyses were synergized to provide an updated phylogeny of the Ocimum genus. Three (major) and seven (sub) population (cluster) models were identified and well-supported (P UPGMA analysis provided best resolution for the 36-accession, DM resistant k3 cluster with consistently strong bootstrap support. Although the k3 cluster is a rich source of DM resistance introgression of resistance into the commercially important k1 accessions is impeded by reproductive barriers as demonstrated by multiple sterile F1 hybrids. The k2 cluster located between k1 and k3, represents a source of transferrable tolerance evidenced by fertile backcross progeny. The 90-accession k1 cluster was largely susceptible to downy mildew with accession 'MRI' representing the only source of DM resistance. High levels of genetic diversity support the observed phenotypic diversity among Ocimum spp. accessions. EST-SSRs provided a robust evaluation of molecular diversity and can be used for additional studies to increase resolution of genetic relationships in the Ocimum genus. Elucidation of population structure

  19. Anderson, Prof. Basil Williams

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1964 Honorary. Anderson, Prof. Basil Williams. Date of birth: 3 July 1901. Date of death: 24 February 1984. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held ...

  20. Salt exclusion and mycorrhizal symbiosis increase tolerance to NaCl and CaCl2 salinity in ‘Siam Queen’ basil (United States)

    A study was conducted to evaluate the effects of salinity on growth and nutrient uptake in basil (Ocimum basilicum L.). Plants were fertilized with a complete nutrient solution and exposed to no, low, or moderate levels of salinity from NaCl or CaCl2. Plants in the control and moderate salinity tre...


    Directory of Open Access Journals (Sweden)

    Korla Swapnavahini


    Full Text Available The waste originated in temples is presently piled up at one place and then disposed off in water bodies or dumped on land to decay, leading to water and soil pollution. The present work aims to determine the biogas yield and nutrient reduction potential of Ocimum sanctum (basil leaf waste obtained from temples. Laboratory scale digesters of 2.5 L capacity were used and fed with basil leaf waste, which was digested in a batch reactor for a retention period of 30 days at room temperature. Preliminary results indicate that the process is effective in reducing the pollution potential of the basil waste. The process removed up to 73% and 42% of total solids and BOD, respectively, along with biogas production.

  2. The Essential Oil Compositions of Ocimum basilicum from Three Different Regions: Nepal, Tajikistan, and Yemen. (United States)

    Sharopov, Farukh S; Satyal, Prabodh; Ali, Nasser A Awadh; Pokharel, Suraj; Zhang, Hanjing; Wink, Michael; Kukaniev, Muhammadsho A; Setzer, William N


    The aerial parts of Ocimum basilicum L. were collected from four different geographical locations, Sindhuli and Biratnagar (Nepal), Chormaghzak village (Tajikistan), and Sana'a (Yemen). The essential oils were obtained by hydrodistillation and analyzed by gas chromatography/mass spectrometry. A cluster analysis of 179 essential oil compositions revealed six major chemotypes: Linalool, eugenol, estragole, methyl eugenol, 1,8-cineole, and geraniol. All four of the basil oils in this study were of the linalool-rich variety. Some of the basil oils were screened for bioactivity including antimicrobial, cytotoxicity in human cancer cells, brine shrimp lethality, nematicidal, larvicidal, insecticidal, and antioxidant. The basil oils in this study were not notably antibacterial, cytotoxic, antioxidant, nor nematicidal, but were active in the brine shrimp lethality test, and did show larvicidal and insecticidal activities. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.

  3. The effects of different UV-B radiation intensities on morphological and biochemical characteristics in Ocimum basilicum L. (United States)

    Sakalauskaitė, Jurga; Viskelis, Pranas; Dambrauskienė, Edita; Sakalauskienė, Sandra; Samuolienė, Giedrė; Brazaitytė, Aušra; Duchovskis, Pavelas; Urbonavičienė, Dalia


    The effects of short-term ultraviolet B (UV-B) irradiation on sweet basil (Ocimum basilicum L. cv. Cinnamon) plants at the 3-4 leaf pair and flowering stages were examined in controlled environment growth chambers. Plants were exposed to 0 (reference), 2 and 4 kJ UV-B m(-2) day(-1) over 7 days. Exposure of basil plants to supplementary UV-B light resulted in increased assimilating leaf area, fresh biomass and dry biomass. Stimulation of physiological functions in young basil plants under either applied UV-B dose resulted in increased total chlorophyll content but no marked variation in carotenoid content. At the flowering stage the chlorophyll and carotenoid contents of basil were affected by supplementary UV-B radiation, decreasing with enhanced UV-B exposure. Both total antioxidant activity (2,2-diphenyl-1-picrylhydrazyl free radical assay) and total phenolic compound content were increased by UV-B light supplementation. Young and mature basil plants differed in their ascorbic acid content, which was dependent on UV-B dose and plant age. UV-B radiation resulted in decreased nitrate content in young basil plants (3-4 leaf pair stage). These results indicate that the application of short-exposure UV-B radiation beneficially influenced both growth parameters and biochemical constituents in young and mature basil plants. © 2012 Society of Chemical Industry.

  4. Bactericidal activity of herbal volatile oil extracts against multidrug-resistant Acinetobacter baumannii


    Intorasoot, Amornrat; Chornchoem, Piyaorn; Sookkhee, Siriwoot; Intorasoot, Sorasak


    Aim: The aim of the study is to investigate the antibacterial activity of 10 volatile oils extracted from medicinal plants, including galangal (Alpinia galanga Linn.), ginger (Zingiber officinale), plai (Zingiber cassumunar Roxb.), lime (Citrus aurantifolia), kaffir lime (Citrus hystrix DC.), sweet basil (Ocimum basilicum Linn.), tree basil (Ocimum gratissimum), lemongrass (Cymbopogon citratus DC.), clove (Syzygium aromaticum), and cinnamon (Cinnamomum verum) against four standard strains of ...

  5. AKTIVITAS ANTIFUNGI EKSTRAK DAUN KEMANGI (Ocimum americanum L. TERHADAP FUNGI Fusarium oxysporum Schlecht

    Directory of Open Access Journals (Sweden)

    Zainal Berlian


    Full Text Available Fusarium oxysporum Schlecht. a parasitic fungus that cause leaf wilt disease in plants. Meanwhile, basil (Ocimum americanum L. is a plant that contains of the active compound in the form of phenols which have antifungal activity. This study aimed to test whether the extract of leaves of basil have antifungal activity againts Fusarium oxysporum Schlecht. and determine the optimum concentration to inhibit the growth of the fungus Fusarium oxysporum Schlecht. Antifungal test is done by using paper disc diffusion method. The study design used was a completely randomized design with 4 treatments and 6 replications. The treatment is K0 (0% w/v, K1 (5% w/v, K2 (10% w/v, and K3 (15% w/v. The results showed that the leaf extract of basil have antifungal activity against Fusarium oxysporum Schlecht. Inhibition zone on K0, K1, K2, and K3 are each 0,0 mm, 1,49 mm, 2,46 mm, and 2,01 mm. The optimum concentration of antifungal activity of extract of basil, namely the K2 concentration (10% w/v. Based on analysis of variance (ANOVA, the concentration of basil leaf extract provides significant differences (p > 0,05 on fungus Fusarium oxysporum Schlecht., where Fcount > Ftable is 4,5 > 3,1.

  6. Quantification of character-impacting compounds in Ocimum basilicum and 'Pesto alla Genovese' with selected ion flow tube mass spectrometry. (United States)

    Amadei, Gianluca; Ross, Brian M


    Basil (Ocimum basilicum) is an important flavourant plant which constitutes the major ingredient of the pasta sauce 'Pesto alla Genovese'. The characteristic smell of basil stems mainly from a handful of terpenoids (methyl cinnamate, eucalyptol, linalool and estragole), the concentration of which varies according to basil cultivars. The simple and rapid analysis of the terpenoid constituents of basil would be useful as a means to optimise harvesting times and to act as a quality control process for basil-containing foodstuffs. Classical analytical techniques such as gas chromatography/mass spectrometry (GC/MS) are, however, slow, technically demanding and therefore less suitable for routine analysis. A new chemical ionisation technique which allows real-time quantification of traces gases, Selected Ion Flow Tube Mass Spectrometry (SIFT-MS), was therefore utilised to determine its usefulness for the assay of terpenoid concentrations in basil and pesto sauce headspace. Trace gas analysis was performed using the NO(+) precursor ion which minimised interference from other compounds. Character-impacting compound concentration was measured in basil headspace with good reproducibility and statistically significant differences were observed between cultivars. Quantification of linalool in pesto sauce headspace proved more difficult due to the presence of interfering compounds. This was resolved by careful selection of reaction product ions which allowed us to detect differences between various commercial brands of pesto. We conclude that SIFT-MS may be a valid tool for the fast and reproducible analysis of flavourant terpenoids in basil and basil-derived foodstuffs. Copyright © 2011 John Wiley & Sons, Ltd.

  7. Diversity in chemical composition and yield of essential oil from two Iranian landraces of sweet basil

    Directory of Open Access Journals (Sweden)

    Ghasemi Pirbalouti Abdollah


    Full Text Available Ocimum basilicum L. belongs to the family Lamiaceae is an herb that is extensively cultivated in some countries. Areal parts, especially leaves of sweet basil are widely used to enhance the flavour of foods such as salads, pasta, tomato products, vegetables, pizza, meat, soups, marine foods, confectioneries and other products. Essential oil yield and chemical components of two Iranian landraces of sweet basil including “Purple” and “Green” grown south-central of Iran (Isfahan province were investigated. The hydro-distillated oils were analyzed by GC-MS. The oil yields were obtained from the aerial of Purple with 0.56 ml/100 g dry matter and the aerial of Green with 0.48 ml/100 g dry matter. Results indicated significant differences (p < 0.01 among the aerial for the main constituents in the essential oil from two Iranian landraces of sweet basil. The major constituents of the essential oil from the aerial of Purple landrace were methyl chavicol or estragol (63.32% and linalool (7.96%. The main compositions of the essential oil from the aerial of Green landrace were methyl chavicol (31.82%, geranial (24.60% and neral (22.65%. Genarlly, a comparison of our results with the previous reports suggests differences in the essential oil compositions and oil yield of the plant material could be attributed to genetic diversity in two Iranian landraces of sweet basil.


    Directory of Open Access Journals (Sweden)



    Full Text Available We have conducted a research on the effect of the extract of leaves basil (Ocimum sanctum L on male mice to investigate the consentration and motility spermatozoa mice. Twoty male mice which has age about 2 months with wight 20 – 25 g were divided into four groups. The extract was provided orally daily until the 20 th day. At 21th day were sacrificed and determine of consentration and motility. The result of the research showed that the extract of Ocimum sanctum L leaves that being given during 20 days with the dosage of 50 mg/g body weight, 100 mg/g bw, and 250 mg/g bw could signifi increase the consentration and motility spermatozoa mice.

  9. The Impact of Hybridization on the Volatile and Sensorial Profile of Ocimum basilicum L.


    Andréa Santos da Costa; Maria de Fátima Arrigoni-Blank; Maria Aparecida Azevedo Pereira da Silva; Mércia Freitas Alves; Darlisson de Alexandria Santos; Péricles Barreto Alves; Arie Fitzgerald Blank


    The aim of the present study was to investigate the volatile and sensorial profile of basil (Ocimum basilicum L.) by quantitative descriptive analysis (QDA) of the essential oil of three hybrids (“Cinnamon” × “Maria Bonita,” “Sweet Dani” × “Cinnamon,” and “Sweet Dani” × “Maria Bonita”). Twelve descriptive terms were developed by a selected panel that also generated the definition of each term and the reference samples. The data were subjected to ANOVA, Tukey's test, and principal component an...

  10. Changes in yogurt fermentation characteristics, and antioxidant potential and in vitro inhibition of angiotensin-1 converting enzyme upon the inclusion of peppermint, dill and basil


    Amirdivani, Shabboo


    The present study investigated the effects of peppermint (Mentha piperita), dill (Anethum graveolens) and basil (Ocimum basilicum) on yogurt formation, proteolysis and inhibition of angiotensin-1 converting enzyme (ACE). Herbal-yogurts had faster rates of pH reduction than plain-yogurt. All herbal-yogurts had higher (p < 0.05) antioxidant activities than plain-yogurt, both at the end of fermentation and throughout the storage period. The o-phthalaldehyde (OPA) peptides in herbal-yogurts in...

  11. Seed Germination and Early Growth Responses of Hyssop, Sweet Basil and Oregano to Temperature Levels

    Directory of Open Access Journals (Sweden)

    Sajad MIJANI


    Full Text Available The objectives of this survey were to determine the effect of temperature on germination and seedling growth of Hyssop (Hyssopus officinalis L., Sweet basil (Ocimum basilicum L. and Oregano (Origanum vulgare L. (Lamiaceae family as well as comparing species regarding germination behavior and growth characteristics. Seeds were germinated on a temperature-gradient bar varying between 5 and 40 °C (with 5 °C intervals. Results indicated that the highest germination percentage of hyssop (92-98%, sweet basil (86-90% and oregano (74-77% occurred at 20-30 °C, 25-30 °C and 20-30 °C, respectively; therefore, moderate and warm temperatures are proper for germination of all species. In all species the maximum germination rate obtained at 30 °C. Among all species, Day 10 % of Sweet basil Germination had the lowest value, which indicates faster germination. The cardinal temperatures (base, optimum and ceiling or maximum were estimated by the segmented model. Base temperature (Tb was calculated for hyssop, sweet basil and oregano as 3.42, 5.70 and 5.46 °C, respectively. Optimal temperature (To calculated for all species was approximately 30°C, So warmer temperatures are much more proper for them. The species showed different maximum temperatures (Tm from 42.91 (Oregano to 48.05 °C (Hyssop. In Hyssop and Sweet basil optimum growth of seedlings were observed at 30°C while Oregano reached its best growth at 25°C. The difference between maximum and minimum temperatures of germination knowing as temperature range (TR index could show adaptation capability to broad sites for planting and domestication. Regarding this index Hyssop stood in the first place.

  12. The Utilization of Ocimum sanctum L. Essential Oil for Antimicrobial Edible Packaging and Its Application for Aloe Vera Dodol

    Directory of Open Access Journals (Sweden)

    Pramono Putro Utomo


    Full Text Available Aloe vera dodol is a traditional food of West Kalimantan that has short shelf life because of its microbial activity. Antimicrobial edible packaging could be used to maintain the quality of packaged food product actively.The purpose of this study is to prolong the shelf life of food products using antimicrobial edible packaging from durian peel and basil (Ocimum sanctum L. essential oil. The research was conducted through 4 phases,i.e. the extraction of pectin from durian peel, basil essential oil distillation, Aspergillus flavus inhibition assay, and antimicrobial edible coating production incorporated with Ocimum sanctum L. essential oil. The results showed that pectin extracted from durian peel at pH 4.5 could give yield of 5.9% with a clear coat (Colourless.The concentration of Ocimum sanctum L. essential oil by 0.6% could inhibit the growth of Aspergillus flavus and prolong the shelf life when applied as an antimicrobial ingredient in edible coating.

  13. Analyzing the structural aspects of Isoprenoid biosynthesis pathway proteins in Ocimum species

    Directory of Open Access Journals (Sweden)

    Muktesh Chandra


    Full Text Available Generally thought that the extremely diverse array of secondary metabolites observed within Ocimum species defends against a comparable diverse array of biotic pests, pathogens and herbivores encountered around its natural range. Along with defense the diverse array of secondary metabolite also leads to the therapeutic and remedial property which justifies Ocimum as natural medicinal and aromatic casket. Many of the defense compounds, aroma compounds and medicinal derivatives are secondary metabolites isolated from trichome glands, mainly consist of terpenoids as well as phenylpropanoids. Various pathways fabricating these compounds are known viz. mevalonate pathway (MVA, phenylpropanoid pathway and MEP pathways. The enzyme cascade responsible for various secondary metabolites, need to be explored in various aspects. Here we had studied the MVA pathway enzymes in O. basilicum and O. gratissimum to figure out variations in enzyme structures due to speciation. Hence, in depth analysis of the transcriptome of O. basilicum and O. gratissimum, varrying in qualitative and quantitative aspects of essential oil were carried out. The transcriptome data from NCBI server was assembled using bioinformatic approaches. nr database at NCBI repository used for annotation, which assigned 60% contigs to known functions. Contigs corresponding to Mevalonate pathway enzymes are isolated using perl pipelines developed in our lab, which were further assembled using CLC workbench to remove redundancy and make larger stretch of sequence. Blastx of these larger sequences assigned them function and they are mapped to validated sequences to make full length. Data from both species led us to overall seven enzymes (total 14 of MVA pathway. These enzymes are studied in detail for various physio-chemical properties, steriochemical properties and motif/domain for protein-protein interaction (PPI study. Homolog models of all enzymes were predicted, against templates from RCSB

  14. The Roles of a Flavone-6-Hydroxylase and 7-O-Demethylation in the Flavone Biosynthetic Network of Sweet Basil* (United States)

    Berim, Anna; Gang, David R.


    Lipophilic flavonoids found in the Lamiaceae exhibit unusual 6- and 8-hydroxylations whose enzymatic basis is unknown. We show that crude protein extracts from peltate trichomes of sweet basil (Ocimum basilicum L.) cultivars readily hydroxylate position 6 of 7-O-methylated apigenin but not apigenin itself. The responsible protein was identified as a P450 monooxygenase from the CYP82 family, a family not previously reported to be involved in flavonoid metabolism. This enzyme prefers flavones but also accepts flavanones in vitro and requires a 5-hydroxyl in addition to a 7-methoxyl residue on the substrate. A peppermint (Mentha × piperita L.) homolog displayed identical substrate requirements, suggesting that early 7-O-methylation of flavones might be common in the Lamiaceae. This hypothesis is further substantiated by the pioneering discovery of 2-oxoglutarate-dependent flavone demethylase activity in basil, which explains the accumulation of 7-O-demethylated flavone nevadensin. PMID:23184958

  15. Chemical composition, antioxidative and antimicrobial activity of essential oil Ocimum sanctum L.

    Directory of Open Access Journals (Sweden)

    Beatović Damir V.


    Full Text Available Ocimum sanctum L. (Lamiaceae sin. Ocimum tenuiflorum L. or Tulsi basil is a plant originating from tropical and subtropical areas of India. It is used in both the traditional and official medicine in India. Tulsi is a type of basil that is insufficiently explored and studied in Europe. The goal of this paper is to determine the chemical composition, antioxidative, and antimicrobial activity of the essential oil Ocimum sanctum L. grown in Serbia. The quantity of essential oil in 100 g of herb (v/w is 0.68%, with 41 components identified in the tested essential oil. The most represented chemical group are sesquiturpene hydrocarbonates with 80.47%. Other groups were much less represented. Sesquiturpene hydrocarbonate β-cariophyllene is a predominant component in the essential oil with 63.80%. The quantity of tested essential oil needed to achieve 50% of inhibition of DPPH radicals is 0.35 μg/ml, and it has high potential to neutralize free radicals. The essential oil exhibited antibacterial activity to all tested strains of bacteria, both Gram-positive and Gram-negative. It affected all strains in an inhibitory way in the interval 0.34-41.50 μl/ml, and in a bactericide way within the range 22.50-124.5 μl/ml. The most sensitive strains of bacteria are Salmonella typhimurium and Escherichia coli, while Listeria monocytogenes and Enterococus faecalis showed greatest resistance. The essential oil exhibited antifugal activity on all tested fungi. It affected all tested fungi in an inhibitory way in the interval 4.42-8.83 μl/ml, and in a microbicide way within the range 10.00-50.00 μl/ml. The most sensitive fungi are: Aspergillus ochraceus, Penicillium ochrochloron and Penicilium funiculosum, while the most resistent one is Aspergillus niger. The tested basil essential oil Ocimum sanctum demonstrated significant antioxidative and antimicrobial effect and may be used as a raw material in food, pharmaceutical and chemical industries.

  16. Insecticidal effects of Ocimum sanctum var. cubensis essential oil on the diseases vector Chrysomya putoria

    Directory of Open Access Journals (Sweden)

    Idelsy Chil-Núñez


    Full Text Available Context: The blowfly Chrysomya putoria is widely distributed throughout the Neotropical region and, besides transmitting pathogens; they could cause secondary myiasis. Botanical insecticides provide an alternative to synthetic pesticides because the excessive use of synthetic insecticides resulted in a progressive resistance of the pests to these chemicals, diminishing their effectiveness and generating consequences with negative environmental impact. The essential oil extracted from Ocimum sanctum (basil has showed insecticidal activity against some insects but has no reported studies on the activity of this plant against flies. Aims: To evaluate the insecticidal effects of Ocimum sanctum var. cubensis Gomes essential oil on the post embryonic development of Chrysomya putoria. Methods: The colonies of Chrysomya putoria were established and maintained at the Laboratório de Entomologia Médica e Forense (FIOCRUZ, Rio de Janeiro, Brazil. The basil essential oil was tested in six concentrations (4.13, 8.25, 20.63, 41.25, 61.87 and 80,25 mg/mL. Mortality and changes in life cycle were recorded daily. Results: β-caryophyllene, β-selinene and eugenol, were the main constituents of the basil essential oil. The experiments demonstrated that in all concentrations tested, this essential oil shortening the duration of all post embryonic stages having a direct impact in the viability of this fly estimating the LC50 in 7.47 mg/mL of concentration. In addition, the essential oil caused morphological alterations in abdomen, wings and ptilinum at lower concentrations. Conclusions: This essential oil emerge as a good option for the control of the disease vector blowfly Chrysomya putoria.

  17. Multivariable parameter optimization for the endoglucanase production by Trichoderma reesei Rut C30 from Ocimum gratissimum seed

    Directory of Open Access Journals (Sweden)

    Mithu Das


    Full Text Available The aim of this study was to evaluate the interaction effects of the physico-chemical parameters on the endoglucanase (CMCase production by Trichoderma reesei Rut C30 on a cellulosic agro-residue by the solid-state fermentation (SSF and to determine their optimum values by the EVOP factorial design technique. The best combination of physical parameters for the maximum production of the endoglucanase (CMCase was 28ºC temperature, 79% relative humidity and 4.8 pH of the medium. The best combination of the chemical parameters was (mg/L nicotinic acid 15, naphthalene acetic acid 7, ferric chloride 5 and Tween-80 6. With the application of this technique, the yield of the CMCase increased by ~ 2.3 fold.

  18. The Study on Diurnal Changes in Leaf Gas Exchange of Lemon Balm, Catnip, Holy Basil and Sweet basil in Ahvaz

    Directory of Open Access Journals (Sweden)

    Mohammad Mahmoodi Sourestani


    Full Text Available Introduction: Mediterranean climate conditions induce several stresses that plants have to cope with, especially during summer months when high temperature and radiation levels along with low water availability in the soil prevail for long periods. Variation in physiological traits such as photosynthesis and plant water status and their association with morphological characters can play an important role in the adaptability of the species to environmental constraints. The previous studies show that scorching weather not only affects the rate of gas exchange, but also results in diurnal changes in activity. Thus, the impact of environmental stresses on plants growing in these conditions should be assessed by examining the evolution of their diurnal variations on leaf gas exchange. Aromatic plants represent a renewable source of valuable compounds that can be used in food, perfumery, and pharmaceutical industry. Among these plants, sweet basil (Ocimumbasilicum, holy basil (Ocimum sanctum, lemon balm (Melissa officinalisL. and catnip (Nepetacataria are very important for different industries. Studies on environmental physiology of medicinal plants are relatively scarce and very few information is available concerning the physiological basis of medicinal plant response to heat stress that is one of the most important factors limiting production of medicinal plants in Khuzestan province. Material and methods: In order to evaluate the diurnal fluctuation of gas exchange of mentioned plants, an experiment was carried out in 2013 at research farm of Horticultural Science, Shahid Chamran University (31°20'N latitude and 48°40'E longitude and 22.5m mean sea level, Ahvaz (Iran, a site characterized by a semidry and scorching weather during late spring and summer. The experiment was arranged based on randomized complete block design (RCBD with three replications and 4×8 factorial scheme (Four plants including lemon balm, catnip, holy basil and basil; and

  19. Chemical composition and antimicrobial properties of different basil essential oils chemotypes from Togo

    Directory of Open Access Journals (Sweden)

    Koffi Koba


    Full Text Available The aerial parts essential oils of Ocimum basilicum (Lamiaceae from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; t-anethole type. The in vitro microbiological experiments revealed that only the methyleugenol and methyleugenol/t-anethole chemotypes were active against tested fungi and bacteria. Their minimum inhibitory concentrations (MIC ranged from 80 to 150 µl.l-1 and from 200 to 500 µl.l-1 respectively. Likewise, on tested bacteria the MIC varied from 200 µl.l-1 to 400 µl.l-1 and from 250 to 500 µl.l-1 respectively. These findings are supportive of the potential of both basil oil chemotypes for use as active ingredients in natural antibiotic drugs.

  20. Chemical composition and antimicrobial properties of different basil essential oils chemotypes from Togo

    Directory of Open Access Journals (Sweden)

    Koffi Koba


    Full Text Available The aerial parts essential oils of Ocimum basilicum (Lamiaceae from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; t-anethole type. The in vitro microbiological experiments revealed that only the methyleugenol and methyleugenol/t-anethole chemotypes were active against tested fungi and bacteria. Their minimum inhibitory concentrations (MIC ranged from 80 to 150 µl.l-1 and from 200 to 500 µl.l-1 respectively. Likewise, on tested bacteria the MIC varied from 200 µl.l-1 to 400 µl.l-1 and from 250 to 500 µl.l-1 respectively. These findings are supportive of the potential of both basil oil chemotypes for use as active ingredients in natural antibiotic drugs.

  1. Effect of Light Spectral Quality on Essential Oil Components in Ocimum Basilicum and Salvia Officinalis Plants

    Directory of Open Access Journals (Sweden)



    Full Text Available In plants grown with artificial lighting, variations in light spectral composition can be used for the directed biosynthesis of the target substances including essential oils, e.g. in plant factories. We studied the effect of light spectral quality on the essential oil composition in Ocimum basilicum and Salvia officinalis plants grown in controlled environment. The variable-spectrum light modules were designed using three types of high-power light-emitting diodes (LEDs with emission peaked in red, blue and red light, white LEDs, and high-pressure sodium lamps as reference. Qualitative and quantitative essential oil determinations were conducted using gas chromatography with mass selective detection and internal standard method.Sweet basil plant leaves contain essential oils (са. 1 % including linalool, pinene, eugenol, camphor, cineole, and other components. And within the genetic diversity of the species, several cultivar groups can be identified according to the flavor (aroma perceived by humans: eugenol, clove, camphor, vanilla basil. Essential oil components produce particular flavor of the basil leaves. In our studies, we are using two sweet basil varieties differing in the essential oil qualitative composition – “Johnsons Dwarf” (camphor as a major component of essential oils and “Johnsons Lemon Flavor” (contains large amount of citral defining its lemon flavor.In sage, essential oil composition is also very variable. As for the plant responses to the light environment, the highest amount of the essential oils was observed at the regimes with white and red + blue LED light. And it was three times less with red light LEDs alone. In the first two environments, thujone accumulation was higher in comparison with camphor, while red LED light and sodium lamp light favored camphor biosynthesis (three times more than thujone. The highest amount of eucalyptol was determined in plants grown with red LEDs.

  2. Arbuscular Mycorrhizal Fungi Enhance Basil Tolerance to Salt Stress through Improved Physiological and Nutritional Status

    International Nuclear Information System (INIS)

    Salwa, A.; Abeer, H.; Alqarawi, A. A.; Abdullah, E.F.; Egamberdieva, D.


    Pot experiments were conducted to evaluate the influence of salinity on some physio-biochemical traits in sweet basil (Ocimum basilicum L.) cultivars with contrasting salt stress tolerance and to determine the role of arbuscular mycorrhizal fungi (AMF) in ameliorating the salt stress in plant. Salt stress (250 mM NaCl) reduced the colonization potential of AMF and inhibited photosynthetic pigments, chlorophyll and carotenoids in plant tissue. AMF inoculated plants contained higher level of chlorophyll pigments. Salt stressed plants showed increased lipid peroxidation, antioxidant enzyme activities like superoxide dismutase (SOD), ascorbate peroxidase (APX) and peroxidase (POD). Plants inoculated with AMF showed lower lipid peroxidation and enhanced antioxidant enzyme activities. Moreover, the content of lipids, proline, and soluble sugars in basil plants was improved with AMF inoculation. AMF inoculation reduced accumulation of Na+ and improved nutrient acquisition. In conclusion, AMF were capable to reduce oxidative stress via supporting of the antioxidant system. Salt tolerant cultivar showed higher antioxidant enzyme activity and accumulation of osmolytes. (author)

  3. Optimization of the Ocimum basilicum L. extraction process regarding the antioxidant activity

    Directory of Open Access Journals (Sweden)

    Vidović Senka S.


    Full Text Available The levels of input variables (temperature and extraction solvent that optimize a particular response (total phenols content, total flavonoids content and antioxidant activity of the Ocimum basilicum L. extraction process were determined by the response surface methodology (RSM. The influence of theextraction temperature on extraction process was investigated in the range from 33.8ºC to 76.2ºC, as well as of extraction solvent ethanol, in the range of concentrations from 21.7% to 78.3%. For the preparation of basil dry extract, characterized with minimal IC50 value, the calculated optimal values of temperature and ethanol concentration were: 75.33ºC and 73.66% (w/w. [Projekat Ministarstva nauke Republike Srbije, br. TR 31013

  4. The impact of hybridization on the volatile and sensorial profile of Ocimum basilicum L. (United States)

    da Costa, Andréa Santos; Arrigoni-Blank, Maria de Fátima; da Silva, Maria Aparecida Azevedo Pereira; Alves, Mércia Freitas; Santos, Darlisson de Alexandria; Alves, Péricles Barreto; Blank, Arie Fitzgerald


    The aim of the present study was to investigate the volatile and sensorial profile of basil (Ocimum basilicum L.) by quantitative descriptive analysis (QDA) of the essential oil of three hybrids ("Cinnamon" × "Maria Bonita," "Sweet Dani" × "Cinnamon," and "Sweet Dani" × "Maria Bonita"). Twelve descriptive terms were developed by a selected panel that also generated the definition of each term and the reference samples. The data were subjected to ANOVA, Tukey's test, and principal component analysis. The hybrid "Cinnamon" × "Maria Bonita" exhibited a stronger global aroma that was less citric than the other samples. Hybridization favored the generation of novel compounds in the essential oil of the hybrid "Sweet Dani" × "Maria Bonita," such as canfora and (E)-caryophyllene; (E)-caryophyllene also was a novel compound in the hybrid "Sweet Dani" × "Cinnamon"; this compound was not present in the essential oils of the parents.

  5. Basil, tea tree and clove essential oils as analgesics and anaesthetics in Amphiprion clarkii (Bennett, 1830

    Directory of Open Access Journals (Sweden)

    A. M. Correia


    Full Text Available Abstract In this study were evaluated the anaesthesia and analgesic effects of clove Eugenia caryophyllata, tea tree Melaleuca alternifolia and basil Ocimum basilicum essential oils (EO during handling of yellowtail clownfish Amphiprion clarkii. Juveniles (3.70 ± 0.75 cm and 1.03 ± 0.50 g; mean ± standard deviation were submitted to concentrations of 40, 50, 60, 70 and 80 µl L-1 of clove, 150, 200, 250, 300 and 350 µl L-1 of basil and 200, 300, 400, 500 and 600 µl L-1 of tea tree oils (n=10/concentration, previously defined in pilot tests. Individually and only once, fish from each treatment were placed in a glass recipient containing 1 L of seawater at a temperature of 25 °C, salinity of 35 g L-1 and the specific concentration of diluted EO (stock solution. Control (only seawater and blank (seawater and ethanol at the highest concentration used to dilute the oils treatments were also conducted. After reaching the stage of surgical anaesthesia, fish were submitted to biometry and a sensibility test. After that, they were transferred to clean seawater for anaesthesia recovery. The times of induction needed to reach each anaesthesia stage and anaesthesia recovery were recorded. Animals were observed for 72 hours after the procedures. All the EO provoked anaesthesia and analgesic effects in A. clarkii, but basil oil is not recommended because it caused involuntary muscle contractions and mortality in 100% and 12% of fish, respectively. The lower concentrations that promote suitable induction and recovery times are 50 µl L-1 of clove oil and 500 µl L-1 of tea tree oil. However, due to its complementary high analgesic efficiency, clove oil is recommended as the ideal anaesthetic for A. clarkii.

  6. Morfología básica de 17 introducciones del género Ocimum en el departamento del Valle

    Directory of Open Access Journals (Sweden)

    Estrada Edgar Iván


    Full Text Available Los objetivos del trabajo fueron establecer un jardín de introducciones de albahaca y contribuir en la caracterización botánica de las cultivariedades introducidas al banco de germoplasma. La colección se realizó en el departamento del Valle en campos de cultivo, áreas de vegetación natural, huertos caseros y mercados locales. En 6 zonas se recolectaron 17 introducciones, pertenecientes a 5 especies del genero Ocimum tres cultivadas (O. basilicum L., O. americanum Jacq Host y 0. minimum L. y dos ornamentales (O. gratissimum Hook y O. micranthum Willd. Se determinó visualmente alta variación para características fenotípicas tales como arquitectura de plantas, presencia de pubescencia, tipo de inflorescencia, flores, hojas y frutos.The objetives of this work were the collection and stablishment of a garden of albahaca and a contribution to the botanical characteristic of the cultivars introduced in the germoplasm bank .The collection was gathered at cultivated fields, natural vegetation areas, house gardens and local markets. Seventeen (17 species were collected, all belonging to the generous Ocimum from six different zones of Valle del Cauca. Three species are cultivated (O. basilium L., O. americanum Jack Host y O. minimum L. and two are considered ornamentals (O. gratissimum Hook y O. micranthum Willd. Phenotipicaly, high variety was observed in the plant architecture, in its pubescence presence, in the type of inflorescence and in flowers, leaves and fruits.


    Directory of Open Access Journals (Sweden)

    N. A. Golubkina


    Full Text Available Selenium accumulation level in basil plants is investigated. A direct correlation between selenium concentration and essential oil content is demonstrated for basil and other aroma plants. No correlation is found between selenium and flavonoids.

  8. Technoeconomic evaluation of urban plant factories: The case of basil (Ocimum basilicum). (United States)

    Liaros, Stelios; Botsis, Konstantinos; Xydis, George


    Greece is currently in a turmoil, experiencing the effects of more than half a decade of economic crisis. Public health and welfare, jobs and wages, labor market concerning employment as long as employability of the work force, inequality, life satisfaction and housing, tourism and environment, economic and energy poverty are heavily impacted by Greece's disadvantageous economic situation. Real estate market could not have gotten away from the financial commotion, being currently in a halt after years of rapid decline. Fired from the present situation of Greece's real estate market, the present study is concerned with the investigation of alternative ways to support the local real estate market. With respect to sustainable development's ethics, the development, implementation, installation and operation of small, inexpensive plant factories within the urban environment is evaluated. Installations such are those, will encourage the penetration of a new market for the untapped buildings' resource, advancing new investing opportunities, promoting economic growth and productivity while creating a new labor market. The study will rely on the basic principles of Life Cycle Costing Assessment and develop a methodology upon which different scenarios will be evaluated against the "Do Nothing" scenario. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Bioactivity of basil ( Ocimum basicilum L.) on control of the spider ...

    African Journals Online (AJOL)

    Essential plant oils contain biopesticides that could be used to control many crop pests. Tetranychus spp. are mites that cause damage to several crops and are primarily controlled by synthetic pesticides. Literature showed that mites can be controlled with essential oils of plants containing eugenol. In this work, we ...

  10. Estudio farmacognóstico de ocimum basilicum l. (albahaca blanca

    Directory of Open Access Journals (Sweden)

    Ester Sánchez Govín


    Full Text Available Ocimum basilicum L. (albahaca blanca es una de las plantas aromáticas que se clasifican por la composición química de su aceite. Se investigó la variedad lactucaefolium que posee propiedades antisépticas, antiinflamatorias y antiespasmódicas. Se determinaron los índices numéricos en esta especie y se estandarizó el perfil cromatográfico a partir de su aceite esencial. El estudio de conservación muestra que el tiempo óptimo de almacenamiento en frasco de vidrio y sobres de polietileno es de 10 meses.Ocimum basilicum L. (white sweet basil is one of the aromatic plants that is classified according to the chemical composition of its oil. The lactucaefolium variety that has antiseptic, antiinflammatory and antispasmodic properties was investigated. The numerical indexes were determined in this species and the chromatographic profile was standardized starting from its essential oil. The conservation study shows that the optimum time of storage in glass flasks and polyethylene bags is of l0 months.

  11. Methyl Jasmonate-Elicited Transcriptional Responses and Pentacyclic Triterpene Biosynthesis in Sweet Basil1[C][W (United States)

    Misra, Rajesh Chandra; Maiti, Protiti; Chanotiya, Chandan Singh; Shanker, Karuna; Ghosh, Sumit


    Sweet basil (Ocimum basilicum) is well known for its diverse pharmacological properties and has been widely used in traditional medicine for the treatment of various ailments. Although a variety of secondary metabolites with potent biological activities are identified, our understanding of the biosynthetic pathways that produce them has remained largely incomplete. We studied transcriptional changes in sweet basil after methyl jasmonate (MeJA) treatment, which is considered an elicitor of secondary metabolites, and identified 388 candidate MeJA-responsive unique transcripts. Transcript analysis suggests that in addition to controlling its own biosynthesis and stress responses, MeJA up-regulates transcripts of the various secondary metabolic pathways, including terpenoids and phenylpropanoids/flavonoids. Furthermore, combined transcript and metabolite analysis revealed MeJA-induced biosynthesis of the medicinally important ursane-type and oleanane-type pentacyclic triterpenes. Two MeJA-responsive oxidosqualene cyclases (ObAS1 and ObAS2) that encode for 761- and 765-amino acid proteins, respectively, were identified and characterized. Functional expressions of ObAS1 and ObAS2 in Saccharomyces cerevisiae led to the production of β-amyrin and α-amyrin, the direct precursors of oleanane-type and ursane-type pentacyclic triterpenes, respectively. ObAS1 was identified as a β-amyrin synthase, whereas ObAS2 was a mixed amyrin synthase that produced both α-amyrin and β-amyrin but had a product preference for α-amyrin. Moreover, transcript and metabolite analysis shed light on the spatiotemporal regulation of pentacyclic triterpene biosynthesis in sweet basil. Taken together, these results will be helpful in elucidating the secondary metabolic pathways of sweet basil and developing metabolic engineering strategies for enhanced production of pentacyclic triterpenes. PMID:24367017

  12. The effects of alcoholic leaf extract Ocimum basilicum on angiogenesis in chick chorioallantoic membrane

    Directory of Open Access Journals (Sweden)

    Niazi Fateme


    Full Text Available Abstract Background: Angiogenesis is an important biological processes of new blood vessels in many pathological stages of development and embryo development occurs and a complex and dynamic phenomenon that is needed for development and other physiological processes. This study aimed to investigate the effect of alcoholic Ocimum basilicum leaf extract on angiogenesis chick chorioallantoic membrane is done. Materials and Methods: In this experimental study 40 Ross fertilized eggs were randomly divided into four groups: control, sham-exposed and experimental groups were divided. The second day of incubation the eggs window was opened. Eighth day of the alcoholic extract of basil doses of 50 and 150 mg/kg on chick chorioallantoic membrane was injected. On day 12, embryos length and weight and chorioallantoic membrane (CAM was photographed by photostereomicroscope Then the numbers and lengths of vessels in special area on CAM were measured with Image J. analyzed through by t-test and ANOVA (P<0.05. Results: The data does not show significant difference between embryos length and weight in sham compare to all experimental groups. In the study vessels number just with 150 mg/kg observed significant. Conclusion: Alcoholic extract of basil is an increase in the number of vessels and in this sense the healing and growth processes associated with them as well as effective.

  13. Karakterisasi Fraksi Aktif Antioksidan dari Ekstrak Etanol Biji Kemangi (Ocimum Basilicum L.

    Directory of Open Access Journals (Sweden)

    Dede Sukandar


    Full Text Available Characterization of antioxidant compounds from the seeds of basil (Ocimum basilicum L. has been done. Extraction is done by maceration method using ethanol solvent, fractionation by TLC and column chromatography, antioxidants test using DPPH method, and characterization of antioxidant compound using GCMS. Ethanol extract and results of fractionation ethanol extract of basil seeds using n-hexane, ethyl acetate, n-butanol and methanol-water extracts show that n-butanol extract has the highest antioxidant activity with IC50 values ​​of 41.90 ppm. Results of column chromatography n-butanol extract using n-hexane : ethyl acetate (1:9 as mobile phase yielded 5 fractions with fraction 4 (F4 isolate has dominant stain of active antioxidants after being sprayed DPPH reagent, it had IC50 values ​​of 39,70 ppm and total phenolic content of 0,003 mg/g. Isolate F4 suspected contains two active compounds as antioxidant which is terpenoid and phenolic compound group, namely squalene and 1,4-di-tert-buthyl-phenol identified by GCMS.DOI :

  14. Phytochemical Profile and Evaluation of the Biological Activities of Essential Oils Derived from the Greek Aromatic Plant Species Ocimum basilicum, Mentha spicata, Pimpinella anisum and Fortunella margarita

    Directory of Open Access Journals (Sweden)

    Eleni Fitsiou


    Full Text Available Natural products, known for their medicinal properties since antiquity, are continuously being studied for their biological properties. In the present study, we analyzed the composition of the volatile preparations of essential oils of the Greek plants Ocimum basilicum (sweet basil, Mentha spicata (spearmint, Pimpinella anisum (anise and Fortunella margarita (kumquat. GC/MS analyses revealed that the major components in the essential oil fractions, were carvone (85.4% in spearmint, methyl chavicol (74.9% in sweet basil, trans-anethole (88.1% in anise, and limonene (93.8% in kumquat. We further explored their biological potential by studying their antimicrobial, antioxidant and antiproliferative activities. Only the essential oils from spearmint and sweet basil demonstrated cytotoxicity against common foodborne bacteria, while all preparations were active against the fungi Saccharomyces cerevisiae and Aspergillus niger. Antioxidant evaluation by DPPH and ABTS radical scavenging activity assays revealed a variable degree of antioxidant potency. Finally, their antiproliferative potential was tested against a panel of human cancer cell lines and evaluated by using the sulforhodamine B (SRB assay. All essential oil preparations exhibited a variable degree of antiproliferative activity, depending on the cancer model used, with the most potent one being sweet basil against an in vitro model of human colon carcinoma.

  15. Phytochemical Profile and Evaluation of the Biological Activities of Essential Oils Derived from the Greek Aromatic Plant Species Ocimum basilicum, Mentha spicata, Pimpinella anisum and Fortunella margarita. (United States)

    Fitsiou, Eleni; Mitropoulou, Gregoria; Spyridopoulou, Katerina; Tiptiri-Kourpeti, Angeliki; Vamvakias, Manolis; Bardouki, Haido; Panayiotidis, Mihalis Ι; Galanis, Alex; Kourkoutas, Yiannis; Chlichlia, Katerina; Pappa, Aglaia


    Natural products, known for their medicinal properties since antiquity, are continuously being studied for their biological properties. In the present study, we analyzed the composition of the volatile preparations of essential oils of the Greek plants Ocimum basilicum (sweet basil), Mentha spicata (spearmint), Pimpinella anisum (anise) and Fortunella margarita (kumquat). GC/MS analyses revealed that the major components in the essential oil fractions, were carvone (85.4%) in spearmint, methyl chavicol (74.9%) in sweet basil, trans-anethole (88.1%) in anise, and limonene (93.8%) in kumquat. We further explored their biological potential by studying their antimicrobial, antioxidant and antiproliferative activities. Only the essential oils from spearmint and sweet basil demonstrated cytotoxicity against common foodborne bacteria, while all preparations were active against the fungi Saccharomyces cerevisiae and Aspergillus niger. Antioxidant evaluation by DPPH and ABTS radical scavenging activity assays revealed a variable degree of antioxidant potency. Finally, their antiproliferative potential was tested against a panel of human cancer cell lines and evaluated by using the sulforhodamine B (SRB) assay. All essential oil preparations exhibited a variable degree of antiproliferative activity, depending on the cancer model used, with the most potent one being sweet basil against an in vitro model of human colon carcinoma.

  16. Re-Reading and Rehabilitating Basil Bernstein (United States)

    Bolander, Brook; Watts, Richard J.


    This article constitutes a re-reading of and an attempt to rehabilitate Basil Bernstein, both of which are important in light of the interpretation of Bernstein as a proponent of the verbal deficit view, and the general discrediting of his work on social class differences in the British educational system, as related to what he later called…

  17. Protective Effect of Ocimum basilicum on Brain Cells Exposed to Oxidative Damage by Electromagnetic Field in Rat: Ultrastructural Study by Transmission Electron Microscopy

    Directory of Open Access Journals (Sweden)

    Khaki Arash


    Full Text Available Objective: Basil herb (Ocimum basilicum has long been used in human nutrition. Nowadays antioxidant role of this herb is known more. The aim of this study was to study the anti-oxidative property of sweet basil to protect central nervous system against oxidative damages of electromagnetic field (EMF and its affective sequences. Materials and Methods: Forty Albino male Wistar rats were randomly allocated to four groups, 10 rats per each. Group 1 received normal diet (control group, group 2 was exposed to 50 Hz EMF for 8 weeks (EMF group. Group 3 was exposed to 50 Hz EMF and fed with basil extract (0.5 g/kg body weight for 8 weeks (treatment group and group 4 was fed with basil extract (0.5 g/kg body weight for 8 weeks and named as herbal group. At the end of eighth week 5 mL blood was taken from all rats for biochemical analysis and for ultra structural study of brain neuron samples was taken. Results: The results showed level of superoxide dismutase (SOD, glutathione (GSH peroxidase and catalase activity (CAT were significantly increased in herbal and treatment groups as compared to EMF group (P < 0.05. Level of malondialdehyde (MDA was significantly decreased in treatment group as compare to EMF group (P < 0.05. Ultra structural evaluation of EMF group showed brain nucleus has a lot of heterochromatic changes and mitochondria have been ovulated and have swelling figure this changes were less in treatment group. Conclusion: Antioxidant capacity of basil extract can cause to decrease oxidative effects of EMF on brain tissue and in rats.

  18. Changes in the content of total nitrogen and mineral nitrogen in the basil herb depending on the cultivar and nitrogen nutrition

    Directory of Open Access Journals (Sweden)

    Katarzyna Dzida


    Full Text Available Among fundamental nutrients, nitrogen fertilization is considered one of the most effective factors affecting both the yield and the quality of plant material. Nitrogen form used for fertilizing is also of great importance. The aim of this study was to investigate the impact of nitrogen nutrition (calcium nitrate, ammonium nitrate, and urea as well as (green, purple, and‘Fino Verde’ on the chemical composition and yielding of basil (Ocimum basilicumL.. After drying the plant material at a temperature of 60°C and milling, total nitrogen was determined by means of Kjeldahl method, while mineral nitrogen content (N-NH 4, N-NO 3 was analyzed in 2% acetic acid extract. Yield of fresh basil matter depended significantly on the variety grown. The highest yields were obtained from a cultivar of ‘Fino Verde’ fertilized with ammonium nitrate. The purple variety plants fertilized with urea were characterized by a largest amount of total nitrogen. The‘Fino Verde’cultivar fertilized with urea accumulated the least quantities of nitrates in the basil herb.

  19. Characterization of Essential Oil Composition in Different Basil Species and Pot Cultures by a GC-MS Method

    Directory of Open Access Journals (Sweden)

    Andrea Muráriková


    Full Text Available Basil (Ocimum L. species are used as medicinal plants due to their essential oils exhibiting specific biological activity. The present work demonstrated that both the variety and season/conditions of cultivation had a significant effect on (i the produced amount (extraction yield, (ii qualitative, as well as (iii quantitative profile of basil essential oil. Among studied basil varieties, a new variety, ‘Mánes’, was characterized for the first time. Based on our quantitative evaluation of GC-MS profiles, the following chemotypes and average concentrations of a main component were detected in the studied basil varieties: ‘Ohře’, ‘Lettuce Leaf’, ‘Purple Opaal’, ‘Dark Green’ (linalool, 5.99, 2.49, 2.34, 2.01 mg/mL, respectively, and ‘Mammolo Genovese’, ‘Mánes’, ‘Red Rubin’ (eucalyptol, 1.34, 0.96, 0.76 mg/mL, respectively. At the same time, when considering other compounds identified in GC-MS profiles, all the studied varieties, except from ‘Lettuce Leaf’, were methyl eugenol-rich with a strong dependence of the eugenol:methyl eugenol ratio on the seasonal changes (mainly solar irradiation, but also temperature and relative humidity. More complex and/or variable (depending on the season and cultivation chemotypes were observed with ‘Lettuce Leaf’ (plus estragole, 2.27 mg/mL, ‘Dark Green’ (plus eucalyptol, 1.36 mg/mL, ‘Mammolo Genovese’ (plus eugenol, 1.19 mg/mL, ‘Red Rubin’ (plus linalool and eugenol, 0.46 and 0.56 mg/mL, respectively, and ‘Mánes’ (plus linalool and eugenol, 0.58 and 0.40 mg/mL, respectively. When considering superior extraction yield (ca. 17 mL·kg−1, i.e., two to five times higher than other examined varieties and consistent amounts (yields of essential oil when comparing inter-seasonal or inter-year data (RSD and inter-year difference in mean yield values ˂2.5%, this new basil variety is very promising for use in the pharmaceutical, food, and cosmetic industries.



    Chattopadhyay, R.R.


    The anxiolytic activity of Ocimum sanctum leaf extract was studied in mice. O.sanctum leaf extract produced significant anxiolytic activity in plus – maze and open field behaviour test models. The effect was compared with diazepam, a standard antianxiety drug.

  1. Acaricidal effect and chemical composition of essential oils extracted from Cuminum cyminum, Pimenta dioica and Ocimum basilicum against the cattle tick Rhipicephalus (Boophilus) microplus (Acari: Ixodidae). (United States)

    Martinez-Velazquez, Moises; Castillo-Herrera, Gustavo Adolfo; Rosario-Cruz, Rodrigo; Flores-Fernandez, Jose Miguel; Lopez-Ramirez, Julisa; Hernandez-Gutierrez, Rodolfo; Lugo-Cervantes, Eugenia del Carmen


    Acaricidal activity of essential oils extracted from cumin seeds (Cuminum cyminum), allspice berries (Pimenta dioica) and basil leaves (Ocimum basilicum) were tested on 10-day-old Rhipicephalus (Boophilus) microplus tick larvae using the LPT. Two-fold dilutions of the three essential oils were tested from a starting dilution of 20% down to 1.25%. Results showed a high toxicological effect for cumin, producing 100% mortality in all tested concentrations on R. microplus larvae. Similarly, allspice essential oil produced 100% mortality at all concentrations with the exception of a dramatic decrease at 1.25% concentration. Conversely, basil essential oil was not shown to be toxic against R. microplus larvae. The most common compounds detected by gas chromatography-mass spectrometry were as follows: cumin: cuminaldehyde (22.03%), γ-terpinene (15.69%) and 2-caren-10-al (12.89%); allspice: methyl eugenol (62.7%) and eugenol (8.3%); basil: linalool (30.61%) and estragole (20.04%). Results clearly indicate that C. cyminum and P. dioica essential oils can be used as an effective alternative for R. microplus tick control, and there is a high probability they can be used for other ticks affecting cattle in Mexico and throughout the world, thereby reducing the necessity for traditional and unfriendly synthetic acaricides.

  2. Survival of pathogenic Escherichia coli on basil, lettuce, and spinach (United States)

    The contamination of lettuce, spinach and basil with pathogenic E. coli has caused numerous illnesses over the past decade. E. coli O157:H7, E. coli O104:H4 and avian pathogenic E. coli (APECstx- and APECstx+) were inoculated on basil plants and in promix soiless substrate using drip and overhead ir...


    African Journals Online (AJOL)

    Steam distilled volatile oils from the leaves of Ocimum americanum L. growing in Western Kenya were analysed by GC and GC-MS. A total of 36 compounds, representing a total of 88.51% of the total oil, were identified. The oil was classified as terpinen-4-ol-type according to the terpinen-4-ol content (43.21%). To the best ...

  4. "??sa ??? ? ????s?? ?? ?µ??? ??et?? ?st?? ?pa????": Greek Poetry and "Paideia" in the Homiletic Tradition of Basil (United States)

    Klitenic Wear, Sarah


    Based on a reading of Basil's "Ad Adulescentes" and the epistles, it is clear that Basil finds moral value in Homer and Hesiod. The trickier issue is to what extent Basil uses Homer and Hesiod in his homilies. It seems that Basil does not abandon his respect for the utility of Hellenic "paideia" for the Christian in his…

  5. Comparative reproduction mechanisms of three species of Ocimum L. (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Matthew Oziegbe


    Full Text Available Ocimum species have a combination of reproductive system which varies with the locality and cultivar. We have studied here the reproductive mechanisms of five variants of three Ocimum species in Nigeria, namely: Ocimum canum Sims., O. basilicum L., and O. americanum L. Flowers from each variant were subjected to open and bagged pollination treatments of hand self-pollination, spontaneous self-pollination and emasculation. All open treatments of the five Ocimum variants produced more fruit and seed than the corresponding bagged treatments. The two O. canum variants and O. basilicum ‘b1’ produced high fruit and seed set in the open and bagged treatments of spontaneous self-pollination. Ocimum basilicum ‘b2’ and O. americanum produced higher fruit and seed set in the self-pollination open treatment but significantly lower fruit and seed set in the bagged treatment. Fewer fruit and seeds were produced in the emasculated open treatments but none in the emasculated bagged treatments of the five Ocimum variants. The floral foragers comprising of bees, wasps and butterflies visited the Ocimum species to collect pollen or nectar in the open treatments. The two O. canum variants and O. basilicum ‘b1’ variant reproduced mainly through autogamy but O. basilicum ‘b2’ and O. americanum showed mixed reproduction of autogamy and outcrosssing. Insect visitation to the flowers enhanced pollination resulting in higher fruit and seed set in all the Ocimum species studied.

  6. The potential effects of Ocimum basilicum on health: a review of pharmacological and toxicological studies. (United States)

    Sestili, Piero; Ismail, Tariq; Calcabrini, Cinzia; Guescini, Michele; Catanzaro, Elena; Turrini, Eleonora; Layla, Anam; Akhtar, Saeed; Fimognari, Carmela


    Basil (Ocimum basilicum L., OB) is a plant world widely used as a spice and a typical ingredient of the healthy Mediterranean diet. In traditional medicine, OB is indicated for many maladies and conditions; OB-containing nutritional supplements are increasingly sold. Conversely, safety concerns have been raised about the promutagens and procarcinogens alkenylbenzenes contained in OB. Areas covered: A critical review of the current status of OB as a nutraceutical, the pharmacology of its bioactive components, the rationale for its indications, and its safety. Expert opinion: Due to the polyphenolic and flavonoidic content, OB can be considered as an important ingredient in healthy diets; OB preparations may be effective as chemopreventive agents or adjunctive therapy in the treatment of different clinical conditions. From a toxicological perspective, since the tumorigenic potential of alkenylbenzenes is counteracted by other OB constituents such as nevadensin, it can be concluded that OB consumption in food and preparations is safe. The only concern relates to OB essential oils: in this case, a concentration limit for alkenylbenzenes should be precautionary defined, and the use of plant chemotypes with no or low levels of these alkylbenzenes for the preparation of essential oils should be made compulsory.

  7. The Impact of Hybridization on the Volatile and Sensorial Profile of Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Andréa Santos da Costa


    Full Text Available The aim of the present study was to investigate the volatile and sensorial profile of basil (Ocimum basilicum L. by quantitative descriptive analysis (QDA of the essential oil of three hybrids (“Cinnamon” × “Maria Bonita,” “Sweet Dani” × “Cinnamon,” and “Sweet Dani” × “Maria Bonita”. Twelve descriptive terms were developed by a selected panel that also generated the definition of each term and the reference samples. The data were subjected to ANOVA, Tukey’s test, and principal component analysis. The hybrid “Cinnamon” × “Maria Bonita” exhibited a stronger global aroma that was less citric than the other samples. Hybridization favored the generation of novel compounds in the essential oil of the hybrid “Sweet Dani” × “Maria Bonita,” such as canfora and (E-caryophyllene; (E-caryophyllene also was a novel compound in the hybrid “Sweet Dani” × “Cinnamon”; this compound was not present in the essential oils of the parents.

  8. Antioxidant properties of various solvent extracts from purple basil (United States)

    Yeşiloğlu, Yeşim; Şit, Latifşah


    Water, ethanol and acetone extracts from leaves and flowers of purple basil, one of the most popular spices consumed in the Thrace region of Turkey, were tested in vitro for their ability to inhibit peroxidation of lipids, to scavenge DPPH, hydrogen peroxide, superoxide anion, to reduce Fe(III) to Fe(II) and to chelate Fe(II) ions. The results showed that purple basil contained naturally occurring antioxidant components and possessed antioxidant activity which may be attributed to its lipid peroxidation inhibitory, radical scavenging and metal chelating activities. It was concluded that purple basil might be a potential source of antioxidants.

  9. An efficient system for in vitro multiplication of Ocimum basilicum ...

    African Journals Online (AJOL)



    Mar 15, 2012 ... Key words: Axillary shoot sprouting, L-glutamine, medicinal plant, micropropagation, Ocimum basilicum. INTRODUCTION ... different combinations and concentrations in 25 × 145 mm glass .... Glossary of Indian Medicinal.

  10. Unravelling the genome of Holy basil: an "incomparable" "elixir of life" of traditional Indian medicine. (United States)

    Rastogi, Shubhra; Kalra, Alok; Gupta, Vikrant; Khan, Feroz; Lal, Raj Kishori; Tripathi, Anil Kumar; Parameswaran, Sriram; Gopalakrishnan, Chellappa; Ramaswamy, Gopalakrishna; Shasany, Ajit Kumar


    Ocimum sanctum L. (O. tenuiflorum) family-Lamiaceae is an important component of Indian tradition of medicine as well as culture around the world, and hence is known as "Holy basil" in India. This plant is mentioned in the ancient texts of Ayurveda as an "elixir of life" (life saving) herb and worshipped for over 3000 years due to its healing properties. Although used in various ailments, validation of molecules for differential activities is yet to be fully analyzed, as about 80 % of the patents on this plant are on extracts or the plant parts, and mainly focussed on essential oil components. With a view to understand the full metabolic potential of this plant whole nuclear and chloroplast genomes were sequenced for the first time combining the sequence data from 4 libraries and three NGS platforms. The saturated draft assembly of the genome was about 386 Mb, along with the plastid genome of 142,245 bp, turning out to be the smallest in Lamiaceae. In addition to SSR markers, 136 proteins were identified as homologous to five important plant genomes. Pathway analysis indicated an abundance of phenylpropanoids in O. sanctum. Phylogenetic analysis for chloroplast proteome placed Salvia miltiorrhiza as the nearest neighbor. Comparison of the chemical compounds and genes availability in O. sanctum and S. miltiorrhiza indicated the potential for the discovery of new active molecules. The genome sequence and annotation of O. sanctum provides new insights into the function of genes and the medicinal nature of the metabolites synthesized in this plant. This information is highly beneficial for mining biosynthetic pathways for important metabolites in related species.

  11. Reduction of microbial contamination and improvement of germination of sweet basil (Ocimum basilicum L.) seeds via surface dielectric barrier discharge

    Czech Academy of Sciences Publication Activity Database

    Ambrico, P. F.; Šimek, Milan; Morano, M.; De Miccolis Angelini, R.M.; Minafra, A.; Trotti, P.; Ambrico, M.; Prukner, Václav; Faretra, F.


    Roč. 50, č. 30 (2017), č. článku 305401. ISSN 0022-3727 R&D Projects: GA ČR(CZ) GA15-04023S Institutional support: RVO:61389021 Keywords : dielectric barrier discharges (DBD) * bio-decontamination * etching * polymers * biomolecules * spores * surface treatment Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 2.588, year: 2016

  12. [Effectiveness of antimicrobial formulations for acne based on orange (Citrus sinensis) and sweet basil (Ocimum basilicum L) essential oils]. (United States)

    Matiz, Germán; Osorio, María R; Camacho, Francisco; Atencia, Maira; Herazo, Jennifer


    Currently, the antimicrobial resistance has developed in bacterial strains involved in the development of acne. Therefore, alternatives to antibiotic treatment have become necessary. Gel formulations were designed based on essential oils and acetic acid, and their effectiveness was evaluated in patients affected by acne. Masked simple experimental study of three gel formulations on 28 volunteer patients, separated in four groups of seven patients. Treatments were applied daily for eight weeks and consisted of (1) antibacterial (essential oils), (2) keratolytic medication (3) essential oils mixed with acetic acetic, and (4) kerolytic medication with acetic acid. Weekly checks were conducted to evaluate patient improvement. All groups reported an improvement of the acne condition, which ranged between 43% and 75% clearance of lesions. Evidence of treatment disappeared within minutes, showing little discomfort or side effects after application. The essential oil formulations were chemically and physically stable during application of treatments. This was demonstrated by gas chromatography, where no evidence no change neither the composition profiles of essential oils nor in acetic acid. The results were ranked good to excellent, particularly for the acetic acid mixture, which achieved improvements of 75%. This appeared to be a result of their joint antiseptic and keratolytic activity. Side effects (burning and redness) disappeared within a few minutes of completing the application, therefore, did not interfere with adherence to treatment.

  13. Densitometric Validation and Optimisation of Polyphenols in Ocimum sanctum Linn by High Performance Thin-layer Chromatography. (United States)

    U K, Ilyas; Katare, Deepshikha P; Aeri, Vidhu


    Ocimum sanctum Linn (Sanskrit: Tulasi; family: Libiaceae), popularly known as holy basil or Ocimum teinufolium, is found throughout the semitropical and tropical parts of India. In Ayurveda, Tulasi has been well known for its therapeutic potentials. To optimise and develop a standard method to quantify seven polyphenols simultaneously by HPTLC. A three-level factor Box-Behnken statistical design was used for optimisation, where extraction time (min), temperature (°C) and methanol:water ratio (% v/v) are the independent variables with polyphenols as the dependent variable. The separation was archived on a silica-gel 60 F254 HPTLC plate using toluene:ethyl acetate:formic acid:methanol (3:3:0.8:0.2 v/v) as the mobile phase. Densitometric analysis of polyphenols was carried out in the absorbance mode at 366 nm. The quantification of polyphenols was carried out based on peak area with a linear calibration curve at concentration ranges of 60-240, 20-200, 100-1600, 40-200, 200-1400, 10-160, 200-1400, 100-5000 ng/band for caffeic acid, ellagic acid, rutin, kaempferol, catechin, quercetin, eupalitin and epicatechin respectively. The method was validated for peak purity, precision, accuracy, limit of detection (LOD) and quantification (LOQ). Method specificity was confirmed using the retention factor value and visible spectra correlation of marker compounds. A validated HPTLC method was newly developed for simultaneous quantification of seven polyphenols in an Ayurvedic preparation of O. sanctum. The proposed method is simple, precise, specific, accurate, cost-effective, less time consuming and has the ability to separate the polyphenols from other constituents. Copyright © 2015 John Wiley & Sons, Ltd.

  14. Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet ...

    African Journals Online (AJOL)

    Chigo Okwuosa

    basilicum (sweet basil) protect against sodium ... arsenite alone, the aqueous extracts plus sodium arsenite, and ethanolic extracts plus sodium ... properties and effects (Aruna and Sivaramakrishnan. 1992 ..... Biotransformation of the pesticide.

  15. Thermal and oxidative stability of the Ocimum basilicum L. essential oil/β-cyclodextrin supramolecular system

    Directory of Open Access Journals (Sweden)

    Daniel I. Hădărugă


    Full Text Available Ocimum basilicum L. essential oil and its β-cyclodextrin (β-CD complex have been investigated with respect to their stability against the degradative action of air/oxygen and temperature. This supramolecular system was obtained by a crystallization method in order to achieve the equilibrium of complexed–uncomplexed volatile compounds in an ethanol/water solution at 50 °C. Both the raw essential oil and its β-CD complex have been subjected to thermal and oxidative degradation conditions in order to evaluate the protective capacity of β-CD. The relative concentration of the O. basilicum L. essential oil compounds, as determined by GC–MS, varies accordingly with their sensitivity to the thermal and/or oxidative degradation conditions imposed. Furthermore, the relative concentration of the volatile O. basilicum L. compounds found in the β-CD complex is quite different in comparison with the raw material. An increase of the relative concentration of linalool oxide from 0.3% to 1.1%, in addition to many sesquiterpene oxides, has been observed. β-CD complexation of the O. basilicum essential oil modifies the relative concentration of the encapsulated volatile compounds. Thus, linalool was better encapsulated in β-CD, while methylchavicol (estragole was encapsulated in β-CD at a concentration close to that of the raw essential oil. Higher relative concentrations from the degradation of the oxygenated compounds such as linalool oxide and aromadendren oxide were determined in the raw O. basilicum L. essential oil in comparison with the corresponding β-CD complex. For the first time, the protective capability of natural β-CD for labile basil essential oil compounds has been demonstrated.

  16. Inflorescence and leaves essential oil composition of hydroponically grown Ocimum basilicum L

    Directory of Open Access Journals (Sweden)



    Full Text Available In order to characterize the essential oils of leaves and inflorescences, water distilled volatile oils of hydroponically grown Ocimum basilicum L. were analyzed by GC/EI-MS. Fifty components were identified in the inflorescence and leaf essential oils of the basil plants, accounting for 98.8 and 99.9 % of the total quantified components respectively. Phenylpropanoids (37.7 % for the inflorescence vs. 58.3 % for the leaves were the predominant class of oil constituents, followed by sesquiterpenes (33.3 vs. 19.4 % and monoterpenes (27.7 vs. 22.1 %. Of the monoterpenoid compounds, oxygenated monoterpenes (25.2 vs. 18.9 % were the main subclass. Sesquiterpene hydrocarbons (25 vs. 15.9 % were the main subclass of sesquiterpenoidal compounds. Methyl chavicol, a phenylpropane derivative, (37.2 vs. 56.7 % was the principle component of both organ oils, with up to 38 and 57 % of the total identified components of the inflorescence and leaf essential oils, respectively. Linalool (21.1 vs. 13.1 % was the second common major component followed by α-cadinol (6.1 vs. 3 %, germacrene D (6.1 vs. 2.7 % and 1,8-cineole (2.4 vs. 3.5 %. There were significant quantitative but very small qualitative differences between the two oils. In total, considering the previous reports, it seems that essential oil composition of hydroponically grown O. basilicum L. had volatile constituents comparable with field grown counterparts, probably with potential applicability in the pharmaceutical and food industries.

  17. Thermal and oxidative stability of the Ocimum basilicum L. essential oil/β-cyclodextrin supramolecular system. (United States)

    Hădărugă, Daniel I; Hădărugă, Nicoleta G; Costescu, Corina I; David, Ioan; Gruia, Alexandra T


    Ocimum basilicum L. essential oil and its β-cyclodextrin (β-CD) complex have been investigated with respect to their stability against the degradative action of air/oxygen and temperature. This supramolecular system was obtained by a crystallization method in order to achieve the equilibrium of complexed-uncomplexed volatile compounds in an ethanol/water solution at 50 °C. Both the raw essential oil and its β-CD complex have been subjected to thermal and oxidative degradation conditions in order to evaluate the protective capacity of β-CD. The relative concentration of the O. basilicum L. essential oil compounds, as determined by GC-MS, varies accordingly with their sensitivity to the thermal and/or oxidative degradation conditions imposed. Furthermore, the relative concentration of the volatile O. basilicum L. compounds found in the β-CD complex is quite different in comparison with the raw material. An increase of the relative concentration of linalool oxide from 0.3% to 1.1%, in addition to many sesquiterpene oxides, has been observed. β-CD complexation of the O. basilicum essential oil modifies the relative concentration of the encapsulated volatile compounds. Thus, linalool was better encapsulated in β-CD, while methylchavicol (estragole) was encapsulated in β-CD at a concentration close to that of the raw essential oil. Higher relative concentrations from the degradation of the oxygenated compounds such as linalool oxide and aromadendren oxide were determined in the raw O. basilicum L. essential oil in comparison with the corresponding β-CD complex. For the first time, the protective capability of natural β-CD for labile basil essential oil compounds has been demonstrated.

  18. Chemical Composition and Antifungal Activity of Ocimum basilicum L. Essential Oil

    Directory of Open Access Journals (Sweden)

    Neveen Helmy Abou El-Soud


    Full Text Available BACKGROUND: The leaves of Ocimum basilicum L. (basil are used in traditional cuisine as spices; its essential oil has found a wide application in perfumery, dental products as well as antifungal agents. AIM: To assess the chemical composition as well as the in vitro antifungal activity of O. basilicum L. essential oil against Aspergillus flavus fungal growth and aflatoxin B1 production. MATERIAL AND METHODS: The essential oil of O. basilicum was obtained by hydrodistillation and analysed using gas chromatography (GC and GC coupled with mass spectrometry (GC/MS. The essential oil was tested for its effects on Aspergillus flavus (A. flavus mycelial growth and aflatoxin B1 production in Yeast Extract Sucrose (YES growth media. Aflatoxin B1 production was determined by high performance liquid chromatography (HPLC. RESULTS: Nineteen compounds, representing 96.7% of the total oil were identified. The main components were as follows: linalool (48.4%, 1,8-cineol (12.2%, eugenol (6.6%, methyl cinnamate (6.2%, α-cubebene (5.7%, caryophyllene (2.5%, β-ocimene (2.1% and α-farnesene (2.0%.The tested oil showed significant antifungal activity that was dependent on the used oil concentration. The complete inhibition of A. flavus growth was observed at 1000 ppm oil concentration, while marked inhibition of aflatoxin B1 production was observed at all oil concentrations tested (500, 750 and 1000 ppm. CONCLUSION: These results confirm the antifungal activities of O. basilicum L. oil and its potential use to cure mycotic infections and act as pharmaceutical preservative against A. flavus growth and aflatoxin B1 production.

  19. The Rule of Saint Basil the Great

    Directory of Open Access Journals (Sweden)

    Piotr Pietrow


    Full Text Available The rules of monasticism were collected and published in a single work entitled Asketikon by Saint Basil the Great. It is arranged in the form of questions and answers to create one coherent work. It has two different publications.The first publication named The Small Asketikon dates to 370-370. It is the fruit of the Saint’s work among Pontic communities and consists of 203 questions and answers. The orignial Greek manuscript has not survived and it is available only in two translations: the Latin Rufin and fragments in Syrian language. The second publication named The Great Asketikon appeard in about 377 and presents the most mature step of cenobitic monasticismin Basil’s elaboration. The Great Asketikon was created by adding new questions to The Small Asketikon and consists of two parts called the The Longer Rules and The Shorter Rules. The Longer Rules are primarily a set of questions and answers. It includes a wide range of rules and norms of the overall life in community. It refers to the fundamental rules of spirituality, such as love, sacrifice, obedience and rudimental problems connected withcommunity organization, cenobitic monasticism and the role of the superior, work and prayer. The second part of The Great Asketikon consists of shorter rules. Two publications are known: the first one originated in Pont andincludes 286 questions and answers and second arose in Cezarei and includes 318 questions and answers. In this work, the Hierarch explains in detail issues regarding community life and solves difficult problems connected with conscience. He writes about behavior towards brothers and explains the significance of weaknesses and virtues.

  20. Microextracción en fase sólida de compuestos volátiles en albahaca (Ocimum basilicum L. Microextracción en fase sólida de compuestos volátiles en albahaca (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Isaac Andrade-González


    Full Text Available Volatile compounds of basil (Ocimum basilicum L. were extracted with solid phase microextraction(SPME and analyzed with gas chromatography-mass spectrometry (GC-MS. TwoSPME fiber coatings, Polydimethylsiloxane/Divinylbenzene (PDMS/DVB, 65 μm and Carbowax/Divinylbenzene (CW/DVB, 65 μm were evaluated in order to compare the extraction ofcomponents. Among the 25 volatile compounds detected were phenylpropanoids, monoterpenes,sesquiterpenes, esters, and aldehydes. There were significant (P Los compuestos volátiles de la albahaca (Ocimum basilicum L. fueron extraídos mediante la microextracción en fase sólida (SPME y analizados con cromatografía de gases-espectrometría de masas (GC-MS. Se evaluaron dos fibras, Polidimetilsiloxano/Divinilbenceno (PDMS/DVB, 65 μm y Carbowax/Divinilbenceno (CW/DVB, 65 μm, para comparar la extracción de componentes. Entre los 25 compuestos volátiles recuperados en la albahaca, se identificaron fenilpropanoides, monoterpenos, sesquiterpenos, ésteres, y aldehídos. Hubieron diferencias significativas (P Cuantitativamente, el componente más importante fue el cinamato de metilo, seguido por el linalol.

  1. Chemical composition and antimicrobial activity of essential oils of Ocimum canum Sims. and Ocimum selloi Benth.

    Directory of Open Access Journals (Sweden)

    Jeferson C. Nascimento


    Full Text Available This work describes the chemical composition and antimicrobial activity of the volatile oils of Ocimum canum and Ocimum selloi, both occurring in Jequié/BA, northeastern Brazil. The plants were collected in the winter/2005 andsummer/2006, the oils extracted by steam distillation and further analyzed by GC-MS. A total of 30 and 31 compounds was identified from the oils of O. selloi and O. canum, respectively. It was observed that the oil content of O. canum showed variation during the seasons, while the oils of O. selloi did not. Methylchavicol and linalool were the main chemical components found in the aerial parts and leaves of O. canum. This finding permitted to characterize this specimen as a new chemotype of O. canum. Regarding the aerial parts of O. selloi, eugenol, 1,8-cineole, transcaryophyllene and linalool were identified as their major components. All extracted oils from the aerial parts showed biological activity against gram-positive cocci - Staphylococcus aureus ATCC 25923 - but only the O. canum one showed activity against gram-negative bacilli - Escherichia coli ATCC 25922.Este trabalho descreve a composição química e a atividade antimicrobiana dos óleos voláteis de Ocimum canum e Ocimum selloi, que ocorrem em Jequié/BA, nordeste do Brasil. As plantas foram colhidas no inverno de 2005 e verão de 2006 e os óleos extraídos por destilação a vapor foram posteriormente analisados por GC-MS. Um total de 30 e 31 compostos foi identificado a partir dos óleos de O. selloi e O. canum, respectivamente. Foi observado que o teor de óleo de O. canum apresentou variação durante as estações do ano, enquanto o óleo de O. selloi não. Metilchavicol e linalol foram os principais componentes químicos encontrados na parte aérea e folhas de O. canum. Esta descoberta permitiu caracterizar este espécime como um novo quimiotipo de O. canum. Com relação às partes aéreas de O. selloi, eugenol, 1,8-cineol, trans-cariofileno e

  2. Efficiency of essential oils of Ocimum basilicum and Cymbopogum flexuosus in the sedation and anaesthesia of Nile tilapia juveniles

    Directory of Open Access Journals (Sweden)



    Full Text Available ABSTRACT This study aimed to verify the sedative and anaesthetic effect of the essential oils of basil (Ocimum basilicum (EOOB and lemongrass (Cymbopogum flexuosus (EOCF in Nile tilapia juveniles. The fish were transferred to aquaria containing different concentrations of each essential oil: 10, 25, 50, 100, 200, 400 and 600 μL L-1. The time of sedation ranged from 7 to 31 seconds and the recommended concentration was 10 or 25 μL L-1 for both essential oils. The best times for anaesthesia and recovery were found for the concentrations of 400 μL L-1 for EOOB (135.2 and 199.1 seconds, respectively and 600 μL L-1 for EOCF (327.1 and 374.8 seconds, respectively. In conclusion, we recommend the use of EOOB and EOCF for the sedation and anaesthesia of Nile tilapia at concentrations of 10-25 (for both, 400 and 600 μL L-1, respectively.

  3. Evaluation of Ocimum basilicum L. seed mucilage as rate controlling matrix for sustained release of propranolol HCl

    Directory of Open Access Journals (Sweden)

    Majid Saeedi


    Full Text Available Polysaccharide mucilage derived from the seeds of Ocimum basilicum L. (family Lamiaceae was investigated for use in matrix formulations containing propranolol hydrochloride. Basil mucilage was extracted and several tablets were formulated. The effect of mucilage on drug release rate was evaluated in comparison with tablets containing two kinds of hydroxypropyl methylcellulose (HPMC K4M and HPMC K100M as standard polymer. The release data were fitted to several models for kinetic evaluation. The results showed that hardness decreased and friability of tablets increased as the concentration of mucilage increased. The rate of release of propranolol HCl from O. basilicm mucilage matrices was mainly controlled by the drug: mucilage ratio. Drug release was slower from the HPMC K4M and HPMCK100M containing tablets compared to the mucilage containing matrices than the drug release from matrices containing O. basilicum seed mucilage in similar ratios.  Formulations containing O. basilicm mucilage were found to exhibit suitable release pattern. The results of kinetic analysis showed that in tablets containing O. basilicm mucilage the highest correlation coefficient was achieved with the zero order model. The swelling and erosion studies revealed that, as the proportion of mucilage in tablets was increased, there was a corresponding increase in percent swelling and a decrease in percent erosion of tablets.

  4. A Modified Technique of Basilic Vein Transposition for Haemodialysis

    International Nuclear Information System (INIS)

    Chaudhary, F. A.; Parvez, Z.


    Objective: To modify the technique of basilic vein transposition for vascular accesss for haemodialysis aiming at better maturation rate, longer survival of fistula and lesser complications. Study Design: Case series. Place and Duration of Study: Shaikh Zayed Hospital and Omer Hospital, Lahore, from February 2008 to July 2011. Methodology: Patients referred for basilic vein transposition for haemodialysis vascular access were prospectively enrolled. The surgical technique included small tracking incisions, an extra 3 - 4 cm of vein length harvesting to avoid tension in the vein in its new course, an oval arteriotomy and a smooth curved pathway, away from vein harvesting incision to avoid entrapment of vein in the scar. Maturation rate, fistula survival and other complications were noted. Results: There was no immediate failure in 51 patients. The complications during follow-up period were infection and thrombosis, bleeding and non-development of basilic vein in 2 patients each; and false aneurysm formation in one. Four patients died during follow-up period. The maturation time was 4.9 A +- 1.1 weeks. The early patency rate was 92.2%, same at 6 months and 90.7% at 12 months. Conclusion: Arteriovenous fistula constructed with modified technique of basilic vein transposition is an acceptable and valid option of vascular access for haemodialysis. (author)

  5. Basil Willey, Sixty Years after (October 22, 2007)

    DEFF Research Database (Denmark)

    Schatz-Jakobsen, Claus


    On the occasion of the sixtieth anniversary of the foundation of the Danish Association of English Teachers' newsletter, Anglo Files, the essay reconsiders the contents of the first issue from December 1947, Cambridge professor Basil Willey's address to the Association on October 22, 1947, 'Poetr...... and Life', and puts Willey's life and text into historical context....

  6. The anticancer effect of Ocimum tenuiflorum leaves

    Directory of Open Access Journals (Sweden)

    Lam, S.N.


    Full Text Available Breast cancer is the leading cause of cancer deaths among females in Malaysia. Ocimum tenuiflorum L., (O. tenuiflorum commonly known as ruku in Malaysia, is usually cultivated as a garden ornamental plant because of its small purplish and some yellowish flower. The specific objective of this research is to investigate the anticancer of O. tenuiflorum against human breast cancer cell lines (MCF-7 and MDA-MB-231 and human fibroblast cell line (HS-27. In addition, another objective is to determine the mineral and heavy metal determination of O. tenuiflorum. O. tenuiflorum exhibited anticancer activity against MCF-7 (a hormone-dependent breast cancer cell line. The viability of MCF-7 cells decreased significantly after treatment with various concentrations of methanolic plant extracts (25 and 100 μg/mL, as shown via 3-(4,5-dimethylthiazol-2-yl2,5-diphenyltetrazolium bromide (MTT assay. The crude extracts show the lower IC50 (less than 100 μg/mL value against the cancer cell lines and show no effect on HS-27. The high content of calcium in the leaves of O. tenuiflorum may play a role in decreasing the risk of certain cancer. The concentrations of heavy metals (Pb and As detected in O. tenuiflorum are safe for consumption.



    H.C. Srivastava, Pankaj Shukla, Ajay Singh Maurya and Sonia Tripathi*


    ABSTRACT: The aerial parts essential oils of Ocimum basilicum (Lamiaceae) from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS) and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; tanethole type. The in vitro microbiological experiments revealed that only the methyleugenol...

  8. short communication the effect of ocimum sanctum and ledum

    African Journals Online (AJOL)

    Preferred Customer

    SHORT COMMUNICATION. THE EFFECT OF OCIMUM SANCTUM AND LEDUM PALUSTRE ON SERUM URIC. ACID LEVEL IN PATIENTS ... It is a metabolic disorder characterized by abnormally high levels of uric acid in the blood. The pain and swelling due to gout can be sudden and may appear and disappear over ...

  9. In vitro regeneration of a common medicinal plant, Ocimum sanctum ...

    African Journals Online (AJOL)

    Embracing micro-propagation method for large scale production of plantlets and also for protection of appropriate germplasm is a prerequisite that needs to be undertaken in order to develop a rapid in vitro regeneration protocol for Ocimum sanctum L. Shoot tips as well as nodal segments were subjected to numerous ...

  10. Floral biology and reproductive mechanisms of the Ocimum canum Sims (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Cláudio Lúcio Fernandes Amaral


    Full Text Available The Ocimum genus (Lamiaceae presents essential oils used in the pharmaceutical, perfume, cosmetics and culinary industries. The aim of this paper was to study the fl oral biology and breeding mechanisms of Ocimum canum Sims. in relation to improved plant breeding. Ocimum canum has inflorescences with white, protandrous and hermaphoditic flowers. The osmophores are located at the anthers and stigma. Anthesis occurs between 10:30 and 11:30 a.m. The main fl oral visitors were bees of the Apis and Augochloropsis genuses. Ocimum canum presents a breeding system with a predominance of outcrossing that possibly demonstrates the wide reproductive flexibility of this species.

  11. A Set of Regioselective O-Methyltransferases Gives Rise to the Complex Pattern of Methoxylated Flavones in Sweet Basil1[C][W][OA (United States)

    Berim, Anna; Hyatt, David C.; Gang, David R.


    Polymethoxylated flavonoids occur in a number of plant families, including the Lamiaceae. To date, the metabolic pathways giving rise to the diversity of these compounds have not been studied. Analysis of our expressed sequence tag database for four sweet basil (Ocimum basilicum) lines afforded identification of candidate flavonoid O-methyltransferase genes. Recombinant proteins displayed distinct substrate preferences and product specificities that can account for all detected 7-/6-/4′-methylated, 8-unsubstituted flavones. Their biochemical specialization revealed only certain metabolic routes to be highly favorable and therefore likely in vivo. Flavonoid O-methyltransferases catalyzing 4′- and 6-O-methylations shared high identity (approximately 90%), indicating that subtle sequence changes led to functional differentiation. Structure homology modeling suggested the involvement of several amino acid residues in defining the proteins’ stringent regioselectivities. The roles of these individual residues were confirmed by site-directed mutagenesis, revealing two discrete mechanisms as a basis for the switch between 6- and 4′-O-methylation of two different substrates. These findings delineate major pathways in a large segment of the flavone metabolic network and provide a foundation for its further elucidation. PMID:22923679

  12. Radiosensitization of Aspergillus niger and Penicillium chrysogenum using basil essential oil and ionizing radiation for food decontamination. (United States)

    The Minimum Inhibitory Concentration (MIC) of basil oil, was determined for two pathogenic fungi of rice, Aspergillus niger and Penicillium chrysogenum. The antifungal activity of the basil oil in combination with ionising radiation was then investigated to determine if basil oil caused radiosensit...

  13. Metode Cepat Identifikasi Flavonoid dari Daun Ocimum sanctum L. (Selasih

    Directory of Open Access Journals (Sweden)

    Diah Dhianawaty


    Full Text Available A plant’s effectiveness as a herbal drug comes from its chemical content such as flavonoids. Flavonoids are useful for human body health. Therefore flavonoids content can be used as a marker from the usefulness of a plant, and rapid identification method of flavonoid is needed. The objective of the research was to get a rapid method of flavonoid content identification from Ocimum sanctum. The extraction, isolation and identification of flavonoids from Ocimum sanctum leaves has been done at Medical Chemistry laboratory Faculty of Medicine Universitas Padjadjaran in 2005. Flavonoids were extracted continually by 95% ethanol, were isolated with paper chromatography/cellulose TLC and 2% acetic acid, then continued with elucidation reagents: n-butanol–acetic acid–water, chloroform–acetic acid–water, forestall, 5%, 15%, 35% and 50% acetic acids. Flavonoids were identified with diagnostic reagents and ultraviolet light. Isolation with 2% and 35% acetic acids respectively gave two spots of flavonoids as flavon, FOAc-1 had Rf=0.69 and FOAc-2 had Rf=0.57. The other elucidation reagents gave one spot of flavonoid. In conclusion, isolation with 2% and 35% acetic acids respectively and identification with diagnostic reagent and ultraviolet light is a rapid method for identification of flavonoids content in Ocimum sanctum

  14. Comportamento fenotípico e genotípico de populações de manjericão Phenotypic and genotypic behavior of basil populations

    Directory of Open Access Journals (Sweden)

    Arie F Blank


    Full Text Available Genótipos de manjericão (Ocimum basilicum L. apresentam diferentes teores, rendimentos e composições químicas de óleos essenciais. Fatores influenciam na produção do óleo essencial de manjericão, como a cultivar plantada e o método de cultivo. O estudo dos parâmetros genéticos tem sido ferramenta útil na identificação de genótipos superiores. Este trabalho teve o objetivo de estimar alguns parâmetros genéticos associados ao comportamento produtivo de seis populações de manjericão nos anos agrícola 2004/05 e 2005/06. As características massa seca de folha + inflorescência e rendimento de óleo essencial apresentaram grande variabilidade por forte influência dos anos estudados. Já o teor de linalol manteve sua produtividade estável ao longo dos dois anos. Teor e rendimento de óleo essencial e teor de linalol no óleo essencial apresentaram herdabilidades altas na análise conjunta, indicando controle genético e grande possibilidade de serem transmitidas para as gerações futuras. Na análise conjunta as populações PI 197442-S3-bulk 3, PI 197442-S3-bulk 5 e PI 197442-S3-bulk 8 apresentaram os maiores teores e rendimentos de óleo essencial. Quanto ao constituinte químico majoritário do óleo essencial, o linalol, todas as populações apresentaram teores semelhantes, diferindo apenas na presença de alguns constituintes químicos minoritários.Basil (Ocimum basilicum L. genotypes present different contents, yields and chemical constituents in its essential oils. Factors influence the essential oil production of basil, such as cultivar and cultivation method. The study of genetic parameters is a useful tool to identify superior genotypes. In this work we estimated some genetic parameters associated to the production behavior of six basil populations cultivated in 2004/05 and 2005/06. The variables dry weight of leaves + inflorescences and essential oil yield presented high variability because of strong influence of

  15. Application of Ocimum basilicum Essential Oil as Vapor on Postharvest Storage of Plum Fruit cv. ‘Golden Drop’

    Directory of Open Access Journals (Sweden)

    Zahra FAKHAR


    Full Text Available Increased interest in theuse of natural compounds instead of chemicals is due to concerns about the effect of synthetic ingredients on humans’ health and over environment. Therefore, in this study essential oil from Ocimum basilicum as a natural and safe compound, was applied at three levels (100, 200 and 300 μl/l as vapor and its effects on postharvest quality and storage life of ‘Golden Drop’ plums was evaluated. After application of treatments, the fruits were stored at +1 °C and 80-85% relative humidity for 42 days. During the storage period, samplings were carried out every week and to simulate market condition, they were kept at room temperate for 24 h. Then some of the qualitative and quantitative traits, such as total soluble solids (TSS, titrable acidity (TA, TSS/TA ratio, weight loss, firmness, ascorbic acid, total antioxidants, as well as color (L*,  hue angle were measured. Results showed that the basil essential oil contributed to a better maintenance of

  16. Sclerotinia Rot on Basil Caused by Sclerotinia sclerotiorum in Korea

    Directory of Open Access Journals (Sweden)

    Soo Sang Hahm


    Full Text Available During growing season of 2011 to 2013, Sclerotinia rot symptoms consistently have been observed on basil in Yesan-gun, Chungcheongnam-do in Korea. The typical symptom formed initially brownish spot on leaf and stem, and then advancing margins, wilting the whole plant and blighting, eventually died. On the surface of diseased lesions was observed cottony, white, dense mat of mycelial growth, and sclerotia (30–100 µm diameter formed on stem and leaf. Morphological and cultural characteristic on potato dextrose agar, color of colony was white and colorless chocolate, sclerotium of irregular shape of the oval was black and 5–50 µm diameter in size. In pathogenicity test, necrosis and wilt of the inoculated stem were observed in all plants and the pathogen was reisolated from stems. On the basis of mycological characteristics, pathogenicity, and internal transcribed spacer rDNA sequence analysis, this fungus was identified as Sclerotinia sclerotiorum. This is the first report of Sclerotinia rot on basil caused by S. sclerotiorum in Korea.

  17. Effects of biocides on chlorophyll contents of detached basil leaves

    Directory of Open Access Journals (Sweden)

    Titima Arunrangsi


    Full Text Available Herbicides and insecticides have been widely and intensively used in agricultural areas worldwide to enhance crop yield. However, many biocides cause serious environmental problems. In addition, the biocides may also have some effects on the treated agricultural crops. To study effects of biocides on chlorophyll content in detached basil leaves, 2,4-D dimethylamine salt (2,4 D-Amine, paraquat, carbosulfan, and azadirachtin, were chosen as representatives of biocide. After applying the chemicals to detached basil leaves overnight in darkness, chlorophyll contents were determined. Only treatment with 2,4 D-Amine resulted in reduction of chlorophyll contents significantly compared to treatment with deionized (DI water. In the case of paraquat and carbosulfan, chlorophyll contents were not significantly changed, while slightly higher chlorophyll contents, compared to DI water, after the treatment with azadirachtin, were observed. The results indicated that 2,4 D-Amine shows an ability to accelerate chlorophyll degradation, but azadirachtin helps to retard chlorophyll degradation, when each biocide is used at the concentration recommended by the manufacturer.

  18. Caracterização morfológica e agronômica de acessos de manjericão e alfavaca Morphologic and agronomic characterization of basil accessions

    Directory of Open Access Journals (Sweden)

    Arie F. Blank


    Full Text Available O manjericão (Ocimum basilicum L. pode ser considerado cultura anual ou perene, conforme o local de cultivo. Existem diversas finalidades para seu uso na culinária, como planta ornamental, medicinal e aromática, sendo o seu oleo essencial valorizado no mercado internacional pelo teor de linalol. Caracterizou-se morfológica e agronômicamente, acessos de Ocimum sp. visando a seleção de genótipos com alto rendimento de óleo essencial rico em linalol. O delineamento experimental foi de blocos casualizados, com duas repetições, avaliando 55 genótipos do Banco de Germoplasma de Ocimum da UFS. Avaliou-se a altura de plantas, peso da matéria seca da parte aérea, teor e rendimento de óleo essencial. Observou-se grande diversidade entre os genótipos para todas as variáveis morfológicas e agronômicas avaliadas. Houve grande amplitude entre os genótipos quanto ao teor de óleo essencial, variando de 0,202 a 2,536 ml/100g e para o rendimento de óleo essencial, variando de 1,103 a 21,817 l/ha. Avaliando as variáveis teor e rendimento de óleo essencial de O. basilicum pode-se selecionar os genótipos NSL6421, PI197442, PI358464, PI414194, PI531396 e 'Fino Verde' para o programa de melhoramento genético que visa a obtenção de novas cultivares de manjericão com alto rendimento de óleo essencial rico em linalol.The sweet basil (Ocimum basilicum L., can be an annual or a perennial plant depending on the place where it is grown. This plant has several culinary, ornamental, medicinal and aromatic uses. The value of its essential oil in the international market depends on the percentage of linalool. We characterized the morphologic and agronomic qualities of the Ocimum accessions, to select genotypes with higher yield of essential oil rich in linalool. Experiment design consisted of randomized blocks with two replications, evaluating 55 genotypes of the Germplasm Bank of Ocimum from the Universidade Federal do Sergipe, Brazil. The plant

  19. A teoria de Basil Bernstein: alguns aspectos fundamentais

    Directory of Open Access Journals (Sweden)

    Ana Maria Morais


    Full Text Available The article begins with a reference to the pieces of work that Basil Bernstein considered to have been the landmarks of the evolution of his thought. This is followed by a detailed description of the two models that contain the main concepts of his theory – Model of Cultural Reproduction and Transformation and Model of Pedagogic Discourse – where the theoretical meaning of these models and concepts is explained and where are given some examples of how to put them into practice at the level of pedagogic texts and contexts. The article also includes the most recent developments of Bernstein’s thought by explaining his ideas about the forms discourses can take – Vertical and Horizontal Discourses. Finally, Bernstein’s theory is approached within the framework of the empirical research, highlighting his epistemological positioning and explicating the methodological model that he suggested should be the driving force of any theory.

  20. Basil conservation affected by cropping season, harvest time and storage period Armazenamento e conservação de manjericão após diferentes épocas e horários de colheita

    Directory of Open Access Journals (Sweden)

    Franceli da Silva


    Full Text Available Fresh basil (Ocimum basilicum L. is used in food, phytotherapic industry, and in traditional therapeutic, due to its essential oil content and composition. Nevertheless basil can not be kept for long periods after harvest and its quality can be reduced. This work aimed to assess the influence of the season and harvest time in the postharvest conservation of basil stored for different periods. Basil was harvested at 8 am and 4 pm both in August/1999 and January/2000. Cuttings were conditioned in PVC packages and stored for 3, 6, and 9 days. During storage, chlorophyll content, essential oil content and composition were determined as well as microbiological analyses were carried out. Harvest season and the days of storage influenced the final content of essential oil. There was a linear decrease in the content of essential oil, in the chlorophyll content and in the number of mold and yeast colonies during storage. There was no effect of cropping season or harvest hour on essential oil composition, but the eugenol and linalool content increased during storage. Coliforms were under 0.3 MPN g-1 and the number of Staphylococcus aureus was under 1.0x10² UFC g-1.O manjericão (Ocimum basilicum L. é empregado tanto na indústria culinária quanto fitoterápica e na medicina tradicional, devido ao teor e composição de seu óleo essencial. No entanto, o manjericão não pode ser conservado por longo período após a colheita e sua qualidade pode ser prejudicada. O objetivo deste trabalho foi verificar a influência da época e do horário de colheita sobre a conservação de manjericão armazenado por diferentes períodos. O manjericão foi colhido às 8h e às 16h em agosto/1999 e em janeiro/2000. Os ramos foram acondicionados em filmes de PVC e armazenados por 3, 6 e 9 dias. Durante o armazenamento, o teor de clorofila, e o teor e a composição do óleo essencial foram determinados e foram conduzidas análises microbiológicas. A época de colheita

  1. Phytochemical characterization of essential oil from Ocimum selloi

    Directory of Open Access Journals (Sweden)



    Full Text Available Ocimum selloi Benth, a native plant of Brazil, has medicinal uses as anti-diarrheic, antispasmodic and anti-inflammatory product. The yield of essential oils of the inflorescences, containing flowers and seeds, was 0.6%, and the yield of leaves, collected in two different seasons, was 0.25% (June 2000 and 0.20% (January 2001, respectively. The essential oils of the inflorescences and leaves presented as major constituents trans-anethol (41.34%, 45.42%, 58.59% and methyl chavicol (27.10%, 24.14%, 29.96%.Ocimum selloi Benth, planta nativa do Brasil de uso medicinal, tem sido utilizada como antidiarréico, antiespasmódico e antiinflamatório. O rendimento dos óleos essenciais das inflorescências, contendo flores e sementes, foi de 0,6% e das folhas, coletadas em duas épocas do ano, foi de 0,25% (junho/00 e 0,20% (janeiro/01, respectivamente. Os óleos essenciais das inflorescências e folhas apresentaram como constituintes majoritários o trans-anethol (41,34%, 45,42%, 58,59% e methyl chavicol (27,10%, 24,14%, 29,96%.

  2. Allelopathic activity of medicinal plant essential oils on seed germination and vigor of lettuce achenes

    Directory of Open Access Journals (Sweden)

    Cíntia Alvarenga Santos Fraga de Miranda


    Full Text Available In recent years, essential oils have gained commercial interest in the agricultural area, mainly for their allelopathic, insecticidal, antifungal, antimicrobial and antioxidant properties, and, also for their natural compounds, which have generally displayed low toxicity, relatively low cost and rapid degradation in the environment. Medicinal plants have emerged as potential suppliers of essential oils because of their ethnopharmacological utility. The aim of this study was to evaluate the allelopathic potential of essential oils extracted from fresh leaves of lemon grass (Cymbopogon citratus, wild basil (Ocimum gratissimum L. and sweet basil (Ocimum basilicum L. with regard to their major constituents (citral, eugenol and cineol, respectively in different application forms (direct contact and the effect of volatile constituents on the germination and vigor of lettuce seeds (cultivar Regina SF 3500. The effects of the oils and their major components were evaluated with regard to the variables: first germination count, total germination, GVI (germination velocity index, seedling dry weight and average lengths of shoots and lettuce roots. The essential oils from lemon grass and basil displayed allelopathic potentials on seed germination and vigor of lettuce achenes that can be assigned to their respective major constituents citral and eugenol. On the other hand, the allelopathic effect of the essential oil from basil was a consequence of the combined effect of all the components, regardless the application method.

  3. Imunno-modulatory effect of Ocimum sanctum against endosulfan induced immunotoxicity in Wistar Rat

    Directory of Open Access Journals (Sweden)

    Bharath B.K.


    Full Text Available The present experiment was designed to make a systematic study of experimentally induced immunotoxicity of endosulfan and its amelioration with Ocimum sanctum in male Wistar rats at 6, 3 and 1.5 mg / Kg b.wt to groups II, III and IV by mixing in ground nut oil for 6 weeks. To the groups V, VI and VII in addition to endosulfan as above mentioned dose, Ocimum sanctum was given at 200 mg / kg b.wt daily per orally for the same duration to study immuno modulatory effect. Group I served as oil control and Group VIII as Ocimum sanctum control. Significant reduction in the both HA titer and DNCB contact sensitivity score was observed in the endosulfan treated groups indicates endosulfan has immunotoxic effect. But significant improvement in the immunity was observed in the Ocimum sanctum treated groups indicates the immuno modulatory property. [Veterinary World 2011; 4(1.000: 25-27


    Directory of Open Access Journals (Sweden)

    Adina Talmaciu


    Full Text Available The activities and role of phenolic compounds in the plant kingdom are well known. They are especially recognized for their function as plant growth regulators, but also for the important role in the biosynthesis process. Based on that, the aim of this work is to establish the influence of polyphenolic compounds, on the main physiological processes involved in basil cultivation under controlled conditions. Studies were carried out on sweet basil seeds (Ocimumbasilicum L. treated with different spruce bark polyphenolic extracts (aqueous extract and ultrasound assisted aqueous extract on several concentrations. The germination energy and germination capacity, plants vegetative organelles development and photoassimilatory pigments content were investigated. The results show that the Picea abies extracts, rich in phenolic compounds, have an influence on the global development of plantlets. An increased value for the growth parameters and pigments concentration was observed, compare with a control sample. Also it was shown that the effect of phenolic compounds on plants development significantly depends on their concentration.

  5. Efeito da adição de óleo essencial de Origanum vulgar e Ocimum gratissimum L. no perfil lipídico da gordura de palma usada em fritura de batata tipo chips


    Ribeiro, Jessica Trautwein Diniz


    O objetivo do presente trabalho foi avaliar o efeito antioxidante do óleo essencial de orégano e alfavacão no perfil de ácidos graxos da gordura de palma, utilizada em processo industrial de batata frita tipo chips, em diferentes etapas do processamento, visando reduzir o estado oxidativo da mesma. O óleo essencial foi obtido do resíduo do orégano da indústria de condimentos, e analisou-se também óleo essencial de orégano comercial. A atividade antioxidante do óleo essencial de orégano foi fe...

  6. Preparation of basil seed mucilage aerogels loaded with paclitaxel nanoparticles by the combination of phase inversion technique and gas antisolvent process

    Directory of Open Access Journals (Sweden)

    Seyyed Ghoreishi


    Full Text Available Objective(S: In this work, paclitaxel (PX, a promising anticancer drug, was loaded in the basil seed mucilage (BSM aerogels by implementation of supercritical carbon dioxide (SC-CO2 technology. Then, the effects of operating conditions were studied on the PX mean particle size (MPS, particle size distribution (PSD and drug loading efficiency (DLE. Methods: The employed SC-CO2 process in this research is the combination of phase inversion technique and gas antisolvent (GAS process. The effect of DMSO/water ratio (4 and 6 (v/v, pressure (10-20 MPa, CO2 addition rate (1–3 mL/min and ethanol concentration (5-10% were studied on MPS, PSD and DLE. Scanning electron microscopy (SEM and Zetasizer were used for particle analysis. DLE was investigated by utilizing the high-performance liquid chromatography (HPLC. Results: Nanoparticles of paclitaxel (MPS of 82–131 nm depending on process variables with narrow PSD were successfully loaded in BSM aerogel with DLE of 28–52%. Experimental results indicated that higher DMSO/water ratio, ethanol concentration, pressure and CO2 addition rate reduced MPS and DLE. Conclusions: A modified semi batch SC-CO2 process based on the combination of gas antisolvent process and phase inversion methods using DMSO as co-solvent and ethanol as a secondary solvent was developed for the loading of an anticancer drug, PX, in ocimum basilicum mucilage aerogel. The experimental results determined that the mean particle size, particle size distribution, and drug loading efficiency be controlled with operating conditions.

  7. The effects of kale (Brassica oleracea ssp. acephala), basil (Ocimum basilicum) and thyme (Thymus vulgaris) as forage material in organic egg production on egg quality

    DEFF Research Database (Denmark)

    Hammershøj, Marianne; Steenfeldt, Sanna


    1. In organic egg production, forage material as part of the diet for laying hens is mandatory. The purpose of the present study was to examine the effect of feeding with forage materials including maize silage, herbs or kale on egg production and various egg quality parameters of the shell, yolk...

  8. RETRACTED: Preliminary study: Kinetics of oil extraction from basil (Ocimum basilicum by microwave-assisted hydrodistillation and solvent-free microwave extraction

    Directory of Open Access Journals (Sweden)

    Heri Septya Kusuma


    This manipulation of the peer-review process represents a clear violation of the fundamentals of peer review, our publishing policies, and publishing ethics standards. Apologies are offered to the reviewers whose identities were assumed and to the readers of the journal that this deception was not detected during the submission process.

  9. Studies on fertilization of dill (Anethum graveolens L. and basil (Ocimum basilicum L.: II Oil yield of dill affected by fertilization

    Directory of Open Access Journals (Sweden)

    S. Hälvä


    Full Text Available The influence of different levels of basic fertilization and nitrogen top-dressing on the herb and oil yield of dill (Anethum graveolens L. was studied in 1984 and 1985 in Finland. The total nitrogen doses were 0, 15, 30, 40, 80, 120 and 160 kg/ha. The crop in 1984 yielded 12 000—34 000 kg/ha fresh dill herb and 10.3—21.1 kg/ha essential oil. The figures in 1985 were 10600—21 000 and 9.4—16.6 kg/ha, respectively. Of the 22 volatile components identified by gas chromatography mass spectrometry, the four most abundant compounds were analysed quantitatively. These compounds were a-phellandrene, 3,6-dimethyl-2,3,3a,4,5,7a-hexahydrobenzofuran, β-phellandrene and limonene, composing 70—95 % of the total aroma content. The optimum basic fertilization for the herb yield proved to be a compound fertilizer of the rate of 40-16-68 kg NPK/ha. The small nitrogen doses (30—40kg N/ha gave also good results in respect to oil yield and the amount of 3,6-dimethyl-2,3,3a,4,5,7a-hexahydrobenzofuran, the most important aroma compound in the dill herb.

  10. Starch accumulation during hydroponic growth of spinach and basil plants under carbon dioxide enrichment

    Energy Technology Data Exchange (ETDEWEB)

    Holbrook, G P; Hansen, J; Wallick, K; Zinnen, T M [North Illinois University, de Kalb, IL (USA). Dept. of Biological Sciences


    The effects of CO[sub 2] enrichment, photoperiod duration, and inorganic phosphate levels on growth and starch accumulaton by spinach and basil plants were studied in a commercial hydroponic facility. During a 3-week growth period, both species exhibited increased whole-plant fresh weight as a result of an increase in atmospheric CO[sub 2] concentration from 400 to 1500 mul/1. However, basil leaves exhibited a 1.5- to 2-fold greater increase in specific leaf weight (SLW), and accumulated starch to much greater levels than did leaves of spinach. At 1500 mul CO[sub 2]/1, starch accounted for up to 38% of SLW with basil compared to [lt] 10% of SLW with spinach. The maximum ratio of starch/chlorophyll was 55.0 in basil leaves vs 8.0 in spinach leaves. High ratio values were associated with the appearance of chlorotic symptoms in leaves of basil grown under CO[sub 2] enrichment, whereas spinach did not exhibit chlorosis. Increasing inorganic phosphate concentrations from 0.7 to 1.8 mM in the hydroponic medium did not appreciably affect leaf starch accumulation in either species. Starch accumulation in basil leaves was not consistently related to the duration of the photoperiod. However, photoperiod-induced changes in leaf starch levels were much greater in basil than spinach. The results clearly indicate that different horticultural crops can show diverse responses to CO[sub 2] enrichment, and thus highlight the need to develop individual growth strategies to optimize production quality of each species.

  11. Coleoptera: Bostrichidae

    African Journals Online (AJOL)


    castaneum is worldwide stored product pest ... oil, roots, etc. ... these with similar properties are the Ocimum gratissum (basil), and Ocimum sanctum (holy basil). It is used as an insect repellent during storage. It also works as a mosquito ...

  12. Avoidance behavior to essential oils by Anopheles minimus, a malaria vector in Thailand (United States)

    Excito-repellency tests were used to characterize behavioral responses of laboratory colonized Anopheles minimus, a malaria vector in Thailand, using four essential oils, citronella (Cymbopogom nadus), hairy basil (Ocimum americanum), sweet basil (Ocimum basilicum), vetiver (Vetiveria zizanioides), ...

  13. Matrix-derived combination effect and risk assessment for estragole from basil-containing plant food supplements (PFS)

    NARCIS (Netherlands)

    Berg, van den S.J.P.L.; Klaus, V.; Alhusainy, W.; Rietjens, I.


    Basil-containing plant food supplements (PFS) can contain estragole which can be metabolised into a genotoxic and carcinogenic 1'-sulfoxymetabolite. This study describes the inhibition of sulfotransferase (SULT)-mediated bioactivation of estragole by compounds present in basil-containing PFS.

  14. Effects of aqueous extracts of Hibiscus sabdariffa calyces and ...

    African Journals Online (AJOL)

    The effects of aqueous extracts of the leaves of Ocimum gratissimum and calyces of Hibiscus sabdariffa on intestinal transit were determined in experimental rats The leaves of Ocimum gratissimum were oven dried and then pulverized. The dried calyces of Hibiscus sabdariffa were also pulverized. 10% extracts of both ...

  15. Bactericidal activity of herbal volatile oil extracts against multidrug resistant Acinetobacter baumannii

    Directory of Open Access Journals (Sweden)

    Amornrat Intorasoot


    Full Text Available Aim:\tTo investigate the antibacterial activity of ten volatile oils extracted from medicinal plants, including galangal (Alpinia galanga Linn., ginger (Zingiber officinale, plai (Zingiber cassumunar Roxb., lime (Citrus aurantifolia, kaffir lime (Citrus hystrix DC., sweet basil (Ocimum basilicum Linn., tree basil (Ocimum gratissimum, lemongrass (Cymbopogon citratus DC., clove (Syzygium aromaticum and cinnamon (Cinnamomum verum against four standard strains of Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Acinetobacter baumannii and thirty clinical isolates of multidrug-resistant A. baumannii (MDR-A. baumannii. Methods:\tAgar diffusion, minimal inhibitory concentration (MIC and minimal bactericidal concentration (MBC were employed for determination of bactericidal activity of water distillated medicinal plants. Tea tree oil (Melaleuca alternifolia was used as positive control in this study. Results:\tThe results indicated the volatile oil extracted from cinnamon exhibited potent antibacterial activity against the most common human pathogens, S. aureus, E. coli, P. aeruginosa and A. baumannii. Most of volatile oil extracts were less effective against non-fermentative bacteria, P. aeruginosa. In addition, volatile oil extracted from cinnamon, clove and tree basil possessed potent bactericidal activity against MDR-A. baumannii with MBC90 of 0.5, 1 and 2 mg/mL, respectively. Conclusions: The volatile oil extracts would be useful as alternative natural product for treatment of the most common human pathogens and MDR-A. baumannii infections. [J Complement Med Res 2017; 6(2.000: 218-222

  16. Bactericidal activity of herbal volatile oil extracts against multidrug-resistant Acinetobacter baumannii. (United States)

    Intorasoot, Amornrat; Chornchoem, Piyaorn; Sookkhee, Siriwoot; Intorasoot, Sorasak


    The aim of the study is to investigate the antibacterial activity of 10 volatile oils extracted from medicinal plants, including galangal ( Alpinia galanga Linn.), ginger ( Zingiber officinale ), plai ( Zingiber cassumunar Roxb.), lime ( Citrus aurantifolia ), kaffir lime ( Citrus hystrix DC.), sweet basil ( Ocimum basilicum Linn.), tree basil ( Ocimum gratissimum ), lemongrass ( Cymbopogon citratus DC.), clove ( Syzygium aromaticum ), and cinnamon ( Cinnamomum verum ) against four standard strains of Staphylococcus aureus , Escherichia coli , Pseudomonas aeruginosa , Acinetobacter baumannii , and 30 clinical isolates of multidrug-resistant A. baumannii (MDR- A. baumannii ). Agar diffusion, minimum inhibitory concentration, and minimum bactericidal concentration (MBC) were employed for the determination of bactericidal activity of water distilled medicinal plants. Tea tree oil ( Melaleuca alternifolia ) was used as positive control in this study. The results indicated the volatile oil extracted from cinnamon exhibited potent antibacterial activity against the most common human pathogens, S. aureus , E. coli , P. aeruginosa , and A. baumannii . Most of volatile oil extracts were less effective against non-fermentative bacteria, P. aeruginosa . In addition, volatile oil extracted from cinnamon, clove, and tree basil possessed potent bactericidal activity against MDR- A. baumannii with MBC 90 of 0.5, 1, and 2 mg/mL, respectively. The volatile oil extracts would be useful as alternative natural product for the treatment of the most common human pathogens and MDR- A. baumannii infections.

  17. The extraction and chromatographic determination of the essentials oils from Ocimum basilicum L. by different techniques

    Energy Technology Data Exchange (ETDEWEB)

    Soran, Maria Loredana; Varodi, Codruta; Lung, Ildiko; Surducan, Emanoil; Surducan, Vasile [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania); Cobzac, Simona Codruta, E-mail: loredana.soran@itim-cj.r [Babes-Bolyai University, Faculty of Chemistry and Chemical Engineering, 11 Arany Janos, 400028 Cluj-Napoca (Romania)


    Three different techniques (maceration, sonication and extraction in microwave field) were used for extraction of essential oils from Ocimum basilicum L. The extracts were analyzed by TLC/HPTLC technique and the fingerprint informations were obtained. The GC-FID was used to characterized the extraction efficiency and for identify the terpenic bioactive compounds. The most efficient extraction technique was maceration followed by microwave and ultrasound. The best extraction solvent system was ethyl ether + ethanol (1:1, v/v). The main compounds identified in Ocimum basilicum L. extracts were: {alpha} and {beta}-pinene (mixture), limonene, citronellol, and geraniol.

  18. The extraction and chromatographic determination of the essentials oils from Ocimum basilicum L. by different techniques

    International Nuclear Information System (INIS)

    Soran, Maria Loredana; Varodi, Codruta; Lung, Ildiko; Surducan, Emanoil; Surducan, Vasile; Cobzac, Simona Codruta


    Three different techniques (maceration, sonication and extraction in microwave field) were used for extraction of essential oils from Ocimum basilicum L. The extracts were analyzed by TLC/HPTLC technique and the fingerprint informations were obtained. The GC-FID was used to characterized the extraction efficiency and for identify the terpenic bioactive compounds. The most efficient extraction technique was maceration followed by microwave and ultrasound. The best extraction solvent system was ethyl ether + ethanol (1:1, v/v). The main compounds identified in Ocimum basilicum L. extracts were: α and β-pinene (mixture), limonene, citronellol, and geraniol.

  19. High pressure-temperature processing as an alternative for preserving basil

    NARCIS (Netherlands)

    Krebbers, B.; Matser, A.; Koets, M.; Bartels, P.; Berg, van den R.


    In this study the effect of sterilisation by high pressure (HP) on the quality of basil was compared to conventional processing techniques. By means of freezing, or blanching followed by drying, microbial reduction of spores was maximal one-log. Pulsed HP-temperature treatment yielded a reduction of

  20. Daytime Solar Heating Controls Downy Mildew Peronospora belbahrii in Sweet Basil.

    Directory of Open Access Journals (Sweden)

    Yigal Cohen

    Full Text Available The biotrophic oomycete Peronospora belbahrii causes a devastating downy mildew disease in sweet basil. Due to the lack of resistant cultivars current control measures rely heavily on fungicides. However, resistance to fungicides and strict regulation on their deployment greatly restrict their use. Here we report on a 'green' method to control this disease. Growth chamber studies showed that P. belbahrii could hardly withstand exposure to high temperatures; exposure of spores, infected leaves, or infected plants to 35-45 °C for 6-9 hours suppressed its survival. Therefore, daytime solar heating was employed in the field to control the downy mildew disease it causes in basil. Covering growth houses of sweet basil already infected with downy mildew with transparent infra-red-impermeable, transparent polyethylene sheets raised the daily maximal temperature during sunny hours by 11-22 °C reaching 40-58 °C (greenhouse effect. Such coverage, applied for a few hours during 1-3 consecutive days, had a detrimental effect on the survival of P. belbahrii: killing the pathogen and/or suppressing disease progress while enhancing growth of the host basil plants.

  1. Authentication of organically and conventionally grown basils by gas chromatograpy/mass spectrometry chemical profiles (United States)

    Basil plants cultivated by organic and conventional farming practices were differentiated using gas chromatography/mass spectrometry (GC/MS) and chemometric methods. The two-way GC/MS data sets were baseline-corrected and retention time-aligned prior to data processing. Two self-devised fuzzy clas...

  2. Basil Bernstein's Theory of the Pedagogic Device and Formal Music Schooling: Putting the Theory into Practice (United States)

    Wright, Ruth; Froehlich, Hildegard


    This article describes Basil Bernstein's theory of the pedagogic device as applied to school music instruction. Showing that educational practices are not personal choices alone, but the result of socio-political mandates, the article traces how education functions as a vehicle for social reproduction. Bernstein called this process the…

  3. Basil Bernstein and Emile Durkheim: Two Theories of Change in Educational Systems (United States)

    Cherkaoui, Mohamed


    Attempts to draw out parallels and differences between Emile Durkheim's and Basil Bernstein's theories of educational systems and highlights Bernstein's reformulation of certain features of Durkheim's thought. Focuses on the role of the school, curriculum change, and social conflict. (Author/RK)

  4. Microbiological Status and Food Safety Compliance of Commercial Basil Production Systems. (United States)

    de Bruin, Willeke; Otto, Denise; Korsten, Lise


    Basil has been implicated in a number of microbe-associated foodborne illnesses across the world, and the source of contamination has often been traced back to the production and/or processing stages of the supply chain. The aim of this study was to evaluate the microbiological quality of fresh basil from the point of production to the retail outlet in the Gauteng and Northwest Provinces of South Africa. A total of 463 samples were collected over a 3-month period from two large-scale commercial herb producing and processing companies and three retail outlets. The microbiological quality of the samples was assessed based on the presence or absence of Escherichia coli O157:H7 and Salmonella Typhimurium and the levels of the indicator bacteria E. coli and total coliforms. Salmonella Typhimurium was detected on four basil samples (0.9%) arriving at the processing facility and at dispatch, but no E. coli O157:H7 was detected throughout the study. Total coliform counts were 0.4 to 4.1 CFU/g for basil, 1.9 to 3.4 log CFU/ml for water, and 0.2 to 1.7 log CFU/cm(2) for contact surfaces, whereas E. coli was detected in the water samples and only once on basil. The Colilert-18 and membrane filter methods were used to analyze water samples, and a comparison of results revealed that the Colilert-18 method was more sensitive. Strong evidence suggests that high numbers of coliforms do not necessarily indicate the presence of Salmonella Typhimurium. The study results highlight the importance of effective implementation of food safety management systems in the fresh produce industry.

  5. Tulsi - Ocimum sanctum: A herb for all reasons

    Directory of Open Access Journals (Sweden)

    Marc Maurice Cohen


    Full Text Available The predominant cause of global morbidity and mortality is lifestyle-related chronic diseases, many of which can be addressed through Ayurveda with its focus on healthy lifestyle practices and regular consumption of adaptogenic herbs. Of all the herbs used within Ayurveda, tulsi (Ocimum sanctum Linn is preeminent, and scientific research is now confirming its beneficial effects. There is mounting evidence that tulsi can address physical, chemical, metabolic and psychological stress through a unique combination of pharmacological actions. Tulsi has been found to protect organs and tissues against chemical stress from industrial pollutants and heavy metals, and physical stress from prolonged physical exertion, ischemia, physical restraint and exposure to cold and excessive noise. Tulsi has also been shown to counter metabolic stress through normalization of blood glucose, blood pressure and lipid levels, and psychological stress through positive effects on memory and cognitive function and through its anxiolytic and anti-depressant properties. Tulsi′s broad-spectrum antimicrobial activity, which includes activity against a range of human and animal pathogens, suggests it can be used as a hand sanitizer, mouthwash and water purifier as well as in animal rearing, wound healing, the preservation of food stuffs and herbal raw materials and traveler′s health. Cultivation of tulsi plants has both spiritual and practical significance that connects the grower to the creative powers of nature, and organic cultivation offers solutions for food security, rural poverty, hunger, environmental degradation and climate change. The use of tulsi in daily rituals is a testament to Ayurvedic wisdom and provides an example of ancient knowledge offering solutions to modern problems.

  6. Exploring the potential effect of Ocimum sanctum in vincristine-induced neuropathic pain in rats

    Directory of Open Access Journals (Sweden)

    Jaggi Amteshwar


    Full Text Available Abstract The present study was designed to investigate the ameliorative potential of Ocimum sanctum and its saponin rich fraction in vincristine-induced peripheral neuropathic pain in rats. Peripheral neuropathy was induced in rats by administration of vincristine sulfate (50 μg/kg i.p. for 10 consecutive days. The mechanical hyperalgesia, cold allodynia, paw heat hyperalgesia and cold tail hyperalgesia were assessed by performing the pinprick, acetone, hot plate and cold tail immersion tests, respectively. Biochemically, the tissue thio-barbituric acid reactive species (TBARS, super-oxide anion content (markers of oxidative stress and total calcium levels were measured. Vincristine administration was associated with the development of mechanical hyperalgesia, cold allodynia, heat and cold hyperalgesia. Furthermore, vincristine administration was also associated with an increase in oxidative stress and calcium levels. However, administration of Ocimum sanctum (100 and 200 mg/kg p.o. and its saponin rich fraction (100 and 200 mg/kg p.o. for 14 days significantly attenuated vincristine-induced neuropathic pain along with decrease in oxidative stress and calcium levels. It may be concluded that Ocimum sanctum has ameliorative potential in attenuating chemotherapy induced-painful neuropathic state, which may be attributed to decrease in oxidative stress and calcium levels. Furthermore, saponin rich fraction of Ocimum sanctum may be responsible for its noted beneficial effect in neuropathic pain in rats.

  7. The natural basil flavonoid nevadensin protects against induction of markers of hepatocarcinogenicity by methyleugenol in male F344 rat

    NARCIS (Netherlands)

    Alhusainy, W.; Williams, G.; Jeffrey, A.M.; Iatropoulos, M.J.; Taylor, S.; Adams, T.B.; Rietjens, I.


    The alkenylbenzene methyleugenol occurs naturally in a variety of spices and herbs, including basil, and their essential oils. At high dose levels methyleugenol induces hepatocarcinogenicity in rodents following bioactivation to 1'-sulfooxymethyleugenol which forms DNA adducts. This study

  8. Teor, rendimento e composição química do óleo essencial de manjericão sob doses de cama de frango Content, yield and chemical composition of the essential basil oil under chicken manure levels

    Directory of Open Access Journals (Sweden)

    José Magno Q Luz


    Full Text Available Óleo essencial de manjericão (Ocimum basilicum L. com alta concentração de linalol é valorizado no mercado internacional e amplamente usado nas indústrias de condimentos e cosméticos. Há poucas informações a respeito do cultivo de manjericão e, portanto o presente trabalho teve o objetivo de avaliar o teor, o rendimento e a qualidade de óleo essencial de genótipos de manjericão em função de níveis de adubação orgânica com cama de frango nas condições de inverno sob irrigação. O experimento foi conduzido na Fazenda Experimental do Glória, pertencente à Universidade Federal de Uberlândia. Foram testados cinco níveis de adubação, sendo 2; 4; 6; 8 e 10 kg de cama de frango por m². O delineamento experimental utilizado foi de blocos ao acaso em esquema fatorial 5 x 2, com quatro repetições. Foram semeados os genótipos Manjericão PI 197442-S3 (G1 e Manjericão NSL 6421-S3 (G2. O óleo essencial foi extraído por hidrodestilações com aparelho tipo Clevenger modificado. Avaliou-se a altura da planta; comprimento e largura de folha; relação comprimento/largura (C/L; teor e rendimento de óleo essencial, e teor de linalol no óleo essencial extraído de folhas e inflorescências frescas e secas. As doses de adubo influenciaram significativamente o teor de linalol do óleo essencial destilado a partir de parte aérea fresca e seca dos genótipos 1 e 2. As outras variáveis não apresentaram diferenças significativas.Basil (Ocimum basilicum L., essential oil with high linalool content, is appreciated in the international market and widely used in spice and cosmetics industries. There are few informations available for basil cultivation, and therefore, the aim of this work was to evaluate the content, yield and quality of the essential oil of basil genotypes depending on organic fertilizer levels in the winter and using irrigation. The experiment was carried out in the Universidade Federal de Uberlândia. Five

  9. Cama-de-frango em mono e policultivo de fáfia com cravo-de-defunto e manjericão Poultry manure in mono and intercrop of Brazilian ginseng with marigold and basil

    Directory of Open Access Journals (Sweden)

    Valdenise C Barboza


    os policultivos foram efetivos.This study was carried out in field of the Universidade Federal da Grande Dourados, in Dourados, Brazil, during the period from March 2005 to September 2006. The aim of the experiment was to evaluate Pfaffia glomerata (Spreng Pedersen yield under monocropping system or intercropped with Tagetes erecta L. and Ocimum basilicum L, in a Distroferric Red Latosol (sand loam Rhodic Oxisol, using semi-decomposed poultry manure (PM. The study objects were Brazilian ginseng (BG, marigold (M and basil (B under monocropping and the intercropping of two Brazilian ginseng, three marigold (BG2M3 and three basil (BG2B3 lines, all of them with or without semi-decomposed poultry manure (PM as fertilizer. Ten treatments were arranged in randomized blocks design, with four replications. Fresh and dry weight production from shoot of Brazilian ginseng were higher (13.22 t ha-1 and 4.39 t ha-1, respectively under monocropping, independently of the use of poultry manure. Nevertheless, none of experimental designs influenced the dry and fresh weight production or root number of Brazilian ginseng which produced average values of 10.02 and 2.07 t ha-1 and 417,916 roots ha-1, respectively. Root diameter was higher (23.5 mm under intercropping system with basil. Dry and fresh weight of marigold flowers were higher (14.28 t ha-1and 1.278 t ha-1, respectively when intercropped with Brazilian ginseng, but only fresh weight of the flowers was increased (14.17 t ha-1 by poultry manure application. Basil shoot production was higher (52.91 t ha-1 when intercropped, independently of the used species; however, they were not influenced by the use of poultry manure. Land equivalent ration (LER for the Brazilian ginseng intercropped with marigold was 2.15 under poultry manure application and 1.99 without it, and for the basil 2.44 under poultry manure application and 3.08 without it. Values higher than 1.0 indicate that the intercropping systems were effective.

  10. Determining the Threshold Value of Basil Yield Reduction and Evaluation of Water Uptake Models under Salinity Stress Condition


    M. Sarai Tabrizi; H. Babazadeh; M. Homaee; F. Kaveh Kaveh; M. Parsinejad


    Introduction: Several mathematical models are being used for assessing the plant response to the salinity of the root zone. The salinity of the soil and water resources is a major challenge for agricultural sector in Iran. Several mathematical models have been developed for plant responses to the salinity stress. However, these models are often applicable in particular conditions. The objectives of this study were to evaluate the threshold value of Basil yield reduction, modeling Basil respon...

  11. Chemical composition and antimicrobial properties of different basil essential oils chemotypes from Togo


    Koffi Koba; P.W. Poutouli; Christine Raynaud; Jean-Pierre Chaumont; Komla Sanda


    The aerial parts essential oils of Ocimum basilicum (Lamiaceae) from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS) and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; t-anethole type. The in vitro microbiological experiments revealed that only the methyleugenol and meth...

  12. Characterization of the Bacterial Community Naturally Present on Commercially Grown Basil Leaves: Evaluation of Sample Preparation Prior to Culture-Independent Techniques

    Directory of Open Access Journals (Sweden)

    Siele Ceuppens


    Full Text Available Fresh herbs such as basil constitute an important food commodity worldwide. Basil provides considerable culinary and health benefits, but has also been implicated in foodborne illnesses. The naturally occurring bacterial community on basil leaves is currently unknown, so the epiphytic bacterial community was investigated using the culture-independent techniques denaturing gradient gel electrophoresis (DGGE and next-generation sequencing (NGS. Sample preparation had a major influence on the results from DGGE and NGS: Novosphingobium was the dominant genus for three different basil batches obtained by maceration of basil leaves, while washing of the leaves yielded lower numbers but more variable dominant bacterial genera including Klebsiella, Pantoea, Flavobacterium, Sphingobacterium and Pseudomonas. During storage of basil, bacterial growth and shifts in the bacterial community were observed with DGGE and NGS. Spoilage was not associated with specific bacterial groups and presumably caused by physiological tissue deterioration and visual defects, rather than by bacterial growth.

  13. Calycomyza hyptidis Spencer (Diptera,Agromyzidae: descriptions, redescriptions and first record in Ocimum basilicum (Lamiaceae in Brazil

    Directory of Open Access Journals (Sweden)

    Viviane Rodrigues de Sousa


    Full Text Available Calycomyza hyptidis Spencer (Diptera, Agromyzidae: descriptions, redescriptions and first record in Ocimum basilicum (Lamiaceae in Brazil. All phases of the leafminer Calycomyza hyptidis Spencer are for the first time described, including the larva, puparium and adult female. Illustrations are presented for male and female terminalia, mine, larva and pupa. The species is first recorded in leaves of Ocimum basilicum L. (Lamiaceae in Brazil.

  14. Leaf sodium accumulation facilitates salt stress adaptation and preserves photosystem functionality in salt stressed Ocimum basilicum

    NARCIS (Netherlands)

    Mancarella, S.; Orsini, F.; Oosten, van M.J.; Sanoubar, R.; Stanghellini, C.; Kondo, S.; Gianquinto, G.; Maggio, A.


    In this study, plant growth, water relations, ABA levels, ion accumulation patterns and chlorophyll fluorescence were functionally linked to salt stress tolerance of two basil cultivars (Napoletano and Genovese) with different stress sensitivity levels. Plants were treated with salty water at 0,

  15. Longitudinal evaluation of Ocimum and other plants effects on the feeding behavioral response of mosquitoes (Diptera: Culicidae in the field in Tanzania

    Directory of Open Access Journals (Sweden)

    Tenu Filemoni


    Full Text Available Abstract Background The use of repellent materials from plants against nuisance insects is common with great potential to compliment existing malaria control programmes and this requires evaluation in the field. Ocimum plant species, Ocimum suave (Willd and O. kilimandscharicum (Guerke materials and their essential oils extracted by steam distillation were evaluated in the field and experimental huts for repellence, exophily and feeding inhibition effects against three mosquito species, Anopheles arabiensis (Patton, An. gambiae ss (Giles and Culex quinquefasciatus (Say. The protective effect of essential oils from Ocimum plants were compared with N, N-diethly-3- methylbenzamide (DEET, a standard synthetic repellent. Also, the protective effect of fumigation by burning of repellent plants; Ocimum suave, Ocimum kilimandscharicum, Azadirachta indica, Eucalyptus globules and Lantana camara were tested in experimental huts and selected local houses. Results In the field, protection by Ocimum plants from mosquito bites was high and there was small variation among different mosquito species. Protection efficiency was 93.4%, 91.98% and 89.75% for An. arabiensis while for Cx. quinquefaciatus it was 91.30%, 88.65% and 90.50% for DEET, Ocimum suave and O. kilimandscharicum respectively. In the experimental hut, deterrence induced by burning of Ocimum and other plants ranged from 73.1.0% to 81.9% for An. arabiensis and 56.5% to 67.8% for Cx. quinquefaciatus, while feeding inhibition was 61.1% to 100% for An. arabiensis and 50% to 100% for Cx. quinquefaciatus. Evaluations under field conditions confirmed high protective efficacy, enhanced feeding inhibition and house entry inhibition (Deterrence. Conclusion This study shows the potential of Ocimum suave and Ocimum kilimandscharicum crude extracts and whole plants of Ocimum suave, Ocimum kilimandscharicum, Azadirachta indica, Eucalyptus globules and Lantana camara for use in protecting against human biting

  16. Minimally invasive basilic vein transposition in the arm or forearm for autogenous haemodialysis access: A less morbid alternative to the conventional technique

    Directory of Open Access Journals (Sweden)

    Ankush Jairath


    Conclusion: Minimally invasive dissection of the basilic vein for vascular access transposition is a safe, reliable procedure with patency and functional outcomes comparable with those of conventional BVT.

  17. Analysis of the enzymatic formation of citral in the glands of sweet basil. (United States)

    Iijima, Yoko; Wang, Guodong; Fridman, Eyal; Pichersky, Eran


    Basil glands of the Sweet Dani cultivar contain high levels of citral, a mixture of geranial and its cis-isomer neral, as well as low levels of geraniol and nerol. We have previously reported the identification of a cDNA from Sweet Dani that encodes an enzyme responsible for the formation of geraniol from geranyl diphosphate in the glands, and that these glands cannot synthesize nerol directly from geranyl diphosphate. Here, we report the identification of two basil cDNAs encoding NADP+-dependent dehydrogenases that can use geraniol as the substrate. One cDNA, designated CAD1, represents a gene whose expression is highly specific to gland cells of all three basil cultivars examined, regardless of their citral content, and encodes an enzyme with high sequence similarity to known cinnamyl alcohol dehydrogenases (CADs). The enzyme encoded by CAD1 reversibly oxidizes geraniol to produce geranial (which reversibly isomerizes to neral via keto-enol tautomerization) at half the efficiency compared with its activity with cinnamyl alcohol. CAD1 does not use nerol and neral as substrates. A second cDNA, designated GEDH1, encodes an enzyme with sequence similarity to CAD1 that is capable of reversibly oxidizing geraniol and nerol in equal efficiency, and prolonged incubation of geraniol with GEDH1 in vitro produces not only geranial and neral, but also nerol. GEDH1 is also active, although at a lower efficiency, with cinnamyl alcohol. However, GEDH1 is expressed at low levels in glands of all cultivars compared with its expression in leaves. These and additional data presented indicate that basil glands may contain additional dehydrogenases capable of oxidizing geraniol.

  18. Different species of basil need different ammonium to nitrate ratio in hydroponics' system

    Directory of Open Access Journals (Sweden)



    Full Text Available Basil is a very important medicinal plant and culinary spice, and is marketed fresh, dried or frozen. In crop nutrition, nitrogen is essential for plant growth and as a macro-element, is part of the proteins’ structure and participates in the metabolic processes involved in the synthesis and energy transfer. It has been shown that a balance between ammonium and nitrate favors plant growth and that the degree of benefit varies among crops. This study was conducted to evaluate the growth of two varieties of basil in function of four nutrient solutions containing different NH4+/NO3- ratios. Results showed that different variety response differently to nutrient solution. Although the highest yield in both varieties (sweet and purple was obtained when fed by nutrient solution without ammonium but their response on quality indices were different due to nitrate ammonium ratio in nutrient solutions. The highest total phenol content of sweet and purple basil was 92 and 100 mg gallic acid equivalent per gram of dry weight respectively, while the highest antioxidant capacity was obtained in purple variety grown in nutrient solution 2 (NH4+:1/NO3:4 and the lowest value were related to sweet variety with the same nutrient solution. Moderate content of total nitrogen can be suitable for sweet variety while for purple variety nutrient solution with low amount of ammonium can be more suitable.

  19. Hepatoprotective effects of parsley, basil, and chicory aqueous extracts against dexamethasone-induced in experimental rats (United States)

    Soliman, Hanan A.; El-Desouky, Mohamed A.; Hozayen, Walaa G.; Ahmed, Rasha R.; Khaliefa, Amal K.


    Aim: The objective of this study is to investigate the hypoglycemic, hypolipidemic, and hepatoprotective effects of the aqueous extract of parsley, basil, and chicory whole plant in normal and dexamethasone (Dex) rats. Materials and Methods: 50 female albino rats were used in this study and divided into 5 groups (for each 10). Group (1) fed basal diet and maintained as negative control group. Group (2) received Dex in a dose of (0.1 mg/kg b. wt.). Groups 3, 4, and 5 were treated with Dex along with three different plant extracts of parsley, basil, and chicory (2 g/kg b. wt.), (400 mg/kg b. wt.), and (100 mg/kg b. wt.), respectively. Results: All these groups were treated given three times per week for 8 consecutive weeks. Dex-induced alterations in the levels of serum glucose, triglyceride, cholesterol, low-density lipoprotein-cholesterol levels and cardiovascular indices and serum alanine aminotransferase, aspartate aminotransferase and lactate dehydrogenase activities, liver thiobarbituric acid (TBARS) levels increased, while high-density lipoprotein-cholesterol, total protein, albumin, and liver glutathione (GSH) levels decreased. On the other hand, plant extracts succeeded to modulate these observed abnormalities resulting from Dex as indicated by the reduction of glucose, cholesterol, TBARS, and the pronounced improvement of the investigated biochemical and antioxidant parameters. Conclusions: It was concluded that probably, due to its antioxidant property, parsley, basil, and chicory extracts have hepatoprotective effects in Dex-induced in rats. PMID:27069727

  20. Comparison ofYield of TwelveBasilCultivarsinTwo Provinces:Isfahan and Mazandaran

    Directory of Open Access Journals (Sweden)

    Nahid Amoli


    Full Text Available Introduction: Basil(Ocimumbasilicum a diploid plant with48chromosomes. Basil isthe aromatic annual herbofthe Lamiaceae familyofleafy vegetablesandhas mentionedand originated inIndiaandIran. Basilhasiron, calcium, magnesium, potassiumandvitamins Aand B. More than 60 varietiesof basilhave been identifiedthathavegreenleavesandredto purple.The performance of15varietiesof basilin Mazandaran province were studied, genotypescollected fromSari(darkgreen withthe23.63 tha-1(fresh weight had thehighestyield. In comparison, 38the massbasil, withtwocultivars(Opal andKashkanyLulu, localpopulationsofmanyof the traits(e.g.,length and width ofleavesandfresh and dry weight showed superiority than cultivars. Incomparing the performance of38varietiesof basilinItaly, drymatter yieldper hectarerangedfrom1812 to6165kg ha-1thatthis wasmore attributestobegenetic aspects. Landraces ofbasilhavevaluabletraitssuch asdrought resistance, saltresistance, resistancetodisease, resistancetocoldandheat. In order to achieveoptimalpopulationpurple basil with high-performance inIsfahan andMazandaran, the present studywas conducted usingsomeof the populationinthese two provinces. Materials and Methods: The number of populations of purple basil wasstudied toselect superior genotypes according to the yield and adaptation to climatic conditions in two provinces at Agricultural Research Station Gharahil of Mazandaran and Kabootarabad of Isfahan. The experiment was conducted as a randomized complete block design with three replications with seeds collected from two areas of the province (a total of 12 varieties of basil during one year. Land preparationwas consisted ofplowanddiscperpendicular to each other(for crushinghunk and thenlevelingandplotsofland. Inprovinces, nitrogen, phosphorusandpotassiumfertilizerwas used based on soiltest.In this experiment,harvest time was4st. for every two region. Duringthe growing seasonweed controlwascarried outmechanically. Result and Discussions: In

  1. Radioprotective effects of ocimum flavonoids on leukocyte oxidants and antioxidants in oral cancer

    Energy Technology Data Exchange (ETDEWEB)

    Reshma, K [Department of Biochemistry, Kasturba Medical College, Mangalore (India); Rao, A V [Fr. Muller' s Medical College, Mangalore (India); Dinesh, M [Department of Oncology, Amritha Institute of Medical Sciences, Cochin (India); Vasudevan, D M [Dept. of Biochemistry, Amritha Institute of Medical Sciences, Cochin (India)


    Oxidants (NADPH oxidase and myeloperoxidase) and antioxidants (GSH, GSH peroxidase, SOD and glucose 6 phosphate dehydrogenase, that provides NADPH for antioxidants) were assayed in the neutrophils from oral cancer patients, in three stages viz, baseline samples, 15 days after radiation and 30 days following radiation. These samples were obtained from 2 groups of patients. Group A that received radiation alone and Group B that received radiation and ocimum flavonoids, a radioprotector. The results showed a significant fall in the SOD levels in the second follow up of group B. Glucose 6 phosphate dehydrogenase showed significant increase only in the first follow up of patients who received Ocimum flavonoids. Except for these findings all other parameters remained statistically nonsignificant. (author)

  2. Radioprotective effects of ocimum flavonoids on leukocyte oxidants and antioxidants in oral cancer

    International Nuclear Information System (INIS)

    Reshma, K.; Rao, A.V.; Dinesh, M.; Vasudevan, D.M.


    Oxidants (NADPH oxidase and myeloperoxidase) and antioxidants (GSH, GSH peroxidase, SOD and glucose 6 phosphate dehydrogenase, that provides NADPH for antioxidants) were assayed in the neutrophils from oral cancer patients, in three stages viz, baseline samples, 15 days after radiation and 30 days following radiation. These samples were obtained from 2 groups of patients. Group A that received radiation alone and Group B that received radiation and ocimum flavonoids, a radioprotector. The results showed a significant fall in the SOD levels in the second follow up of group B. Glucose 6 phosphate dehydrogenase showed significant increase only in the first follow up of patients who received Ocimum flavonoids. Except for these findings all other parameters remained statistically nonsignificant. (author)

  3. Quantitative and Qualitative Analysis of Phenolic and Flavonoid Content in Moringa oleifera Lam and Ocimum tenuiflorum L. (United States)

    Sankhalkar, Sangeeta; Vernekar, Vrunda


    Number of secondary compounds is produced by plants as natural antioxidants. Moringa oleifera Lam. and Ocimum tenuiflorum L. are known for their wide applications in food and pharmaceutical industry. To compare phenolic and flavonoid content in M. oleifera Lam and O. tenuiflorum L. by quantitative and qualitative analysis. Phenolic and flavonoid content were studied spectrophotometrically and by paper chromatography in M. oleifera Lam. and O. tenuiflorum L. Higher phenolic and flavonoid content were observed in Moringa leaf and flower. Ocimum flower showed higher phenolic content and low flavonoid in comparison to Moringa. Flavonoids such as biflavonyl, flavones, glycosylflavones, and kaempferol were identified by paper chromatography. Phytochemical analysis for flavonoid, tannins, saponins, alkaloids, reducing sugars, and anthraquinones were tested positive for Moringa and Ocimum leaf as well as flower. In the present study higher phenolic and flavonoid content, indicated the natural antioxidant nature of Moringa and Ocimum signifying their medicinal importance. Moringa oleifera Lam. and Ocimum tenuiflorum L. are widly grown in India and are known for their medicinal properties. Number of secondary metabolites like phenolics and flavonoids are known to be present in both the plants. The present study was conducted with an objective to qualitatively and quantitatively compare the phenolics and flavanoids in these two medicinally important plants.Quantitation of total phenolics and flavanoids was done by spectrophotometrically while qualitative analysis was perfomed by paper chromatography and by phytochemical tests. Our results have shown higher phenolics and flavanoid content in Moringa leaf and flower. However, higher phenolic content was absent in Ocimum flower compared to that of Moringa. Phytochemical analysis of various metabolites such as flavonoids, tanins, sapponins, alkaloids, anthraquinones revealed that both the plant extracts were rich sources of

  4. Activity of Ocimum basilicum, Ocimum canum, and Cymbopogon citratus essential oils against Plasmodium falciparum and mature-stage larvae of Anopheles funestus s.s.

    Directory of Open Access Journals (Sweden)

    Akono Ntonga Patrick


    Full Text Available The biological activities of essential oils from three plants grown in Cameroon: Ocimum basilicum, Ocimum canum, and Cymbopogon citratus were tested against Plasmodium falciparum and mature-stage larvae of Anopheles funestus. Gas chromatography and gas chromatography – mass spectrometry analyses showed that the main compounds are geranial, 1,8-cineole and linalool in C. citratus, O. canum and O. basilicum, respectively. Larvicidal tests carried out according to the protocol recommended by the World Health Organization showed that the essential oil of leaves of C. citratus is the most active against larvae of An. funestus (LC50 values = 35.5 ppm and 34.6 ppm, respectively, for larval stages III and IV after 6 h of exposure. Besides, the in vitro anti-plasmodial activity evaluated by the radioisotopic method showed that the C. citratus oil is the most active against P. falciparum, with an IC50 value of 4.2 ± 0.5 μg/mL compared with O. canum (20.6 ± 3.4 μg/mL and O. basilicum (21 ± 4.6 μg/mL. These essential oils can be recommended for the development of natural biocides for fighting the larvae of malaria vectors and for the isolation of natural products with anti-malarial activity.

  5. Antifungal activity of the basil (Ocimmum basilicum L. extract on Penicillium aurantiogriseum, P. glabrum, P. chrysogenum, and P. brevicompactum

    Directory of Open Access Journals (Sweden)

    Kocić-Tanackov Sunčica D.


    Full Text Available This study was aimed at investigating the antifungal potential of basil (Ocimmum basilicum L. extract against toxin-producing Penicillium spp. (P. aurantiogriseum, P. glabrum, P. chrysogenum, and P. brevicompactum isolated from food. The basil extract composition was determined by the GC-MS method. The major component identified in the extract was estragole (86.72%. The determination of the antifungal activity of basil extract on Penicillium spp. was performed using the agar plate method. Basil extract reduced the growth of Penicillium spp. at all applied concentration levels (0.16, 0.35, 0.70, and 1.50 mL/100mL with the colony growth inhibition from 3.6 (for P. glabrum to 100% (for P. chrysogenum. The highest sensitivity showed P. chrysogenum, where the growth was completely inhibited at the basil extract concentration of 1.50 mL/100mL. The growth of other Penicillium spp. was partially inhibited with the colony growth inhibition of 63.4 % (P. brevicompactum, 67.5% (P. aurantiogriseum, and 71.7% (P. glabrum. Higher concentrations (0.70 and 1.50 mL/100mL reduced the growth of the aerial mycelium of all tested Penicillium species. In addition, at the same extract concentrations, the examination of microscopic preparation showed the deformation of hyphae with the frequent occurrence of fragmentations and thickenings, occurrence of irregular vesicle, frequently without metulae and phialides, enlarged metulae. The results obtained in this investigation point to the possibility of using basil extract for the antifungal food protection. [Projekat Ministarstva nauke Republike Srbije, br. TR-31017

  6. Enrichment, development, and assessment of Indian basil oil based antiseptic cream formulation utilizing hydrophilic-lipophilic balance approach. (United States)

    Yadav, Narayan Prasad; Meher, Jaya Gopal; Pandey, Neelam; Luqman, Suaib; Yadav, Kuldeep Singh; Chanda, Debabrata


    The present work was aimed to develop an antiseptic cream formulation of Indian basil oil utilizing hydrophilic-lipophilic balance approach. In order to determine the required-hydrophilic lipophilic balance (rHLB) of basil oil, emulsions of basil oil were prepared by phase inversion temperature technique using water, Tween 80, and Span 80. Formulated emulsions were assessed for creaming (BE9; 9.8, BE10; 10.2), droplet size (BE18; 3.22 ± 0.09 μ m), and turbidity (BE18; 86.12 ± 2.1%). To ensure correctness of the applied methodology, rHLB of light liquid paraffin was also determined. After rHLB determination, basil oil creams were prepared with two different combinations of surfactants, namely, GMS : Tween 80 (1 : 3.45) and SLS : GMS (1 : 3.68), and evaluated for in vitro antimicrobial activity, skin irritation test, viscosity and consistency. The rHLB of basil oil and light liquid paraffin were found to be 13.36 ± 0.36 and 11.5 ± 0.35, respectively. Viscosity, and consistency parameters of cream was found to be consistent over 90 days. Cream formulations showed net zone of growth inhibition in the range of 5.0-11.3 mm against bacteria and 4.3-7.6 mm against fungi. Primary irritation index was found to be between 0.38 and1.05. Conclusively stable, consistent, non-irritant, enriched antiseptic basil oil cream formulations were developed utilizing HLB approach.

  7. ‘Norine’, a cinnamon-linalool hybrid cultivar of basil

    Directory of Open Access Journals (Sweden)

    Arie Fitzgerald Blank


    Full Text Available 'Norine’ is a hybrid cultivar of basil, adapted to the Northeastern Brazil, which is derived from the cultivars ‘Cinnamon’ and ‘Maria Bonita’. It has essential oil content of 2.91% and yield of 2.37 mL plant-1. The main chemical compounds of the essential oil are (E-methyl cinnamate (41.93 % and linalool (34.92 %. ‘Norine’ is characterized by presenting upright growth habit, rounded crown, mean height of 55 cm, mean crown diameter of 59 cm, mean leaf length of 8.4 cm, and mean leaf width of 4.5 cm.

  8. [Recontextualization of nursing clinical simulation based on Basil Bernstein: semiology of pedagogical practice]. (United States)

    dos Santos, Mateus Casanova; Leite, Maria Cecília Lorea; Heck, Rita Maria


    This is an investigative case study with descriptive and participative character, based on an educational experience with the Simulation in Nursing learning trigger. It was carried out during the second semester of the first cycle of Faculdade de Enfermagem (FEN), Universidade Federal de Pelotas (UFPel). The aim is to study the recontextualization of pedagogic practice of simulation-based theories developed by Basil Bernstein, an education sociologist, and to contribute with the improvement process of education planning, and especially the evaluation of learning trigger. The research shows that Bernstein's theory is a powerful tool semiotic pedagogical of practices which contributes to the planning and analysis of curricular educational device.

  9. Adopting adequate leaching requirement for practical response models of basil to salinity (United States)

    Babazadeh, Hossein; Tabrizi, Mahdi Sarai; Darvishi, Hossein Hassanpour


    Several mathematical models are being used for assessing plant response to salinity of the root zone. Objectives of this study included quantifying the yield salinity threshold value of basil plants to irrigation water salinity and investigating the possibilities of using irrigation water salinity instead of saturated extract salinity in the available mathematical models for estimating yield. To achieve the above objectives, an extensive greenhouse experiment was conducted with 13 irrigation water salinity levels, namely 1.175 dS m-1 (control treatment) and 1.8 to 10 dS m-1. The result indicated that, among these models, the modified discount model (one of the most famous root water uptake model which is based on statistics) produced more accurate results in simulating the basil yield reduction function using irrigation water salinities. Overall the statistical model of Steppuhn et al. on the modified discount model and the math-empirical model of van Genuchten and Hoffman provided the best results. In general, all of the statistical models produced very similar results and their results were better than math-empirical models. It was also concluded that if enough leaching was present, there was no significant difference between the soil salinity saturated extract models and the models using irrigation water salinity.

  10. Can Ocimum basilicum relieve chronic unpredictable mild stress-induced depression in mice? (United States)

    Ayuob, Nasra Naeim; Firgany, Alaa El-Din L; El-Mansy, Ahmed A; Ali, Soad


    Depression is one of the important world-wide health problems. This study aimed to assess the ameliorative effect of Ocimum basilicum (OB) essential oil on the behavioral, biochemical and histopathological changes resulted from exposure to chronic unpredictable mild stress (CUMS). It also aimed to investigate the underlying mechanism in an animal model of depression. Forty male Swiss albino mice were divided into four groups (n=10): control, CUMS (exposed to CUMS for 4weeks), CUMS plus fluoxetine, and CUMS plus OB. At the end of the experiment, behavioral changes, serum corticosterone level, protein and gene expressions of brain derived neurotropic factor (BDNF) and glucocorticoid receptors (GR) in the hippocampus was all assessed. Immunoexpression of surface makers of glial fibrillary acidic protein (GFAP), Ki67, Caspase-3, BDNF and GR in the hippocampus were estimated. Data were analyzed by using the statistical package for the social sciences (SPSS). OB alleviated both behavioral and biochemical changes recorded in mice after exposure to CUMS. It also reduced neuronal atrophy observed in the hippocampal region III cornu ammonis (CA3) and dentate gyrus and restored back astrocyte number. OB decreased apoptosis in both neurons and glial cells and increased neurogenesis in the dentate gyrus in a pattern comparable to that of fluoxetine. Increased BDNF and GR gene and protein expressions seems to be behind the antidepressant-like effect of OB. Ocimum basilicum ameliorates the changes induced after exposure to the chronic stress. Assessing Ocimum basilicum efficacy on human as antidepressant is recommended in further studies. Copyright © 2017. Published by Elsevier Inc.

  11. "Antimicrobial and antiproliferative activity of essential oil, aqueous and ethanolic extracts of Ocimum micranthum Willd leaves". (United States)

    Caamal-Herrera, Isabel O; Carrillo-Cocom, Leydi M; Escalante-Réndiz, Diana Y; Aráiz-Hernández, Diana; Azamar-Barrios, José A


    Ocimum micranthum Willd is a plant used in traditional medicine practiced in the region of the Yucatan peninsula. In particular, it is used for the treatment of cutaneous infections and wound healing, however there are currently no existing scientific studies that support these applications. The aim of the present study was to evaluate the antimicrobial and the in vitro proliferative activity (on healthy mammalian cell lines) of the essential oil and extracts (aqueous and ethanolic) of this plant. The minimal inhibitory concentration (MIC) of essential oil and aqueous and ethanolic extracts of Ocimum micranthum leaves against Staphylococcus aureus, Bacillus subtilis, Pseudomonas aeruginosa and Candida albicans was determined using the microdilution technique. The in vitro proliferative activity of human fibroblast (hFB) and Chinese hamster ovary (CHO-K1) cells treated with these extracts was evaluated using the MTT test. The hFB cell line was also evaluated using Trypan Blue assay. Candida albicans was more susceptible to the ethanolic extract and the aqueous extract (MIC value of 5 μL/mL and 80 μL/mL respectively). In the case of Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa, the MIC of the aqueous and ethanolic extract was 125 μL/mL. The aqueous extract showed a significant (p essential oil and extracts of Ocimum micranthum leaves are sufficient to cause an antiproliferative effect on the hFB cell line but do not produce an antimicrobial effect against the microorganisms evaluated. More studies are necessary to improve understanding of the mechanism of action of the compounds implicated in the bioactivities shown by the crude extracts.

  12. Effects of antibiotic growth promoter, probiotic and basil essential oil supplementation on the intestinal microflora of broiler chickens

    Directory of Open Access Journals (Sweden)



    Full Text Available Effects of the probiotic ‘Protexin', basil essential oil and the antibiotic growth promoter ‘Avilamycin' were studied on the ileum microbial flora of broilers when these substances are used as broiler feed additives. A total of six hundred Arian broilers were divided into 6 treatment groups, with 4 replicates of 25 birds. Treatments have been performed with a plant essential oil at 3 levels (200, 400 and 600 ppm, the probiotic ‘Protexin' (150 ppm, the antibiotic ‘Avilamycin' (150 ppm and a control group with no additives. Birds in different treatments received the same diets during the experimental period. The results showed that the probiotic treatment significantly decreased the total bacteria counts (P0.05. The lowest and highest lactic acid bacteria in ileum were obtained in the control group and in birds receiving 400 ppm basil essential oil, respectively. Moreover, addition of 600 ppm of basil essential oil into diet decreased the number of E. coli colonies as compared to other treatments (P< 0.05. It could be speculated that the basil essential oil and ‘Protexin' could replace the antibiotics, which have been banned to use as growth promoter in animal feeds.

  13. Determination and risk assessment of naturally occurring genotoxic and carcinogenic alkenylbenzenes in basil-containing sauce of pesto

    NARCIS (Netherlands)

    Al-Malahmeh, Amer J.; Al-Ajlouni, Abdalmajeed M.; Wesseling, Sebas; Vervoort, Jacques; Rietjens, Ivonne M.C.M.


    A risk assessment of basil-based pesto sauces containing methyleugenol and related alkenylbenzenes was performed based on their levels detected in a series of pesto sauces available on the Dutch market. The estimated daily intake (EDI) values of alkenylbenzenes as a result of consumption of the

  14. Diverse Geological Applications For Basil: A 2d Finite-deformation Computational Algorithm (United States)

    Houseman, Gregory A.; Barr, Terence D.; Evans, Lynn

    Geological processes are often characterised by large finite-deformation continuum strains, on the order of 100% or greater. Microstructural processes cause deformation that may be represented by a viscous constitutive mechanism, with viscosity that may depend on temperature, pressure, or strain-rate. We have developed an effective com- putational algorithm for the evaluation of 2D deformation fields produced by Newto- nian or non-Newtonian viscous flow. With the implementation of this algorithm as a computer program, Basil, we have applied it to a range of diverse applications in Earth Sciences. Viscous flow fields in 2D may be defined for the thin-sheet case or, using a velocity-pressure formulation, for the plane-strain case. Flow fields are represented using 2D triangular elements with quadratic interpolation for velocity components and linear for pressure. The main matrix equation is solved by an efficient and compact conjugate gradient algorithm with iteration for non-Newtonian viscosity. Regular grids may be used, or grids based on a random distribution of points. Definition of the prob- lem requires that velocities, tractions, or some combination of the two, are specified on all external boundary nodes. Compliant boundaries may also be defined, based on the idea that traction is opposed to and proportional to boundary displacement rate. In- ternal boundary segments, allowing fault-like displacements within a viscous medium have also been developed, and we find that the computed displacement field around the fault tip is accurately represented for Newtonian and non-Newtonian viscosities, in spite of the stress singularity at the fault tip. Basil has been applied by us and colleagues to problems that include: thin sheet calculations of continental collision, Rayleigh-Taylor instability of the continental mantle lithosphere, deformation fields around fault terminations at the outcrop scale, stress and deformation fields in and around porphyroblasts, and

  15. Artificial LED lighting enhances growth characteristics and total phenolic content of Ocimum basilicum, but variably affects transplant success

    NARCIS (Netherlands)

    Bantis, Filippos; Ouzounis, Theoharis; Radoglou, Kalliopi


    The morphological and phytochemical characteristics of two Ocimum basilicum cultivars (Lettuce Leaf, and Red Rubin-mountain Athos hybrid) under artificial lighting were investigated. Four LED light treatments [AP673L (high red and high red:far-red), G2 (high red and low red:far-red), AP67

  16. In vitro comparative effect of extracts of the seeds of Embelia rowlandii

    African Journals Online (AJOL)



    Oct 16, 2012 ... This traditional treatment is based on eating the seeds each time one suffers from ... using a grinding machine. The powder was sieved ..... Anthelmintic activity of essential oil of Ocimum gratissimum L. and euguenol against ...

  17. Research Paper ISSN 0189-6016©2008

    African Journals Online (AJOL)

    Prof. Adewunmi

    ) of 13 populations of different silvicultural zones ... The present work reports the antimicrobial activity of the essential oil of Ocimum gratissimum L., and the chemical ..... 'Some Medicinal Forest Plants of Africa and Latin America.' 7. Harjula, H.

  18. anti-inflammatory and analgesic activities: chemical constituents of ...

    African Journals Online (AJOL)



  19. Physiological seed quality of varieties of Ocimum produced under conditions of Valle del Cauca, Colombia

    Directory of Open Access Journals (Sweden)

    Leila Aceneth Durán Gaviria


    Full Text Available The genus Ocimum with over 150 species is characterized by high morphological variability and Chemotypes of great value in the industries of perfumery, cosmetics, food and pharmaceutical features. In order to evaluate the physiological quality of the seeds, in the Experimental Center and the Laboratory of Plant Physiology at the National University of Colombia at Palmira, germination and viability tests were performed with 2,3,5 triphenyl tetrazolium, TTZ. In trials, using a factorial design with five varieties of seeds, three treatments and three replications, the effect of imbibing the seeds for five minutes in Potassium nitrate 0.2% KNO3 and gibberellic acid GA3 250 ppm and 500 ppm respectively as first irrigation and a control (water was evaluated. The results showed that the seeds from the species O. selloi had the highest percentage (90% of viability in TTZ and germination (46.2%. The seeds soaked in 0.2% KNO3 showed the highest values of seed germination in three of the five varieties tested. The best responses were obtained with germination seeds O.selloi species (70% and O. micranthum (58%, followed by Ocimum sp. (26%. The results showed the presence of varying levels of latency, which was partially overcome by the application of potassium nitrate (KNO 3 0.2%.

  20. Toxicological Study of Ocimum sanctum Linn Leaves: Hematological, Biochemical, and Histopathological Studies

    Directory of Open Access Journals (Sweden)

    M. K. Gautam


    Full Text Available The present study was aimed to study the acute and subacute toxicity studies with orally administered 50% ethanolic leaves extract of Ocimum sanctum Linn (OSE. In acute toxicity tests, four groups of mice (n=6/group/sex were orally treated with doses of 200, 600, and 2000 mg/kg, and general behavior, adverse effects, and mortality were recorded for up to 14 days. In subacute toxicity study, rats received OSE by gavage at the doses of 200, 400, and 800 mg/kg/day (n=6/group/sex for 28 days, and biochemical, hematological, and histopathological changes in tissues (liver, kidney, spleen, heart, and testis/ovary were determined. OSE did not produce any hazardous symptoms or death and CNS and ANS toxicities in the acute toxicity test. Subacute treatment with OSE did not show any change in body weight, food and water consumption, and hematological and biochemical profiles. In addition, no change was observed both in macroscopic and microscopic aspects of vital organs in rats. Our result showed that Ocimum sanctum extract could be safe for human use.

  1. Mosquitocidal and water purification properties of Ocimum sanctum and Phyllanthus emblica

    Directory of Open Access Journals (Sweden)

    Kadarkarai Murugan


    Full Text Available Ocimum sanctum was tested for its larvicidal and water sedimentation properties; the fruit ethanol and methanol extracts of Phyllanthus emblica were tested for phytochemical, larvicidal, oviposition-deterrent and ovicidal activities. Results emphasized that plant extracts have high toxicity against the egg and larvae of the malarial vector Anopheles stephensi and also have water sedimentation properties. LC50 of Phyllanthus emblica against Anopheles stephensi larvae ranged from 33.08 ppm to 81.26 ppm and from 23.44 to 54.19 ppm for ethanol and methanol extracts, respectively. Phyllanthus emblica also showed excellent ovipositional deterrent and ovicidal activities. The oviposition activity index value of ethanol and methanol extracts of Phyllanthus emblica at 500 ppm were -0.80 and -0.92, respectively. Ocimum sanctum includes both insecticidal secondary compounds, amino acids (glycine, lysine, vitamin C and other substances, that make treated water suitable for human consumption. Water quality parameters such as color, turbidity and pH were analyzed in the water samples (pre-treatment and post-treatment of plant extracts taken from the breeding sites of mosquitoes. Hence, the plant product can be used as both mosquitocidal and water purifier.

  2. Motifs et manifestations de l’amour de l’homme pour Dieu et l’amour du prochain selon Saint Basile le Grand

    Directory of Open Access Journals (Sweden)

    Ernest Janczyk


    Full Text Available This article addresses the issue of the motivation of the fundamental order of love for God and the neighbour which Saint Basil the Great used in his doctrine. Based on an analysis of the texts of Saint Basil, this article demonstrates the intimate relationship that should exist between the love for God and the love for man. The ideal of this relationship is represented, according to the analysis, by Jesus Christ, the only Saviour of the world.

  3. and Gongronema latifolium

    African Journals Online (AJOL)



    Dec 21, 2010 ... The effect of fertilizer treatment on the antimicrobial activity of the leaves of Ocimum gratissimum (L.) and Gongronema latifolium (Benth) was investigated. Cultivated O. gratissimum (L) and G. latifolium were applied with NPK (15:15:15) fertilizer at 100, 200, 300, 400 and 500 kg/ha treatment levels in.

  4. The Impact of Location and Growing Medium on Harvest Yield and Flavor of Basil and Squash Microgreens (United States)

    Leal, J.; Ventura, C. J.


    The purpose of this experiment is to discover the most efficient, feasible way to produce a high yield of flavorful microgreens within the best growing medium and building location at the Stanford Educational Farm. In recent years, microgreens, young, small edible greens utilized as flavor garnishes for fine dining, have evolved into an immensely profitable market that will continue to expand and prosper. To capitalize on such opportunities, the primary metrics focused upon are harvest yield and flavor of basil and squash microgreens, as they develop in different concentrations of quick root and compost while located in either a greenhouse or lath house. It was hypothesized that if basil and squash microgreens were grown in a mixture of 50% compost and 50% quick root in the greenhouse, then they would produce the greatest harvest yield and maximum amount of flavor. The general experimental protocol includes monitoring the growth of the microgreens, then harvesting directly after the first true leaves begin to emerge. Upon harvest, each set of microgreens are separated into different clear glass jars to place on a small scale for weighing to determine the yield and tasting the leaves to analyze the flavor content. The highest yield of basil (63 grams) developed in a tray of 100% quick root in the lath house, while the greatest yield of squash (51 grams) succeeded in 100% quick root in the greenhouse. Overall however, the basil grew fastest in the greenhouse but tasted stronger in the lath house. Additionally, because the harvest yield and flavor results were so poor in all other locations and growing mediums for squash during the first trial, it cannot be considered a viable microgreen. In the future, more trials should be conducted for greater numbers of trays of microgreens to collect more data. The nutritional value of microgreens should also be explored further to obtain a holistic approach to the value of these plants from seed to harvest to consumption.

  5. Thyme and basil essential oils included in edible coatings as a natural preserving method of oilseed kernels. (United States)

    Riveros, Cecilia G; Nepote, Valeria; Grosso, Nelson R


    Sunflower seeds are susceptible to developing rancidity and off-flavours through lipid oxidation. Edible coatings and essential oils have proven antioxidant properties in different food products. The purpose of this study was to evaluate the combined effect of using an edible coating and thyme and basil essential oils to preserve the chemical and sensory quality parameters of roasted sunflower seeds during storage. 50% DPPH inhibitory concentration (IC50) values of 0.278 and 0.0997 µg mL(-1) were observed for thyme and basil, respectively. On storage day 40, peroxide values were 80.68, 70.28, 68.43, 49.31 and 33.87 mEq O2 kg(-1) in roasted sunflower seeds (RS), roasted sunflower seeds coated with carboxymethyl cellulose (CMC) (RS-CMC), roasted sunflower seeds coated with CMC added with basil (RS-CMC-A), thyme (RS-CMC-T) and butylated hydroxytoluene (RS-CMC-BHT), respectively. RS-CMC-T and RS-CMC-BHT presented the lowest peroxide values, conjugated dienes and p-anisidine values during storage. RS-CMC-BHT, RS-CMC-T, and RS-CMC-A showed the lowest oxidized and cardboard flavour intensity ratings. On storage day 40, roasted sunflower flavour intensity ratings were higher in RS-CMC-T and RS-CMC-A. Thyme and basil essential oils added to the CMC coating improved the sensory stability of this product during storage, but only thyme essential oil increased their chemical stability. © 2015 Society of Chemical Industry.

  6. Investigating the effect of aqueous extracts of basil and savory on antioxidant activity, microbial and sensory properties of probiotic yogurt. (United States)

    Mosiyani, Zohreh Ghaleh; Pourahmad, Rezvan; Eshaghi, Mohammad Reza


    The low viability of probiotics causes the short shelf life of fermented products. Therefore compounds which prolong the viability of probiotic bacteria can increase or at least maintain the health- benefiting properties of these products. On the other hand, the addition of antioxidants is one of the methods to increase the shelf life of food products which has recently become more prevalent. In this respect, herbal extracts which are a good source of antioxidants can be appropriate alternative. The aim of this study was  to evaluate the effect of adding basil and savory extracts on antioxidant activity, and on the microbial and organoleptic characteristics of probiotic yogurt. The effect of adding basil extract (8% and 10%) and savory extract (6% and 8%) separately to low fat yogurt (1.5% fat) containing Lactobacillus paracasei subsp. paracasei was investigated. The samples were stored at 4°C. The viability of Lactobacillus paracasei subsp. paracasei, antioxidant activ- ity and sensory properties of probiotic yogurt were evaluated on the 1st, 7th, 14th and 21st days. Basil and savory extracts significantly increased the viability of probiotic bacteria (p 0.05). During storage, there was no significant difference between the organoleptic scores of the samples (p > 0.05), but the taste score did increase significantly (p yogurt.

  7. Mineral constituents of medicinally important herbs mentha arvensis and ocimum basilicum

    International Nuclear Information System (INIS)

    Sahito, S.; Kazi, G.H.; Kazi, T.; Hafeez-u-Raman Shaikh; Memon, A.N.


    The role of elements particularly trace elements in health and disease are now well established. In this paper we investigate the presence of various elements in very common herbs Mentha arvensis (Mint, vern. Podina) and ocimum basilicum(vern Niazboo or Tulsi). Economically the both herbs have great importance as the source of volatile aromatic oils, medicines. Medicinal drugs like menthol is derived from Mentha arvensis, which is useful in cough and diarrhea. The samples of both plants were collected from surrounding of Hyderabad and vouchers specimens were prepared following the standard Herbarium techniques. The dried parts of each plant were digested with nitric acid and hydrogen peroxide and analysed by atomic absorption spectrophotometer technique using air acetylene flame to estimate various metals present in both herbs. (author)

  8. Mineral constituents of medicinally important herbs mentha arvensis and ocimum basilicum

    Energy Technology Data Exchange (ETDEWEB)

    Sahito, S; Kazi, G H; Kazi, T [University of Sindh, Jamshoro (Pakistan). Centre of Excellence in Analytical Chemistry; Shar, G Q [Liaquat Univ. of Health and Sciences, Jamshoro (Pakistan); Shaikh, Hafeez-u-Raman [University of Sindh, Jamshoro (Pakistan). Inst. of Biochemistry; Memon, A N [University of Sindh, Jamshoro (Pakistan). Dept. of Botany


    The role of elements particularly trace elements in health and disease are now well established. In this paper we investigate the presence of various elements in very common herbs Mentha arvensis (Mint, vern. Podina) and ocimum basilicum(vern Niazboo or Tulsi). Economically the both herbs have great importance as the source of volatile aromatic oils, medicines. Medicinal drugs like menthol is derived from Mentha arvensis, which is useful in cough and diarrhea. The samples of both plants were collected from surrounding of Hyderabad and vouchers specimens were prepared following the standard Herbarium techniques. The dried parts of each plant were digested with nitric acid and hydrogen peroxide and analysed by atomic absorption spectrophotometer technique using air acetylene flame to estimate various metals present in both herbs. (author)

  9. Extracellular biosynthesis of gold and silver nanoparticles using Krishna tulsi ( Ocimum sanctum) leaf (United States)

    Philip, Daizy; Unni, C.


    Aqueous extract of Ocimum sanctum leaf is used as reducing agent for the environmentally friendly synthesis of gold and silver nanoparticles. The nanoparticles were characterized using UV-vis, transmission electron microscopy (TEM), X-ray diffraction (XRD) and FTIR analysis. These methods allow the synthesis of hexagonal gold nanoparticles having size ∼30 nm showing two surface plasmon resonance (SPR) bands by changing the relative concentration of HAuCl 4 and the extract. Broadening of SPR is observed at larger quantities of the extract possibly due to biosorption of gold ions. Silver nanoparticles with size in the range 10-20 nm having symmetric SPR band centered around 409 nm are obtained for the colloid synthesized at room temperature at a pH of 8. Crystallinity of the nanoparticles is confirmed from the XRD pattern. Biomolecules responsible for capping are different in gold and silver nanoparticles as evidenced by the FTIR spectra.

  10. The Effect of Mechanical Wounding on the Composition of Essential Oil from Ocimum Minimum L. Leaves

    Directory of Open Access Journals (Sweden)

    S. Grant Wyllie


    Full Text Available The effect of mechanical damage on the composition of the essential oil obtained from eugenol-rich Ocimum minimum leaves was determined over 48 hours. Changes in the levels of five oil-constituents were detected in the first post-wounding day but only one of those components (camphor exhibited the same behaviour the day after. The levels of eugenol (-4.8% and linalool (+2.5% were affected the most by the wounding process. Principal component analysis (PCA showed the post-wounding response to be independent from the pre-wounding levels of the particular compounds expressing the response and from the overall leaf oil-composition.

  11. Biosynthesis of silver nanoparticles using Ocimum sanctum (Tulsi) leaf extract and screening its antimicrobial activity (United States)

    Singhal, Garima; Bhavesh, Riju; Kasariya, Kunal; Sharma, Ashish Ranjan; Singh, Rajendra Pal


    Development of green nanotechnology is generating interest of researchers toward ecofriendly biosynthesis of nanoparticles. In this study, biosynthesis of stable silver nanoparticles was done using Tulsi ( Ocimum sanctum) leaf extract. These biosynthesized nanoparticles were characterized with the help of UV-vis spectrophotometer, Atomic Absorption Spectroscopy (AAS), Dynamic light scattering (DLS), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), and Transmission electron microscopy (TEM). Stability of bioreduced silver nanoparticles was analyzed using UV-vis absorption spectra, and their antimicrobial activity was screened against both gram-negative and gram-positive microorganisms. It was observed that O. sanctum leaf extract can reduce silver ions into silver nanoparticles within 8 min of reaction time. Thus, this method can be used for rapid and ecofriendly biosynthesis of stable silver nanoparticles of size range 4-30 nm possessing antimicrobial activity suggesting their possible application in medical industry.

  12. Biosynthesis of silver nanoparticles using Ocimum sanctum (Tulsi) leaf extract and screening its antimicrobial activity

    International Nuclear Information System (INIS)

    Singhal, Garima; Bhavesh, Riju; Kasariya, Kunal; Sharma, Ashish Ranjan; Singh, Rajendra Pal


    Development of green nanotechnology is generating interest of researchers toward ecofriendly biosynthesis of nanoparticles. In this study, biosynthesis of stable silver nanoparticles was done using Tulsi (Ocimum sanctum) leaf extract. These biosynthesized nanoparticles were characterized with the help of UV–vis spectrophotometer, Atomic Absorption Spectroscopy (AAS), Dynamic light scattering (DLS), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), and Transmission electron microscopy (TEM). Stability of bioreduced silver nanoparticles was analyzed using UV–vis absorption spectra, and their antimicrobial activity was screened against both gram-negative and gram-positive microorganisms. It was observed that O. sanctum leaf extract can reduce silver ions into silver nanoparticles within 8 min of reaction time. Thus, this method can be used for rapid and ecofriendly biosynthesis of stable silver nanoparticles of size range 4–30 nm possessing antimicrobial activity suggesting their possible application in medical industry.

  13. Relaxant effects of Ocimum basilicum on guinea pig tracheal chains and its possible mechanism(s

    Directory of Open Access Journals (Sweden)

    Mohammad Hossein Boskabady


    Full Text Available Therapeutic effects of Ocimum basilicum on respiratory diseases especially dyspnea have been reported in Iranian ancient medical books. In the present study, the relaxant effects of macerated and soxhlet extracts of this plant on tracheal chains of guinea pigs were evaluated. The relaxant effects of 4 cumulative concentrations of macerated and soxhlet extracts (0.25, 0.5, 0.75 and 1.0 W/V in comparison with saline as negative control and 4 cumulative concentrations of theophylline (0.25, 0.5, 0.75, and 1.0 mM as positive control were examined on precontracted tracheal chains of two groups of 6 guinea pig by 60 mM KCl (group 1 and 10 µM methacholine (group 2. Decrease in contractile tone of tracheal chains was considered as relaxant effect. In group 1 experiments only the last two higher concentrations of theophylline showed significant relaxant effect compared to that of saline (p<0.001 for both concentrations, which were significantly greater than those of macerated and soxhlet extracts (p<0.001 for all cases and in group 2 experiments both macerated and soxhlet extracts showed concentrationdependent relaxant effects compared to that of saline (p<0.05 to p<0.001 for both extracts. There were significant differences between the relaxant effects of both extracts with those of theophylline in group 2 experiments (p<0.01 to p<0.001. The relaxant effects of macerated and soxhlet extracts in group 1 were significantly lower than those of groups 2. These results showed a potent relaxant effect of Ocimum basilicum on tracheal chains of guinea pigs which were lower than theophylline at concentrations used.

  14. Adubação orgânica na produção, rendimento e composição do óleo essencial da alfavaca quimiotipo eugenol Organic fertilization in the production, yield and chemical composition of basil chemotype eugenol

    Directory of Open Access Journals (Sweden)

    Luiz Antonio Biasi


    Full Text Available Este trabalho foi realizado na UFPR, município de Pinhais-PR, de outubro de 2005 a junho de 2006. Avaliou-se a resposta do Ocimum gratissimum à adubação orgânica com composto de esterco de carneiro, verificando a viabilidade dessa prática para o aumento no rendimento de biomassa, na quantidade e qualidade de seu óleo essencial. As mudas foram plantadas com espaçamento de 0,5 m entre plantas dentro das parcelas e 1 m entre as parcelas. Testaram-se 3 doses de adubação com composto orgânico (4; 8 e 12 kg m-2 e uma testemunha, com 5 repetições e 8 plantas por parcela. As colheitas foram realizadas aos 150 e 226 dias após o plantio, sendo avaliado o rendimento de massa fresca e massa seca total e de folhas, flores e caule, o teor de óleo essencial das folhas e flores e a sua composição por cromatógrafo a gás acoplado a um detector de massas (CG-MS. Houve diferença entre os tratamentos, quanto ao rendimento de biomassa na primeira colheita, onde o tratamento com 8 kg m-2 de composto orgânico foi superior à testemunha sem adubação, para a massa fresca de flores por planta e massa seca total e de flores por planta, mas não diferiu dos outros níveis de adubação. Na segunda colheita não houve diferença entre os tratamentos. Quanto ao rendimento de óleo essencial não houve diferença entre os tratamentos nas duas colheitas. Também não foram observadas grandes variações nos componentes do óleo essencial decorrente dos tratamentos aplicados. Entretanto, ocorreram variações na composição do óleo essencial quando extraído das folhas e das flores, sendo o teor médio de eugenol de 90,4% nas folhas e 80,8% nas flores, na colheita em março. Já na colheita em junho, houve uma redução do teor de eugenol nas folhas e uma elevação dos teores, principalmente de alfa trans trans farneseno, beta bisaboleno, beta cariofileno, germacrene D e alfa selineno.This work was carried out at the Universidade Federal do Parana

  15. Evaluation of In Vitro Anticancer Activity of Ocimum Basilicum, Alhagi Maurorum, Calendula Officinalis and Their Parasite Cuscuta Campestris


    Behbahani, Mandana


    The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231) and normal breast cell line (MCF 10A). The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative ...

  16. Caracterização e ontogenia dos tricomas glandulares de Ocimum selloi Benth. - Lamiaceae Characterization and ontogeny of the glandular trichomes of Ocimum selloi Benth. (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Letícia de Almeida Gonçalves


    Full Text Available Ocimum selloi Benth. (Lamiaceae é uma espécie nativa da América do Sul e na medicina popular tem sido usada devido suas propriedades analgésica, anti-inflamatória e antiespasmódica. O objetivo do presente trabalho foi identificar os tipos de tricomas glandulares que ocorrem nos órgãos vegetativos e reprodutivos de O. selloi e determinar a ontogenia desses tricomas. Ramos laterais em início de formação, folhas totalmente expandidas, flores em diferentes estádios de diferenciação, amostras de caule e do eixo das inflorescências foram analisados em microscopias de luz e eletrônica de varredura. Tricomas glandulares do tipo peltado e capitado subséssil foram observados no caule, nas folhas, no eixo da inflorescência e na superfície adaxial das sépalas. Nas sépalas foi encontrado, além dos tricomas secretores peltados e capitados subsésseis, o tricoma glandular capitado pedunculado. A ontogenia inicia-se com a expansão de uma célula protodérmica que, de acordo com a seqüência de divisões periclinais e anticlinais (ora simétricas, ora assimétricas, dá origem aos tricomas. A diferenciação dos tricomas glandulares peltados e capitados não é sincrônica e ocorre muito cedo no desenvolvimento da folha, do caule e do eixo floral.Ocimum selloi Benth. (Lamiaceae is native to South America and in traditional medicine has been used due to its analgesic, anti-inflammatory, and antispasmodic properties. The aim of this study was to identify the types of glandular trichomes that occur on the vegetative and reproductive organs of O. selloi and to determine trichome ontogeny. Lateral branches at the initial formation phase, fully opened leaves, flowers at different differentiation stages, and stem and inflorescence axes were analyzed under light and scanning electron microscopy. Glandular trichomes of the peltate and subsessile capitate types were observed on the stem, leaves, inflorescence axis and the adaxial surface of the

  17. Atividade potencialmente alelopática do óleo essencial de Ocimum americanum Potentially allelophatic activity of the essential oil of Ocimum americanum

    Directory of Open Access Journals (Sweden)

    A.P.S. Souza Filho


    Full Text Available Os óleos essenciais são reconhecidos pelas suas diversificadas ações biológicas. A biodiversidade amazônica é rica em espécies de plantas produtoras de óleos essenciais. Neste trabalho, objetivou-se caracterizar a atividade potencialmente alelopática do óleo essencial de Ocimum americanum (estoraque e determinar seus efeitos sobre a germinação de sementes e o desenvolvimento de duas espécies de plantas daninhas. O óleo essencial foi testado em concentrações variando de 100 a 2.000 mg L-1, considerando seus efeitos sobre a germinação de sementes (25 ºC de temperatura constante e fotoperíodo de 12 horas e o desenvolvimento da radícula e do hipocótilo (25 ºC de temperatura constante e fotoperíodo de 24 horas das plantas daninhas malícia (Mimosa pudica e mata-pasto (Senna obtusifolia. Fatores relacionados a concentração, especificidade das plantas receptoras e parâmetros analisados foram decisivos para os efeitos obtidos. A tendência geral foi de relação positiva entre concentração e efeito inibitório. Malícia foi mais sensível aos efeitos do que mata-pasto. Comparativamente, a germinação, seguida do desenvolvimento da radícula, foi afetada pelo óleo essencial em maior magnitude, ficando o desenvolvimento do hipocótilo como o de menor sensibilidade. Os efeitos observados podem ser atribuídos à presença, no óleo essencial, de monoterpenos, monoterpenos oxigenados, sesquiterpenos, alifáticos e fenilpropanoides, com destaque para os constituintes com atividade alelopática já comprovada, como o limoneno, a cânfora e o linalol.Essential oils are known for their several biological activities. The biodiversity of the Amazon region is rich in essential-oil producing plants.The aim of this work was to study the potentially allelopathic activity of the essential oil of Ocimum americanum and to determine its effects on seed germination and growth of two weed species. Solutions of the essential oil were tested

  18. Basil extract inhibits the sulfotransferase mediated formation of DNA adducts of the procarcinogen 1′-hydroxyestragole by rat and human liver S9 homogenates and in HepG2 human hepatoma cells

    NARCIS (Netherlands)

    Jeurissen, S.M.F.; Punt, A.; Delatour, T.; Rietjens, I.M.C.M.


    The effects of a basil extract on the sulfation and concomitant DNA adduct formation of the proximate carcinogen 1′-hydroxyestragole were studied using rat and human liver S9 homogenates and the human hepatoma cell line HepG2. Basil was chosen since it contains the procarcinogen estragole that can

  19. Basil extract inhibits the sulfotransferase mediated formation of DNA adducts of the procarcinogen 1'-hydroxyestragole by rat and human liver S9 homogenates and in HepG2 human hepatoma cells

    NARCIS (Netherlands)

    Jeurissen, S.M.F.; Punt, A.; Delatour, T.; Rietjens, I.M.C.M.


    The effects of a basil extract on the sulfation and concomitant DNA adduct formation of the proximate carcinogen 1¿-hydroxyestragole were studied using rat and human liver S9 homogenates and the human hepatoma cell line HepG2. Basil was chosen since it contains the procarcinogen estragole that can

  20. Determining the Threshold Value of Basil Yield Reduction and Evaluation of Water Uptake Models under Salinity Stress Condition

    Directory of Open Access Journals (Sweden)

    M. Sarai Tabrizi


    Full Text Available Introduction: Several mathematical models are being used for assessing the plant response to the salinity of the root zone. The salinity of the soil and water resources is a major challenge for agricultural sector in Iran. Several mathematical models have been developed for plant responses to the salinity stress. However, these models are often applicable in particular conditions. The objectives of this study were to evaluate the threshold value of Basil yield reduction, modeling Basil response to salinity and to evaluate the effectiveness of available mathematical models for the yield estimation of the Basil . Materials and Methods: The extensive experiments were conducted with 13 natural saline water treatments including 1.2, 1.8, 2, 2.2, 2.5, 2.8, 3, 3.5, 4, 5, 6, 8, and 10 dSm-1. Water salinity treatments were prepared by mixing Shoor River water with fresh water. In order to quantify the salinity effect on Basil yield, seven mathematical models including Maas and Hoffman (1977, van Genuchten and Hoffman (1984, Dirksen and Augustijn (1988, and Homaee et al., (2002 were used. One of the relatively recent methods for soil water content measurements is theta probes instrument. Theta probes instrument consists of four probes with 60 mm long and 3 mm diameter, a water proof container (probe structure, and a cable that links input and output signals to the data logger display. The advantages that have been attributed to this method are high precision and direct and rapid measurements in the field and greenhouse. The range of measurements is not limited like tensiometer and is from saturation to wilting point. In this study, Theta probes instrument was calibrated by weighing method for exact irrigation scheduling. Relative transpiration was calculated using daily soil water content changes. A coarse sand layer with 2 centimeters thick was used to decrease evaporation from the surface soil of the pots. Quantity comparison of the used models was done

  1. Raman spectroscopy for the evaluation of the effects of different concentrations of Copper on the chemical composition and biological activity of basil essential oil (United States)

    Nawaz, Haq; Hanif, Muhammad Asif; Ayub, Muhammad Adnan; Ishtiaq, Faiqa; Kanwal, Nazish; Rashid, Nosheen; Saleem, Muhammad; Ahmad, Mushtaq


    The present study is performed to evaluate the effect of different concentrations of Cu as fertilizer on the chemical composition of basil essential oil and its biological activity including antioxidant and antifungal activities by employing Raman spectroscopy. Moreover, the effect of Cu is also determined on the vegetative growth and essential oil yield. Both, antifungal and antioxidant activities were found to be maximum with essential oils obtained at 0.04 mg/l concentration of Cu fertilizer. The results of the GC-MS and Raman spectroscopy have revealed that the linalool and estragole are found to be as a major chemical compound in basil essential oil. The Raman spectral changes associated with these biological components lead to the conclusion that estragole seems to have dominating effect in the biological activities of the basil essential oil as compared to linalool although the latter is observed in greater concentration.

  2. Brachial artery repair using the basilic vein as a reliable conduit in a 3-year-old child

    Directory of Open Access Journals (Sweden)

    Hyunyoung G. Kim


    Full Text Available A supracondylar fracture of the humerus is the most common upper extremity fracture in children with concurrent neurovascular complications. However, bypass grafting in the management of a pediatric open elbow dislocation with an arterial injury has rarely been reported in the literature. Hence, an adequate conduit for a vessel graft interposition remains questionable when a primary anastomosis is limited in an arterial reconstruction. The purpose of this study is to present a brachial artery reconstruction in a 3-year-old patient with an open supracondylar fracture of the humerus. In the clinical and surgical examination of the patient, an open wound in the left antecubital fossa presented with accompanying brachial artery injury. To repair the artery, a reverse end-to-end anastomosis was conducted using basilic vein graft from the ipsilateral arm under general anesthesia. The patient had palpable radial pulses in the postoperative clinical examination and was discharged without complications. The great saphenous vein (GSV has proven to be the most common and the best conduit for arterial reconstruction of the upper extremity in the adult patients. However, the GSV graft is known to have the propensity for becoming aneurysmal in pediatric patients. Some studies have demonstrated the basilic vein as a suitable conduit in pediatric patients, in that it has durable patency, fewer branches, size compatibility for anastomosis, and proximity to the brachial artery. Our case confirms the safety of using this autogenous vein from within the zone of injury for arterial reconstruction, after a supracondylar humeral fracture. The management of pediatric elbow fractures accompanying vascular injuries can be technically demanding due to relatively small, delicate structures and concurrent neurovascular network. Nonetheless, a vascular injury should be treated with high level of suspicion and immediate intervention to avoid any limb ischemia or loss. In

  3. Design and evaluation of in vivo formulations based on orange (Citrus sinensis and sweet basil (Ocimum basilicum L, essential oils and acetic acid Diseño y evaluación in vivo de formulaciones para acné basadas en aceites esenciales de naranja (Citrus sinensis, albahaca (Ocimum basilicum L y ácido acético

    Directory of Open Access Journals (Sweden)

    Jennifer Herazo


    Full Text Available Introduction. Currently, the antimicrobial resistance of bacterial strains involved in the development of acne is a reality, it is necessary to find alternatives to antibiotic treatment.
    Objectives. Designing gel formulations based on essential oils and acetic acid and evaluate its effectiveness in volunteers patients affected by acne.
    Materials and methods. Masked simple experimental study of three gel formulations on four groups of seven patients. Treatments antibacterial (essential oils, keratolytic and mixed (acetic acid, were applied daily for eight weeks. Weekly checks were conducted to evaluate the improvement in patients.
    Results. All groups reported improvement of acne condition, which ranged between 43% and 75% clearance of lesions, with little discomfort or side effects after application of treatments, which disappeared within minutes.
    Conclusions. The formulations prepared were found to be chemically and physically stable during application of treatments, which was demonstrated by gas chromatography, where no evidence no change neither the composition profiles of essential oils nor in acetic acid. The results were ranked good to excellent, particularly for acetic acid, which achieved improvements of over 75%, a result of their joint activity antiseptic and keratolytic. Side effects (burning and redness disappeared within a few minutes of completing the application, therefore, did not prevent adherence to treatment.
    Introducción. Actualmente la resistencia a los antimicrobianos de las cepas bacterianas involucradas en el desarrollo del acné es una realidad, se hace necesario buscar alternativas terapéuticas para su tratamiento.
    Objetivos. Diseñar formulaciones tipo gel con base en aceites esenciales y ácido acético y evaluar su efectividad en pacientes voluntarios afectados por acné.
    Materiales y métodos. Estudio experimental simple enmascarado de tres formulaciones tipo gel sobre cuatro grupos de siete pacientes. Los tratamientos antibacteriano (aceites esenciales, queratolítico y mixto (ácido acético, se aplicaron diariamente por espacio de ocho semanas. Se realizaron controles semanales para evaluar la evolución de los pacientes.
    Resultados. Todos los grupos reportaron mejoría (desaparición de las lesiones de la condición del acné, las cuales oscilaron entre el 43% y el 75%, con leves efectos secundarios transitorios relacionados a la aplicación de los tratamientos utilizados
    Conclusiones. Las formulaciones estudiadas mostraron ser estables química y físicamente durante la aplicación de los tratamientos, lo cual se demostró mediante análisis de cromatografía de gases, en donde no se evidenció ningún cambio en los perfiles de composición de los aceites esenciales ni en el del ácido acético. Los resultados se catalogaron entre buenos y excelentes, en particular el del ácido acético, que logró mejorías superiores al 75%, dada su actividad mixta antiséptica y queratolítica. Los efectos secundarios (ardor y enrojecimiento desaparecieron a los pocos minutos de realizada la aplicación, y no impidieron la adherencia a los tratamientos.

  4. Ameliorative potential of Ocimum sanctum in chronic constriction injury-induced neuropathic pain in rats

    Directory of Open Access Journals (Sweden)



    Full Text Available The present study was designed to investigate the ameliorative potential of Ocimumsanctum and its saponin rich fraction in chronic constriction injury-induced neuropathic pain in rats. The chronic constriction injury was induced by placing four loose ligatures around the sciatic nerve, proximal to its trifurcation. The mechanical hyperalgesia, cold allodynia, paw heat hyperalgesia and cold tail hyperalgesia were assessed by performing the pinprick, acetone, hot plate and cold tail immersion tests, respectively. Biochemically, the tissue thio-barbituric acid reactive species, super-oxide anion content (markers of oxidative stress and total calcium levels were measured. Chronic constriction injury was associated with the development of mechanical hyperalgesia, cold allodynia, heat and cold hyperalgesia along with an increase in oxidative stress and calcium levels. However, administration of Ocimumsanctum (100 and 200 mg/kg p.o. and its saponin rich fraction (100 and 200 mg/kg p.o. for 14 days significantly attenuated chronic constriction injury-induced neuropathic pain as well as decrease the oxidative stress and calcium levels. It may be concluded that saponin rich fraction of Ocimum sanctum has ameliorative potential in attenuating painful neuropathic state, which may be attributed to a decrease in oxidative stress and calcium levels.

  5. In vitro antifungal activity of Ocimum selloi essential oil and methylchavicol against phytopathogenic fungi1

    Directory of Open Access Journals (Sweden)

    Larissa Corrêa Bomfim Costa

    Full Text Available The efficacy of Ocimum selloi essential oil was evaluated for controlling the growth of mycelia and spores germination Moniliophthora perniciosa. Six compounds (99.89% of the total oil were identified by GC-MS, of which methyl chavicol, methyl eugenol, β-caryophyllene, germacrene-D, bicyclogermacrene and spathulenol. Essential oil was tested for antifungal activity, which was determined by disc diffusion and minimum inhibitory concentration (MIC determination methods. Application of the oil reduced mycelial growth in a dose dependent manner, with maximum inhibition being observed at concentration of 1,000 ppm. Such antifungal activity could be attributed to methyl chavicol since the pure compound was shown to be similarly effective against Moniliophthora perniciosa at 1,000 ppm. The oil when applied at a concentration of 1,000 ppm, reduced the spore germination of Colletotrichum gloeosporioides and M. perniciosa by 93 and 87%, respectively, but had no effect on the Alternaria alternata. It is concluded that the oil from O. selloi and its major constituent, methyl chavicol, are efficient in inhibiting M. perniciosa, but less effective against C. gloeosporioides and A. alternata. The results obtained from this work may contribute to the development of alternative anti-fungal agents to protect the cacao crop from fungal disease.

  6. Rhizospheric Microflora Escalating Aroma Constituents and Yield Attributes in Ocimum tenuiflorum (L. cv. CIM-Ayu

    Directory of Open Access Journals (Sweden)

    Shilpi Khare Saikia


    Full Text Available The exploration of rhizospheric microbial flora for crop yield enhancement is well established. Rhizospheric microbes influence the plant physiology by imparting several beneficial effects, namely, Nitrogen fixation, increased nutrient uptake, and secondary metabolites production on their host plants. The present study investigates the response of Bacillus megaterium ATCC No. 13525, Pseudomonas fluorescens ATCC No. 14581, and Trichoderma viride MTCC No. 167 in alone and combined treatments for their effect on growth and yield parameters in a commercially important Ocimum tenuiflorum L. cv. CIM-Ayu. The plant is therapeutically important for its essential oil constituents, namely, eugenol, β-caryophyllene, and various monoterpenes. The combination treatments, T7 (B. megaterium + P. fluorescens and T8 (B. megaterium + P. fluorescens + T. viride, showed maximum enhancement (27.27% of percentage essential oil as compared to untreated control. Nutrient uptake especially N2 content was significantly increased (43% with the treatment T8 (B. megaterium + P. fluorescens + T. viride. Amongst major essential oil constituents, eugenol content was maximally increased by 58.5% as compared to 42.9% (control indicating a cumulative role of microbial inoculants for crop yield boost-up.

  7. Ocimum basilicum ethanolic extract decreases cholesterol synthesis and lipid accumulation in human macrophages. (United States)

    Bravo, Elena; Amrani, Souliman; Aziz, Mohammed; Harnafi, Hicham; Napolitano, Mariarosaria


    Macrophage lipid accumulation induced by low density lipoproteins (LDL) plays a pivotal role in atherosclerotic plaque development. Previous work showed that Ocimum basilicum extract, used as hypocholesterolemic agent by traditional medicine in Morocco, has hypolipidemic activity in rat acute hyperlipimidemia. This study investigated the effects of ethanolic extract of O. basilicum on lipid accumulation in human macrophages. As modification of LDL increase atherogenicity of the particles we evaluated the effects of the extract on LDL oxidation. The extract caused a dose-related increase of LDL-resistance to Cu(2+)-induced oxidation. Furthermore, at the dose of 60 microg/ml, significantly decreases the accumulation of macrophage lipid droplets induced by modified LDL evaluated as by red-oil staining. Cholesterol esterification and triacylglycerol synthesis in the cells were not affected. Macrophage treatment with 60 microg/ml, but not 20 microg/ml, of the extract reduced newly synthesized unesterified cholesterol by about 60% and decreased scavenger receptors activity by about 20-30%, evaluated by the internalization of cholesterol carried by [(3)H]CE-aggregated-LDL. The results suggest that O. basilicum ethanolic extract has the capability to reduce foam cell formation through the reduction of cholesterol synthesis and the modulation of the activity of surface scavenger receptors.

  8. Beneficial Effect of Ocimum sanctum (Linn) against Monocrotaline-Induced Pulmonary Hypertension in Rats. (United States)

    Meghwani, Himanshu; Prabhakar, Pankaj; Mohammed, Soheb A; Dua, Pamila; Seth, Sandeep; Hote, Milind P; Banerjee, Sanjay K; Arava, Sudheer; Ray, Ruma; Maulik, Subir Kumar


    The study was designed to explore any beneficial effect of Ocimum sanctum (Linn) (OS) in experimental pulmonary hypertension (PH) in rats. OS is commonly known as “holy basil” and “Tulsi” and is used in the Indian System of Medicine as antidiabetic, antioxidant, hepatoprotective, adaptogenic, and cardioprotective. Monocrotaline (MCT) administration caused development of PH in rats after 28 days and rats were observed for 42 days. Treatments (sildenafil; 175 µg/kg, OS; 200 mg/kg) were started from day 29 after the development of PH and continued for 14 days. Parameters to assess the disease development and effectiveness of interventions were echocardiography, right and left ventricular systolic pressures, and right ventricular end diastolic pressure, percentage medial wall thickness (%MWT) of pulmonary artery, oxidative stress markers in lung tissue, NADPH oxidase (Nox-1) protein expression in lung, and mRNA expression of Bcl2 and Bax in right ventricular tissue. OS (200 mg/kg) treatment ameliorated increased lung weight to body weight ratio, right ventricular hypertrophy, increased RVSP, and RVoTD/AoD ratio. Moreover, OS treatment decreases Nox-1 expression and increases expression of Bcl2/Bax ratio caused by MCT. The present study demonstrates that OS has therapeutic ability against MCT-induced PH in rat which are attributed to its antioxidant effect. The effect of OS was comparable with sildenafil.

  9. Ocimum basilicum improve chronic stress-induced neurodegenerative changes in mice hippocampus. (United States)

    Ayuob, Nasra Naeim; El Wahab, Manal Galal Abd; Ali, Soad Shaker; Abdel-Tawab, Hanem Saad


    Alzheimer's disease (AD), one of the progressive neurodegenerative diseases might be associated with exposure to stress and altered living conditions. This study aimed to evaluate the effectiveness of Ocimum basilicum (OB) essential oils in improving the neurodegenerative-like changes induced in mice after exposed to chronic unpredictable mild stress (CUMS). Forty male Swiss albino mice divided into four groups (n = 10); the control, CUMS, CUMS + Fluoxetine, CUMS + OB were used. Behavioral tests, serum corticosterone level, hippocampus protein level of the glucocorticoid receptors (GRs) and brain-dreived neurotropic factor (BDNF) were determined after exposure to CUMS. Hippocampus was histopathologically examined. Data were analyzed using statistical package for the social sciences (SPSS) and P value of less than 0.05 was considered significant. OB diminished the depression manifestation as well as impaired short term memory observed in the mice after exposure to the CUMS as evidenced by the forced swimming and elevated plus maze test. OB also up-regulated the serum corticosterone level, hippocampal protein level of the glucocorticoid receptor and the brain-derived neurotropic factor and reduced the neurodegenerative and atrophic changes induced in the hippocampus after exposure to CUMS. Essential oils of OB alleviated the memory impairment and hippocampal neurodegenerative changes induced by exposure to the chronic unpredictable stress indicating that it is the time to test its effectiveness on patients suffering from Alzheimer disease.

  10. Extraction of mosquitocidals from Ocimum canum leaves for the control of dengue and malarial vectors

    Directory of Open Access Journals (Sweden)

    Pari Madhiyazhagan


    Full Text Available Objective: To assess the potentiality of Ocimum canum (O. canum (Lamiaceae in larvicidal, pupicidal, adulticidal, and repellent activities against the malarial vector, Anopheles stephensi (An. stephensi and the dengue vector, Aedes aegypti (Ae. aegypti. Methods: The mosquitocidal activity of methanol extracts from O. canum against immature and adult An. stephensi and Ae. aegypti (L. were studied. Standard WHO bioassays were used to evaluate the effectiveness of the plant extract against mosquitoes. Results: The methanol extract of O. canum was very effective against the immature stages of An. stephensi (LC50=193.280, 240.551, 303.409, 374.936 and pupa 469.547 mg/L and Ae. aegypti (LC 50=242.071, 287.277, 332.668, 394.061 and pupa 457.879 mg/L. Smoke toxicity assay showed significant mortality rate against adult An. stephensi (86.6% and Ae. aegypti (84.78%. The number of eggs laid by the females were strictly reduced after exposure to smoke. Conclusions: From the observed results we conclude that O. canum can be used as an effective larvicidal and repellent agent against the malarial and dengue vectors.

  11. Ocimum basilicum essential oil combined with deltamethrin to improve the management of Spodoptera frugiperda

    Directory of Open Access Journals (Sweden)

    Sérgio Macedo Silva

    Full Text Available ABSTRACT For an important and expensive crop such as corn, the resistance of Spodoptera frugiperda J.E. Smith to various pesticides has led to research throughout the world for a potential insecticide from a natural source. For the management of pest resistance, natural compounds associated with synthetic insecticides can be a promising tool because they can reduce the application of the synthetics molecules while maintaining their effectiveness and promoting the control of the pests. Linalool is a potential insecticide that is easily obtained because it is found in high concentrations in the essential oil of Ocimum basilicum L. Therefore, the present study aimed to evaluate the toxicity of this essential oil and its combination with deltamethrin to control S. frugiperda. Through dose response assays, the acute toxicities (LD50 of the essential oil and deltamethrin were estimated. Additionally, the combination of these materials was also assessed, attaining a reduction of 80% of the LD50 of deltamethrin while obtaining the same result as when the pyrethroid was administered alone. From these results, it is expected that the combination of natural compounds and synthetic insecticides will be a promising practice, helping to manage resistance while reducing the environmental impact of toxic compounds.

  12. Oxygen introduction during extraction and the improvement of antioxidant activity of essential oils of basil, lemon and lemongrass

    Directory of Open Access Journals (Sweden)

    Daniele de Freitas Ferreira

    Full Text Available ABSTRACT: Essential oil extraction is commonly carried out by using the hydrodistillation method, which is described in official compendia of food quality control and medicinal plants. Despite the widespread use of this method, few studies have evaluated the effect of the atmosphere change during extraction on the composition and antioxidant activity of essentials oils. Therefore, a study of oxygen introduction influence during the extraction of essential oils from basil, lemongrass and lemon by hydrodistillation was performed. Total amount of oxygenated compounds (e.g., linalool, camphor, α-terpineol, neral, geranial, eugenol and α-muurolol increased for all essential oils extracted under oxygen flow. Antioxidant activity evaluated by using the ORAC method significantly increased (P<0.0001 with oxygen from 618 to 906, 355 to 613 and 72 to 262µmol Trolox g-1 oil for basil, lemongrass and lemon, respectively. Therefore, the simple modification proposed could be considered a suitable alternative to obtain essential oils with higher antioxidant activity.

  13. Comparative study for antibacterial potential of in vitro and in vivo grown Ocimum basilicum L. plant extracts

    Energy Technology Data Exchange (ETDEWEB)

    Shafique, M; Khan, S J [Pakistan Councile of Scientific and Industrial Research, Lahore (Pakistan). Dept. of Food and Biotechnology


    The antimicrobial activities of in vitro grown callus extract and in vivo grown Ocimum basilicum L. plant leaves extracts were studied and compared. Effect of extraction solvent was also assessed. These extracts were tested in vitro against eight bacterial strains following disc diffusion method. The results indicated that in vitro grown callus extracts of O. basilicum exhibited higher antimicrobial activity against tested Gram positive microorganisms as compared to in vivo grown plant material extract. These findings indicate towards potential use of biotechnology for natural therapeutic agent production. (author)

  14. Artificial LED lighting enhances growth characteristics and total phenolic content of Ocimum basilicum, but variably affects transplant success


    Bantis, Filippos; Ouzounis, Theoharis; Radoglou, Kalliopi


    The morphological and phytochemical characteristics of two Ocimum basilicum cultivars (Lettuce Leaf, and Red Rubin-mountain Athos hybrid) under artificial lighting were investigated. Four LED light treatments [AP673L (high red and high red:far-red), G2 (high red and low red:far-red), AP67 (moderate blue and red and low red:far-red), and NS1 (high blue and green, high red:far-red and 1% ultraviolet)] with different colors mixing UV, blue, green, red and far-red, and fluorescent tubes (FL, high...

  15. Comparative study for antibacterial potential of in vitro and in vivo grown Ocimum basilicum L. plant extracts

    International Nuclear Information System (INIS)

    Shafique, M.; Khan, S.J.


    The antimicrobial activities of in vitro grown callus extract and in vivo grown Ocimum basilicum L. plant leaves extracts were studied and compared. Effect of extraction solvent was also assessed. These extracts were tested in vitro against eight bacterial strains following disc diffusion method. The results indicated that in vitro grown callus extracts of O. basilicum exhibited higher antimicrobial activity against tested Gram positive microorganisms as compared to in vivo grown plant material extract. These findings indicate towards potential use of biotechnology for natural therapeutic agent production. (author)

  16. Sustratos orgánicos como alternativa para la producción de albahaca (Ocimum Selloi Benth)


    Campos Mota, Lilián; Flores Sánchez, Diego


    La especie de albahaca Ocimum Selloi Benth ha sido empleada en México por sus propiedades medicinales y como condimento. Por otra parte, el uso de vermicomposta es una alternativa en la producción orgánica de las plantas medicinales; por lo tanto, esta investigación tuvo como objetivo evaluar el efecto de la vermicomposta en el crecimiento de albahaca. Como tratamientos se emplearon 4 sustratos: 1) vermicomposta de café (con base a pulpa proveniente del beneficio húmedo) más cascarilla de caf...

  17. Identification and quantification of a major anti-oxidant and anti-inflammatory phenolic compound found in basil, lemon, thyme, mint, oregano, rosemary, sage, and thyme (United States)

    Basil, lemon thyme, mint, oregano, rosemary, sage, and thyme are in the mint family of plants that are used as culinary herbs world-wide. These herbs contain phenolic compounds that are believed to have strong antioxidant and anti-inflammatory activities. Therefore, the major phenolic compounds fr...

  18. Basil A. Pruitt Jr. MD and the US Army Institute for Surgical Research: Five Decades of Science, Clinical Care, Mentorship, and Leadership. (United States)

    Stewart, Ronald M


    Over the past half century Dr. Basil A. Pruitt, Jr., a great citizen, surgeon, innovator, mentor and leader, transformed our world through his dogged commitment to science and service to humanity. Dr. Pruitt's contribution lives on in the work of the US Army Institute of Surgical Research and the surgeons, physicians and scientists he shaped and inspired.

  19. Phytotoxic Activity of Ocimum tenuiflorum Extracts on Germination and Seedling Growth of Different Plant Species

    Directory of Open Access Journals (Sweden)

    A. K. M. Mominul Islam


    Full Text Available Phytotoxic activity of Ocimum tenuiflorum (Lamiaceae plant extracts was investigated against the germination and seedling growth of cress (Lepidium sativum, lettuce (Lactuca sativa, alfalfa (Medicago sativa, Italian ryegrass (Lolium multiflorum, barnyard grass (Echinochloa crus-galli, and timothy (Phleum pratense at four different concentrations. The plant extracts at concentrations greater than 30 mg dry weight equivalent extract mL−1 reduced significantly the total germination percent (GP, germination index (GI, germination energy (GE, speed of emergence (SE, seedling vigour index (SVI, and coefficient of the rate of germination (CRG of all test species except barnyard grass and GP of lettuce. In contrast, time required for 50% germination (T50 and mean germination time (MGT were increased at the same or higher than this concentration. The increasing trend of T50 and MGT and the decreasing trend of other indices indicated a significant inhibition or delay of germination of the test species by O. tenuiflorum plant extracts and vice versa. In addition, the shoot and root growth of all test species were significantly inhibited by the extracts at concentrations greater than 10 mg dry weight equivalent extract mL−1. The I50 values for shoot and root growth were ranged from 26 to 104 mg dry weight equivalent extract mL−1. Seedling growth was more sensitive to the extracts compared to seed germination. Results of this study suggest that O. tenuiflorum plant extracts have phytotoxic properties and thus contain phytotoxic substances. Isolation and characterization of those substances from this plant may act as a tool for new natural, biodegradable herbicide development to control weeds.

  20. Genome sequencing of herb Tulsi (Ocimum tenuiflorum) unravels key genes behind its strong medicinal properties. (United States)

    Upadhyay, Atul K; Chacko, Anita R; Gandhimathi, A; Ghosh, Pritha; Harini, K; Joseph, Agnel P; Joshi, Adwait G; Karpe, Snehal D; Kaushik, Swati; Kuravadi, Nagesh; Lingu, Chandana S; Mahita, J; Malarini, Ramya; Malhotra, Sony; Malini, Manoharan; Mathew, Oommen K; Mutt, Eshita; Naika, Mahantesha; Nitish, Sathyanarayanan; Pasha, Shaik Naseer; Raghavender, Upadhyayula S; Rajamani, Anantharamanan; Shilpa, S; Shingate, Prashant N; Singh, Heikham Russiachand; Sukhwal, Anshul; Sunitha, Margaret S; Sumathi, Manojkumar; Ramaswamy, S; Gowda, Malali; Sowdhamini, Ramanathan


    Krishna Tulsi, a member of Lamiaceae family, is a herb well known for its spiritual, religious and medicinal importance in India. The common name of this plant is 'Tulsi' (or 'Tulasi' or 'Thulasi') and is considered sacred by Hindus. We present the draft genome of Ocimum tenuiflurum L (subtype Krishna Tulsi) in this report. The paired-end and mate-pair sequence libraries were generated for the whole genome sequenced with the Illumina Hiseq 1000, resulting in an assembled genome of 374 Mb, with a genome coverage of 61 % (612 Mb estimated genome size). We have also studied transcriptomes (RNA-Seq) of two subtypes of O. tenuiflorum, Krishna and Rama Tulsi and report the relative expression of genes in both the varieties. The pathways leading to the production of medicinally-important specialized metabolites have been studied in detail, in relation to similar pathways in Arabidopsis thaliana and other plants. Expression levels of anthocyanin biosynthesis-related genes in leaf samples of Krishna Tulsi were observed to be relatively high, explaining the purple colouration of Krishna Tulsi leaves. The expression of six important genes identified from genome data were validated by performing q-RT-PCR in different tissues of five different species, which shows the high extent of urosolic acid-producing genes in young leaves of the Rama subtype. In addition, the presence of eugenol and ursolic acid, implied as potential drugs in the cure of many diseases including cancer was confirmed using mass spectrometry. The availability of the whole genome of O.tenuiflorum and our sequence analysis suggests that small amino acid changes at the functional sites of genes involved in metabolite synthesis pathways confer special medicinal properties to this herb.

  1. A comparison study on the antibacterial efficiency of essential oil and dried powder of Ocimum basilicum in ground beef during refrigerated storage

    Directory of Open Access Journals (Sweden)

    shohreh Dadfar


    Conclusion: The results indicated that both essential oil and dried powder of Ocimum basilicum increased the microbial stability of ground meat during storage, whereas dried powder showed more preservative capability at final days of storage. So it is possible to use this kind of natural product instead of synthetic one to reduce the disease of consumers and enhancing the organoleptic features of food

  2. Essential Oil Composition and Antimicrobial Activity of Methyl cinnamate-Linalool Chemovariant of Ocimum basilicum L. from India

    Directory of Open Access Journals (Sweden)

    Rajendra Chandra Padalia


    Full Text Available The essential oils obtained from hydrodistillation of Ocimum basilicum L. harvested at four different growth stages during spring-summer and rain-autumn cropping seasons , were characterized using GC and GC-MS. The e ssential oil yield was found to vary from 0.28–0.32% and 0.40–0.52% during spring-summer and rain-autumn cropping season, respectively with its maximal at full bloom stage. Altogether , forty constituents, comprising 94.9–98.3% were identified represented by ( E -methyl cinnamate (36.6 – 66.4%, linalool (11.2 – 43.8%, and (Z -methyl cinnamate (5.4-7.6% as main constituents. Results showed that growth stages strongly influenced the chemical composition of the essential oil in two cropping seasons, particularly concerning to the content of ( E -methyl cinnamate and linalool. Seed setting stage was optimized for harvesting ( E -methyl cinnamate rich oil (66.4% in rain-winter cropping season. The antimicrobial potential of the essential oil was tested againist eight pathogenic bacteria and three fungal strains. Antimicrobial assay showed that the essential oil possessed good antibacterial activity against Streptococcus mutans, Staphylococcus epidermidis, Escherichia coli , and antifungal activity against Candida kefyr and Candida albicans. Ocimum basilicum , essential oil, ( E - methyl cinnamate, linalool, antibacterial activity, antifungal activity

  3. Comparative effectiveness of one-stage versus two-stage basilic vein transposition arteriovenous fistulas. (United States)

    Ghaffarian, Amir A; Griffin, Claire L; Kraiss, Larry W; Sarfati, Mark R; Brooke, Benjamin S


    Basilic vein transposition (BVT) fistulas may be performed as either a one-stage or two-stage operation, although there is debate as to which technique is superior. This study was designed to evaluate the comparative clinical efficacy and cost-effectiveness of one-stage vs two-stage BVT. We identified all patients at a single large academic hospital who had undergone creation of either a one-stage or two-stage BVT between January 2007 and January 2015. Data evaluated included patient demographics, comorbidities, medication use, reasons for abandonment, and interventions performed to maintain patency. Costs were derived from the literature, and effectiveness was expressed in quality-adjusted life-years (QALYs). We analyzed primary and secondary functional patency outcomes as well as survival during follow-up between one-stage and two-stage BVT procedures using multivariate Cox proportional hazards models and Kaplan-Meier analysis with log-rank tests. The incremental cost-effectiveness ratio was used to determine cost savings. We identified 131 patients in whom 57 (44%) one-stage BVT and 74 (56%) two-stage BVT fistulas were created among 8 different vascular surgeons during the study period that each performed both procedures. There was no significant difference in the mean age, male gender, white race, diabetes, coronary disease, or medication profile among patients undergoing one- vs two-stage BVT. After fistula transposition, the median follow-up time was 8.3 months (interquartile range, 3-21 months). Primary patency rates of one-stage BVT were 56% at 12-month follow-up, whereas primary patency rates of two-stage BVT were 72% at 12-month follow-up. Patients undergoing two-stage BVT also had significantly higher rates of secondary functional patency at 12 months (57% for one-stage BVT vs 80% for two-stage BVT) and 24 months (44% for one-stage BVT vs 73% for two-stage BVT) of follow-up (P < .001 using log-rank test). However, there was no significant difference

  4. Stavropigiyskiy Institute and the Society of St. Basil the Great: the history of the establishment, activities, relationships

    Directory of Open Access Journals (Sweden)

    N. M. Svitlyk


    New materials concerning cultural cooperation problems of mentioned societies have been introduced into the scientific circulation in this publication. First of all, it is related to the signed agreement between Stavropigiyskiy Institute and the Society of St. Basil the Great, which is dedicated to sales process of church and secular literature. Epistolary communication between superiors of the societies has also been analyzed. Private letters is an important source for researchers. They have great scientific value. They are especially valuable for studying the heritage of famous historical figures, as in such letters different thoughts, which sometimes were not embodied in the scientific works, were often described. A description of correspondence between scientists, its subjects, importance for the implementation of private co-operation and cultural development has been offered by the author of the essay. The archives are the subject of the special scientific value. The authors of the studied letters discussed extremely important issues, such as magyarization of the intelligentsia of Transcarpathia, the influence of polonization on public life in Galicia and, as the consequence, the rapid spread of russophile sentiments there. In the analyzed letters a lot of information has been found, which proves the existence of close contacts on both sides of the Carpathians. The correspondence between people of Transcarpathia and Galicia to certain extent revived culture and education in the Region. Based on the processed material, conclusions of the study about the role of Stavropigiysky Institute in Lviv and the Society of St. Basil in Uzhgorod on the cultural development of Ukrainian lands in general have been made, and also about the importance of their mutual cooperation for inter-regional unity of Ukrainian lands. This fact is especially important in modern situation in Ukraine.

  5. Fungal Endophyte Diversity and Bioactivity in the Indian Medicinal Plant Ocimum sanctum Linn.

    Directory of Open Access Journals (Sweden)

    Kanika Chowdhary

    Full Text Available Endophytic mycopopulation isolated from India's Queen of herbs Tulsi (Ocimum sanctum were explored and investigated for their diversity and antiphytopathogenic activity against widespread plant pathogens Botrytis cinerea, Sclerotinia sclerotiorum, Rhizoctonia solani and Fusarium oxysporum. 90 fungal isolates, representing 17 genera were recovered from 313 disease-free and surface sterilised plant segments (leaf and stem tissues from three different geographic locations (Delhi, Hyderabad and Mukteshwar during distinct sampling times in consequent years 2010 and 2011 in India. Fungal endophytes were subjected to molecular identification based on rDNA ITS sequence analysis. Plant pathogens such as F. verticillioides, B. maydis, C. coarctatum, R. bataticola, Hypoxylon sp., Diaporthe phaseolorum, Alternaria tenuissima and A. alternata have occurred as endophyte only during second sampling (second sampling in 2011 in the present study. Bi-plot generated by principal component analysis suggested tissue specificity of certain fungal endophytes. Dendrogram revealed species abundance as a function of mean temperature of the location at the time of sampling. Shannon diversity in the first collection is highest in Hyderabad leaf tissues (H' = 1.907 whereas in second collection it was highest from leaf tissues of Delhi (H' = 1.846. Mukteshwar (altitude: 7500 feet reported least isolation rate in second collection. Nearly 23% of the total fungal isolates were considered as potent biocontrol agent. Hexane extract of M. phaseolina recovered from Hyderabad in first collection demonstrated highest activity against S. sclerotiorum with IC50 value of 0.38 mg/ml. Additionally, its components 2H-pyran-2-one, 5,6-dihydro-6-pentyl and palmitic acid, methyl ester as reported by GC-MS Chromatogram upon evaluation for their antiphytopathogenic activity exhibited IC50 value of 1.002 and 0.662 against respectively S. sclerotiorum indicating their significant role in

  6. Formulation and in Vivo Evaluation for Anti-Aging Effects of an Emulsion Containing Basil Extract Using non- Invasive Biophysical Techniques

    Directory of Open Access Journals (Sweden)

    N. Akhtar


    Full Text Available Background and the purpose of study: Skin aging is a complex process induced by constant exposure to ultraviolet (UV irradiation and damages human skin. UV generates reactive oxygen species leading to collagen deficiency and eventually skin wrinkling. Basil contains a number of phenolics and favonoids which possess antioxidant properties. The aim of this study was to formulate and investigate the antiaging potential of a cream containing Basil extract. Methods: A single blinded study was conducted using non-invasive methods. Formulation containing 3% of the concentrated extract of Basil was developed by entrapping in the inner aqueous phase of w/o emulsion and base contained no extract. Both creams were stored at different storage conditions of 8°C, 25°C, 40°C and 40°C+ 75% relative humidity to predict their stabilities. The formulation and base were evaluated for their effects on various skin parameters i.e., moisture and trans epidermal water loss (TEWL, volume, energy and surface evaluation of the living skin (SELS. Results: Significant effects (p≤0.05 were observed for both creams in the case of TEWL. The base showed insignificant (p≤0.05 while formulation showed significant effects on skin moisture. Volume, SELS SEr (skin roughness, SEsc (skin scaliness, SEsm (skin smoothness, SEw (skin wrinkles parameter showed significant decline while texture parameter of ‘Energy' showed significant increase. Conclusion: The results statistically indicated that the active formulation containg extract of Basil exert antiaging effects when applied topically.

  7. Effects on humans elicited by inhaling the fragrance of essential oils: sensory test, multi-channel thermometric study and forehead surface potential wave measurement on basil and peppermint. (United States)

    Satoh, Tomoko; Sugawara, Yoshiaki


    The effects on humans inhaling the fragrance of essential oils were examined in terms of a sensory test, a multi-channel skin thermometer study and a portable forehead surface electroencephalographic (IBVA-EEG) measurement. The essential oils examined in this study were those of basil and peppermint, because our previous sensory test had indicated an opposite effect of these essential oils when mental work was undertaken; the inhalation of basil produced a more favorable impression after work than before work, whereas peppermint produced an unfavorable impression under these circumstances. For subjects administered basil or peppermint before and after mental work using an inhalator, a series of multi-channel skin thermometer studies and IBVA-EEG measurements were conducted. Using such paired odorants, our results showed that when compared between before and after mental work assigned to subjects: (1) the inhalation of basil, in which a favorable impression was predominant on the whole in terms of the sensory evaluation spectrum, was shown to be associated upward tendency in finger-tip skin temperature; (2) whereas these situations were opposite in the case of peppermint, in which the reversed (unfavorable) feature in sensory profiling was accompanied by a decrease in the magnitude of beta waves and a decrease in the finger-tip skin temperature both based on Welch's method, even at p < 0.01, implying a decreasing propensity of the aroused state and of the arousal response. The elucidation of such sensory and physiological endpoints of paired odorants would be of primary importance for human chemoreception science, because these are only rarely recorded during the same experiments, and this paradigm is highly informative about non-verbal responses to odorants.

  8. A Shigella sonnei outbreak traced to imported basil--the importance of good typing tools and produce traceability systems, Norway, 2011. (United States)

    Guzman-Herrador, B R; Nilsen, E; Cudjoe, K S; Jensvoll, L; Kvamme, J M; Lindegård Aanstad, A; Lindstedt, B A; Nygård, K; Severinsen, G; Werner-Johansen, Ø; Wester, A L; Wiklund, M; Vold, L


    On 9 October 2011, the University Hospital of North Norway alerted the Norwegian Institute of Public Health (NIPH) about an increase in Shigella sonnei infections in Tromsø. The isolates had an identical ‘multilocus variable-number tandem repeat analysis’ (MLVA) profile. Most cases had consumed food provided by delicatessen X. On 14 October, new S. sonnei cases with the same MLVA-profile were reported from Sarpsborg, south-eastern Norway. An outbreak investigation was started to identify the source and prevent further cases. All laboratory-confirmed cases from both clusters were attempted to be interviewed. In addition, a cohort study was performed among the attendees of a banquet in Tromsø where food from delicatessen X had been served and where some people had reported being ill. A trace-back investigation was initiated. In total, 46 cases were confirmed (Tromsø= 42; Sarpsborg= 4). Having eaten basil pesto sauce or fish soup at the banquet in Tromsø were independent risk factors for disease. Basil pesto was the only common food item that had been consumed by confirmed cases occurring in Tromsø and Sarpsborg. The basil had been imported and delivered to both municipalities by the same supplier. No basil from the specific batch was left on the Norwegian market when it was identified as the likely source. As a result of the multidisciplinary investigation, which helped to identify the source, the Norwegian Food Safety Authority, together with NIPH, planned to develop recommendations for food providers on how to handle fresh plant produce prior to consumption.

  9. Antioxidant and DNA damage protective properties of anthocyanin-rich extracts from Hibiscus and Ocimum: a comparative study. (United States)

    Sarkar, Biswatrish; Kumar, Dhananjay; Sasmal, Dinakar; Mukhopadhyay, Kunal


    Anthocyanin extracts (AEs) from Ocimum tenuiflorum (leaf), Hibiscus rosa-sinensis (petal) and Hibiscus sabdariffa (calyx) were investigated and compared for in vitro antioxidant activity and DNA damage protective property. Total phenolic content (TPC) and total anthocyanin content (TAC) of the AEs were determined and the major anthocyanins were characterised. In vitro antioxidant activities were assessed by ferric-reducing antioxidant power (FRAP) assay, 2,2-diphenyl-1-picryl hydrazyl (DPPH) radical-scavenging activity, 2-deoxy-D-ribose degradation assay and lipid peroxidation assay. The protective property of the AEs was also examined against oxidative DNA damage by H2O2 and UV using pUC19 plasmid. All the AEs particularly those from O. tenuiflorum demonstrated efficient antioxidant activity and protected DNA from damage. Strong correlation between antioxidant capacity and TPC and TAC was observed. Significant correlation between antioxidant capacity and TPC and TAC ascertained that phenolics and anthocyanins were the major contributors of antioxidant activity.

  10. A Comparative Study of the Inhibitory Effect of the Extracts of Ocimum sanctum, Aegle marmelos, and Solanum trilobatum on the Corrosion of Mild Steel in Hydrochloric Acid Medium

    Directory of Open Access Journals (Sweden)

    M. Shyamala


    Full Text Available A comparative study of the inhibitory effect of plant extracts, Ocimum sanctum, Aegle marmelos, and Solanum trilobatum, on the corrosion of mild steel in 1N HCl medium was investigated using weightloss method, electrochemical methods, and hydrogen permeation method. Polarization method indicates plant extracts behave as mixed-type inhibitor. The impedance method reveals that charge-transfer process mainly controls the corrosion of mild steel. On comparison, maximum inhibition efficiency was found in Ocimum sanctum with 99.6% inhibition efficiency at 6.0% v/v concentration of the extract. The plant extracts obey Langmuir adsorption isotherm. The SEM morphology of the adsorbed protective film on the mild steel surface has confirmed the high performance of inhibitive effect of the plant extracts. From hydrogen permeation method, all the plant extracts were able to reduce the permeation current. The reason for the reduced permeation currents in presence of the inhibitors may be attributed to the slow discharge step followed by fast electrolytic desorption step. Results obtained in all three methods were very much in good agreement in the order Ocimum sanctum > Aegle marmelos > Solanum trilobatum.

  11. Characterization of turbulent processes by the Raman lidar system BASIL during the HD(CP)2 observational prototype experiment - HOPE (United States)

    Di Girolamo, Paolo; Summa, Donato; Stelitano, Dario; Cacciani, Marco; Scoccione, Andrea; Behrendt, Andreas; Wulfmeyer, Volker


    Measurements carried out by the Raman lidar system BASIL are reported to demonstrate the capability of this instrument to characterize turbulent processes within the Convective Boundary Layer (CBL). In order to resolve the vertical profiles of turbulent variables, high resolution water vapour and temperature measurements, with a temporal resolution of 10 sec and a vertical resolution of 90 and 30 m, respectively, are considered. Measurements of higher-order moments of the turbulent fluctuations of water vapour mixing ratio and temperature are obtained based on the application of spectral and auto-covariance analyses to the water vapour mixing ratio and temperature time series. The algorithms are applied to a case study (IOP 5, 20 April 2013) from the HD(CP)2 Observational Prototype Experiment (HOPE), held in Central Germany in the spring 2013. The noise errors are demonstrated to be small enough to allow the derivation of up to fourth-order moments for both water vapour mixing ratio and temperature fluctuations with sufficient accuracy.

  12. Undergraduate Sustainable Learning: Effects of Sustainable Soilless Media on Production and Sensory Evaluation of Cucumbers, Basil, Parsley, and Lettuce

    Directory of Open Access Journals (Sweden)

    Victoria Russell


    Full Text Available Modern greenhouse production has been ~100% reliant on fossil fuels for all inputs (glazing, heating, fertilization, lighting, post-harvest. Recent innovations may reduce fossil fuel dependence but their effectiveness may not be thoroughly tested. To promote education in sustainable production, undergraduate students in Greenhouse Management class (Hort 3002W; University of Minnesota tested the effectiveness of two organic or ‘sustainable’ soilless media (Sunshine Natural and Organic Growing Mix, Sungro Metro-Mix Special Blend with a control (Sunshine LC8 Professional for crop production (height, leaf/flower number, yield and sensory evaluations (appearance, texture, taste, purchase of cucumbers (‘Big Burpless Hybrid’, ‘Sweet Burpless Hybrid’, basil (‘Opal Purple’, ‘Redleaf’, parsley (‘Green River’, ‘Extra Curled Dwarf’, ‘Hamburg’, and lettuce (Flying Saucer ‘Green’, ‘Red’. Significant differences between sustainable vs. control soils occurred for plant growth, depending on vegetative or reproductive traits, crops, and cultivars. These differences occasionally disappeared for sensory evaluation of edible components. In most crops, however, cultivars were highly significant factors. Undergraduate research can be used to provide directionality for future vegetable and herb plant breeding to focus on creating cultivars with increased yield and high consumer acceptance when grown in sustainable greenhouse soilless mixes.

  13. Qualidade fisiológica de sementes de Ocimum selloi benth: sob condições de luz, temperatura e tempo de armazenamento Physiological quality of Ocimum selloi Benth: seeds under conditions of light, temperature and storage time

    Directory of Open Access Journals (Sweden)

    Larissa Corrêa do Bomfim Costa


    Full Text Available O atroveran ou elixir-paregórico (Ocimum selloi Benth. é uma espécie aromática nativa do Brasil, produtora de óleo essencial rico em metil-chavicol. Neste trabalho, objetivou-se avaliar a influência da temperatura, luz e tempo de armazenamento em diferentes ambientes sobre a germinação e o vigor de sementes de O. selloi. Inicialmente, testou-se o efeito da presença e ausência de luz branca sob fotoperíodo de 12 horas para determinar o fotoblastismo das sementes em diferentes temperaturas (20, 25, 30 e 35ºC. Em seguida, testou-se a germinação e emergência no armazenamento sob duas temperaturas (ambiente e câmara fria aos 0, 2, 4, 6, 8 10 e 12 meses de armazenamento. A espécie foi classificada como fotoblástica neutra, apresentando germinação em ampla faixa de temperatura (20 a 30ºC. A germinação das sementes manteve-se por doze meses de armazenamento em câmara fria e à temperatura ambiente, entretanto, o vigor decresce a partir de seis meses em armazenamento sob temperatura ambiente."Atroveran" or "elixir-paregórico" (Ocimum selloi Benth. is a Brazilian species that produces an essential oil rich in methyl chavicol. This work aimed to evaluate the influence of light, temperature and time of storage in different environments on the germination and vigor of O. selloi seeds. We initially tested the influence of presence and absence of white light in a 12-hour photoperiod to determine the photoblastism of the seeds under different temperatures (20, 25, 30 and 35ºC. The physiological quality of seeds conserved under two temperatures (room temperature and cold chamber was tested at 0, 2, 4, 6, 8 10 and 12 months of storage. The species was classified as neutral photoblastic with germination at a wide temperature range (20ºC-30°C. Germination was maintained for twelve months of storage in cold chamber at room temperature, but the vigor was reduced in seeds kept at room temperature after the sixth month of storage.

  14. Dietary agents in the prevention of alcohol-induced hepatotoxicty: preclinical observations. (United States)

    Shivashankara, Arnadi Ramachandrayya; Azmidah, Aysha; Haniadka, Raghavendra; Rai, Manoj Ponadka; Arora, Rajesh; Baliga, Manjeshwar Shrinath


    Long term alcohol consumption is one of the important causes for liver failure and death. To complicate the existing problem there are no dependable hepatoprotective drugs and a large number of patients prefer using complementary and alternative medicines for treating and managing hepatic complications. Almost 25 centuries ago, Hippocrates, the father of medicine, proclaimed "Let food be thy medicine and medicine be thy food." Exploring the association between diet and health continues even today. Preclinical studies carried out in the recent past have shown that the commonly used dietary agents like Allium sativum (garlic), Camellia sinensis (tea), Curcuma longa (turmeric), Emblica officinalis (Indian gooseberry), Ferula asafoetida (asafoetida), Garcinia cambogia (Malabar tamarind), Glycine max (soyabean), Murraya koenigii (curry leaves), Piper betle (beetle leaf), Prunus armeniaca (apricot), Ocimum gratissimum (wild basil), Theobroma cacao (cocoa), Trigonella foenum-graecum (fenugreek) and Vitis vinifera (grapes) protect against ethanol-induced hepatotoxicity. Mechanistic studies have shown that the beneficial effects of these phytochemicals in preventing the ethanol-induced hepatotoxicity are mediated by the antioxidant, free radical scavenging, anti-inflammatory and anti-fibrotic effects. The present review for the first time collates the hepatoprotective effects of these agents and also emphasizes on aspects that need future research to establish their utility in humans.

  15. Phase equilibrium in systems with ionic liquids: An example for the downstream process of the Biphasic Acid Scavenging utilizing Ionic Liquids (BASIL) process. Part I: Experimental data

    International Nuclear Information System (INIS)

    Sahandzhieva, Katya; Maurer, Gerd


    Highlights: ► Phase equilibrium for a downstream process in sustainable chemical technology. ► Biphasic Acid Scavenging Utilizing Ionic Liquids (BASIL) Process. ► SLE, LLE, and SLLE of (NaCl + water + 1-propanol + 1-MIM) and its ternary subsystems. ► Experimental phase equilibrium data at temperatures between 298 K and 333 K. - Abstract: Experimental results are presented for the (liquid + liquid), (solid + liquid) and (solid + liquid + liquid) equilibria occurring in the downstream process of a typical example for the Biphasic Acid Scavenging Utilizing Ionic Liquids (BASIL)-processes. In a BASIL process an organic base is used to catalyze a chemical reaction and, at the same time, to scavenge an acid that is an undesired side product of that reaction. The particular example of a BASIL process treated here is the reaction of 1-butanol and acetylchloride to butylacetate and hydrochloric acid, where the acid is scavenged by the organic base 1-methyl imidazole (1-MIM) resulting in the ionic liquid 1-methyl imidazolium chloride. The reaction results in a two-phase system as butylacetate and the ionic liquid reveal a large liquid–liquid miscibility gap. The organic base has to be recovered. This is commonly achieved by treating the ionic liquid–rich liquid phase with an aqueous solution of sodium hydroxide (i.e., converting the ionic liquid to the organic base) and extracting the organic base by an appropriate organic solvent (e.g., 1-propanol). The work presented here deals in experimental work with the (liquid + liquid), (solid + liquid) and (solid + liquid + liquid) phase equilibria that are encountered in such extraction processes. Experimental results are reported for temperatures between about 298 K and 333 K: for the solubility of NaCl in several solvents (1-propanol, 1-MIM), (water + 1-MIM), (1-propanol + 1-MIM), (water + 1-propanol), and (water + 1-propanol + 1-MIM) and for the (liquid + liquid) equilibrium as well as for the (solid + liquid

  16. Efecto antimicrobiano de extractos etanólicos de albahaca (Ocimum basilicum L. sobre el crecimiento de Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Julio Colivet


    Full Text Available La albahaca (Ocimum basilicum L. es una planta herbácea de la familia de las labiadas (Lamiaceae, muy común en Venezuela. En la presente investigación se evaluó la supervivencia de una cepa de Staphylococcus aureus por la acción antimicrobiana de extractos etanólicos de albahaca fresca y seca. Las muestras frescas fueron sometidas a homogeneización en licuadora. Para la obtención de las muestras secas se utilizó una estufa convencional a temperatura de 55 ºC x 28 horas. Los extractos se obtuvieron por destilación a presión reducida, temperatura de 45 ºC y empleando etanol como solvente. Posteriormente, se emplearon en medios de cultivo contentivos de S. aureus y se monitoreó el crecimiento del microorganismo en el tiempo, obteniéndose los parámetros de crecimiento a través del modelo de Baranyi y Roberts (1994. Los extractos frescos y secos produjeron efecto antimicrobiano sobre S. aureus a concentraciones de 5 y 10 %, afectando los parámetros de crecimiento de la bacteria, presentando diferencias estadísticamente significativas (p < 0,05 con respecto al grupo control.

  17. Protective effect of Ocimum sanctum L after high-dose {sup 131}Iodine exposure in mice: an in vivo study

    Energy Technology Data Exchange (ETDEWEB)

    Bhartiya, Uma S; Raut, Yogita S; Joseph, Lebana J [Laboratory Nuclear Medicine Section, Radiochemistry and Isotope Group, Bhabha Atomic Research Centre, Tata Memorial Hospital Annexe, Parel, Mumbai (India); Rao, Badanidiyoor S [Radiological Physics and Advisory Division, Bhabha Atomic Research Centre, Mumbai (India)


    Radioprotective effect of aqueous extract of Ocimum sanctum (40 mg/kg body weight, for 15 days) in mice exposed to high-doses (3.7 MBq) of oral {sup 131}Iodine was investigated by studying the organ weights, lipid peroxidation and antioxidant defense enzymes in various target organs like liver, kidneys, salivary glands and stomach at 24 hr after exposure in adult Swiss mice. The mean weight of the salivary glands showed significant increase after {sup 131}Iodine administration. {sup 131}Iodine exposure significantly increased lipid peroxidation in kidneys and salivary glands in comparison to control animals. Pretreatment with O. sanctum in radioiodine exposed group showed significant reduction in lipid peroxidation in both kidneys and salivary glands. In liver, reduced glutathione (GSH) levels showed significant reduction after radioiodine exposure while pretreatment with O. sanctum exhibited less depletion in GSH level even after {sup 131}Iodine exposure. However, no such changes were observed in stomach. The results indicate the possibility of using aqueous extract of O. sanctum for ameliorating {sup 131}lodine induced damage to the salivary glands. (author)

  18. Antimicrobial activity of Tulsi (Ocimum tenuiflorum essential oil and their major constituents against three species of bacteria

    Directory of Open Access Journals (Sweden)

    Hanaa Abbas M Yamani


    Full Text Available In recent years scientists worldwide have realized that the effective life span of any antimicrobial agent is limited, due to increasing development of resistance by microorganisms. Consequently, numerous studies have been conducted to find new alternative sources of antimicrobial agents, especially from plants. The aims of this project were to examine the antimicrobial properties of essential oils distilled from Australian-grown Ocimum teniflorum (Tulsi, to quantify the volatile components present in flower spikes, leaves and the essential oil, and to investigate the compounds responsible for any activity. Broth micro-dilution was used to determine the minimum inhibitory concentration (MIC of Tulsi essential oil against selected microbial pathogens. The oils, at concentrations of 4.5% and 2.25% completely inhibited the growth of Staphylococcus aureus (including MRSA and Escherichia coli, while the same concentrations only partly inhibited the growth of Pseudomonas aeruginosa. Of 54 compounds identified in Tulsi leaves, flower spikes or essential oil, three are proposed to be responsible for this activity; camphor, eucalyptol and eugenol. Since S. aureus (including MRSA, P. aeruginosa and E. coli are major pathogens causing skin and soft tissue infections, Tulsi essential oil could be a valuable topical antimicrobial agent for management of skin infections caused by these organisms.

  19. Evaluation of in vitro anticancer activity of Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. (United States)

    Behbahani, Mandana


    The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231) and normal breast cell line (MCF 10A). The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative Real Time PCR. Three active fractions were detected by nuclear magnetic resonance as lutein, lupeol and eugenol, respectively, in C. officinalis, A. maurorum and O. basilicum. These compounds and their epoxidized forms were also detected in their parasite C. campestris. The cytotoxic activity of lutein epoxide, lupeol epoxide and eugenol epoxide was significantly more than lutein, lupeol and eugenol. The mRNA expression level of p53, caspase-3 and bax genes were increased in both cancer cells treated with all pure compounds. However, bcl-2 gene expression decreased in treated breast cancer cells. In conclusion, all the data indicated that the epoxide forms of lupeol, lutein and eugenol are potential drug candidates for inducing apoptosis in human breast cancer cells.

  20. Synthesis of Silver Nanoparticles from the Aqueous Extract of Leaves of Ocimum sanctum for Enhanced Antibacterial Activity

    Directory of Open Access Journals (Sweden)

    Charusheela Ramteke


    Full Text Available The field of nanotechnology is the most active area of research in modern materials science. Though there are many chemical as well as physical methods, green synthesis of nanomaterials is the most emerging method of synthesis. We report the synthesis of antibacterial silver nanoparticles (AgNPs using leaf broth of medicinal herb, Ocimum sanctum (Tulsi. The synthesized AgNPs have been characterized by UV-Vis spectroscopy, transmission electron microscopy (TEM, and X-ray diffractometry. The mean particle of synthesized NPs was found to be 18 nm, as confirmed by TEM. The qualitative assessment of reducing potential of leaf extract has also been carried out which indicated presence of significant amount of reducing entities. FTIR analysis revealed that the AgNPs were stabilized by eugenols, terpenes, and other aromatic compounds present in the extract. Such AgNPs stabilized by Tulsi leaf extract were found to have enhanced antimicrobial activity against well-known pathogenic strains, namely Staphylococcus aureus and E. coli.

  1. Efecto antimicrobiano de extractos etanólicos de albahaca (Ocimum basilicum L. sobre el crecimiento de Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Julio Colivet


    Full Text Available La albahaca (Ocimum basilicum L. es una planta herbácea de la familia de las labiadas (Lamiaceae, muy común en Venezuela. En la presente investigación se evaluó la supervivencia de una cepa de Staphylococcus aureus por la acción antimicrobiana de extractos etanólicos de albahaca fresca y seca. Las muestras frescas fueron sometidas a homogeneización en licuadora. Para la obtención de las muestras secas se utilizó una estufa convencional a temperatura de 55 ºC x 28 horas. Los extractos se obtuvieron por destilación a presión reducida, temperatura de 45 ºC y empleando etanol como solvente. Posteriormente, se emplearon en medios de cultivo contentivos de S. aureus y se monitoreó el crecimiento del microorganismo en el tiempo, obteniéndose los parámetros de crecimiento a través del modelo de Baranyi y Roberts (1994. Los extractos frescos y secos produjeron efecto antimicrobiano sobre S. aureus a concentraciones de 5 y 10 %, afectando los parámetros de crecimiento de la bacteria, presentando diferencias estadísticamente significativas (p < 0,05 con respecto al grupo control.

  2. Antibacterial efficacy of Mangifera indica L. kernel and Ocimum sanctum L. leaves against Enterococcus faecalis dentinal biofilm (United States)

    Subbiya, Arunajatesan; Mahalakshmi, Krishnan; Pushpangadan, Sivan; Padmavathy, Kesavaram; Vivekanandan, Paramasivam; Sukumaran, Vridhachalam Ganapathy


    Introduction: The Enterococcus faecalis biofilm in the root canal makes it difficult to be eradicated by the conventional irrigants with no toxicity to the tissues. Hence, plant products with least side effects are explored for their use as irrigants in the root canal therapy. Aim: To evaluate and compare the antibacterial efficacy of Mangifera indica L. kernel (mango kernel) and Ocimum sanctum L. leaves (tulsi) extracts with conventional irrigants (5% sodium hypochlorite (NaOCl) and 2% chlorhexidine) against E. faecalis dentinal biofilm. Materials and Methods: Agar diffusion and broth microdilution assay was performed with the herbal extracts and conventional irrigants (2% chlorhexidine and 5% NaOCl) against E. faecalis planktonic cells. The assay was extended onto 3 week E. faecalis dentinal biofilm. Results: Significant reduction of colony forming units (CFU)/mL was observed for the herbal groups and the antibacterial activity of the herbal groups was at par with 5% NaOCl. Conclusions: The antibacterial activity of these herbal extracts is found to be comparable with that of conventional irrigants both on the biofilm and planktonic counterparts. PMID:24082577

  3. Comunidade de insetos visitantes florais de Ocimum selloi Benth (Lamiaceae em Santa Cruz do Sul, RS, Brasil

    Directory of Open Access Journals (Sweden)

    Karine Schoeninger


    Full Text Available Este trabalho objetivou listar a comunidade de visitantes florais de Ocimum selloi, indicar os potenciais polinizadores e seus padrões de visitação. A coleta dos visitantes florais ocorreu no ano de 2007, em área antropofizada, sendo analisada a constância e a dominância dos táxons. Coletou-se um total de 653 insetos, pertencentes a sete ordens; Hymenoptera, com 370 indivíduos, foi o grupo mais representativo. Foram identificadas 36 famílias, sendo 12 de Hymenoptera e oito de Diptera, as mais diversas. Apidae foi a família com maior constância e dominância compreendida, principalmente, pela abelha Apis mellifera L., 1758 (n = 223, seguida de Halictidae (n = 107. A maior atividade forrageira foi observada no horário entre as 9h e 11h da manhã. Constatou-se que A. mellifera foi o principal visitante floral e potencial polinizador de O. selloi.

  4. Evaluation of Antioxidant and Antimicrobial Activities and Phenolic Profile for Hyssopus officinalis, Ocimum basilicum and Teucrium chamaedrys

    Directory of Open Access Journals (Sweden)

    Laurian Vlase


    Full Text Available This study was designed to examine the in vitro antioxidant and antimicrobial activities and to characterize the polyphenolic composition of the ethanolic extracts of Hyssopus officinalis, Ocimum basilicum and Teucrium chamaedrys. Qualitative and quantitative analysis of the major phenolic compounds were conducted using high-performance liquid chromatography coupled to mass spectrometry (HPLC-MS. The total polyphenols, caffeic acid derivatives and flavonoids content was spectrophotometrically determined. The phenolic profile showed the presence of phenolic acid derivatives (caftaric, gentisic, caffeic, p-coumaric, chlorogenic and ferulic acids, flavonoid glycosides (rutin, isoquercitrin and quercitrin and free flavonoid aglycons (luteolin, quercetin, in different concentrations. DPPH radical scavenging assay, Trolox equivalent antioxidant capacity (TEAC method, hemoglobin ascorbate peroxidase activity inhibition (HAPX assay, and electron paramagnetic resonance (EPR radicals detection were employed, revealing several aspects of the antioxidant activities of these species. The antimicrobial tests were performed using the disk diffusion assay. These extracts contained a large amount of the polyphenolic compounds (77.72, 175.57, and 243.65 mg/g, respectively, and they showed a good antioxidant activity, as witnessed by a number of methods. T. chamaedrys had a high antimicrobial activity. Besides their antioxidant activity, the antimicrobial effect of these extracts confirms the biological activities of these herbal medicinal products.

  5. Evaluation of in vitro anticancer activity of Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris.

    Directory of Open Access Journals (Sweden)

    Mandana Behbahani

    Full Text Available The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231 and normal breast cell line (MCF 10A. The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative Real Time PCR. Three active fractions were detected by nuclear magnetic resonance as lutein, lupeol and eugenol, respectively, in C. officinalis, A. maurorum and O. basilicum. These compounds and their epoxidized forms were also detected in their parasite C. campestris. The cytotoxic activity of lutein epoxide, lupeol epoxide and eugenol epoxide was significantly more than lutein, lupeol and eugenol. The mRNA expression level of p53, caspase-3 and bax genes were increased in both cancer cells treated with all pure compounds. However, bcl-2 gene expression decreased in treated breast cancer cells. In conclusion, all the data indicated that the epoxide forms of lupeol, lutein and eugenol are potential drug candidates for inducing apoptosis in human breast cancer cells.

  6. Essential Oil of Ocimum basilicum L. and (−-Linalool Blocks the Excitability of Rat Sciatic Nerve

    Directory of Open Access Journals (Sweden)

    Antonio Medeiros Venancio


    Full Text Available The racemate linalool and its levogyrus enantiomer [(−-LIN] are present in many essential oils and possess several pharmacological activities, such as antinociceptive and anti-inflammatory. In this work, the effects of essential oil obtained from the cultivation of the Ocimum basilicum L. (EOOb derived from Germplasm Bank rich in (−-LIN content in the excitability of peripheral nervous system were studied. We used rat sciatic nerve to investigate the EOOb and (−-LIN effects on neuron excitability and the extracellular recording technique was used to register the compound action potential (CAP. EOOb and (−-LIN blocked the CAP in a concentration-dependent way and these effects were reversible after washout. EOOb blocked positive amplitude of 1st and 2nd CAP components with IC50 of 0.38±0.2 and 0.17±0.0 mg/mL, respectively. For (−-LIN, these values were 0.23±0.0 and 0.13±0.0 mg/mL. Both components reduced the conduction velocity of CAP and the 2nd component seems to be more affected than the 1st component. In conclusion EOOb and (−-LIN inhibited the excitability of peripheral nervous system in a similar way and potency, revealing that the effects of EOOb on excitability are due to the presence of (−-LIN in the essential oil.

  7. Anti-inflammatory and antiedematogenic activity of the Ocimum basilicum essential oil and its main compound estragole: In vivo mouse models. (United States)

    Rodrigues, Lindaiane Bezerra; Oliveira Brito Pereira Bezerra Martins, Anita; Cesário, Francisco Rafael Alves Santana; Ferreira E Castro, Fyama; de Albuquerque, Thaís Rodrigues; Martins Fernandes, Maria Neyze; Fernandes da Silva, Bruno Anderson; Quintans Júnior, Lucindo José; da Costa, José Galberto Martins; Melo Coutinho, Henrique Douglas; Barbosa, Roseli; Alencar de Menezes, Irwin Rose


    The genus Ocimum are used in cooking, however, their essential oils are utilized in traditional medicine as aromatherapy. The present study was carried out to investigate the chemical composition and systemic anti-inflammatory activity of the Ocimum basilicum essential oil (EOOB) and its major component estragole, as well as its possible mechanisms of action. The Ocimum basilicum essential oil was obtained by hydrodistillation and analyzed by GC-MS. The anti-inflammatory action was verified using acute and chronic in vivo tests as paw edema, peritonitis, and vascular permeability and granulomatous inflammation model. The anti-inflammatory mechanism of action was analyzed by the participation of histamine and arachidonic acid pathways. The chemical profile analysis identified fourteen components present in the essential oil, within them: estragole (60.96%). The in vivo test results show that treatment with EOOB (100 and 50 mg/kg) and estragole (60 and 30 mg/kg) significantly reduced paw edema induced by carrageenan and dextran. The smallest doses of EOOB (50 mg/kg) and estragole (30 mg/kg) showed efficacy in the reduction of paw edema induced by histamine and arachidonic acid, vascular permeability inhibition and leukocyte emigration in the peritoneal fluid. Theses doses were capable of reducing the chronic inflammatory process. The results observed between the EOOB and estragole demonstrate efficacy in anti-inflammatory activity, however, the essential oil is more efficacious in the acute and chronic anti-inflammatory action. This study confirms the therapeutic potential of this plant and reinforces the validity of its use in popular medicine. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  8. ESR-based Identification of Radiation-Induced Free Radicals in Gamma-Irradiated Basil and Clove Using Different Sample Pre-Treatments

    International Nuclear Information System (INIS)

    Kwak, J.Y.; Ahn, J.J.; Kashif Akram; Kwon, J.H.


    An improved detection of radiation-induced paramagnetic faults was developed to identify the irradiation status of basil and clove. The effectiveness of different sample pretreatments, including freeze-drying (FD), oven-drying (OD), alcoholic-extraction (AE), and water-washing and alcoholic-extraction (WAE), were examined. All non-irradiated samples showed a single central signal (g 0 = 2.006), whereas radicals representing two additional side peaks (g 1 = 2.023 and g 2 = 1.986) with a mutual distance of 6 mT were detected in the irradiated samples. AE and WAE produced the best results for irradiated clove in terms of intensities of radiation-specific ESR signals and their ratios to the central signal. However, FD provided the highest intensities of radiation-specific ESR signals for basil, whereas their ratios to the major signal were better in the cases of AE and WAE. Signal noise, particularly due to Mn 2+ signals, was observed, whereas it decreased in AE and WAE pretreatments. Based on our results, AE and WAE can improve the detection conditions for radiation-specific ESR signals in irradiated samples. (author)

  9. New design of experiment combined with UV-Vis spectroscopy for extraction and estimation of polyphenols from Basil seeds, Red seeds, Sesame seeds and Ajwan seeds (United States)

    Mabood, Fazal; Gilani, Syed Abdullah; Hussain, Javid; Alshidani, Sulaiman; Alghawi, Said; Albroumi, Mohammed; Alameri, Saif; Jabeen, Farah; Hussain, Zahid; Al-Harrasi, Ahmed; Al Abri, Zahra K. M.; Farooq, Saima; Naureen, Zakira; Hamaed, Ahmad; Rasul Jan, M.; Shah, Jasmin


    New experimental designs for the extraction of polyphenols from different seeds including Basil seed, Red seed, Sesame seeds and Ajwan seeds were investigated. Four variables the concentration and volume of methanol and NaOH solutions as well as the temperature and time of extraction were varied to see their effect on total phenol extraction. The temperature was varied in the range from 25 °C to 200 °C while the time in the range from 30 to 200 minutes. Response surface methodology was used to optimize the extraction parameters. The estimation of polyphenols was measured through phenols reduction UV-Vis spectroscopic method of phosphotungstic-phosphomolybdic acids (Folin-Ciocalteu's reagent). Calibration curve was made by using tannic acid as a polyphenols standard in the concentration range from 0.1 to 10 ppm. The regression line obtained shows the value of correlation coefficient i.e. R = 0.930 and Root mean square error of cross validation (RMSEC) value of 0.0654. The Basil seeds were found containing the highest amount of total phenols i.e. 785.76 mg/100 g. While the Sesame seeds having the least amount i.e. 33.08 mg/100 g. The Ajwan seeds and the Red seeds are containing the medium amounts i.e. 379 mg/100 g and 220.54 mg/100 g respectively.

  10. New design of experiment combined with UV-Vis spectroscopy for extraction and estimation of polyphenols from Basil seeds, Red seeds, Sesame seeds and Ajwan seeds. (United States)

    Mabood, Fazal; Gilani, Syed Abdullah; Hussain, Javid; Alshidani, Sulaiman; Alghawi, Said; Albroumi, Mohammed; Alameri, Saif; Jabeen, Farah; Hussain, Zahid; Al-Harrasi, Ahmed; Al Abri, Zahra K M; Farooq, Saima; Naureen, Zakira; Hamaed, Ahmad; Rasul Jan, M; Shah, Jasmin


    New experimental designs for the extraction of polyphenols from different seeds including Basil seed, Red seed, Sesame seeds and Ajwan seeds were investigated. Four variables the concentration and volume of methanol and NaOH solutions as well as the temperature and time of extraction were varied to see their effect on total phenol extraction. The temperature was varied in the range from 25°C to 200°C while the time in the range from 30 to 200minutes. Response surface methodology was used to optimize the extraction parameters. The estimation of polyphenols was measured through phenols reduction UV-Vis spectroscopic method of phosphotungstic-phosphomolybdic acids (Folin-Ciocalteu's reagent). Calibration curve was made by using tannic acid as a polyphenols standard in the concentration range from 0.1 to 10ppm. The regression line obtained shows the value of correlation coefficient i.e. R=0.930 and Root mean square error of cross validation (RMSEC) value of 0.0654. The Basil seeds were found containing the highest amount of total phenols i.e. 785.76mg/100g. While the Sesame seeds having the least amount i.e. 33.08mg/100g. The Ajwan seeds and the Red seeds are containing the medium amounts i.e. 379mg/100g and 220.54mg/100g respectively. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. 1540-IJBCS-Article-Do Moukpevi Réné+

    African Journals Online (AJOL)


    acide désoxyribonucléique (ADN). Aïdam AV. 2005. Etablissement des cultures organisées d'Ocimum gratissimum L. et d'Ocimum basilicum L. en vue de la production de composés d'intérêts thérapeutiques et phytosanitaires. Thèse de doctorat en Physiologie et. Biotechnologie végétales, Université de. Lomé, Togo, 158 p ...

  12. 986-IJBCS-Article-Dr Niebie Roger

    African Journals Online (AJOL)


    basilicum L. sur le rendement d'extraction, la composition chimique de l'huile essentielle et son pouvoir ... parfumerie cosmétique et pesticides (Darrah, ...... Protective effect of basil (Ocimum ... composition and antimicrobial properties.

  13. Original Research

    African Journals Online (AJOL)



    Dec 21, 2014 ... Natural plant extracts are promising alternatives for chemical food additives and ... pesticides. ..... Table 2: Determination of antifungal properties of oil extracts by disk .... concentration of sweet basil (Ocimum basilicum), cassia.

  14. Antagonistic activity of Ocimum sanctum L. essential oil on growth and zearalenone production by Fusarium graminearum in maize grains

    Directory of Open Access Journals (Sweden)

    Naveen Kumar eKalagatur


    Full Text Available The present study was aimed to establish the antagonistic effects of Ocimum sanctum L. essential oil (OSEO on growth and zearalenone (ZEA production of Fusarium graminearum. GC-MS chemical profiling of OSEO revealed the existence of 43 compounds and the major compound was found to be eugenol (34.7%. DPPH free radical scavenging activity (IC50 of OSEO was determined to be 8.5µg/mL. Minimum inhibitory concentration (MIC and minimum fungicidal concentration (MFC of OSEO on F. graminearum were recorded as 1250 µg/mL and 1800 µg/mL, respectively. Scanning electron microscope observations showed significant micro morphological damage in OSEO exposed mycelia and spores compared to untreated control culture. Quantitative UHPLC studies revealed that OSEO negatively effected the production of ZEA; the concentration of toxin production was observed to be insignificant at 1500 µg/mL concentration of OSEO. On other hand ZEA concentration was quantified as 3.23 µg/mL in OSEO untreated control culture. Reverse transcriptase qPCR analysis of ZEA metabolic pathway genes (PKS4 and PKS13 revealed that increase in OSEO concentration (250 µg/mL to 1500 µg/mL significantly downregulated the expression of PKS4 and PKS13. These results were in agreement with the artificially contaminated maize grains as well. In conlusion, the antifungal and antimycotoxic effects of OSEO on F. graminearum in the present study reiterated that, the essential oil of O. sanctum could be a promising herbal fungicide in food processing industries as well as grain storage centers.

  15. An insight into structural and functional characteristics of 3-hydoxy 3-methyl glutarylCoA reductase from Ocimum species

    Directory of Open Access Journals (Sweden)

    Shilpi Bansal


    Full Text Available Secondary metabolites, the biological compounds secreted by plants as an aid to support their growth and development under stress conditions or as a part of their defense mechanism, now hold equal importance for mankind who employs it immensely for medication, flavorings, aroma, etc. Wide applicability of these compounds instigates one to understand the biosynthesis, structure and regulation of these bioactive molecules. Terpenoids form the largest group of secondary metabolites which comprise of a wide range of structurally and functionally distinct metabolites synthesized either via mevalonate pathway or non-mevalonate pathway. Targeting a key regulatory enzyme of this pathway, modulation of which would alter the carbon flux would be beneficial to enhance our knowledge about the above issue. For this the transcriptome (from SRA of different Ocimum species was mined out for important pathway genes using various bioinformatics approaches. Amongst them 3-hydoxy 3-methyl glutaryl CoA reductase (HMGR was selected which is the rate limiting enzyme in mevalonate pathway which controls the conversion of HMG-CoA to mevalonic acid. Isolation, cloning, protein expression, purification, etc. would be discussed in detail in the meeting. Full length protein was also characterized through bioinformatics tools to study its structure, properties, conserved domains, etc. Increase in secondary metabolite production by alteration of HMGR pool along with transcript modulation studies in planta revealed that HMGR gene governs the biosynthesis of secondary metabolites. Transcriptome mapping of different HMGR homologs which on comparison within member of same genus revealed its divergent nature which could account to its multifunctional role in different plants. Besides, providing a deep insight about the enzyme function combination of such molecular, transgenic and bioinformatics tools would help to develop strategies to engineer the HMGR mediated flux and also

  16. Effect of combination of Phyllanthus emblica, Tinospora cordifolia, and Ocimum sanctum on spatial learning and memory in rats

    Directory of Open Access Journals (Sweden)

    Harshad O Malve


    Full Text Available Background: There has been a steady rise in number of patients suffering from dementia including dementia associated with Alzheimer′s disease. Effective treatment of Alzheimer′s disease dementia is an unmet medical need. Objective: To evaluate effects of formulation containing combination of Phyllanthus emblica (Pe and Tinospora cordifolia (Tc with and without Ocimum sanctum (Os on learning and memory performance of normal and memory impaired rats in complex maze and compare with effects of Tinospora cordifolia and Phyllanthus emblica alone. Materials and Methods: Wistar rats; either sex (100-150 g were divided in seven groups Control, Piracetam, Rivastigmine, Tc, Pe, Formulation 1 (Tc + Pe, and Formulation 2 (Tc + Pe + Os.The study was divided in four parts: In part 1 memory enhancement was tested in normal rats. In part 2, 3, and 4 the effects of drugs were tested in Scopolamine-, Diazepam-, and Cyclosporine-induced amnesia. Hebb-Williams maze was used to test for learning and memory. Time required to trace food and number of errors in maze were noted. Results: In normal rats, all test drugs showed significant reduction in time required to trace the food and number of errors after 24 h compared with vehicle control. Formulations 1 and 2 reduced the time required to trace food and number of errors and the results were comparable with positive control groups and comparators Tc and Pe. Formulations 1 and 2 reversed amnesia produced by Scopolamine, Diazepam, and Cyclosporine when compared with vehicle control and showed comparable results with those of positive control groups and comparators Tc and Pe. Conclusion: Formulations 1 and 2 demonstrated nootropic activity and both the formulations showed comparable nootropic activity with that of Tc and Pe alone.

  17. Effect of Curcuma longa and Ocimum sanctum on myocardial apoptosis in experimentally induced myocardial ischemic-reperfusion injury (United States)

    Mohanty, Ipseeta; Arya, Dharamvir Singh; Gupta, Suresh Kumar


    Background In the present investigation, the effect of Curcuma longa (Cl) and Ocimum sanctum (Os) on myocardial apoptosis and cardiac function was studied in an ischemia and reperfusion (I-R) model of myocardial injury. Methods Wistar albino rats were divided into four groups and orally fed saline once daily (sham, control IR) or Cl (100 mg/kg; Cl-IR) or Os (75 mg/kg; Os-IR) respectively for 1 month. On the 31st day, in the rats of the control IR, Cl-IR and Os-IR groups LAD occlusion was undertaken for 45 min, and reperfusion was allowed for 1 h. The hemodynamic parameters{mean arterial pressure (MAP), heart rate (HR), left ventricular end-diastolic pressure (LVEDP), left ventricular peak positive (+) LVdP/dt (rate of pressure development) and negative (-) LVdP/dt (rate of pressure decline)} were monitored at pre-set points throughout the experimental duration and subsequently, the animals were sacrificed for immunohistopathological (Bax, Bcl-2 protein expression & TUNEL positivity) and histopathological studies. Results Chronic treatment with Cl significantly reduced TUNEL positivity (p < 0.05), Bax protein (p < 0.001) and upregulated Bcl-2 (p < 0.001) expression in comparison to control IR group. In addition, Cl demonstrated mitigating effects on several myocardial injury induced hemodynamic {(+)LVdP/dt, (-) LVdP/dt & LVEDP} and histopathological perturbations. Chronic Os treatment resulted in modest modulation of the hemodynamic alterations (MAP, LVEDP) but failed to demonstrate any significant antiapoptotic effects and prevent the histopathological alterations as compared to control IR group. Conclusion In the present study, significant cardioprotection and functional recovery demonstrated by Cl may be attributed to its anti-apoptotic property. In contrast to Os, Cl may attenuate cell death due to apoptosis and prevent the impairment of cardiac performance. PMID:16504000

  18. Triterpenoids from Ocimum labiatum Activates Latent HIV-1 Expression In Vitro: Potential for Use in Adjuvant Therapy

    Directory of Open Access Journals (Sweden)

    Petrina Kapewangolo


    Full Text Available Latent HIV reservoirs in infected individuals prevent current treatment from eradicating infection. Treatment strategies against latency involve adjuvants for viral reactivation which exposes viral particles to antiretroviral drugs. In this study, the effect of novel triterpenoids isolated from Ocimum labiatum on HIV-1 expression was measured through HIV-1 p24 antigen capture in the U1 latency model of HIV-1 infection and in peripheral blood mononuclear cells (PBMCs of infected patients on combination antiretroviral therapy (cART. The mechanism of viral reactivation was determined through the compound’s effect on cytokine production, histone deacetylase (HDAC inhibition, and protein kinase C (PKC activation. Cytotoxicity of the triterpenoids was determined using a tetrazolium dye and flow cytometry. The isolated triterpene isomers, 3-hydroxy-4,6a,6b,11,12,14b-hexamethyl-1,2,3,4,6,6a,6b,7,8,8a,9,10,11,12,12a,14,14a,14b-octadecahydropicene-4,8a-dicarboxylic acid (HHODC, significantly (p < 0.05 induced HIV-1 expression in a dose-dependent manner in U1 cells at non-cytotoxic concentrations. HHODC also induced viral expression in PBMCs of HIV-1 infected patients on cART. In addition, the compound up-regulated the production of interleukin (IL-2, IL-6, tumour necrosis factor (TNF-α, and interferon (IFN-γ but had no effect on HDAC and PKC activity, suggesting cytokine upregulation as being involved in latency activation. The observed in vitro reactivation of HIV-1 introduces the adjuvant potential of HHODC for the first time here.

  19. Effect of Processing on the Elemental Composition of Selected Leafy ...

    African Journals Online (AJOL)

    The elemental composition of leaves of Vernonia amygdalina, Gnetum africana, Gongronema latifolium and Ocimum gratissimum subjected to different processing methods were investigated. Processing methods employed include oven drying, sun drying, fresh milling, steaming and a combination of these while the mineral ...

  20. Evaluating the ethyl-acetate fraction of crude methanol leaf extract of ...

    African Journals Online (AJOL)

    Ointment formulations of the ethyl acetate fraction of the crude methanol leaf extract of Ocimum gratissimum was in this study evaluated for wound healing activities in rat using the excision wound model. The air-dried and pulversied leaves were extracted with methanol in a Soxhlet extraction apparatus to obtain the ...

  1. Leaf storage conditions and genomic DNA isolation efficiency in ...

    African Journals Online (AJOL)



    Mar 4, 2008 ... Storage of plant tissues for DNA is important to avoid degradation of DNA. Preliminary studies were conducted on Ocimum gratissimum L. in order to establish the storage conditions for the collected samples before DNA extraction. Secondly, the aim was to determine the best protocol for the extraction.

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 4051 - 4100 of 11090 ... Vol 6, No 18 (2007), Effects of aqueous leaves extract of Ocimum gratissimum on blood glucose levels of streptozocininduced diabetic wistar rats, Abstract ... Vol 11, No 15 (2012), Effects of bran, shorts and feed flour by ultra-fine grinding on rheological characteristics of dough and bread qualities ...

  3. Chemical composition, antioxidant effects and antimicrobial ...

    African Journals Online (AJOL)

    Thymus vulgaris, Cinnamomum zeylanicum and Ocimum gratissimum are spices widely used as aroma enhancers and food preservatives. This work assessed the chemical composition, antioxidant and antimicrobial effect of their essential oils on some food pathogenic bacteria, namely, Staphylococcus aureus, Citrobacter ...

  4. Leaf storage conditions and genomic DNA isolation efficiency in ...

    African Journals Online (AJOL)

    Storage of plant tissues for DNA is important to avoid degradation of DNA. Preliminary studies were conducted on Ocimum gratissimum L. in order to establish the storage conditions for the collected samples before DNA extraction. Secondly, the aim was to determine the best protocol for the extraction of high quality DNA, ...

  5. BKR.2013.023 (Galley_Proof)

    African Journals Online (AJOL)

    Femi Olorunniji


    Aug 20, 2013 ... Poloniae Pharmaceutica 68: 541−547. Ejele AE, Duru IA, Oze RN, Iwu IC and Ogukwe CE (2012). Comparison of antimicrobial potential of Piper umbellatum,. Piper guineense, Ocimum gratissimum andNewbouldia laevis extracts. International Research Journal of. Biochemistry and Bioinformatics 2: 36−40.

  6. Download this PDF file

    African Journals Online (AJOL)

    Conclusion: This study showed initial evidence of the use of plant materials by ..... Ocimum gratissimum L. Esrou,Deveti. 1197FDS/UL /3892. FDS/UL. 0,04. WP ..... properties of plant extracts have been widely shown in several studies(Kim et ...

  7. Effect of Some Plant Extracts on the Microbial Spoilage of Cajanus ...

    African Journals Online (AJOL)

    The effect of ethanolic extracts of seven plant sources on the microbial spoilage of Cajanus cajan extract was investigated. The results showed that the extracts obtained from Aloe vera, bitter leaf, Gultiferae (garcinia or bitter kola), Ocimum gratissimum (scent leaf) and Zingiber officialae (ginger) were effective against ...

  8. Nigerian Food Journal - Vol 28, No 2 (2010)

    African Journals Online (AJOL)

    Nigerian Food Journal. ... The effect of inorganic fertilizer treatment on the mineral and vitamin content of the leaves of Ocimum gratissimum (l) · EMAIL FULL TEXT ... Functional foods, nutriceuticals and health · EMAIL FULL TEXT EMAIL FULL TEXT ... A Banso, P.O Ayodele, A.G Jiya ... V.C Ezeocha, G.I Onwuka, 210-216.

  9. SORO ET AL.pmd

    African Journals Online (AJOL)


    Furthermore, the application of mancozeb, or the essential oil of Ocimum gratissimum on tomato plants inoculated reduced the ... the dry foliar biomass by more than 40 % for the Tropimech cultivar, the most sensitive tomato variety to Forl. Key words : Antifungal ..... Melaleuca alternifolia (tea tree) oil. J. Appl. Microbiol.

  10. Anti-cryptococcal activity of ethanol crude extract and hexane fraction from Ocimum basilicum var. Maria bonita: mechanisms of action and synergism with amphotericin B and Ocimum basilicum essential oil. (United States)

    Cardoso, Nathalia N R; Alviano, Celuta S; Blank, Arie F; Arrigoni-Blank, Maria de Fátima; Romanos, Maria Teresa V; Cunha, Marcel M L; da Silva, Antonio Jorge R; Alviano, Daniela S


    Ocimum basilicum L. (Lamiaceae) has been used in folk medicine to treat headaches, kidney disorders, and intestinal worms. This study evaluates the anti-cryptococcal activity of ethanol crude extract and hexane fraction obtained from O. basilicum var. Maria Bonita leaves. The MIC values for Cryptococcus sp. were obtained according to Clinical and Laboratory Standards Institute in a range of 0.3-2500 μg/mL. The checkerboard assay evaluated the association of the substances tested (in a range of 0.099-2500 μg/mL) with amphotericin B and O. basilicum essential oil for 48 h. The ethanol extract, hexane fraction and associations in a range of 0.3-2500 μg/mL were tested for pigmentation inhibition after 7 days of treatment. The inhibition of ergosterol synthesis and reduction of capsule size were evaluated after the treatment with ethanol extract (312 μg/mL), hexane fraction (78 μg/mL) and the combinations of essential oil + ethanol extract (78 μg/mL + 19.5 μg/mL, respectively) and essential oil + hexane fraction (39.36 μg/mL + 10 μg/mL, respectively) for 24 and 48 h, respectively. The hexane fraction presented better results than the ethanol extract, with a low MIC (156 μg/mL against C. neoformans T 444 and 312 μg/mL against C. neoformans H99 serotype A and C. gattii WM779 serotype C). The combination of the ethanol extract and hexane fraction with amphotericin B and essential oil enhanced their antifungal activity, reducing the concentration of each substance needed to kill 100% of the inoculum. The substances tested were able to reduce the pigmentation, capsule size and ergosterol synthesis, which suggest they have important mechanisms of action. These results provide further support for the use of ethanol extracts of O. basilicum as a potential source of antifungal agents.

  11. Merci esotiche che viaggiano verso occidente: la cornice e la figura del narratore popolare a partire da una lettura del Cunto de li cunti di Basile

    Directory of Open Access Journals (Sweden)

    Elena Massi


    Full Text Available One of the most precious goods we have gained from the East is the literary frame. Certain of its functions are observable from its early history, in the Middle Ages. In Eastern countries, ”the frame” was a communicative tool to express judgement and opinions in public according to different social conditions. In Western countries, it is still used as an   to express judgement, but only in the literary world. Eric Auerbach in Zur Technik der Fruhrenaissancenovelle in Italien und Frankreich says that from Dante to Boccaccio, the literary frame becomes the story's atmosphere and its barycentre because it offers writers the possibility to organize the relationship between text and context. In my hypothesis, Auerbach's words can work to introduce a narratological function to the literary frame. We notice other two functions: an anthropological one explained by Tzvetan Todorov in La conquête de l'Amérique and a psychological one showed by Andrè Jolles in De Decameron van Boccaccio. According to Tzvetan Todorov, in the seventeenth century, missionaries used literary frames to communicate with native Americans: in Historia general de las cosas de la Nueva España by Bernardino de Sahagún, a literary frame is used to organize different cultural knowledges. Andrè Jolles metaphorically says that thanks to literary frames, we are still able to listen to the voices of popular narrators because the literary frame reproduces cognitive structures typical of children. I propose to show these functions in the Cunto de li cunti by Basile. In this way, we can observe the modernity of Basile. The Neapolitan author not only founded the fairytale genre in Europe. He also contributed to spread a universal communicative form we can observe from three points of view: narratological, anthropological, and psychological.

  12. Dissecting molecular and physiological response mechanisms to high solar radiation in cyanic and acyanic leaves: a case study on red and green basil. (United States)

    Tattini, Massimiliano; Sebastiani, Federico; Brunetti, Cecilia; Fini, Alessio; Torre, Sara; Gori, Antonella; Centritto, Mauro; Ferrini, Francesco; Landi, Marco; Guidi, Lucia


    Photosynthetic performance and the expression of genes involved in light signaling and the biosynthesis of isoprenoids and phenylpropanoids were analysed in green ('Tigullio', TIG) and red ('Red Rubin', RR) basil. The aim was to detect the physiological and molecular response mechanisms to high sunlight. The attenuation of blue-green light by epidermal anthocyanins was shown to evoke shade-avoidance responses with consequential effects on leaf morpho-anatomical traits and gas exchange performance. Red basil had a lower mesophyll conductance, partially compensated by the less effective control of stomatal movements, in comparison with TIG. Photosynthesis decreased more in TIG than in RR in high sunlight, because of larger stomatal limitations and the transient impairment of PSII photochemistry. The methylerythritol 4-phosphate pathway promoted above all the synthesis and de-epoxidation of violaxanthin-cycle pigments in TIG and of neoxanthin and lutein in RR. This enabled the green leaves to process the excess radiant energy effectively, and the red leaves to optimize light harvesting and photoprotection. The greater stomatal closure observed in TIG than in RR was due to enhanced abscisic acid (ABA) glucose ester deglucosylation and reduced ABA oxidation, rather than to superior de novo ABA synthesis. This study shows a strong competition between anthocyanin and flavonol biosynthesis, which occurs at the level of genes regulating the oxidation of the C2-C3 bond in the dihydro-flavonoid skeleton. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email:

  13. Microbial community profiling of fresh basil and pitfalls in taxonomic assignment of enterobacterial pathogenic species based upon 16S rRNA amplicon sequencing. (United States)

    Ceuppens, Siele; De Coninck, Dieter; Bottledoorn, Nadine; Van Nieuwerburgh, Filip; Uyttendaele, Mieke


    Application of 16S rRNA (gene) amplicon sequencing on food samples is increasingly applied for assessing microbial diversity but may as unintended advantage also enable simultaneous detection of any human pathogens without a priori definition. In the present study high-throughput next-generation sequencing (NGS) of the V1-V2-V3 regions of the 16S rRNA gene was applied to identify the bacteria present on fresh basil leaves. However, results were strongly impacted by variations in the bioinformatics analysis pipelines (MEGAN, SILVAngs, QIIME and MG-RAST), including the database choice (Greengenes, RDP and M5RNA) and the annotation algorithm (best hit, representative hit and lowest common ancestor). The use of pipelines with default parameters will lead to discrepancies. The estimate of microbial diversity of fresh basil using 16S rRNA (gene) amplicon sequencing is thus indicative but subject to biases. Salmonella enterica was detected at low frequencies, between 0.1% and 0.4% of bacterial sequences, corresponding with 37 to 166 reads. However, this result was dependent upon the pipeline used: Salmonella was detected by MEGAN, SILVAngs and MG-RAST, but not by QIIME. Confirmation of Salmonella sequences by real-time PCR was unsuccessful. It was shown that taxonomic resolution obtained from the short (500bp) sequence reads of the 16S rRNA gene containing the hypervariable regions V1-V3 cannot allow distinction of Salmonella with closely related enterobacterial species. In conclusion 16S amplicon sequencing, getting the status of standard method in microbial ecology studies of foods, needs expertise on both bioinformatics and microbiology for analysis of results. It is a powerful tool to estimate bacterial diversity but amenable to biases. Limitations concerning taxonomic resolution for some bacterial species or its inability to detect sub-dominant (pathogenic) species should be acknowledged in order to avoid overinterpretation of results. Copyright © 2017 Elsevier B


    Directory of Open Access Journals (Sweden)

    Eduardo L\\u00F3pez-Blancas


    Full Text Available Actividad antioxidante y enzimática de albahaca “Nufar” ( Ocimum basilicum L. almacenada en refrigeración. El presente estudio tuvo como objetivo evaluar el efecto del almacenamiento en refrigeración sobre la actividad antioxidante y actividad enzimática en albahaca ‘Nufar’. En la Universidad Aut ónoma Chapingo (Texcoco, México, durante el ciclo primavera-verano de 2012, albahaca preciclo primavera-verano de 2012, albahaca previamente empacada en película plástica, se almacenó en cámaras frigoríficas a 5 y 10 °C , y a temperatura ambiente (20 °C - testigo, por dieciocho días. Cada 48 horas, se evaluó el contenido de fenoles totales, capacidad antioxidante y la actividad de las enzimas catalasa, superóxido dismutasa, peroxidasa y polifenol oxidasa. En relación con el tiempo en refrigeración a 5 °C a los dos y cuatro días se presentó la mayor actividad de catalasa (14,3 U/mg/pro y superóxido dismutasa (2,9 U/mg/pro, y a los diez y dieciocho días hubo aumento de la actividad de peroxidasa (57,6 y 74,9 U/ mg/pro. A 10 °C y diez días se incrementó el contenido de fenoles totales de 3,7 a 4,2 mg/kg/PFr; así como la capacidad antioxidante de 47,5 a 79,1 mg VCEAC/g/PFr a ocho días; también aumentó la actividad de la polifenol oxidasa de 11,7 a 31,8 U/mg/pro a diez días. El almacenamiento a 5 °C afectó el contenido de fenoles totales y capacidad antioxidante, así como la actividad enzimática de peroxidasa y polifenol oxidasa, e incrementó la actividad de catalasa y superóxido dismutasa, por lo cual, se sugiere el almacenamiento de albahaca “nufar” a 10 °C para disminuir la actividad de las enzimas oxidativas.

  15. Yaldiz et al., Afr J Tradit Complement Altern Med. (2015) 12(6):71-76

    African Journals Online (AJOL)


    Background: Ocimum basilicum L., commonly known as sweet basil, is an important aromatic plant cultivated in many parts of the world for its essential oil. Basil does not show natural distribution in Turkey but they are cultivated as medicinal, seasoning or oil plants especially in the western and southern Anatolia. In this ...

  16. Journal of Pharmaceutical and Allied Sciences - Vol 8, No 3 (2011)

    African Journals Online (AJOL)

    Antibacterial activity of crude extract of Ocinum gratissimum (African basil) on clinical strains of Escherichia coli, Salmonella typhi and Klebsiella pneumoniae · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AAJ Adewumi, VO Aina, AS Saratu, LU Nkechi, 1348-1354 ...

  17. Author Details

    African Journals Online (AJOL)

    Antibacterial activity of crude extract of Ocinum gratissimum (African basil) on clinical strains of Escherichia coli, Salmonella typhi and Klebsiella pneumoniae. Abstract · Vol 8, No 3 (2011) - Articles Antibacterial activity of Globimetulla browni (Mistletoe) leaf extract against four clinical bacterial isolates. Abstract · Vol 8, No 3 ...

  18. Hilic MS/MS determination of amino acids in herbs of Fumaria schleicheri L., Ocimum basilicum L., and leaves of Corylus avellana L. (United States)

    Prokopenko, Yuliya; Jakštas, Valdas; Žvikas, Vaidotas; Georgiyants, Victoriya; Ivanauskas, Liudas


    The aim of research was to study the content of amino acids using in extracts of Fumaria schleicheri L., Ocimum basilicum L., and Corylus avellana L. by HILIC MS/MS method. Separation of amino acids in the samples was carried out with Acquity H-class UPLC system (Waters, Milford, USA) equipped with SeQuant ZIC-Hilic collumn (2.1 × 150 mm, 3.5 μm) (Merck Millipore, Darmstadt, Germany). The MS/MS fragment ion chromatograms of the test solutions established the presence of 19 amino acids. The obtained results have shown that O. basilicum L. characterized the highest concentrations of different neurogenic amino acids (128.1 mg/kg), comparing with F. schleicheri L. and C. avellana L. (57.72 and 52.91 mg/kg, respectively).

  19. Desenvolvimento de mudas de manjericão (Ocimum basilicum L.em função do recipiente e do tipo e densidade de substratos

    Directory of Open Access Journals (Sweden)

    M.S. Maggioni


    Full Text Available Uma das etapas mais importantes na produção do manjericão é o desenvolvimento das mudas. Nesta etapa, o cuidado com o recipiente e o substrato é essencial, pois afetam diretamente o crescimento e a arquitetura do sistema radicular, bem como, o fornecimento de nutrientes. Assim, o objetivo deste trabalho foi avaliar o desenvolvimento de mudas de manjericão (Ocimum basilicum L. influenciadas pelo tipo e densidade de diferentes substratos, cultivadas em bandejas de poliestireno com diferentes números de células. O experimento foi conduzido na área de Jardinocultura da Universidade Federal da Grande Dourados (UFGD em Dourados - MS. O delineamento experimental utilizado foi em blocos casualizados com cinco repetições, sendo os tratamentos dispostos em esquema fatorial 3x3x5, sendo três tipos de bandejas de poliestireno expandido com 72, 128 e 200 células com volumes internos de 124,3; 44,8 e 17,7 mL, respectivamente. Três tipos de substratos comerciais (PlantMax Florestais®; Tropstrato Vida Verde® e PlantMax Hortaliças HA®, e cinco densidades de substratos (0,36; 0,42; 0,48; 0,54 e 0,60 kg dm-3. Decorridos 78 dias após a emergência das plantas avaliou-se alturas das plantas, massa fresca e seca da parte aérea e sistema radicular, e comprimento de raízes. A produção de mudas comerciais de manjericão (Ocimum basilicum L. foi melhor com o uso do substrato Tropstrato Vida Verde® na bandeja de 72 células associado com a densidade de 0,47 kg dm-3.

  20. Recontextualização da simulação clínica em enfermagem baseada em Basil Bernstein: semiologia da prática pedagógica Recontextualización de la simulación de enfermería clínica basada en Basil Bernstein: la semiología de la práctica pedagógica Recontextualization of Nursing clinical simulation based on Basil Bernstein: semiology of pedagogical practice

    Directory of Open Access Journals (Sweden)

    Mateus Casanova dos Santos


    Full Text Available O presente artigo é um estudo de caso investigativo de caráter participante e descritivo, a partir da vivência pedagógica no disparador de aprendizagem Simulação em Enfermagem, do segundo semestre do primeiro ciclo da graduação da Faculdade de Enfermagem (FEn da Universidade Federal de Pelotas (UFPel, onde se desenvolve a simulação clínica de semiologia e semiotécnica em Enfermagem. O objetivo é estudar a recontextualização da prática pedagógica da Simulação com base em teorizações do sociólogo da educação Basil Bernstein, contribuindo para o processo de aperfeiçoamento do planejamento de ensino e, especialmente, da avaliação deste disparador de aprendizagem. A partir das reflexões deste estudo, observa-se a teorização de Bernstein como uma potente ferramenta semiológica das práticas pedagógicas, a qual contribui para o planejamento e análise do dispositivo pedagógico curricular.Este artículo es un caso de estudio de carácter descriptivo y de investigación participante, desde la experiencia educativa de aprendizaje en el gatillo Simulación en Enfermería, de la segunda mitad del primer ciclo de la Escuela Enfermería (FEN de la Universidade Federal de Pelotas (UFPel donde se desarrolla la simulación de la semiología clínica y la semiótica en Enfermería. El objetivo es estudiar la recontextualización de la práctica pedagógica de teorías basadas en la simulación del sociólogo de la educación Basil Bernstein, contribuyendo al proceso de mejora de la educación, planificación y aprendizaje, especialmente la evaluación de gatillo. De las reflexiones de este estudio, existe la teoría de Bernstein como una poderosa herramienta de semiótica prácticas pedagógicas, lo que contribuye a la planificación y el análisis de dispositivos educativos curriculares.This article is a case study of investigative and descriptive participant character, from the educational experience of learning in the trigger

  1. A New Formula to Estimate the Length of Right Upper Extremity Vein from Elbow Crease to Carina Calculated by Peripherally Inserted Central Catheter Insertion through Right Basilic Vein Puncture

    International Nuclear Information System (INIS)

    Cho, Hyun Hwan; Jeon, Eui Yong; Lee, Hyun Jung; Lee, Hyun; Koh, Sung Hye; Choi, Sun Young; Lee, Kwan Seop; Yoon, Dae Young; Im, Hyoung June


    To measure the length of the upper extremity vein between the elbow crease and the carina (elbow crease to carina length, ECL), to facilitate the appropriate positioning of the tip of the peripherally inserted central catheter (PICC). A total of 124 patients (64 men and 60 women; mean age 65.2 ± 15.4 years; range, 21-90 years) inserted with PICC through the right basilic vein under fluoroscopy were included in this retrospective study. The ECL was determined as follows: ECL = (distance from elbow crease to puncture site) + (the catheter length of PICC) - (distance from carina to catheter tip on post-procedural chest radiograph). We analyzed the relationship between ECL and patient height. The mean ECL through right basilic vein was 42.07 ±4.03 cm (27.5 to 52.2 cm). ECL was found to be significantly correlated with patient height: ECL (cm) = 0.24 X patient height (cm) + 3.75. The formula developed in our study would be helpful for predicting the optimal catheter length during a blind bedside procedure of PICC via the right basilic vein.

  2. Characterization of Turbulent Processes by the Raman Lidar System Basil in the Frame of the HD(CP)2 Observational Prototype Experiment - Hope (United States)

    Di Girolamo, Paolo; Summa, Donato; Stelitano, Dario; Cacciani, Marco; Scoccione, Andrea; Behrendt, Andreas; Wulfmeyer, Volker


    Measurements carried out by the Raman lidar system BASIL are reported to demonstrate the capability of this instrument to characterize turbulent processes within the Convective Boundary Layer (CBL). In order to resolve the vertical profiles of turbulent variables, high resolution water vapour and temperature measurements, with a temporal resolution of 10 sec and a vertical resolution of 90 and 210 m, respectively, are considered. Measurements of higher-order moments of the turbulent fluctuations of water vapour mixing ratio and temperature are obtained based on the application of spectral and auto-covariance analyses to the water vapour mixing ratio and temperature time series. The algorithms are applied to a case study (IOP 5, 20 April 2013) from the HD(CP)2 Observational Prototype Experiment (HOPE), held in Central Germany in the spring 2013. The noise errors are demonstrated to be small enough to allow the derivation of up to fourth-order moments for both water vapour mixing ratio and temperature fluctuations with sufficient accuracy.

  3. A comparative study of antiplaque and antigingivitis effects of herbal mouthrinse containing tea tree oil, clove, and basil with commercially available essential oil mouthrinse

    Directory of Open Access Journals (Sweden)

    Shaila V. Kothiwale


    Full Text Available Background: The relatively safe nature and cost-effectiveness of herbal extracts have led to a resurgent interest in their utility as therapeutic agents. Therefore, this prospective, double-blind, randomly controlled clinical trial was designed to compare the antiplaque and antigingivitis effects of newly formulated mouthrinse containing tea tree oil (TTO, clove, and basil with those of commercially available essential oil (EO mouthrinse. Materials and Methods: Forty patients were selected for a 21-day study period and randomly divided into two groups. The test group patients were given newly formulated herbal mouthrinse and the control group patients were given commercially available EO mouthrinse. The Plaque Index (PI, Gingival Index (GI, and Papillary Marginal Attachment (PMA Index were recorded at baseline, 14 days, and 21 days. The microbial colony forming units (CFU were assessed at baseline and 21 days. Results: Test group patients using herbal mouthrinse showed significant improvement in GI (0.16, PI (0.57, and PMA (0.02 scores. These improvements were comparable to those achieved with commercially available EO mouthrinse. However, the aerobic and anaerobic CFU of microbiota were reduced with the herbal mouthrinse (P = 0.0000. Conclusion: The newly formulated herbal mouthrinse and commercially available mouthrinse were beneficial clinically as antiplaque and antigingivitis agents. Newly formulated mouthrinses showed significant reduction in microbial CFU at 21 days. So, our findings support the regular use of herbal mouthrinse as an antiplaque, antigingivitis, and antimicrobial rinse for better efficacy.

  4. Comprehensive Comparison of the Performance of Autogenous Brachial-Basilic Transposition Arteriovenous Fistula and Prosthetic Forearm Loop Arteriovenous Graft in a Multiethnic Asian Hemodialysis Population

    Directory of Open Access Journals (Sweden)

    Koy Min Chue


    Full Text Available Aim. For patients who have exhausted cephalic vein arteriovenous fistula (AVF options, controversy exists on whether brachial-basilic AVF with transposition (BBTAVF or a forearm arteriovenous graft (AVG should be the next vascular access of choice. This study compared the outcomes of these two modalities. Methods. A retrospective study of 122 Asian multiethnic patients who underwent either a BBTAVF (81 or an AVG (41. Maturation time and intervention rates were analyzed. Functional primary, secondary, and overall patency rates were evaluated. Results. The maturation time for BBTAVFs was significantly longer than AVGs. There was also a longer deliberation time before surgeons abandon a failing BBTAVF compared to an AVG. Both functional primary and secondary patency rates were significantly higher in the BBTAVF group at 1-year follow-up: 73.2% versus 34.1% (p<0.001 and 71.8% versus 54.3% (p=0.022, respectively. AVGs also required more interventions to maintain patency. When maturation rates were considered, the overall patency of AVGs was initially superior in the first 25 weeks after creation and then became inferior afterwards. Conclusion. BBTAVFs had superior primary and functional patency and required less salvage interventions. The forearm AVG might have a role in patients who require early vascular access due to complications from central venous catheters or with limited life expectancy.

  5. Studies on the performance of TiO{sub 2} thin films as protective layer to chlorophyll in Ocimum tenuiflorum L from UV radiation

    Energy Technology Data Exchange (ETDEWEB)

    Malliga, P. [Department of Physics, V.V.Vanniaperumal College for Women, Virudhunagar – 626001 (India); Selvi, B. Karunai [Department of Botany, V.V.Vanniaperumal College for Women, Virudhunagar – 626001 (India); Pandiarajan, J.; Prithivikumaran, N. [Nanoscience Lab, Department of Physics, VHNSN College, Virudhunagar – 626001 (India); Neyvasagam, K., E-mail: [Department of Physics, The Madura College, Madurai - 625011 (India)


    Thin films of TiO{sub 2} were prepared on glass substrates using sol-gel dip coating technique. The films with 10 coatings were prepared and annealed at temperatures 350°C, 450°C and 550°C for 1 hour in muffle furnace. The annealed films were characterized by X – Ray diffraction (XRD), UV – Visible, AFM, Field Effect Scanning Electron Microscopy (FESEM) and EDAX studies. Chlorophyll has many health benefits due to its structural similarity to human blood and its good chelating ability. It has antimutagenic and anticarcinogenic properties. UV light impairs photosynthesis and reduces size, productivity, and quality in many of the crop plant species. Increased exposure of UV light reduces chlorophyll contents a, b and total content in plants. Titanium Dioxide (TiO{sub 2}) is a wide band gap semiconductor and efficient light harvester. TiO{sub 2} has strong UltraViolet (UV) light absorbing capability. Here, we have studied the performance of TiO{sub 2} thin films as a protective layer to the chlorophyll contents present in medicinal plant, tulsi (Ocimum tenuiflorum L) from UV radiation. The study reveals that crystallite size increases, transmittance decreases and chlorophyll contents increases with increase in annealing temperature. This study showed that TiO{sub 2} thin films are good absorber of UV light and protect the chlorophyll contents a, b and total content in medicinal plants.

  6. Mosquitocidal and antiplasmodial activity of Senna occidentalis (Cassiae) and Ocimum basilicum (Lamiaceae) from Maruthamalai hills against Anopheles stephensi and Plasmodium falciparum. (United States)

    Murugan, Kadarkarai; Aarthi, Narayanan; Kovendan, Kalimuthu; Panneerselvam, Chellasamy; Chandramohan, Balamurugan; Kumar, Palanisamy Mahesh; Amerasan, Duraisamy; Paulpandi, Manickam; Chandirasekar, Ramachandran; Dinesh, Devakumar; Suresh, Udaiyan; Subramaniam, Jayapal; Higuchi, Akon; Alarfaj, Abdullah A; Nicoletti, Marcello; Mehlhorn, Heinz; Benelli, Giovanni


    Each year, mosquito-borne diseases infect nearly 700 million people, resulting to more than 1 million deaths. In this study, we evaluated the larvicidal, pupicidal, and smoke toxicity of Senna occidentalis and Ocimum basilicum leaf extracts against the malaria vector Anopheles stephensi. Furthermore, the antiplasmodial activity of plant extracts was evaluated against chloroquine (CQ)-resistant (CQ-r) and CQ-sensitive (CQ-s) strains of Plasmodium falciparum. In larvicidal and pupicidal experiments, S. occidentalis LC50 ranged from 31.05 (I instar larvae) to 75.15 ppm (pupae), and O. basilicum LC50 ranged from 29.69 (I instar larvae) to 69 ppm (pupae). Smoke toxicity experiments conducted against adults showed that S. occidentalis and O. basilicum coils evoked mortality rates comparable to the pyrethrin-based positive control (38, 52, and 42%, respectively). In antiplasmodial assays, Senna occidentalis 50% inhibitory concentration (IC50) were 48.80 μg/ml (CQ-s) and 54.28 μg/ml (CQ-r), while O. basilicum IC50 were 68.14 μg/ml (CQ-s) and 67.27 μg/ml (CQ-r). Overall, these botanicals could be considered as potential sources of metabolites to build newer and safer malaria control tools.

  7. Studies on the performance of TiO2 thin films as protective layer to chlorophyll in Ocimum tenuiflorum L from UV radiation

    International Nuclear Information System (INIS)

    Malliga, P.; Selvi, B. Karunai; Pandiarajan, J.; Prithivikumaran, N.; Neyvasagam, K.


    Thin films of TiO 2 were prepared on glass substrates using sol-gel dip coating technique. The films with 10 coatings were prepared and annealed at temperatures 350°C, 450°C and 550°C for 1 hour in muffle furnace. The annealed films were characterized by X – Ray diffraction (XRD), UV – Visible, AFM, Field Effect Scanning Electron Microscopy (FESEM) and EDAX studies. Chlorophyll has many health benefits due to its structural similarity to human blood and its good chelating ability. It has antimutagenic and anticarcinogenic properties. UV light impairs photosynthesis and reduces size, productivity, and quality in many of the crop plant species. Increased exposure of UV light reduces chlorophyll contents a, b and total content in plants. Titanium Dioxide (TiO 2 ) is a wide band gap semiconductor and efficient light harvester. TiO 2 has strong UltraViolet (UV) light absorbing capability. Here, we have studied the performance of TiO 2 thin films as a protective layer to the chlorophyll contents present in medicinal plant, tulsi (Ocimum tenuiflorum L) from UV radiation. The study reveals that crystallite size increases, transmittance decreases and chlorophyll contents increases with increase in annealing temperature. This study showed that TiO 2 thin films are good absorber of UV light and protect the chlorophyll contents a, b and total content in medicinal plants

  8. Synergism Effect of the Essential Oil from Ocimum basilicum var. Maria Bonita and Its Major Components with Fluconazole and Its Influence on Ergosterol Biosynthesis (United States)

    Cardoso, Nathalia N. R.; Alviano, Celuta S.; Blank, Arie F.; Romanos, Maria Teresa V.; Fonseca, Beatriz B.; Rozental, Sonia; Rodrigues, Igor A.; Alviano, Daniela S.


    The aim of this study was to evaluate the activity of the EO and its major components of Ocimum basilicum var. Maria Bonita, a genetically improved cultivar, against the fluconazole sensitive and resistant strains of Candida albicans and Cryptococcus neoformans. Geraniol presented better results than the EO, with a low MIC (76 μg/mL against C. neoformans and 152 μg/mL against both Candida strains). The combination of EO, linalool, or geraniol with fluconazole enhanced their antifungal activity, especially against the resistant strain (MIC reduced to 156, 197, and 38 μg/mL, resp.). The ergosterol assay showed that subinhibitory concentrations of the substances were able to reduce the amount of sterol extracted. The substances tested were able to reduce the capsule size which suggests they have an important mechanism of action. Transmission electron microscopy demonstrated cell wall destruction of C. neoformans after treatment with subinhibitory concentrations. In C. albicans ultrastructure alterations such as irregularities in the membrane, presence of vesicles, and cell wall thickening were observed. The biofilm formation was inhibited in both C. albicans strains at MIC and twice MIC. These results provide further support for the use of O. basilicum EO and its major components as a potential source of antifungal agents. PMID:27274752

  9. Evaluation of the synergistic effect of Allium sativum, Eugenia jambolana, Momordica charantia, Ocimum sanctum and Psidium guajav on hepatic and intestinal drug metabolizing enzymes in rats

    Directory of Open Access Journals (Sweden)

    Devendra Kumar


    Full Text Available Aims/Background: Present study investigated the synergistic effect of polyherbal formulations (PHF of Allium sativum L Eugenia jambolana Lam., Momordica charantia L., Ocimum sanctum Linn and Psidium guajava L. in the inhibition/induction of hepatic and intestinal CYPs and Phase-II conjugated drug metabolizing enzymes. Consumption of these herbal remedy has been extensively documented for diabetes treatment in Auyureda. Methodology: PHF of these five herbs was prepared and different doses were orally administered to Sprague Dawley rats of different groups except control group. Expression of mRNA and activity of drug metabolizing enzymes were examined by RT-PCR and HPLC in isolated liver and intestine microsomes in PHF pretreated rats. Results: Activities of hepatic and intestinal Phase-II enzyme levels increased along with mRNA levels except CYP3A mRNA level. PHF administration increases the activity of hepatic and intestinal UDPGT and GST in response to dose and time; however, activity of hepatic SULT increased at higher doses. Conclusions: CYPs and Phase-II conjugated enzymes levels can be modulated in dose and time dependent manner. Observations suggest that poly herbal formulation might be a possible cause of herb-drug interaction, due to changes in pharmacokinetic of crucial CYPs and Phase-II substrate drug. [J Complement Med Res 2016; 5(4.000: 372-382

  10. A teoria dos códigos linguísticos de Basil Bernstein e a questão da modalidade oral da língua

    Directory of Open Access Journals (Sweden)

    Claudiana Nair Pothin Narzetti


    Full Text Available Este artigo apresenta resultados de pesquisa, de caráter bibliográfico e histórico, que consistiu em um retorno à teoria dos códigos restrito e elaborado, do sociólogo da linguagem Basil Bernstein, elaborada para caracterizar as diferenças entre a linguagem da classe trabalhadora e a linguagem da classe média, bem como para explicar as implicações do domínio desses códigos para o sucesso escolar dos estudantes. A pesquisa justificou-se por se tratar de um tema atual, isto é, a discrepância entre a linguagem falada pelo estudante das classes populares e a linguagem falada na escola, que está na origem, ainda hoje, de problemas de aprendizagem de língua portuguesa no Brasil. O objetivo foi retornar à teoria dos códigos e, confrontando-a com os recentes adquiridos da linguística, inquirir se essa teoria pode, atualmente, oferecer elementos para elaboração de metodologias de ensino de língua materna. O ponto de vista escolhido foi o das reflexões recentes, elaboradas no campo da linguística, sobre as modalidades oral e escrita da língua. A pesquisa constatou que os códigos dos quais tratou Bernstein podem ser concebidos como usos linguísticos na modalidade oral com diferentes níveis de formalidade. Nessa perspectiva, as reflexões do autor inglês suscitam um trabalho mais intenso com a produção de textos orais nas aulas de língua portuguesa.

  11. Spinal muscular atrophy type I and the dual role of viruses: An interview with Professor Basil T. Darras, Professor of Neurology (Pediatrics) at Harvard Medical School. (United States)

    Mammas, Ioannis N; Spandidos, Demetrios A


    According to Professor Basil T. Darras, Professor of Neurology (Pediatrics) at Harvard Medical School and Director of the Spinal Muscular Atrophy (SMA) Program at Boston Children's Hospital in Boston (MA, USA), the diagnosis of SMA type I is clinical and is based on detailed general physical and neurological examinations. SMA type I remains the most common genetic disease resulting in death in infancy and is really devastating for the child, the parents, as well as the medical professionals with the privilege of caring for patients with SMA and their parents. The proposed management options include: i) no respiratory support; ii) non-invasive ventilation; and iii) tracheotomy with mechanical ventilation. Deciding, which option is the best, is indeed a very personal decision. The optimal clinical care should be extremely mindful of parents' wishes and management goals with regard to the quality of life. Since the end of 2016 in the USA, and recently in Europe, there exists the possibility of accessing a novel treatment drug for SMA, namely Nusinersen. This antisense oligonucleotide is administered intrathecally and increases the production of the fully functional SMN protein, thus improving motor function, the quality of life and survival. Among the ongoing clinical trials, oral treatment with RG7916, a small molecule SMN2 splicing modifier, appears to be really promising. Gene therapy using viral vectors is expected to offer an 'one and done' therapy and possibly a cure, if administered early in life, before any symptoms appear. It is really interesting that viruses, which at the moment are the cause of death of children with SMA, if genetically modified, may be used for their treatment.

  12. Tri-trophic insecticidal effects of African plants against cabbage pests.

    Directory of Open Access Journals (Sweden)

    Blankson W Amoabeng

    Full Text Available Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae, Siam weed, Chromolaena odorata (Asteraceae, Cinderella weed, Synedrella nodiflora (Asteraceae, chili pepper, Capsicum frutescens (Solanaceae, tobacco, Nicotiana tabacum (Solanaceae cassia, Cassia sophera (Leguminosae, physic nut, Jatropha curcas (Euphorbiaceae, castor oil plant, Ricinus communis (Euphorbiaceae and basil, Ocimum gratissimum (Lamiaceae. In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis, all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from

  13. Tri-trophic insecticidal effects of African plants against cabbage pests. (United States)

    Amoabeng, Blankson W; Gurr, Geoff M; Gitau, Catherine W; Nicol, Helen I; Munyakazi, Louis; Stevenson, Phil C


    Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily

  14. Tri-Trophic Insecticidal Effects of African Plants against Cabbage Pests (United States)

    Amoabeng, Blankson W.; Gurr, Geoff M.; Gitau, Catherine W.; Nicol, Helen I.; Stevenson, Phil C.


    Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily

  15. Phenolic extract from Ocimum basilicum restores lipid metabolism in Triton WR-1339-induced hyperlipidemic mice and prevents lipoprotein-rich plasma oxidation

    Directory of Open Access Journals (Sweden)

    Ilham Touiss


    Full Text Available In this study we investigated the hypolipidemic and anti-lipoprotein-oxidation activities of phenolic extract from sweet basil a popular culinary herb. The hypolipidemic activity was studied in mice model injected intraperitoneally with Triton WR-1339 at a dose of 200 mg/kg body weight. The animals were grouped as follows: normolipidemic control group (n = 8, hyperlipidemic control group (n = 8 and phenolic extract-treated group (n = 8 at a dose of 200 mg/kg body weight. After 7 h and 24 h treatment, the oral administration of the phenolic extract exerts a significant reduction of plasma total cholesterol, triglycerides and LDL-cholesterol concentrations (P < 0.001. On the other hand, we demonstrated that the phenolic extract prevents plasma lipid oxidation by 16% (P < 0.001, 20% (P < 0.001, 32% (P < 0.001 and 44% (P < 0.001 at a doses of 10, 25, 50 and 100 μg/mL, respectively. The results were compared with ascorbic acid used as standard synthetic antioxidant. HPLC analysis shows that the extract contains 4 major phenolics and is especially rich in rosmarinic acid. This finding indicates that the phenolic extract might be beneficial in lowering hyperlipidemia and preventing atherosclerosis.

  16. Caracterização química de extratos de Ocimum basilicum L. obtidos através de extração com CO2 a altas pressões

    Directory of Open Access Journals (Sweden)

    Marcio Mazutti


    Full Text Available This work reports extraction yield and chemical characterization of the extracts obtained by high-pressure CO2 extraction of a cultivar of Ocimum basilicum L. The experiments were performed in the temperature range of 20 to 50 °C, from 100 to 250 atm of pressure. Chemical analyses were carried out by gas chromatography coupled to mass spectrometry, permitting to identify 23 compounds that were grouped into five chemical classes. Results showed that temperature and solvent density influenced positively the extraction yield. At 20 °C and 0.41 g cm-3 occurred a rise in the concentration of monoterpenes, oxygenated monoterpenes, sesquiterpenes and oxygenated sesquiterpenes.

  17. Evaluation of the potential effect of Allium sativum, Momordica charantia, Eugenia jambolana, Ocimum sanctum & Psidium guajava on intestinal P-glycoprotein in rats

    Directory of Open Access Journals (Sweden)

    Devendra Kumar


    Full Text Available Aims/Background: This study was evaluated synergistic effect of Polyherbal formulation (PHF of Allium sativum L., Eugenia jambolana Lam., Momordica charantia L., Ocimum sanctum Linn and Psidium guajava L on p-glycoprotein of intestine. These five herbs were traditionally used for diabetes. These herbs are commonly present in ayurvedic product as antidiabetics in India. Methodology: PHF was prepared by five indigenous herbs. Different doses (50, 100 and 200 mg/kg/day of was orally administered to Sprague-Dawley rats of different groups for multiple weeks except control groups. Alteration in Pgp expression was evaluated by RT-PCR and western blotting while modulation in activity of Pgp was evaluated using rhodamine 123 as transport substrate by in-situ absorption and everted gut sac method. Results: In PHF pretreated group received 50, 100 and 200 mg/kg/day for seven days, mRNA level decreased by 1.75, 2.45 and 2.37 fold respectively as compared to control. Similarly when PHF at dose of 100 mg/kg/day was given consequently for four weeks maximum decrease in Pgp expression level was observed only after one week and further increase in the treatment duration did not produce significant decrease compared to first week treatment. Pgp mediated transport of rhodamine 123 was significantly decreased with everted gut sac prepared from PHF pretreated rats (one week compared to those prepared from vehicle treated rats. Conclusions: In conclusion, we report that PHF pretreatment down regulated the expression of intestinal Pgp and this down regulated intestinal Pgp would result in decreased functional activity. Additionally this down regulated Pgp expression might affect the bioavailability of antidiabetic Pgp substrate drugs. [J Complement Med Res 2017; 6(1.000: 68-74

  18. Induction of stress volatiles and changes in essential oil content and composition upon microwave exposure in the aromatic plant Ocimum basilicum

    Energy Technology Data Exchange (ETDEWEB)

    Lung, Ildikó [National Institute for Research and Development of Isotopic and Molecular Technologies, 67-103 Donat Street, Cluj-Napoca 400293 (Romania); Soran, Maria-Loredana, E-mail: [National Institute for Research and Development of Isotopic and Molecular Technologies, 67-103 Donat Street, Cluj-Napoca 400293 (Romania); Opriş, Ocsana; Truşcă, Mihail Radu Cătălin [National Institute for Research and Development of Isotopic and Molecular Technologies, 67-103 Donat Street, Cluj-Napoca 400293 (Romania); Niinemets, Ülo [Institute of Agricultural and Environmental Sciences, Estonian University of Life Sciences, 1 Kreutzwaldi Street, Tartu 51014 (Estonia); Copolovici, Lucian [Institute of Agricultural and Environmental Sciences, Estonian University of Life Sciences, 1 Kreutzwaldi Street, Tartu 51014 (Estonia); Institute of Technical and Natural Sciences Research-Development of “Aurel Vlaicu” University, 2 Elena Drăgoi Street, Arad 310330 (Romania)


    Exposure to sustained low intensity microwaves can constitute a stress for the plants, but its effects on plant secondary chemistry are poorly known. We studied the influence of GSM and WLAN-frequency microwaves on emissions of volatile organic compounds and content of essential oil in the aromatic plant Ocimum basilicum L. hypothesizing that microwave exposure leads to enhanced emissions of stress volatiles and overall greater investment in secondary compounds. Compared to the control plants, microwave irradiation led to decreased emissions of β-pinene, α-phellandrene, bornyl acetate, β-myrcene, α-caryophyllene and benzaldehyde, but increased emissions of eucalyptol, estragole, caryophyllene oxide, and α-bergamotene. The highest increase in emission, 21 times greater compared to control, was observed for caryophyllene oxide. The irradiation resulted in increases in the essential oil content, except for the content of phytol which decreased by 41% in the case of GSM-frequency, and 82% in the case of WLAN-frequency microwave irradiation. The strongest increase in response to WLAN irradiation, > 17 times greater, was observed for hexadecane and octane contents. Comparisons of volatile compositions by multivariate analyses demonstrated a clear separation of different irradiance treatments, and according to the changes in the volatile emissions, the WLAN-frequency irradiation represented a more severe stress than the GSM-frequency irradiation. Overall, these results demonstrating important modifications in the emission rates, essential oil content and composition indicate that microwave irradiation influences the quality of herbage of this economically important spice plant. - Highlights: • Microwave irradiation represents a stress for the plants. • Microwave exposure leads to enhanced emissions of stress volatiles. • O. basilicum irradiation with microwaves increases the essential oil content. • Microwave pollution can constitute a threat to the


    Directory of Open Access Journals (Sweden)

    Pandu Sastry KAKARAPARTHI


    Full Text Available An experiment was conducted to study the changes in the chemical composition of the essential oil of two varieties of Ocimum basilicum over a period of six months at short harvest intervals for two crop seasons. In variety Vikarsudha, GC/MS analysis revealed the presence of eighteen essential oil constituents. Linalool (23.5­40.1% and 22.8­33.7% and methyl chavicol (25.4­51.9% and 40.0­52.7% were the major constituents in main and ratoon crops. Similarly, in variety Kuhmohak GC/MS analysis revealed the presence of linalool (19.2­25.4 % and 16.1­31.3% and methyl chavicol (34.7­53.4% and 39.4­59.2% in large quantities in main and ratoon crops, respectively. β myrcene, limonene, 1,8 cineole, ocimene, camphor, terpinen-4-ol, bornyl acetate, eugenol, methyl eugenol, β elemene, β caryophyllene, α humulene, γ Cadinene and cadinol were present in small quantities. Results pertaining to the zone of inhibition in the antimicrobial activity of essential oil indicated that Chromobacterium violaceum is more sensitive compared to Staphylococcus aureus. Among the fungal strains Aspergillus niger was found to be more sensitive. GC-MS analysis of the fixed oils obtained from the seeds in the ratoon crop revealed the presence of unsaturated and saturated fatty acids. The unsaturated fatty acids averaged 89% consisting of α-linolenic (49.3%­52.4%, linoleic (23.4%­26.0%, and oleic (10.3%­12.3% acids. The most abundant saturated fatty acids were palmitic and stearic acids.

  20. Induction of stress volatiles and changes in essential oil content and composition upon microwave exposure in the aromatic plant Ocimum basilicum

    International Nuclear Information System (INIS)

    Lung, Ildikó; Soran, Maria-Loredana; Opriş, Ocsana; Truşcă, Mihail Radu Cătălin; Niinemets, Ülo; Copolovici, Lucian


    Exposure to sustained low intensity microwaves can constitute a stress for the plants, but its effects on plant secondary chemistry are poorly known. We studied the influence of GSM and WLAN-frequency microwaves on emissions of volatile organic compounds and content of essential oil in the aromatic plant Ocimum basilicum L. hypothesizing that microwave exposure leads to enhanced emissions of stress volatiles and overall greater investment in secondary compounds. Compared to the control plants, microwave irradiation led to decreased emissions of β-pinene, α-phellandrene, bornyl acetate, β-myrcene, α-caryophyllene and benzaldehyde, but increased emissions of eucalyptol, estragole, caryophyllene oxide, and α-bergamotene. The highest increase in emission, 21 times greater compared to control, was observed for caryophyllene oxide. The irradiation resulted in increases in the essential oil content, except for the content of phytol which decreased by 41% in the case of GSM-frequency, and 82% in the case of WLAN-frequency microwave irradiation. The strongest increase in response to WLAN irradiation, > 17 times greater, was observed for hexadecane and octane contents. Comparisons of volatile compositions by multivariate analyses demonstrated a clear separation of different irradiance treatments, and according to the changes in the volatile emissions, the WLAN-frequency irradiation represented a more severe stress than the GSM-frequency irradiation. Overall, these results demonstrating important modifications in the emission rates, essential oil content and composition indicate that microwave irradiation influences the quality of herbage of this economically important spice plant. - Highlights: • Microwave irradiation represents a stress for the plants. • Microwave exposure leads to enhanced emissions of stress volatiles. • O. basilicum irradiation with microwaves increases the essential oil content. • Microwave pollution can constitute a threat to the

  1. Evaluation of anxiolytic and sedative effect of essential oil and hydroalcoholic extract of Ocimum basilicum L. and chemical composition of its essential oil. (United States)

    Rabbani, Mohammed; Sajjadi, Seyed Ebrahim; Vaezi, Arefeh


    Ocimum basilicum belongs to Lamiaceae family and has been used for the treatment of wide range of diseases in traditional medicine in Iranian folk medicine. Due to the progressive need to anti-anxiety medications and because of the similarity between O. basilicum and Salvia officinalis, which has anti-anxiety effects, we decided to investigate the anxiolytic and sedative activity of hydroalcoholic extract and essential oil of O. basilicum in mice by utilizing an elevated plus maze and locomotor activity meter. The chemical composition of the plant essential oil was also determined. The essential oil and hydroalcoholic extract of this plant were administered intraperitoneally to male Syrian mice at various doses (100, 150 and 200 mg/kg of hydroalcoholic extract and 200 mg/kg of essential oil) 30 min before starting the experiment. The amount of hydroalcoholic extract was 18.6% w/w and the essential oil was 0.34% v/w. The major components of the essential oil were methyl chavicol (42.8%), geranial (13.0%), neral (12.2%) and β-caryophyllene (7.2%). HE at 150 and 200 mg/kg and EO at 200 mg/kg significantly increased the time passed in open arms in comparison to control group. This finding was not significant for the dose of 100 mg/kg of the extract. None of the dosages had significant effect on the number of entrance to the open arms. Moreover, both the hydroalcoholic extract and the essential oil decreased the locomotion of mice in comparison to the control group. This study shows the anxiolytic and sedative effect of hydroalcoholic extract and essential oil of O. basilicum. The anti-anxiety and sedative effect of essential oil was higher than the hydroalcoholic extract with the same doses. These effects could be due to the phenol components of O. basilicum.

  2. Science, School Science, and School: Looking at Science Learning in Classrooms from the Perspective of Basil Bernstein's Theory of the Structure of Pedagogic Discourse (United States)

    Campbell, Ralph Ian

    This analytic paper asks one question: How does Basil Bernstein's concept of the structure of pedagogic discourse (SPD) contribute to our understanding of the role of teacher-student interactions in science learning in the classroom? Applying Bernstein's theory of the SPD to an analysis of current research in science education explores the structure of Bernstein's theory as a tool for understanding the challenges and questions related to current concerns about classroom science learning. This analysis applies Bernstein's theory of the SPD as a heuristic through a secondary reading of selected research from the past fifteen years and prompts further consideration of Bernstein's ideas. This leads to a reevaluation of the categories of regulative discourse (RD) and instructional discourse (ID) as structures that frame learning environments and the dynamics of student-teacher interactions, which determine learning outcomes. The SPD becomes a simple but flexible heuristic, offering a useful deconstruction of teaching and learning dynamics in three different classroom environments. Understanding the framing interactions of RD and ID provides perspectives on the balance of agency and expectation, suggesting some causal explanations for the student learning outcomes described by the authors. On one hand, forms of open inquiry and student-driven instruction may lack the structure to ensure the appropriation of desired forms of scientific thinking. On the other hand, well-designed pathways towards the understanding of fundamental concepts in science may lack the forms of more open-ended inquiry that develop transferable understanding. Important ideas emerge about the complex dynamics of learning communities, the materials of learning, and the dynamic role of the teacher as facilitator and expert. Simultaneously, the SPD as a flexible heuristic proves ambiguous, prompting a reevaluation of Bernstein's organization of RD and ID. The hierarchical structure of pedagogic

  3. Estudo da biologia floral e mecanismos reprodutivos do alfavacão (Ocimum officinalis L. visando o melhoramento - DOI: 10.4025/actascibiolsci.v26i3.1598 Study of the floral biology and reproductive mechanisms of Alfavacão (Ocimum officinalis L. aiming at genetic improvement - DOI: 10.4025/actascibiolsci.v26i3.1598

    Directory of Open Access Journals (Sweden)

    Cláudio Lúcio Fernandes Amaral


    Full Text Available O Gênero Ocimum, da Família Lamiaceae, compreende plantas ricas em óleos essenciais destinados às industrias para produção de fármacos, perfumes e cosméticos. O conhecimento do sistema reprodutivo é extremamente relevante, pois permite definir estratégias de seleção com base em cruzamentos intra e interpopulacionais. O objetivo deste trabalho foi estudar a biologia floral e os mecanismos reprodutivos do alfavacão com vistas ao melhoramento genético. A atividade floral compreendeu três estádios florais: primeiro, pré-antese, quando ocorreu a polinização; segundo, antese, quando aconteceu a abertura assincrônica de estames e, terceiro, pós-antese, quando houve a fecundação dos óvulos. O processo de antese está intimamente relacionado com as condições climáticas. Os acessos de O. officinalis do Banco de Germoplasma de Plantas Medicinais da UESB, apesar de se reproduzirem, predominantemente, por autofecundação, podem apresentar fecundação cruzada, o que evidencia a ampla versatilidade reprodutiva dessa espécie, acentuando a variabilidade genética, a qual é essencial para sua evoluçãoSome of the plants from Ocimum genus in Lamiaceae family are source of essential oils used in pharmacy, perfume and cosmetics industry. The knowledge of mate systems is extremely important because it allows to define selection strategies based on intra and interpopulation crossbreeding. The aim of this work was to study floral biology and reproductive mechanisms of alfavacão aiming at genetic improvement. The floral activity included three floral stages: first, pre-anthesis, when the pollination happened; second, anthesis, when the asynchronous opening of stamens happened; and third, pos-anthesis, when there was the fecundation of the ova. The anthesis process is intimately related to climatic conditions. The accesses of O. officinalis from Banco de Germoplasma de Plantas Medicinais da UESB (Medicinal Plants Germplasm Bank from UESB

  4. Antileishmanial and antifungal activity of plants used in traditional medicine in Brazil. (United States)

    Braga, Fernanda G; Bouzada, Maria Lúcia M; Fabri, Rodrigo L; de O Matos, Magnum; Moreira, Francis O; Scio, Elita; Coimbra, Elaine S


    The antileishmanial and antifungal activity of 24 methanol extracts from 20 plants, all of them used in the Brazilian traditional medicine for the treatment of several infectious and inflammatory disorders, were evaluated against promastigotes forms of two species of Leishmania (L. amazonensis and L. chagasi) and two yeasts (Candida albicans and Cryptococcus neoformans). Among the 20 tested methanolic extracts, those of Vernonia polyanthes was the most active against L. amazonensis (IC(50) of 4 microg/ml), those of Ocimum gratissimum exhibited the best activity against L. chagasi (IC(50) of 71 microg/ml). Concerning antifungical activity, Schinus terebintifolius, O. gratissimum, Cajanus cajan, and Piper aduncum extracts were the most active against C. albicans (MIC of 1.25 mg/ml) whereas Bixa orellana, O. gratissimum and Syzygium cumini exhibited the best activity against C. neoformans (MIC of 0.078 mg/ml).

  5. Characterisation of boundary layer turbulent processes by the Raman lidar BASIL in the frame of HD(CP)2 Observational Prototype Experiment (United States)

    Di Girolamo, Paolo; Cacciani, Marco; Summa, Donato; Scoccione, Andrea; De Rosa, Benedetto; Behrendt, Andreas; Wulfmeyer, Volker


    Measurements carried out by the University of Basilicata Raman lidar system (BASIL) are reported to demonstrate the capability of this instrument to characterise turbulent processes within the convective boundary layer (CBL). In order to resolve the vertical profiles of turbulent variables, high-resolution water vapour and temperature measurements, with a temporal resolution of 10 s and vertical resolutions of 90 and 30 m, respectively, are considered. Measurements of higher-order moments of the turbulent fluctuations of water vapour mixing ratio and temperature are obtained based on the application of autocovariance analyses to the water vapour mixing ratio and temperature time series. The algorithms are applied to a case study (11:30-13:30 UTC, 20 April 2013) from the High Definition Clouds and Precipitation for Climate Prediction (HD(CP)2) Observational Prototype Experiment (HOPE), held in western Germany in the spring 2013. A new correction scheme for the removal of the elastic signal crosstalk into the low quantum number rotational Raman signal is applied. The noise errors are small enough to derive up to fourth-order moments for both water vapour mixing ratio and temperature fluctuations.To the best of our knowledge, BASIL is the first Raman lidar with a demonstrated capability to simultaneously retrieve daytime profiles of water vapour turbulent fluctuations up to the fourth order throughout the atmospheric CBL. This is combined with the capability of measuring daytime profiles of temperature fluctuations up to the fourth order. These measurements, in combination with measurements from other lidar and in situ systems, are important for verifying and possibly improving turbulence and convection parameterisation in weather and climate models at different scales down to the grey zone (grid increment ˜ 1 km; Wulfmeyer et al., 2016).For the considered case study, which represents a well-mixed and quasi-stationary CBL, the mean boundary layer height is found to

  6. 1601-IJBCS-Article-Mohamed Soumanou

    African Journals Online (AJOL)


    L'influence du mode de cuisson sur la valeur nutritionnelle de Solanum macrocarpum, Amaranthus hybridus et Ocimum gratissimum a été investiguée. Les teneurs en matière sèche, cendres, protéines, lipides, fibres et minéraux des légumes-feuilles traités ont été analysées conformément aux méthodes standards. Les.

  7. Protective effect of Ocimum sanctum on 3-methylcholanthrene, 7,12-dimethylbenz(a)anthracene and aflatoxin B1 induced skin tumorigenesis in mice

    Energy Technology Data Exchange (ETDEWEB)

    Rastogi, Shipra; Shukla, Yogeshwer; Paul, Bhola N; Chowdhuri, D Kar; Khanna, Subhash K [Industrial Toxicology Research Centre, Mahatma Gandhi Marg, P.O. Box 80, Lucknow-226001 (India); Das, Mukul [Industrial Toxicology Research Centre, Mahatma Gandhi Marg, P.O. Box 80, Lucknow-226001 (India)


    A study on the protective effect of alcoholic extract of the leaves of Ocimum sanctum on 3-mthylcholanthrene (MCA), 7,12-dimethylbenzanthracene (DMBA) and aflatoxin B{sub 1} (AFB{sub 1}) induced skin tumorigenesis in a mouse model has been investigated. The study involved pretreatment of mice with the leaf extract prior to either MCA application or tetradecanoyl phorbol acetate (TPA) treatment in a two-stage tumor protocol viz a viz, DMBA/TPA and AFB1/TPA. The results of the present study indicate that the pretreatment with alcoholic extract of the leaves of O. sanctum decreased the number of tumors in MCA, DMBA/TPA and AFB1/TPA treated mice. The skin tumor induced animals pretreated with alcoholic extract led to a decrease in the expression of cutaneous {gamma}-glutamyl transpeptidase (GGT) and glutathione-S-transferase-P (GST-P) protein. The histopathological examination of skin tumors treated with leaf extract showed increased infiltration of polymorphonuclear, mononuclear and lymphocytic cells, decreased ornithine decarboxylase activity with concomitant enhancement of interleukin-1{beta} (IL-1{beta}) and tumor necrosis factor-{alpha} (TNF-{alpha}) in the serum, implying the in vivo antiproliferative and immunomodulatory activity of leaf extract. The decrease in cutaneous phase I enzymes and elevation of phase II enzymes in response to topical application of leaf extract prior to MCA, AFB1, DMBA/TPA and AFB1/TPA treatment indicate the possibility of impairment in reactive metabolite(s) formation and thereby reducing skin carcinogenicity. Furthermore, pretreatment of leaf extract in the carcinogen induced animals resulted in elevation of glutathione levels and decrease in lipid peroxidation along with heat shock protein expression, indicating a scavenging or antioxidant potential of the extract during chemical carcinogenesis. Thus it can be concluded that leaf extract of O. sanctum provides protection against chemical carcinogenesis in one or more of the

  8. Mitigación de NaCl por efecto de un bioestimulante en la germinación de Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Daulemys Batista Sánchez


    Full Text Available Los bioestimulantes vegetales activan el proceso de germinación de las semillas; accionan funciones fisiológicas en las plantas, contienen sustancias propias del metabolismo vegetal, que mejoran el uso de nutrientes y son una opción para mitigar estrés por salinidad. El objetivo del estudio fue evaluar el efecto de un bioestimulante de origen natural (FitoMas-E®, como atenuante de la salinidad en la germinación de las variedades de albahaca (Ocimum basilicum L. Emily, Napoletano y Nufar. Las semillas se sometieron a concentraciones de NaCl (0, 50, 100 y 150 mM y dosis de FitoMas-E® (0, 0.5, 1 y 1.5 mL L-1, en un diseño completamente al azar con arreglo factorial con cuatro repeticiones, en condiciones controladas. Se evaluó porcentaje y tasa de germinación, altura de la plántula, longitud de radícula, biomasa fresca y seca de la radícula, biomasa fresca y seca de la parte aérea. Los resultados mostraron que la altura de la planta, longitud de la radícula, biomasa fresca de parte aérea y biomasa seca de la radícula con 150 mM de NaCl fueron las más dañadas. Napoletano y Nufar mostraron longitud de radícula mayor en 0 mM y conforme la concentración de NaCl incrementó, la longitud de radícula disminuyó significativamente para las tres variedades. Las plántulas de semillas tratadas con FitoMas-E®, incrementaron longitud de radícula, destacando Napoletano en 1 mL L‑1 y Nufar con 0.5 mL L 1. Napoletano mostró biomasa fresca de parte aérea mayor en 0 mM con 0.5 mL L-1 de FitoMas-E®. Las plántulas de Napoletano de semillas tratadas con 0.5 mL L‑1 de FitoMas-E® incrementaron la biomasa seca de radícula en 0 y 50 mM de NaCl. Se concluye que el FitoMas-E® con dosis de 0.5 y 1 mL L-1 mitiga el efecto del estrés salino de moderado a severo en semillas de albahaca.

  9. Uso del FitoMas-E® como atenuante del estrés salino (NaCl durante la emergencia y crecimiento inicial de Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    D. Batista-Sánchez


    Full Text Available El uso de bioestimulantes vegetales estimula la emergencia y el crecimiento vegetal debido a que están compuestos por sustancias naturales como carbohidratos, péptidos de bajo peso molecular y aminoácidos, activadores de las funciones fisiológicas de las plantas, por lo que su aplicación permite un mejor aprovechamiento de los nutrientes y representa una opción para enfrentar problemas de estrés abiótico por salinidad. El objetivo de este estudio fue determinar el efecto del bioestimulante FitoMas-E® derivado de la caña de azúcar como atenuante de la salinidad en la emergencia y el crecimiento de plántulas de variedades de albahaca (Ocimum basilicum L. con respuesta diferencial al estrés por salinidad. Tres variedades de albahaca: Napoletano, Emily y Nufar se sometieron a cuatro concentraciones de NaCl (0, 50, 100 y 150 mM y cuatro dosis de FitoMas-E® (0, 0.5, 1.0 y 1.5 mL L-1 en un diseño completamente al azar con arreglo factorial con cuatro repeticiones. El trabajo se desarrolló en una estructura de malla sombra y las variables que se midieron fueron: porcentaje y tasa de emergencia, longitud de radícula, altura de la plántula, biomasa fresca y seca de radícula y de parte aérea. Los resultados evidenciaron que en condiciones de estrés salino (NaCl de moderado a severo, las variables disminuyeron significativamente. Largo de raíz, altura de planta y biomasa seca de raíz en 150 mM de NaCl fueron las más afectadas. Se observó que cuando se aplicó FitoMas-E® las plantas incrementaron significativamente sus valores en las variables, largo de raíz 32% y altura de planta 41%, lo que revela el efecto estimulante del FitoMas-E®, siendo 0.5 mL L-1 la dosis estimulante para la variedad Napoletano y 1.0 mL L-1 para la variedad Emily, aún y cuando se encontraban en condiciones de estrés salino hasta 100 mM de NaCl. Para la concentración de 150 mM se evidenció una afectación extrema para las variedades Emily y Nufar.


    Directory of Open Access Journals (Sweden)

    Subakir Subakir


    Full Text Available Leprosy is a chronic disease caused by Mycobacterium leprae. M. Leprae (AFB is found in blood of lepromatous patients. A preliminary study of AFB (Acid Fast Bacteria was performed from 49 mosquitoes in a leprosy ward. The result shows that 2(4,1% mosquitoes were found positive AFB. This study was undertaken to investigate the possibility of mosqiutoes as a vehicle in transmission and spreading of leprosy.

  11. Eskişehir koşullarında yetiştirilen Reyhan (Ocimum basilicum L.) bitkisinin bazı bitkisel özelliklerin ve diurnal varyabilitesinin belirlenmesi


    Kulan, Engin Gökhan


    Bu çalışma Eskişehir Osmangazi Üniversitesi Ziraat Fakültesi Tarla Bitkileri Bölümü deneme alanında 2010 yılında yürütülmüştür. Denemede Eskişehir ekolojik koşullarında yetiştirilen reyhan (Ocimum basilicum L.) bitkisinin verim ve verim özellikleri ile farklı biçim saatlerinin reyhanın uçucu yağı ve uçucu yağ bileşimi üzerine olan etkileri incelenmiştir. Tesadüf bloklarında bölünmüş parseller deneme desenine göre 3 tekerrürlü olarak kurulan denemede reyhan bitkileri çiçeklen...

  12. Rendimento e caracterização química do óleo essencial de genótipos de manjericão (Ocimum basilicum L.) no Distrito Federal


    Jannuzzi, Hermes


    O manjericão (Ocimum basilicum) é uma planta aromática largamente cultivada, devido ao seu grande polimorfismo, originário de polinizações cruzadas, durante séculos de domesticação. A importância dessa espécie está na da arquitetura da planta, coloração e morfologia das folhas e flores, além da composição química de seus óleos essenciais, originando aromas específicos e tendo utilização variada na gastronomia, perfumaria e indústria farmacêutica. Neste trabalho foram realizados dois experimen...

  13. Levantamento etnobotânico de plantas medicinais na cidade de Ipameri - GO Ethnobotanical survey of medicinal plants in Ipameri City - Goiás State

    Directory of Open Access Journals (Sweden)

    M.R. Zucchi


    of these plants; and to diagnose the gender profile and the age and wage ranges of users. Thus, structured interviews were conducted with 200 families in the city and plants were collected for their correct identification. The material was herborized, identified and deposited in the Herbarium of "Universidade Estadual de Goiás" (HUEG. Of the 200 families interviewed, 75 said they did not make use of plants for medicinal purposes (37.5%, while 125 said they do use them (62.5%. The latter group reported the 35 most used species: "hortelã-rasteira" (Mentha x villosa L., "boldo-sete-dores" (Plectranthus barbatus Andrews., lemon grass (Cymbopogon citratus (DC. Stapf., "quebra-pedra" (Phyllanthus niruri L., chamomile (Chamomilla recutita (L. Rauschert., pennyroyal (Mentha pulegium L., guaco (Mikania glomerata Spreng., mentrasto (Ageratum conyzoides L., clove basil (Ocimum gratissimum L., wormwood (Artemisia canphorata Vill., balm (Eysenhardtia platycarpa Mich., broom (Baccharis trimera (Less. DC., fennel (Foeniculum vulgare Mill., aloe (Aloe vera L. and mallow (Althaea officinalis L.. All consumer families (100% stated to prefer plants grown organically, to select the plants based on their good appearance (68% families and to eat them in natura (unprocessed, 100%. The use of medicinal plants in Ipameri is independent of gender (54% womem and 46% men and extends to several age and socioeconomic ranges, configuring thus a good consumer market.

  14. Plant extracts in the control of aphids Brevicoryne brassicae (L. and Myzus persicae (SulzerExtratos vegetais no controle dos afídeos Brevicoryne brassicae (L. e Myzus persicae (Sulzer

    Directory of Open Access Journals (Sweden)

    Rafael Reginato Ávila


    Full Text Available Were accomplished the effect of plant extracts of clove basil (Ocimum gratissimum L., horsetail (Equisetum hyemale L., coriander (Coriandrum sativum L. and tobacco (Nicotiana tabacum L. on Brevicoryne brassicae (L., 1758 and Myzus persicae (Sulzer, 1776 aphids in cabbage Brassica oleracea (L.. The treatments consisted of plant extracts prepared fresh and dry (concentrations of 2.5; 5.0; and 10% and the controls insecticide acephate and water. These solutions were sprayed on cabbage discs placed on agar in Petri dishes, containing twenty adult aphids. In sequence, the Petri dishes were sealed with plastic film and this procedure was repeated for the two aphid species studied. The assessment of the number of live nymphs and adults occurred at 1, 12, 24, and 72 hours after installation. The extracts of coriander and tobacco prepared in a concentration of 10% showed toxic effects similar to the organophosphate insecticide acephate, on adults and nymphs of the aphids Brevicoryne brassicae and Myzus persicae. Coriander revealed a promising alternative that deserves detailed studies regarding the performance of its active ingredients and dosage determination in order to provide a safe herbal product to control insects.Avaliou-se o efeito de extratos vegetais de alfavaca-cravo (Ocimum gratissimum L., cavalinha (Equisetum hyemale L., coentro (Coriandrum sativum L. e fumo (Nicotiana tabacum L. sobre os pulgões Brevicoryne brassicae (L., 1758 e Myzus persicae (Sulzer, 1776 em couve Brassica oleracea (L.. Os tratamentos consistiram de extratos vegetais preparados a fresco e seco (nas concentrações de 2,5; 5,0 e 10%, do padrão inseticida acefato e de água. As soluções assim obtidas foram pulverizadas em discos de couve colocados sobre agar em placas de Petri, contendo vinte pulgões adultos. Na sequência, as placas de Petri foram vedadas com filme plástico transparente, sendo este procedimento repetido para as duas espécies de afídeos. A avalia

  15. Diferentes condimentos vegetais: avaliação sensorial e de atividade antibacteriana em preparação alimentar com frango cozido Different spice plants: sensorial evaluation and antibacterial activity in chicken broth

    Directory of Open Access Journals (Sweden)

    F. Rodrigues


    , individualmente, atividade antibacteriana significativa, mesmo que sem significância quando comparados entre si. Contudo, em relação ao tempo de início da atividade antibacteriana, destacou-se a pimenta dedo-de-moça, enquanto que, em relação ao prolongamento dessa ação no tempo, destacou-se o alho nirá. As 12 plantas condimentares em estudo tiveram atestada a sensorialidade, sendo que as quatro plantas com destaque tiveram a atividade anti-coliforme termo-resistente comprovada in loco. Diferentes condimentos vegetais foram capazes de fornecer qualificação sensorial e sanitária em caldo com frango cozido, em condições domésticas de manuseio.Based on the in vitro antibacterial activity predetermined for 12 spice plants with ethnographic indicator, this feature was tested in loco in the model cooked chicken broth. First, ten evaluators were trained, according to the current legislation for Free and Informed Consent, providing previous knowledge about the plants parsley (Petroselinum sativum, marjoram (Origanum X aplii and Origanum majorana, basil (Ocimum basilicum, common sage (Salvia officinalis, thyme (Thymus vulgaris, anis-like spice (Ocimum selloi, african basilicum (Ocimum gratissimum, nirá garlic (Allium tuberosum, leek (Allium porrum, turmeric (Curcuma longa and "dedo-de-moça" chili (Capsicum baccatum. Those spices were individually added to the chicken broth to perform a Hedonic Scale-like Acceptance Test, selecting four of the twelve spices that had higher sensory acceptance, "dedo-de-moça" chili, nirá garlic, leek and thyme. A new Acceptance Test was then performed using low, medium and high concentrations of those four spices to establish the most acceptable sensory intensities. The elected quantities (0.5 g "dedo-de-moça" chili, 15 g nirá garlic, 15 g leek and 5 g thyme were added to the chicken broth, then challenged with Escherichia coli (ATCC 11229 at a final 10 concentration of CFU/mL, the tolerated limit according to legislation. The control

  16. Characterization of Water Vapor Fluxes by the Raman Lidar System Basil and the Univeristy of Cologne Wind Lidar in the Frame of the HD(CP)2 Observational Prototype Experiment - Hope (United States)

    Di Girolamo, Paolo; Summa, Donato; Stelitano, Dario; Cacciani, Marco; Scoccione, Andrea; Schween, Jan H.


    Measurements carried out by the Raman lidar system BASIL and the University of Cologne wind lidar are reported to demonstrate the capability of these instruments to characterize water vapour fluxes within the Convective Boundary Layer (CBL). In order to determine the water vapour flux vertical profiles, high resolution water vapour and vertical wind speed measurements, with a temporal resolution of 1 sec and a vertical resolution of 15-90, are considered. Measurements of water vapour flux profiles are based on the application of covariance approach to the water vapour mixing ratio and vertical wind speed time series. The algorithms are applied to a case study (IOP 11, 04 May 2013) from the HD(CP)2 Observational Prototype Experiment (HOPE), held in Central Germany in the spring 2013. For this case study, the water vapour flux profile is characterized by increasing values throughout the CBL with lager values (around 0.1 g/kg m/s) in the entrainment region. The noise errors are demonstrated to be small enough to allow the derivation of water vapour flux profiles with sufficient accuracy.

  17. Shelf-life extension of refrigerated sea bass slices wrapped with fish protein isolate/fish skin gelatin-ZnO nanocomposite film incorporated with basil leaf essential oil. (United States)

    Arfat, Yasir Ali; Benjakul, Soottawat; Vongkamjan, Kitiya; Sumpavapol, Punnanee; Yarnpakdee, Suthasinee


    Microbiological, chemical and sensory changes of sea bass slices wrapped with fish protein isolate (FPI)/fish skin gelatin (FSG) films incorporated with 3 % ZnO nanoparticles (ZnONP) (w/w, based on protein content) and 100 % basil leaf essential oil (BEO) (w/w, based on protein content) during storage of 12 days at 4 °C were investigated. Sea bass slices wrapped with FPI/FSG-ZnONP-BEO film had the lowest growth of psychrophilic bacteria, lactic acid bacteria and spoilage microorganisms including Pseudomonas , H2S-producing bacteria and Enterobacteriaceae throughout storage of 12 days in comparison with those wrapped with FPI/FSG-BEO, FPI/FSG-ZnONP, FPI/FSG film, polypropylene film (PP film) and the control (without wrapping), respectively (P < 0.05). Lowered increases in pH, total volatile base, peroxide value and TBARS value were found in FPI/FSG-ZnO-BEO film wrapped samples, compared with others (P < 0.05). Sensory evaluation revealed that shelf-life of sea bass slices was longest for samples wrapped with FPI/FSG-ZnONP-BEO film (12 days), as compared to the control (6 days) (P < 0.05).

  18. Heavy Metals in selected Edible Vegetables and their daily intake in Sanandaj, Iran

    International Nuclear Information System (INIS)

    Alasvand Zarasvand, M.; Maleki, A.


    The levels of four different heavy metals [cadmium (Cd), lead (Pb), chromium (Cr) and copper (Cu)] were determined in various vegetables [leek (Allium ampeloprasum), sweet basil (Ocimum basilicum), parsley (Petroselium cripsum), gardem cress (lepidium sativum) and tarragon (Artemisia dracuncullus)] cultivated around the Sanandaj city. (Author)

  19. Heavy Metals in selected Edible Vegetables and their daily intake in Sanandaj, Iran

    Energy Technology Data Exchange (ETDEWEB)

    Alasvand Zarasvand, M; Maleki, A


    The levels of four different heavy metals [cadmium (Cd), lead (Pb), chromium (Cr) and copper (Cu)] were determined in various vegetables [leek (Allium ampeloprasum), sweet basil (Ocimum basilicum), parsley (Petroselium cripsum), gardem cress (lepidium sativum) and tarragon (Artemisia dracuncullus)] cultivated around the Sanandaj city. (Author)

  20. Author Details

    African Journals Online (AJOL)

    Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) protect against sodium arsenite-induced hepatotoxicity in Wistar rats. Abstract PDF · Vol 29, No 1 (2014) - Articles Hepatoprotective and anticlastogenic effects of ethanol extract of Irvingia gabonensis (IG) leaves in sodium arsenite-induced toxicity in ...

  1. Role of mycorrhizal fungi and salicylic acid in salinity tolerance of ...

    African Journals Online (AJOL)

    Most researchers showed that inoculation of plants with mycorrhizal fungi and using salicylic acid increase tolerance of plants due to salinity. In this study, the effect of mycorrhizal fungi, including Glomus mosseae, Glomus intraradices, and salicylic acid (0.2 mM) on tolerance of green basil (Ocimum basilicum L.) to salinity ...

  2. Author Details

    African Journals Online (AJOL)

    Herb yield and chemical composition of basil (Ocimum basilicum L) essential oil in relation to the different harvest period and cultivation conditions. Abstract PDF · Vol 13, No 2 (2016) - Articles Relationship between total phenolic, total flavonoid and oleuropein in different aged olive (Olea europaea l.) Cultivar leaves

  3. Antifungal Activities of Some Leaf Extracts on Seed-borne Fungi of ...

    African Journals Online (AJOL)

    The efficacy of leaf extracts of basil (Ocimum basilicum), bitter leaf (Vernonia amygdalina), lemon grass (Cymbopogen citratus), neem (Azadirachta indica) and paw-paw (Carica papaya) on major seed-borne fungi: Aspergillus niger, Aspergillus flavus, Botryodiplodia theobromae and Fusarium moniliforme of African yam ...

  4. Research Paper ISSN 0189-6016©2008

    African Journals Online (AJOL)


    inflammatory, antitumor and antioxidant properties (Sharada et al., 1996; Bhattacharya et al., ... Withaferin-A (WA) was extracted and isolated from commercially available Withania somnifera root ..... Chemomodulatory efficacy of Basil leaf (Ocimum ... In vitro human phase I metabolism of xenobiotics I: pesticides and related.

  5. Larvicidal Activity of essential oils from Brazilian plants against Aedes aegypti L.

    Directory of Open Access Journals (Sweden)

    Eveline Solon Barreira Cavalcanti


    Full Text Available Aedes aegypti L. is the major vector of dengue fever, an endemic disease in Brazil. In an effort to find effective and affordable ways to control this mosquito, the larvicidal activities of essential oils from nine plants widely found in the Northeast of Brazil were analyzed by measurement of their LC50. The essential oils were extracted by steam distillation and their chemical composition determined by GL-chromatography coupled to mass spectroscopy. The essential oils from Cymbopogon citratus and Lippia sidoides, reported in the literature to have larvicidal properties against A. aegypti, were used for activity comparison. The results show that Ocimum americanum and Ocimum gratissimum have LC50 of 67 ppm and 60 ppm respectively, compared to 63 ppm for L. sidoides and 69 ppm for C. citratus. These results suggest a potential utilization of the essential oil of these two Ocimum species for the control of A. aegypti.

  6. Evaluation of five essential oils from aromatic plants of Cameroon for controlling food spoilage and mycotoxin producing fungi. (United States)

    Nguefack, J; Leth, V; Amvam Zollo, P H; Mathur, S B


    Five essential oils (EO) extracted from Cymbopogon citratus, Monodora myristica, Ocimum gratissimum, Thymus vulgaris and Zingiber officinale were investigated for their inhibitory effect against three food spoilage and mycotoxin producing fungi, Fusarium moniliforme, Aspergillus flavus and Aspergillus fumigatus. Five strains of each fungus were tested. The agar dilution technique was used to determine the inhibitory effect of each EO on the radial growth of the fungus, and a dose response was recorded. The EO from O. gratissimum, T. vulgaris and C. citratus were the most effective and prevented conidial germination and the growth of all three fungi on corn meal agar at 800, 1000 and 1200 ppm, respectively. Moderate activity was observed for the EO from Z. officinale between 800 and 2500 ppm, while the EO from M. myristica was less inhibitory. These effects against food spoilage and mycotoxin producing fungi indicated the possible ability of each essential oil as a food preservative. A comparative test on the preservative ability of the EO from O. gratissimum and potassium sorbate against A. flavus at pH 3.0 and 4.5 showed that the EO remained stable at both pH, whereas the efficacy of potassium sorbate was reduced at higher pH. We concluded that the EO from O. gratissimum is a potential food preservative with a pH dependent superiority against potassium sorbate, and these are novel scientific information.

  7. Simultaneous quantitative determination of multiple bioactive markers in Ocimum sanctum obtained from different locations and its marketed herbal formulations using UPLC-ESI-MS/MS combined with principal component analysis. (United States)

    Pandey, Renu; Chandra, Preeti; Srivastava, Mukesh; Mishra, D K; Kumar, Brijesh


    Ocimum sanctum L., with phenolic acids, flavonoids, propenyl phenols and terpenoids as active pharmacological constituents, is a popular medicinal herb and is present as an ingredient in many herbal formulations. Therefore, development of a reliable analytical method for simultaneous determination of the pharmacologically active constituents of O. sanctum is of high importance. To develop and validate a new, rapid, sensitive and selective UPLC-ESI/MS/MS method for simultaneous determination of 23 bioactive markers including phenolic acids, flavonoids, propenyl phenol and terpenoid in the leaf extract and marketed herbal formulations of O. sanctum. An UPLC-ESI/MS/MS method using negative electrospray ionisation (ESI) in multiple-reaction-monitoring (MRM) mode was used for simultaneous determination. Chromatographic separation was achieved on an Acquity UPLC BEH C18 -column using a gradient elution with 0.1% formic acid in water and 0.1% formic acid in acetonitrile. Principal component analysis (PCA) was applied to correlate and discriminate eight geographical collections of O. sanctum based on quantitative data of the analytes. The developed method was validated as per International Conference on Harmonization guidelines and found to be accurate, with overall recovery in the range 95.09-104.84% (RSD ≤ 1.85%), precise (RSD ≤ 1.98%) and linear (r(2)  ≥ 0.9971) over the concentration range of 0.5-1000 ng/mL. Ursolic acid was found to be the most abundant marker in all the samples investigated, except for the marketed tablet. The method established is simple, rapid and sensitive, hence it can be reliably utilised for the quality control of O. sanctum and derived herbal formulations. Copyright © 2015 John Wiley & Sons, Ltd.

  8. Atividade antimicrobiana dos óleos essenciais de erva-cidreira e manjericão frente a bactérias de carnes bovinas
    Antimicrobial activity of essential oils of cidreira-herb and basil against bacteria from bovine meat

    Directory of Open Access Journals (Sweden)

    G. G. SANTOS


    Full Text Available

    O presente trabalho teve como objetivo avaliar a atividade antimicrobiana, in vitro, dos óleos essenciais extraídos de Lippia alba (Mill N. E. Brown e Ocimum basilicum frente a microrganismos isolados de carnes bovinas. Os óleos foram extraídos por hidrodestilação e caracterizados quanto à composição por cromatografi a gasosa. A concentração inibitória mínima (CIM e concentração bactericida mínima dos óleos (CBM foram determinadas pelo método de microplacas utilizando concentrações de óleos entre 0,39 e 25μg/mL. Foram utilizadas suspensões de diferentes cepas de Escherichia coli, Staphylococcus aureus e Salmonella sp. na concentração de 0,5x104 UFC/mL. O óleo de Lippia alba N.E. Brown apresentou maior efi ciência como agente bacteriostático e bactericida frente às diferentes cepas de Staphylococcus aureus e Salmonella sp. isoladas de carnes bovinas do que o óleo essencial de Ocimum basilicum (cultivar “Maria Bonita”, o qual foi mais efetivo frente às cepas de Escherichia coli. Além disto, os óleos essenciais apresentaram atividade antimicrobiana em concentrações muito menores do que as obtidas por outros pesquisadores.

  9. Activité larvicide sur Anopheles gambiae Giles et composition chimique des huiles essentielles extraites de quatre plantes cultivées au Cameroun

    Directory of Open Access Journals (Sweden)

    Tchoumbougnang F.


    Full Text Available Larvicidal activity against Anopheles gambiae Giles and chemical composition of essential oils from four plants cultivated in Cameroon. The chemical composition of the essential oils obtained by hydrodistillation of dry leaves from Cymbopogon citrates (DC. Stapf, Ocimum canum Sims, Ocimum gratissimum L. var 'gratissimum' L. and Thymus vulgaris L. cultivated in Cameroon were analyzed and their larvicidal activity against fourth instar larvae of Anopheles gambiae Giles were determined. The yields of extraction indicate that T. vulgaris (0.95% was richer in essential oil than C. citratus (0.67%. O. canum and O. gratissimum have approximately the same content in volatile constituents (0.59% and 0.60%, respectively. The analyses by GC and GC/MS showed that these oils are monoterpenic (86.8-97.4%. Oxygenated monoterpenes predominate in C. citratus and O. canum (81.6% and 68.9%, respectively while O. gratissimum oil contains a majority of monoterpene hydrocarbons (61.0%. T. vulgaris is characterized by the same proportion of monoterpene hydrocarbons (45.6% and oxygenated monoterpenes (48.9%. The main compounds found in the essential oil of C. citratus are acyclic monoterpenes such as geraniol (15.6%, geranial (39.3%, neral (21.9% and myrcene (14.0%. The essential oil of T. vulgaris is characterized by p-menthane structures given by thymol (40.1%, p-cymene (23.4% and γ-terpinene (15.1%; p-cymene (32.1% and thymol (24.3% were also the constituents quantitatively important in O. gratissimum essential oil while linalool (56.3% and limonene (10.9% were predominant in O. canum. Bioassay test done by the World Health Organization standard protocol revealed that these essential oils have remarkable larvicidal properties as they could induce 100% mortality in the larvae of A. gambiae at the concentration of 100 ppm for C. citratus, 200 ppm with T. vulgaris, 350 ppm for O. gratissimum and 400 ppm for O. canum. Their LC50 and LC80 show the same reactivity order

  10. Comparaison de l'efficacite Antifongique de l'huile Essentielle d ...

    African Journals Online (AJOL)

    Une étude a été menée à la fois in vitro et in vivo afin d'évaluer l'activité antifongique du mancozèbe et de l'huile essentielle d'Ocimum gratissimum L. sur Fusarium oxysporum f. sp. radicis-lycopersici (Forl). Une corrélation positive a été établie entre l'inhibition de la croissance radiale mycélienne du mycopathogène et la ...

  11. Basil plants growth and essential oil yield in a production system with successive cuts Crescimento de plantas de manjericão e produção de óleo em sistema de produção com cortes sucessivos

    Directory of Open Access Journals (Sweden)

    André May


    Full Text Available This work studied the growth of basil plants and the effect of successive cuts on the total yield and quality of the essential oil, throughout the crop cycle. Steady increases were observed in the dry weight of the aerial part and in the essential oil yield, during the cultivation cycle. Intensive cultivation and successive cuts could improve the agronomical and industrial yield in each harvest.Esta pesquisa visou estudar o crescimento de plantas de manjericão e o efeito de cortes sucessivos sobre a produção e qualidade do óleo essencial ao longo do ciclo. Observou-se aumento na massa seca da parte aérea e na produção de óleo essencial ao longo do ciclo de cultivo. O cultivo do manjericão submetido a cortes sucessivos pode aumentar a produção do óleo em cada colheita.

  12. 2572-IJBCS-Article-Yapi Adon Basile

    African Journals Online (AJOL)


    des plantes médicinales est le fait de métabolites primaires et surtout secondaires. ... la médecine moderne, certaines affections ..... Anémie, Fatigue générale, Maladie de la peau, Rhumatisme ..... dans la couverture des soins de santé.

  13. Hypothenar hammer syndrome and basilic bypass. (United States)

    Chander, R K; Phair, J; Oza, P; Patel, M; Balar, N


    We report a case of hypothenar hammer syndrome. The case presents necessary diagnostic measures and discusses the etiology of this syndrome. Additionally, the case reviews treatments, which culminated in the eventual use of ulnar artery bypass with autogenous basilica vein to treat and resolve the ischemic fingers of the patient. © The Author(s) 2013 Reprints and permissions:

  14. Dicty_cDB: Contig-U15883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ndgk*kktrggygcwttniqfnq*ifne* q**fetnigvittfntiisitwfnfdangickcivistinsieyvtfigavlstnvti*k e*kqqk*q*e*iskfrgem...IA --- ---nnnnnnnnnnnkliihksiviiriqhsqivtqlnhtryhtimtigghphlvpkh*fl liiqpiliqlktitifyslmi...ab1. 38 0.33 2 ( DY330556 ) OB_MEa0005L07.f OB_MEa Ocimum basilicum cDNA clon... 38 0.36 2 ( EY305365 ) CAWX...ZGC_9 Danio rerio cDNA clo... 42 1.3 2 ( DY338804 ) OB_SEa09A12.r OB_SEa Ocimum basil...nnnnnnnflmqqhq qyqqqyqlmqqhyqqqlsqqhhqqvwvqiqlhvv*vvvvvvvvvvvvvvvi*pvelnqvv vvveekvdliimvmdmvmdhmvmvvkvqevhvvvniiythiytlnitsivi

  15. Phyto-metals screening of selected anti-diabetic herbs and infused concoctions


    Olanrewaju O. Olujimi; Olusegun N. Onifade; Adeleke T. Towolawi; Temilade F. Akinhanmi; Adeniyi A. Afolabi; Kabir A. Olanite


    Objective: To determine the levels of some selected heavy metals in both the selected anti-diabetic herbal plants and infused concoctions for diabetes treatment. Methods: Ten anti-diabetic plant samples: pawpaw leaves (Carica papaya), bitter melon leaves (Momordica charantia), holy basil leaves (Ocimum sanctum), bitter leaf (Vernonia amygdalina), ginger rhizome (Zingiber officinale), garlic (Allium sativum), African red pepper fruits (Capsicum frutescens), negro pepper grain (Xylopia aethi...

  16. QCM-Arrays for Sensing Terpenes in Fresh and Dried Herbs via Bio-Mimetic MIP Layers

    Directory of Open Access Journals (Sweden)

    Naseer Iqbal


    Full Text Available A piezoelectric 10 MHz multichannel quartz crystal microbalance (MQCM, coated with six molecularly imprinted polystyrene artificial recognition membranes have been developed for selective quantification of terpenes emanated from fresh and dried Lamiaceae family species, i.e., rosemary (Rosmarinus Officinalis L., basil (Ocimum Basilicum and sage (Salvia Officinalis. Optimal e-nose parameters, such as layer heights (1–6 KHz, sensitivity

  17. Plant compounds insecticide activity against Coleoptera pests of stored products




    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...

  18. Atividade antibacteriana de óleos essenciais em cepas isoladas de infecção urinária Antibacterial activity of essential oils on microorganisms isolated from urinary tract infection

    Directory of Open Access Journals (Sweden)

    Rogério Santos Pereira


    Full Text Available A análise da atividade antibacteriana de óleos essenciais de ervas medicinais (Ocimum gratissimum, L., Cybopogum citratus (DC Stapf. e Salvia officinalis, L. foi verificada frente a 100 cepas de bactérias isoladas de indivíduos da comunidade com diagnóstico de infecção urinária. Os microrganismos foram semeados em ágar Muller Hinton e os extratos aplicados com replicador de Steers e incubados a 37°C por 24 horas. Verificou-se que Salvia officinalis, L. apresentou ação inibitória superior às outras ervas, tendo eficácia de 100% quando testadas em espécies de Klebsiella e Enterobacter, 96% em Escherichia coli, 83% contra Proteus mirabilis e 75% contra Morganella morganii.The antibacterial activity of essential oils extracted from medicinal plants (Ocimum gratissimum, L., Cybopogum citratus (DC Stapf., and Salvia officinalis, L. was assessed on bacterial strains derived from 100 urine samples. Samples were taken from subjects diagnosed with urinary tract infection living in the community. Microorganisms were plated on Müller Hinton agar. Plant extracts were applied using a Steers replicator and petri dishes were incubated at 37°C for 24 hours. Salvia officinalis, L. showed enhanced inhibitory activity compared to the other two herbs, with 100% efficiency against Klebsiella and Enterobacter species, 96% against Escherichia coli, 83% against Proteus mirabilis, and 75% against Morganella morganii.

  19. Fungitoxic effect of concentrations of essential oils on Colletotrichum gloeosporioides, isolated from the passion fruit

    Directory of Open Access Journals (Sweden)

    Ismail Teodoro Souza Júnior


    Full Text Available This study aimed to evaluate the effect of different concentrations of essential oils on the fungus Colletotrichum gloeosporioides. The essential oils were obtained from shoots of the plants Lippia sidoides, Ocimum gratissimum, Lippia citriodora, Cymbopogon citratus and Psidium guayava var. pomifera. After the incorporation of oil in water-agar and PDA medium, in concentrations of 1μL/mL, 3μL/mL 5μL/mL and 10μL/mL and witness at 0μL/mL (oil/the culture medium, the inhibitions of conidia germination and mycelial growth, respectively, were evaluates. The results showed that from the concentration of 1μL/mL, essential oils of all plant species had an effect on conidia germination, with an inhibition of 100%. The species Lippia sidoides, Ocimum gratissimum, Lippia citriodora and Cymbopogon citratus inhibited the growth of the fungus mycelium by 100%. The oil of Psidium guayava var. pomifera had progressive control over the mycelium of C. gloeosporioides, in accordance with the increase in concentrations of essential oil.

  20. Tipos e doses de adubação orgânica no crescimento, no rendimento e na composição química do óleo essencial de elixir paregórico Sources and doses of organic fertilization in Ocimum selloi growth, essential oil yield and chemical composition

    Directory of Open Access Journals (Sweden)

    Larissa Corrêa do Bomfim Costa


    Full Text Available A prática da adubação orgânica, além de fornecer nutrientes para as plantas, proporciona a melhoria da estrutura física do solo, aumenta a retenção de água, diminui as perdas por erosão e favorece o controle biológico. O elixir paregórico (Ocimum selloi Benth. é uma espécie medicinal nativa das regiões Sul e Sudeste do Brasil onde é utilizada popularmente como antidiarréico, antiespasmódico e antiinflamatório. Este trabalho teve como objetivo verificar o efeito de diferentes doses de dois adubos orgânicos no crescimento, no rendimento e na composição do óleo essencial de elixir paregórico. Os experimentos foram conduzidos em Lavras, MG, em estufa plástica com os seguintes tratamentos de adubação: ensaio A - esterco bovino: 1 sem adubação (controle; 2 solo + 3kg m-2 de esterco; 3 solo+ 6kg m-2 de esterco; 4 solo+ 9kg m-2 de esterco; 5 solo + 12kg m-2 de esterco; ensaio B - Esterco avícola: 1 sem adubação (controle; 2 solo + 1,5kg m-2 de esterco; 3 solo + 3kg m-2 de esterco; 4 solo + 4,5kg m-2 de esterco e 5 solo + 6kg m-2 de esterco. Foi verificada a influência das doses de adubação com esterco bovino e galinha sobre o crescimento da planta em altura e diâmetro do caule, acúmulo de biomassa seca, AF, AFE, RPF, teor de clorofilas, espessura do limbo foliar, rendimento e composição química do óleo essencial.The organic fertilization provides nutrients for the plants, improves the soil physical structure, increases the water retention, reduces the erosion losses and favors the biological control. Ocimum selloi is a native medicinal plant of south and southeast of Brazil where is used popularly as antidiarrhetic, antispasmodic and anti-inflammatory. This research aimed to verify the effect of different doses of two organic fertilizers souces in O. selloi growth, essential oil yield and chemical composition. The experiments were carried out in Lavras, MG, with pots in polyethylene greenhouse with two manuring

  1. Musca domestica laboratory susceptibility to three ethnobotanical culinary plants. (United States)

    El Zayyat, Elham A; Soliman, Mohammed I; Elleboudy, Noha A; Ofaa, Shaimaa E


    Throughout history, synanthropic Musca domestica had remained a worldwide problem whenever poor sanitation and bad hygienic conditions exists. Houseflies growing resistance to chemical insecticides are a rising environmental problem that necessitates search for alternatives. Mentha cervina, Ocimum basilicum, and Coriandrum sativum were tested for bioactivity on M. domestica adults and larvae. They are culinary Mediterranean plants. In adulticidal bioassay, using both CDC bottles and fumigation techniques, basil was the most effective extract with LC50 1.074 and 34.996 g/L, respectively. Concerning larvicidal bioassay by fumigation technique, coriander had the highest toxicity index with LC50 29.521 g/L. In both dipping and feeding technique, basil had the highest toxicity with LC50 32.643 and 0.749 g/L, respectively. Basil showed the highest toxicity results in four out of the five models tested followed by coriander then mint; this result highlights the potentiality of basil as a green insecticide in management of flies and opens new insight in the industrialization of basil-based fly control products.

  2. Influência do processamento da folha e tipo de secagem no teor e composição química do óleo essencial de manjericão cv. Maria Bonita Influence of leaf processing and type of drying on the content and chemical composition of the essential oil of basil cv. Maria Bonita

    Directory of Open Access Journals (Sweden)

    Luciana Domiciano Silva Rosado


    Full Text Available O manjericão é uma planta medicinal aromática pertencente à família Lamiaceae, rica em óleos essenciais e com grande interesse industrial. Objetivou-se, no presente trabalho, estudar a influência do processamento da folha (inteira e pulverizada submetida a dois tipos secagem (estufa de ventilação forçada a 38º C e sala com desumidificador, sobre o teor e composição química do óleo essencial. O delineamento utilizado foi o inteiramente casualizado (DIC, com 4 tratamentos e 6 repetições. O óleo essencial foi extraído por hidrodestilação das folhas e analisado por CG e CG/EM. O tipo de secagem e o processamento da folha do O. basilicum influenciaram no teor e composição química do óleo essencial. Maior porcentagem da área de pico do componente químico linalol foi obtida quando se realizou o processo de secagem das folhas. A secagem em estufa conservou o aroma e a coloração verde das folhas, preservando as características originais da cultivar.Ocimum basilicum L. cv. Maria Bonita is a medicinal aromatic plant of the Lamiaceae family, it is rich in essential oils with high industrial interest. The present work aimed to study the influence of leaf processing (whole and ground leaf in two drying types (oven-drying at 38º C and room temperature using moisture dryer on the content and chemical composition of the essential oil. A completely randomized design was used with 4 treatments and 6 replicates. The essential oil obtained by hydrodestillation of the leaves was analyzed by GC and GC/MS. The results show that the drying type and the processing of the leaf influence the content and chemical composition of the essential oil. High amounts of linalol were obtained when the leaves underwent dry processing. The oven-dried conserved the aroma and the green color of the leaves, preserving the original characteristics of the cultivar.

  3. Insecticidal effects of essential oils extracted from aromatic plants on Ceratitis capitata (Wied.) in Lebanon

    Energy Technology Data Exchange (ETDEWEB)

    Abi Chahine, M [Lebanese Agricultural Research Institute, Jdeidet el-Metn (Lebanon); Khoury, N; Webeh, E [Lebanese Agricultural Research Institute, Jdeidet el-Metn (Lebanon)


    Full text: The excessive use of chemical pesticides to control agricultural pests is becoming alarming. The objective of this study is to search for biopesticides of plant origin that could be used to control one of the major pest of fruit production; the Mediterranean fruit fly (Ceratitis capitata Wied.). A colony of the Lebanese wild strain of this insect was reared under laboratory condition to provide biological material. The insecticidal activity of the essential oils extracted from aromatic plants in Lebanon was assessed. The tested plants are: Foeniculum vulgare, Thymbra spicata, Artemisia herba alba, Origanum syriacum, Ruta chalepensis, Lavandula stoechas, Salvia fruticosa, Mentha microphylla, Juniperus oxycedrus, Rosmarinus officinalis, Myrtus communis, Laurus nobilis and Ocimum gratissimum. Results show that essential oils isolated from F. vulgare, T. spicata, A. herba alba, O. syriacum and R. chalepensis have promising insecticidal potential. (author)

  4. Evaluation of ash from some tropical plants of Nigeria for the control of Sclerotium rolfsii Sacc. on wheat (Triticum aestivum L.). (United States)

    Enikuomehin, O A; Ikotun, T; Ekpo, E J


    Eleven ash samples, from organs of nine tropical plants, were screened for their abilities to inhibit mycelial growth and sclerotial germination of a Nigerian isolate of Sclerotium rolfsii on agar and in the soil. Ten ash samples showed some activity against mycelial growth of S. rolfsii in vitro. Ash samples from Delonix regia stem wood, Mangifera indica leaf and Vernonia amygdalina leaf were most effective as each totally inhibited mycelial growth of S. rolfsii in vitro. Ocimum gratissimum leaf ash, D. regia wood ash and Musa paradisiaca flower bract ash inhibited sclerotial germination on agar. Nine ash samples protected seeds against pre-emergence rot. Ash from M. indica leaf, V. amygdalina leaf and Azadirachta indica leaf protected seedlings against post-emergence infection. Eichornia crassipes ash, which was ineffective in vitro, offered some protection to seeds in soil against pre-emergence rot. The study demonstrates potentials of ash samples from tropical plants in control of S. rolfsii on wheat.

  5. Antimutagenic activity of extracts of leaves of four common edible vegetable plants in Nigeria (west Africa). (United States)

    Obaseiki-Ebor, E E; Odukoya, K; Telikepalli, H; Mitscher, L A; Shankel, D M


    Organic solvent extracts of leaves of 4 common edible vegetable plants--Bryophyllum pinnatum, Dialium guincense, Ocimum gratissimum and Vernonia amygdalina--had inhibitory activity for His- to His+ reverse-mutations induced by ethyl methanesulfonate acting on Salmonella typhimurium TA100. The concentrated ethyl acetate, methanol and petroleum ether extracts were heat-stable when dissolved in dimethyl sulfoxide. The Bryophyllum ethyl acetate extract was fractionated into alkaloidal/water-soluble, acids, polar lipid and non-polar lipid fractions. The polar and non-polar lipid fractions inhibited reversion mutations induced by ethyl methanesulfonate acting on TA100 or TA102, and were also active against reversions induced by 4-nitro-O-phenylenediamine and 2-aminofluorene in TA98. The alkaloidal/water-soluble and the acid fractions had no appreciable antimutagenic activities.

  6. Produção de biomassa e óleo essencial de elixir-paregórico em função do corte das inflorescências e épocas de colheita Biomass and essential oil production of Ocimum selloi as affected by cutting of inflorescences and harvest times

    Directory of Open Access Journals (Sweden)

    Larissa CB Costa


    Full Text Available Avaliou-se a produção de biomassa e óleo essencial de plantas de elixir-paregórico (Ocimum selloi, em função do corte das inflorescências e épocas de colheita. O experimento foi realizado em campo, em blocos ao acaso, com os tratamentos dispostos em fatorial 2 x 8, sendo dois sistemas de manejo (com e sem corte de inflorescências e oito épocas de colheita (45; 60; 75; 90; 105; 120; 135 e 150 dias após o transplante das mudas, com quatro repetições. Avaliaram-se as características altura de planta, massa seca de caule (MSC, folhas (MSF e inflorescências (MSI e teor e rendimento de óleo essencial destilado de folhas. O corte das inflorescências não afetou a altura das plantas. Plantas intactas apresentaram uma média de altura de 51,8 cm, enquanto aquelas que tiveram suas inflorescências cortadas atingiram em média 53,2 cm de altura. O crescimento das plantas apresentou resposta quadrática em relação às épocas de colheita, com a altura máxima estimada de 65,9 cm, 139 dias após o transplante (DAT. As plantas cujas inflorescências foram cortadas produziram maior MSC (51,8 g planta-1 e MSF (27,9 g planta-1, em relação às plantas sem corte (MSC = 42,4; MSF = 21,3 g planta-1 e, assim como MSI, apresentaram ajuste quadrático para os dois sistemas de manejo, ao longo das épocas de colheita. O teor de óleo essencial das folhas não foi afetado pelo sistema de manejo, mas apresentou resposta quadrática às épocas de colheita. Entretanto, o rendimento médio de óleo essencial das folhas das plantas cuja inflorescência foi cortada foi significativamente maior (1,60 g planta-1 do que nas plantas que não sofreram o corte (1,18 g planta-1. Para as plantas que tiveram as suas inflorescências cortadas, o rendimento de óleo máximo estimado foi de 2,36 g planta-1, obtido 135 DAT, enquanto nas plantas que não foram cortadas o rendimento de óleo máximo estimado foi de 1,65 g planta-1, obtido 114 DAP.Biomass and essential

  7. Light-Induced Alterations in Basil Ganglia Kynurenic Acid Levels (United States)

    Sroufe, Angela E.; Whittaker, J. A.; Patrickson, J. W.; Orr, M. C.


    The metabolic synthesis, release and breakdown of several known CNS neurotransmitters have been shown to follow a circadian pattern entrained to the environmental light/dark cycle. The levels of excitatory amino acid (EAA) transmitters such as glutamate, have been shown to vary with environmental lighting conditions. Kynurenic Acid (KA), an endogenous tryptophan metabolite and glutamate receptor antagonist, has been reported to have neuroprotective effects against EAA-induced excitotoxic cell damage. Changes in KA's activity within the mammalian basal ganglia has been proposed as being contributory to neurotoxicity in Huntington's Disease. It is not known whether CNS KA levels follow a circadian pattern or exhibit light-induced fluctuations. However, because the symptoms of certain degenerative motor disorders seem to fluctuate with daily 24 hour rhythm, we initiated studies to determine if basal ganglia KA were influenced by the daily light/dark cycle and could influence motor function. Therefore in this study, HPLC-EC was utilized to determine if basal ganglia KA levels in tissue extracts from adult male Long-Evans rats (200-250g) entrained to 24 and 48 hours constant light and dark conditions, respectively. Samples were taken one hour before the onset of the subjective day and one hour prior to the onset of the subjective night in order to detect possible phase differences in KA levels and to allow for accumulation of factors expressed in association with the light or dark phase. Data analysis revealed that KA levels in the basal ganglia vary with environmental lighting conditions; being elevated generally during the dark. Circadian phase differences in KA levels were also evident during the subjective night and subjective day, respectively. Results from these studies are discussed with respect to potential cyclic changes in neuronal susceptibility to excitotoxic damage during the daily 24 hour cycle and its possible relevance to future therapeutic approaches in treating neurodegenerative disorders.

  8. Effects of medicinal plant extracts on growth of Leishmania (L. amazonensis and Trypanosoma cruzi Efeito de extratos de plantas medicinais no crescimento de Leishmania (L. amazonensis e Trypanosoma cruzi

    Directory of Open Access Journals (Sweden)

    Patrícia Shima Luize


    Full Text Available This study describes the screening of extracts obtained from 19 species of plants used in Brazilian traditional medicine for treatment of a variety of diseases. The extracts were tested against axenic amastigote and promastigote forms of Leishmania (L. amazonensis, and epimastigote forms of Trypanosoma cruzi in vitro at a concentration of 100 mg/ml. Baccharis trimera, Cymbopogon citratus, Matricaria chamomilla, Mikania glomerata, Ocimum gratissimum, Piper regnellii, Prunus domestica, Psidium guajava, Sambucus canadensis, Stryphnodendron adstringens, Tanacetum parthenium, and Tanacetum vulgare showed significant effects against one or both parasites, with a percentage of growth inhibition between 49.5 and 99%. The extracts showed no cytotoxic effect on sheep erythrocytes. These medicinal plants may be sources of new compounds that are clinically active against L. amazonensis and T. cruzi.Este estudo descreve a triagem de extratos obtidos de 19 espécies de plantas usadas na medicina tradicional brasileira para o tratamento de várias doenças. Os extratos foram testados contra formas amastigota axênica e promastigota de Leishmania (L. amazonensis, e formas epimastigota de Trypanosoma cruzi in vitro na concentração de 100 mg/ml. Baccharis trimera, Cymbopogon citratus, Matricaria chamomilla, Mikania glomerata, Ocimum gratissimum, Piper regnellii, Prunus domestica, Psidium guajava, Sambucus canadensis, Stryphnodendron adstringens, Tanacetum parthenium, e Tanacetum vulgare apresentaram efeito significante contra um ou ambos parasitas, com a porcentagem de inibição de crescimento entre 49,5 e 99%. Os extratos não mostraram efeito citotóxico em hemácias de carneiro. Essas plantas medicinais podem ser fontes alternativas de novos compostos clinicamente ativos contra L. amazonensis e T. cruzi.

  9. Composition and antimicrobial activity of essential oils from aromatic plants used in Brazil Composição e atividade antimicrobiana de óleos essenciais de plantas aromáticas usadas no Brasil

    Directory of Open Access Journals (Sweden)

    Adilson Sartoratto


    Full Text Available Essential oils from aerial parts of Mentha piperita, M. spicata, Thymus vulgaris, Origanum vulgare, O. applii, Aloysia triphylla, Ocimum gratissimum, O. basilicum were obtained by steam destillation using a Clevenger-type system. These oils were screened for antibacterial and anti-Candida albicans activity using bioautographic method. Subsequently, minimal inhibitory concentration from oils was determined by microdilution method. Most essential oil studied were effective against Enterococcus faecium and Salmonella cholerasuis. Aloysia triphylla and O. basilicum presented moderate inhibition against Staphylococcus aureus while only A. tryphila and M. piperita were able to control the yeast Candida albicans. The oils were analyzed by GC and GC-MS techniques in order to determine the majoritary compounds.Óleos essenciais foram obtidos a partir das partes aéreas de Mentha piperita, M. spicata, Thymus vulgaris, Origanum vulgare, O. applii, Aloysia triphylla, Ocimum gratissimum e O. basilicum através de arraste de vapor em sistema tipo Clevenger. Os óleos foram avaliados quanto à atividade antimicrobiana contra bactérias e contra a levedura Candida albicans pelo método de bioautografia. A concentração mínima inibitória dos óleos com atividade positiva foi em seguida determinada pelo método da microdiluição. De acordo com os resultados, a maioria dos óleos essenciais estudados foram efetivos contra Enterococcus faecium e Salmonella cholerasuis. A.triphylla e O. basilicum apresentaram inibição moderada contra Staphylococcus aureus enquanto apenas A. tryphila e M. piperita foram capazes de inibir a levedura Candida albicans. Os óleos foram analisados quimicamente por técnicas de CG e CG-EM de modo a determinar os compostos majoritários presentes.

  10. Antibacterial Activity of Different Plant Extracts and Phenolic Phytochemicals Tested on Paenibacillus Larvae Bacteria

    Directory of Open Access Journals (Sweden)

    Liviu Mărghitaş


    Full Text Available Paenibacillus larvae, a Gram-positive and spore-forming bacterium is responsible for American foulbrood disease inbees. The antimicrobial activity of different plant extracts and phenolic phytochemical was evaluated onPaenibacillus larvae bacteria. In addition possible correlation with antioxidant activity of the same plant extracts wasstudied. Extracts of the following plants were utilized: Achillea millefolium (yarrow, Ocimum basilicum (basil,Thymus vulgaris (thyme and Urtica dioica (nettle. The extracts that showed antimicrobial activity were later testedto determine the Minimal Inhibitory Concentration (MIC. Although nettle present the lowest polyphenolic contentcompared with the other plant extracts, exhibit the highest antimicrobial activity, measured as the inhibition zoneusing Mueller-Hinton agar plates. Basil presented both polyphenolic content and antimicrobial activity at higherlevels, while thyme had the lowest antimicrobial activity, even it present high amount of polyphenols.

  11. Dicty_cDB: Contig-U12922-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-11 2 ( EA053492 ) Sequence 221 from patent US 7157621. 62 2e-11 4 ( DY329960 ) OB_MEa0004O04.r OB_MEa Ocimum basil...hql*mvfiknfkkkkkkkk Frame B: llaywxyyyyskyifvyt*niyk*fllvvnfv*lisivsnf*nnkekkngxk...CP001124 |pid:none) Geobacter bemidjiensis Bem, comp... 70 2e-10 (A4JHJ8) RecName...... 56 4e-06 CP000852_1193( CP000852 |pid:none) Caldivirga maquilingensis IC-16... 55 5e-06*frfw**awklw*i fr*sk*rgys*icmhfnfignqks*f*tksiinwwwyc*fy*cgchfqryh*sn*rvs** yh*iksfhfr*krwsklsigfttyernws*ity

  12. Dicty_cDB: Contig-U15678-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nating seedlings, TAMU Sola... 52 6e-10 3 ( DY336852 ) OB_SEa04P11.r OB_SEa Ocimum basil...efly Bemisia tabaci... 50 6e-10 2 ( T34713 ) EST73889 Human Bone Homo sapiens cDNA 5' end simi...qyiyiffiyiffffpklyif*kiilhpstqkkkkkkkkniisqhtv fcisi*ssp*nyffykkkik*ivfvfvliivifffpllnk*kkksffffliiyivi...qmyqphfkciliqaqtlte*lveqvmiqitf*lilq *rvklsiveplkfsinslinvlilvstlqvnkmqiplvevlkmf*dpskvvhnnhhhkyq nhnhnnhhnh... ... 60 5e-14 4 ( GE464933 ) 294762759 Nasonia vitripennis Adult Female Nasoni... 70 5e-14 2 ( BU819448 ) UA43BPG03 Populus trem

  13. FORMULASI SEDIAAN SABUN CAIR ANTIBAKTERI MINYAK ATSIRI DAUN KEMANGI (Ocimumamericanum L. DAN UJI TERHADAP BAKTERI Staphylococcus epidermidis dan Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Febry Astuti Abu


    Full Text Available Basil (Ocimum americanum L. is a plant that has antibacterial activity against Staphylococcus aureus and Staphylococcus epidermidis that is a bacteria can cause infection. Basil contains essential oils that act as an antibacterial. This research aims to formulate the essential oil of basil leaves into a liquid soap, determine antibacterial activity against S.aureus and S.epidermidis bacteria with the agar diffusion method using wells and determine the stability of the preparation. Antibacterial activity data that gain was analyzed by one-way ANOVA with a level of trust 95% followed by Duncan test. The results of the research showed basil essential oil liquid soap preparation has antibacterial activity. The analysis results showed that there were significant differences in the concentration of 2%, 3%, 4%, and the Duncan test results showed no significant difference between the concentration of 4% with control (+. The results of the t-student analysis of liquid soap include viscosity, pH and dispersive capacity does not fill the parameters of stability during the storage period of 28 days

  14. Antimicrobial activity of various extracts of Ocimum basilicum l. and ...

    African Journals Online (AJOL)

    While the chloroform and acetone extracts had no effect, the methanol extracts showed inhibition zones against strains of Pseudomonas aeruginosa, Shigella sp., Listeria monocytogenes, Staphylococcus aureus and two different strains of Escherichia coli. The cells of microorganisms, which were treated and untreated with ...

  15. Evaluation of nootropic potential of Ocimum sanctum Linn. in mice. (United States)

    Joshi, Hanumanthachar; Parle, Milind


    Dementia is one of the age related mental problems and a characteristic symptom of various neurodegenerative disorders including Alzheimer's disease. Certain drugs like diazepam, barbiturates and alcohol disrupt learning and memory in animals and man. However, a new class of drugs known as nootropic agents is now used in situations where there is organic disorder in learning abilities. The present work was undertaken to assess the potential of O. sanctum extract as a nootropic and anti-amnesic agent in mice. Aqueous extract of dried whole plant of O. sanctum ameliorated the amnesic effect of scopolamine (0.4 mg/kg), diazepam (1 mg/kg) and aging induced memory deficits in mice. Elevated plus maze and passive avoidance paradigm served as the exteroceptive behavioral models. O. sanctum extract decreased transfer latency and increased step down latency, when compared to control (piracetam treated), scopolamine and aged groups of mice significantly. O. sanctum preparations could of beneficial in the treatment of cognitive disorders such as dementia and Alzheimer's disease.

  16. In vitro regeneration of a common medicinal plant, Ocimum sanctum ...

    African Journals Online (AJOL)


    brings down circulatory strain, mitigates cardiovascular depressant, is antiulcer, fights .... DISCUSSION. Proficient regeneration systems are vital for hereditary. 0. 10. 20 .... Hao D, Xiao P (2015). Genomics and Evolution in Traditional Medicinal.

  17. Phytochemical and nutrient compositions of the leaves of Ocimum ...

    African Journals Online (AJOL)

    Aluko Bukola


    Aug 7, 2012 ... carbohydrate content (639.6 g/kg), ash, crude fat and crude fiber, but very ... In addition, the plant was found to be a good source of iron, zinc and manganese. Furthermore, the concentrations of cadmium (0.01 g/kg) and lead (0.02 g/kg), which are ... phytochemical, proximate, mineral and vitamin C analysis.

  18. Evaluation of Ocimum suave essential oil against anthropophilic ...

    African Journals Online (AJOL)

    Abstract: Interruption of vector-human contact is of priority in breaking the transmission chain of malaria parasites. The use of plant extracts as repellents against malaria vectors have been advocated in different studies. The objective of this study was to evaluate the protective efficacy of freshly distilled and ten years old ...

  19. Evaluation of Ocimum suave essential oil against anthropophilic ...

    African Journals Online (AJOL)

    The use of plant extracts as repellents against malaria vectors have been advocated in different studies. The objective of ... essential oil of Oc mum suave against Anopheles gamb ae s.s. The feeding inhibition of old and freshly prepared. O. suave extracts in ... against insects of medical and veterinary im- portance (Pålsson ...

  20. Antioxidant Activity of the Aqueous Crude Extract of Ocimum ...

    African Journals Online (AJOL)

    . leaf on the basal and traumatized (cadmium-induced) serum levels of alkaline phosphatase (ALP), total acid phosphatase (ACPT) and prostatic acid phosphatase (ACPP) of the male guinea-pig (GP) were evaluated. Preliminary ...