WorldWideScience

Sample records for basf-industriekernkraftwerk reaktor 2

  1. PENGARUH KONSENTRASI ZrO2 TERHADAP KORELASI PERPINDAHAN PANAS NANOFLUIDA AIR-ZrO2 UNTUK PENDINGIN REAKTOR

    Directory of Open Access Journals (Sweden)

    K.A. Sudjatmi

    2015-03-01

    Full Text Available Sejalan dengan perkembangan konsep keselamatan pasif pada sistem keselamatan PLTN, maka sistem perpindahan panas konveksi alam memegang peranan penting. Pemakaian nanofluid sebagai fluida pendingin pada sistem keselamatan nuklir dapat digunakan pada Sistem Pendingin Teras Darurat dan Sistem Pendingin Pengungkung Luar Reaktor. Beberapa peneliti telah melakukan studi desain konseptual aplikasi nanofluid untuk meningkatkan keselamatan AP1000 dan sistem pendingin teras darurat pada reaktor daya eksperimen. Penerapan nanofluida juga mulai dikembangkan melalui hasil penelitian perpindahan panas konveksi alamiah pada sub-buluh dengan nanofluida sebagai fluida kerjanya sangat dibutuhkan. Penelitian ini bertujuan untuk menentukan pengaruh perubahan konsentrasi ZrO2 terhadap korelasi perpindahan panas konveksi alamiah dengan pendekatan eksperimental. Data eksperimental yang diperoleh digunakan untuk mengembangkan korelasi umum empirik perpindahan panas konveksi alamiah. Metode penelitian dengan menggunakan alat uji sub-buluh vertikal dengan geometri segitiga dan segiempat menggunakan air dan nanofluida air-ZrO2 sebagai fluida kerjanya. Konsentrasi nanopartikel dalam larutan yang digunakan sebesar 0,05 %, 0,10% dan 0,15 % dalam persen berat. Hasil penelitian menunjukan bahwa untuk bilangan Rayleigh yang sama, kemampuan pemindahan kalor oleh nanofluida air-ZrO2 lebih baik dari pada pemindahan kalor oleh air. Namun peningkatan konsentrasi nanofluida tidak selalu mendapatkan kemampuan pemindahan kalor yang lebih baik. Kata kunci: nanofluida air-ZrO2, konveksi alamiah, sub-buluh segitiga, sub-buluh segi segiempat   In line with the development of the passive safety concept for the safety systems of nuclear power plants, the natural convection heat transfer system plays an important role. The nanofluid as coolant fluid on nuclear safety system can be used in Emergency core cooling system and in reactor coolant system confinement. Several researchers have

  2. DESAIN KONSEPTUAL PERISAI RADIASI REAKTOR RRI-50

    Directory of Open Access Journals (Sweden)

    Amir Hamzah

    2015-06-01

    Full Text Available ABSTRAK DESAIN KONSEPTUAL PERISAI RADIASI REAKTOR RRI-50. Salah satu parameter yang harus dipenuhi dalam mendesain reaktor nuklir adalah desain perisai radiasi yang dapat menjamin keamanan dan keselamatan radiasi bagi pekerja dan masyarakat sekitar. Pada penelitian ini dilakukan desain perisai radiasi RRI-50 dengan elemen bakar berjenis U9Mo-Al berkerapatan tinggi dengan tipe pelat sebanyak 21 buah dan berdimensi seperti elemen bakar RSG-GAS tapi panjang aktifnya 70 cm. Konfigurasi teras terdiri dari 16 elemen bakar dan 4 elemen kendali serta 5 posisi iradiasi sehingga membentuk matriks 5 x 5. Tujuan dari penelitian ini adalah mendesain perisai radiasi dan menentukan distribusi laju dosis di daerah kerja dan di lingkungan reaktor RRI-50. Tahapan awal penelitian adalah perhitungan kuat sumber dan inventori bahan radioaktif teras reaktor dengan mensimulasikan operasi 50 MW selama 20 hari tiap siklus menggunakan program ORGEN2.1. Berdasarkan kuat sumber tersebut dan model yang dibuat menggunakan program VisEd, maka dilakukan analisis penentuan parameter perisai radiasi secara iteratif menggunakan program MCNPX. Pada tahap akhir, dilakukan analisis distribusi laju dosis di seluruh ruang di dalam dan di luar gedung reaktor juga menggunakan program MCNPX. Hasil yang diperoleh menunjukkan bahwa ketinggian permukaan air adalah 1000 cm dan kombinasi 90 cm beton berat dan 60 cm beton biasa dapat digunakan sebagai perisai biologi. Desain perisai tersebut mereduksi laju dosis menjadi 0,05 µSv/jam di Balai Operasi sementara di Balai Eksperimen dan di luar gedung reaktor menjadi 4,2 µSv/jam dan 0,03 µSv/jam pada saat reaktor beroperasi. Hasil penelitian juga menunjukkan pemasagan perisai tambahan setebal 280 cm berjarak 300 cm di depan tabung berkas neutron radial yang terbuka mereduksi laju dosis gamma dan neutron menjadi 3,3 µSv/jam dan 3,1x10-11 µSv/jam. Hasil-hasil penelitian ini menunjukkan bahwa desain perisai radiasi yang dibuat membuat reaktor

  3. Pembuatan Biodiesel Dari Minyak Kelapa Sawit Dengan Menggunakan Katalis Berpromotor Ganda Berpenyangga γ-Alumina (CaO/KI/γ-Al2O3 Dalam Reaktor Fluidized Bed

    Directory of Open Access Journals (Sweden)

    Sunu R Puspitaningati

    2013-09-01

    Full Text Available Biodiesel merupakan salah satu energi alternatif pengganti bahan bakar fosil dari hasil reaksi transesterifikasi minyak nabati dengan metanol. Proses pembuatan biodiesel selama ini menggunakan katalis homogen NaOH atau KOH yang memiliki kelemahan terbentuknya produk samping berupa sabun dan rumitnya pemisahan produk biodiesel dengan katalis. Maka dari itu, mulai dikembangkan penggunaan katalis heterogen untuk menggantikan penggunaan katalis homogen. Penelitian ini mengembangkan katalis CaO/KIγ-Al2O3­. Pembuatan katalis melalui metode presipitasi CaO pada γ-Al2O3 serta asam asetat sebagai larutan precursor selama 3 jam lalu impregnasi KI selama 3 jam. Kemudian, dioven selama 12 jam pada suhu 110oC dan dikalsinasi pada suhu 650oC selama 4,5 jam. Katalis yang diperoleh digunakan untuk membantu proses transesterifikasi biodiesel dengan variable massa katalis, rasio molar minyak dan metanol, dan suhu. Dari hasil penelitian didapatkan bahwa biodiesel dapat diproduksi melalui reaksi transesterifikasi menggunakan katalis CaO/KI/γ-Al2O3­ dalam reaktor fluidized bed. Kemurnian tertinggi dari biodiesel yang didapatkan yaitu sebesar 99,17%. Yield dan konversi tertinggi sebesar 97,19% dan 96,89%  didapatkan pada penggunaan massa katalis 16 gram dan rasio molar minyak dan metanol 1 : 36 serta kondisi operasi suhu 225oC dan laju alir umpan 6 ml/menit (waktu tinggal 8 jam memiliki densitas sebesar 0,853 gr/ml serta viskositas sebesar 5,53 mm2/s (cSt.

  4. ANALISIS PENGENDALIAN DAYA REAKTOR PCMSR DENGAN LAJU ALIR PENDINGIN

    Directory of Open Access Journals (Sweden)

    Iqbal Syafin Noha

    2015-03-01

    Full Text Available Passive Compact Molten Salt Reactor (PCMSR merupakan pengembangan dari Molten Salt Reactor (MSR yang memiliki karakter berbeda dengan lima reaktor generasi IV lainnya, yaitu menggunakan bahan bakar leburan garam. Pada reaktor MSR, garam lebur tidak digunakan sebagai pendingin tetapi digunakan sebagai medium pembawa bahan bakar. Dengan fase bahan bakar yang berupa garam lebur LiF-BeF2-ThF4-UF4, maka dapat dilakukan pengendalian daya dengan mengatur laju aliran bahan bakar dan pendingin. Tujuan penelitian ini adalah untuk mengetahui pengaruh perubahan laju alir pendingin terhadap daya reaktor PCMSR. Analisis dilakukan dengan empat jenis masukan untuk perubahan laju alir pendingin, yaitu masukan step, ramp, eksponensial, dan sinusoidal. Untuk masukan step, laju alir pendingin dibuat berubah secara mendadak. Selanjutnya untuk masukan ramp dan eksponensal, perubahan laju alir masing-masing dibuat perlahan secara linear dan mengikuti fungsi eksponensial. Kemudian untuk masukan sinusoidal, laju alir berubah naik turun secara periodik dengan memvariasikan frekuensi dari perubahan laju alir tersebut. Hasil penelitian menunjukkan bahwa penurunan laju alir pendingin sebesar 50% dari laju pendingin sebelumnya, menyebabkan daya pada reaktor PCMSR turun sebesar 63% dari daya sebelumnya. Jika terjadi fluktuasi laju aliran pendingin, maka semakin cepat perubahan tersebut, maka respon daya yang diberikan semakin kecil. Pada frekuensi yang sangat cepat, daya reaktor menjadi konstan dan cenderung tidak memiliki respon terhadap laju aliran. Hal ini merupakan salah satu aspek keselamatan reaktor, karena reaktor tidak merespon perubahan yang terlalu cepat. Kemampuan reaktor mengatur daya menyesuaikan laju aliran pendingin merupakan aspek keselamatan lainnya. Kata kunci : PCMSR, pengendalian daya, laju alir pendingin, uji respon   Passive Compact Molten Salt Reactor (PCMSR is the development of Molten Salt Reactor (MSR which has different character from other five

  5. OPTIMASI DESAIN TERMOHIDROLIKA TERAS DAN SISTEM PENDINGIN REAKTOR RISET INOVATIF DAYA TINGGI

    Directory of Open Access Journals (Sweden)

    Endiah Puji Hastuti

    2015-10-01

    Full Text Available ABSTRAK OPTIMASI DESAIN TERMOHIDROLIKA TERAS DAN SISTEM PENDINGIN REAKTOR RISET INOVATIF DAYA TINGGI. Implementasi reaktor inovasi telah diterapkan pada berbagai reaktor riset baru yang saat ini sedang dibangun.  Pada saat ini BATAN sedang merancang desain konseptual reaktor riset daya tinggi yang telah masuk pada tahap optimasi desain. Spesifikasi desain konseptual reaktor riset inovatif adalah reaktor tipe kolam berpendingin air dan reflektor D2O. Teras reaktor memiliki kisi 5x5 dengan 16 bahan bakar dan 4 batang kendali. Teras reaktor berada di dalam tabung berisi D2O yang berfungsi sebagai posisi iradiasi. Daya reaktor 50 MW didesain untuk membangkitkan fluks neutron termal sebesar 5x1014 n/cm2s. Teras reaktor berbentuk kompak dan menggunakan bahan bakar U9Mo-Al dengan tingkat muat uranium 7-9 gU/cm3. Desain termohidrolika yang mencakup pemodelan, perhitungan dan analisis kecukupan pendingin dibuat sinergi dengan desain fisika teras agar keselamatan reaktor terjamin. Makalah ini bertujuan menyampaikan hasil analisis perhitungan termohidrolika teras dan sistem reaktor riset inovatif pada kondisi tunak. Analisis dilakukan menggunakan program perhitungan yang telah tervalidasi, masing-masing adalah Caudvap, PARET-ANL, Fluent dan ChemCad 6.4.1. Hasil perhitungan menunjukkan bahwa pembangkitan panas yang tinggi dapat dipindahkan tanpa menyebabkan pendidihan dengan menerapkan desain teras reaktor bertekanan, di samping itu desain awal komponen utama sistem pembuangan panas yang terintegrasi telah dilakukan, sehingga konseptual desain termohidrolika RRI-50 dapat diselesaikan. Kata kunci : reaktor riset inovatif, Caudvap, PARET-ANL, Fluent, ChemCad 6.4.1.   ABSTRACT THERMALHYDRAULIC DESIGN AND COOLING SYSTEM OPTIMIZATION OF THE HIGH POWER INOVATIVE RESEARCH REACTOR. Reactor innovation has been implemented in a variety of new research reactors that currently are being built. At this time BATAN is designing a conceptual design of the high power

  6. INVESTIGASI KARAKTERISTIK TERMOHIDROLIKA TERAS REAKTOR DAYA KECIL DENGAN PENDINGINAN SIRKULASI ALAM MENGGUNAKAN RELAP5

    Directory of Open Access Journals (Sweden)

    Susyadi Susyadi

    2016-02-01

    Full Text Available ABSTRAK INVESTIGASI KARAKTERISTIK TERMOHIDROLIKA TERAS REAKTOR DAYA KECIL DENGAN PENDINGINAN SIRKULASI ALAM MENGGUNAKAN RELAP5. Reaktor modular daya-kecil (small modular reactor, SMR memiliki prospek tinggi untuk dibangun di Indonesia. Keluaran dayanya yang relatif kecil dan disainnya yang kompak serta dapat dikonstruksi secara modular memberikan keunggulan fleksibilitas pembangunan yang lebih baik dibanding reaktor konvensional berdaya besar. Disain sistem reaktor kategori ini sangat bervariasi, salah satu diantaranya adalah jenis reaktor air tekan (pressurized water reactor, PWR yang menerapkan sirkulasi alamiah pada sistem pendingin primernya. Selain itu reaktor ini juga memiliki teras (core lebih pendek dibanding PWR konvensional. Dari kedua perbedaan tersebut maka terdapat kemungkinan perbedaan pola perpindahan panas yang dapat berimplikasi terhadap keselamatan secara keseluruhan. Oleh karena itu, pada penelitian ini dilakukan investigasi terhadap karakteristik termohidrolika teras reaktor tersebut khususnya karakteristik temperatur fluida dan bahan bakar serta laju alir fluidanya. Tujuannya adalah untuk mengetahui perbedaan marjin keselamatan temperatur teras reaktor bila dibanding dengan PWR konvensional. Investigasi dilakukan dengan menggunakan program RELAP5, dimana secara parsial teras reaktor dimodelkan menggunakan model-model generik yang ada pada program dan dilakukan beberapa perhitungan kondisi tunak. Hasil perhitungan menunjukkan bahwa saat beroperasi pada daya nominalnya, reaktor modular ini memiliki margin temperatur pendidihan sebesar 2K lebih baik dibanding reaktor konvensional. Selain itu, keunggulan marjin keselamatan reaktor modular daya-kecil ini juga ditunjukkan dari naiknya laju alir mengikuti kenaikan dayanya yang berarti memiliki sifat keselamatan yang melekat (inherent safety. Kata kunci: reaktor modular daya-kecil, PWR, sirkulasi alam, RELAP5, termohidrolika   ABSTRACT INVESTIGATION ON CORE THERMAL HYDRAULIC

  7. DESAIN KONSEPTUAL TERAS REAKTOR RISET INOVATIF BERBAHAN BAKAR URANIUM MOLIBDENUM DARI ASPEK NEUTRONIK

    Directory of Open Access Journals (Sweden)

    Tukiran Surbakti

    2015-03-01

    Full Text Available Manfaat yang luas dari penggunaan reaktor riset membuat banyak negara membangun reaktor riset baru. Kecenderungan saat ini adalah reaktor tipe reaktor serbaguna (MPR dengan teras yang kompak untuk mendapatkan fluks neutron yang tinggi dengan daya yang relatif sedang atau rendah. Reaktor riset yang ada di Indonesia yang paling muda usianya sudah berumur 25 tahun. Oleh karena itu diperlukan desain reaktor riset baru sebagai alternatif, disebut reaktor riset inovatif (RRI, kelak pengganti reaktor riset yang sudah ada. Tujuan dari riset ini mendapatkan konfigurasi teras setimbang reaktor riset yang optimal dengan kriteria memiliki fluks neutron termal minimum sebesar 2,5x1014 n/cm2 s pada daya 20 MW (minimum, memiliki panjang operasi satu siklus lebih dari 40 hari dan penggunaan bahan bakar yang paling efisien. Desain neutronik dilakukan untuk bahan bakar baru U-9Mo-Al dengan kerapatan bervariasi dan jenis reflektor yang bervariasi. Desain dilakukan dengan paket program WIMSD-5B dan BATAN-FUEL. Hasil desain konseptual menyajikan 4 konfigurasi teras yaitu 5×5, 5×7, 6×5 dan 6×6. Hasil optimasi menunjukkan bahwa teras setimbang reaktor RRI dengan konfigurasi 5×5, tingkat muat 235U sebesar 450 g, reflektor berilium, fluks neutron termal maksimum di daerah reflektor sebesar 3,33×1014 neutron cm-2s-1 dan panjang siklus 57 hari merupakan desain teras reaktor riset inovatif yang paling optimal. Kata kunci: desain konseptual, bahan bakar uranium-molibdenum,berilium, D2O, WIMS, BATAN-FUEL   The multipurpose of research reactor utilization make many countries build the new research reactor. Trend of this reactor for this moment is multipurpose reactor type with a compact core to get high neutron flux at the low or medium level of power. The research newest reactor in Indonesia right now is already 25 year old. Therefore, it is needed to design a new research reactor, called innovative research reactor (IRR and then as an alternative to replace the old

  8. DESAIN TERAS ALTERNATIF UNTUK REAKTOR RISET INOVATIF (RRI DARI ASPEK NEUTRONIK

    Directory of Open Access Journals (Sweden)

    Iman Kuntoro

    2015-03-01

    Full Text Available Berdasarkan dokumen kriteria pengguna dan fungsi utamanya, Reaktor Riset Inovatif (RRI dipersyaratkan dapat menghasilkan fluks neutron termal maksimum 1×1015 neutron cm-2s-1. Hal ini diperlukan agar reaktor RRI dapat digunakan untuk target yang membutuhkan fluks neutron tinggi. Dalam penelitian sebelumnya diperoleh bahwa desain reaktor RRI tidak mungkin menghasilkan fluks neutron tersebut jika menggunakan bahan bakar seperti yang digunakan reaktor RSG-GAS. Hal ini diduga karena dimensinya terlalu besar, mengingat fluks neutron berbanding terbalik dengan volume teras. Tujuan penelitaian ini adalah untuk mendapatkan desain teras alternatif reaktor RRI yang memenuhi persyaratan fluks neutron termal tersebut. Alternatif bahan bakar yang dipilih adalah yang dipakai di reaktor JMTR (Japan Material Testing Reactor yang berdimensi lebih kecil dibanding reaktor RSG-GAS. Disamping itu tinggi aktif teras divariasi 70 cm dan 75 cm. Desain teras dilakukan dengan perangkat analaitik WIMS-D5B, Batan-FUEL dan Batan-3DIFF. Teras alternatif menggunakan konsep konfigurasi teras kompak 5×5 dengan 4 elemen kendali jenis follower. Berdasarkan hasil perhitungan ada 3 (tiga teras alternatif yang dapat memenuhi persyaratan tersebut, termasuk teras menggunakan bahan bakar reaktor RSG-GAS dengan menambah tinggi aktifnya menjadi 70 cm dari 60 cm. Dengan menganalisis seluruh aspek, keselamatan serta efisiensi dan efektivitas reaktor, maka teras alternatif dengan bahan bakar tipe JMTR dengan tinggi aktif 70 cm merupakan teras alternatif yang terbaik. Kata kunci: neutronik, teras kompak, reaktor riset inovatif, fluks neutron termal tinggi   Based on its User Requirement Document and main function, RRI shall be able to provide a maximum thermal neutron flux of 1×1015 neutron cm-2s-1. The reason is that the RRI reactor can serve targets requiring a high neutron flux. From the previous results it was obtained that RRI design using fuel of RSG-GAS type was not possible to

  9. ANALISIS KECELAKAAN REAKTOR AKIBAT KEGAGALAN SISTEM PEMBUANG PANAS PADA REAKTOR NUKLIR GENERASI IV

    Directory of Open Access Journals (Sweden)

    A. G. Abdullah

    2012-05-01

    Full Text Available Salah satu aspek terpenting dalam proses desain reaktor nuklir adalah aspek keselamatan reaktor. Sebelum membangun reaktor secara fisik, terlebih dahulu dibuat perencaaan perhitungan yang matang termasuk melakukan simulasi kinerja keselamatannya dalam menghadapi kemungkinan kecelakaan. Penelitian ini bertujuan untuk mengembangkan model simulasi kecelakaan Pembangkit Listrik Tenaga Nuklir (PLTN yang disebabkan  gagalnya sistem pembuang panas. Kecelakaan akibat gagalnya sistem pembuang panas dipicu oleh hilangnya kemampuan pendinginan dari pembangkit uap. Urutan kecelakaan ini diawali dengan hilangnya kemampuan reaktor untuk membuang panas dari loop pendingin sekunder. Selama kecelakaan, laju pembuangan panas mengalami penurunan sedangkan temperatur masukan pendingin mengalami peningkatan. Hasil simulasi memberikan gambaran bahwa reaktor dapat bertahan dari kecelakaan. Hasil analisis kecelakaan menunjukkan bahwa temperatur maksimum bahan bakar, selongsong dan pendingin memiliki batas keselamatan yang sangat besar.One of the most important aspects in nuclear reactor design process is the safety aspect. Advanced and accurate safety simulation must be performed before it can be built.  This research aims to develop a simulation model of Nuclear Power Plant (NPP accidents due to the loss of  heat sink system. Loss of heat sink accident was triggered by the loss of cooling capability of steam generators.  This  accident  sequence  began with the loss of the reactor’s ability to remove heat from the secondary cooling loop. During the accident, the heat dissipation rate decreased whereas the coolant inlet temperatures increased till a new equilibrium level. The analysis results of the accident showed that there are large safety margin to the maximum temperature of the fuel, cladding, and coolant.

  10. Pembuatan Biodiesel Dari Minyak Kelapa Sawit RBD Dengan Menggunakan Katalis Berpromotor Ganda Berpenyangga γ-Alumina (CaO/MgO/ γ-Al2O3 Dalam Reaktor Fluidized Bed

    Directory of Open Access Journals (Sweden)

    Niar Kurnia Julianti

    2014-09-01

    Full Text Available Biodiesel merupakan salah satu energi alternatif pengganti bahan bakar fosil dari hasil reaksi transesterifikasi minyak nabati dengan metanol. Proses pembuatan biodiesel selama ini menggunakan katalis homogen NaOH atau KOH yang memiliki kelemahan terbentuknya produk samping berupa sabun dan rumitnya pemisahan produk biodiesel dengan katalis. Maka dari itu, mulai dikembangkan katalis heterogen. Penelitian ini mengembangkan katalis berpromotor ganda berpenyangga y-alumina (CaO/MgO/y-Al2O3 dalam reaktor fluidized bed. Pembuatan katalis melalui metode presipitasi CaO dan MgO pada y-Al2O3 serta asam asetat sebagai larutan precursor. Kemudian, katalis dioven selama 12 jam pada suhu 110C dan dikalsinasi pada suhu 700 C selama 5 jam. Katalis yang diperoleh digunakan untuk proses transesterifikasi dengan ratio molar minyak metanol 1:36; variabel massa katalis 4, 7, 10, 13, 16 gram; laju alir reaktan 4, 7, 10, 13, 16 ml/menit; dan suhu 125, 150, 175, 200, 225 C. Dimana yield dan % konversi terbaik dari penelitian diperoleh sebesar 0,642 gr biodiesel/gr minyak dan 63,975% pada massa katalis 16 gram, suhu 225 C dan laju alir reaktan 4 ml/menit.

  11. Fire modeling of the Heiss Dampf Reaktor containment

    Energy Technology Data Exchange (ETDEWEB)

    Nicolette, V.F. [Sandia National Labs., Albuquerque, NM (United States); Yang, K.T. [Notre Dame Univ., IN (United States)

    1995-09-01

    This report summarizes Sandia National Laboratories` participation in the fire modeling activities for the German Heiss Dampf Reaktor (HDR) containment building, under the sponsorship of the United States Nuclear Regulatory Commission. The purpose of this report is twofold: (1) to summarize Sandia`s participation in the HDR fire modeling efforts and (2) to summarize the results of the international fire modeling community involved in modeling the HDR fire tests. Additional comments, on the state of fire modeling and trends in the international fire modeling community are also included. It is noted that, although the trend internationally in fire modeling is toward the development of the more complex fire field models, each type of fire model has something to contribute to the understanding of fires in nuclear power plants.

  12. Pengembangan Reaktor Fotokatalitik Rotating Drum untuk Pengolahan Air Limbah Industri Tekstil

    Directory of Open Access Journals (Sweden)

    Cholid Syahroni

    2015-11-01

    Full Text Available Reaksi oksidasi fotokatalitik memiliki potensi untuk mendegradasi senyawa organik hingga tingkat mineralisasi, sehingga tidak meninggalkan residu (sludge. Penelitian ini bertujuan membuat reaktor fotokatalitik rotating drum dan mengaplikasikan pada industri tekstil. Langkah percobaan meliputi pembuatan katalis TiO2 secara anodizing serta karakterisasi dengan XRD dan SEM, pembuatan reaktor fotokatalitik  rotating drum dan uji coba degradasi air limbah industri tekstil. Proses anodizing dilakukan dengan bias potensial sebesar 40 volt selama 2 jam menggunakan elektrolit etilen glikol yang mengandung amonium fluorida dan air. Uji karakterisasi secara XRD dan SEM menunjukkan bahwa struktur kristal TiO2 adalah anatase dengan ukuran kristalit 8–19 nm. Bentuk kristal nanotube, dengan diameter 30–110 nm. Hasil uji coba menunjukkan bahwa  degradasi secara fotokatalitik dengan penambahan H2O2 0,15% terhadap air limbah bisa menurunkan COD 72,12% dalam waktu 2 jam. 

  13. REAKTOR INNOVATIVE MOLTEN SALT (IMSR DENGAN SISTEM KESELAMATAN PASIF MENYELURUH

    Directory of Open Access Journals (Sweden)

    Andang Widiharto

    2015-04-01

    Full Text Available Pengembangan Teknologi Reaktor Nuklir pada masa mendatang mengarah pada peningkatan aspek keselamatan, peningkatan pendayagunaan bahan bakar, reduksi limbah radioaktif, ketahanan terhadap proliferasi bahan-bakar nuklir dan peningkatan aspek ekonomi. reaktor Innovative Molten Salt (IMSR adalah reaktor nuklir yang menggunakan bahan bakar cair berupa garam lebur fluoride (7LiF-ThF4-UF4-MaFx. Reaktor IMSR didesain sebagai reaktor pembiak termal, yaitu membiakkan U-233 dari Th-232. Hal ini untuk menjawab permasalahan sustainabilitas ketersedian sumber daya bahan bakar nuklir dan reduksi limbah radioaktif. Dalam aspek keselamatan, desain reaktor IMSR memiliki sifat inherent safe, yaitu koefisien umpan balik daya yang negatif serta memiliki fitur-fitur keselamatan pasif. Fitur-fitur keselamatan pasif terdiri dari sistem shutdown pasif, sistem pendinginan pasif pasca shutdown serta sistem pendinginan pasif untuk produk fisi. Kecelakaan yang berpotensi terjadi pada IMSR, yaitu kecelakaan kehilangan aliran bahan bakar, kecelakaan kehilangan aliran pendingin, kecelakaan kehilangan kemampuan pengambilan kalor serta kecelakaan kerusakan integritas sistem reaktor, dapat ditangani sepenuhnya secara pasif hingga mencapai kondisi shutdown selamat. Kata kunci: keselamatan pasif, inherent safe, IMSR   The next Nuclear Reactor Technology developments are directed to the increasing of the aspects of safety, fuel utility, radioactive waste reduction, proliferation retention and economy. Innovative Molten Salt Reactor (IMSR is a nuclear reactor design that uses fluoride molten salt (7LiF-ThF4-UF4-MaFx. IMSR is designed as a thermal breeder reactor, i.e. to produce U-233 from Th-232. This is the answer of natural nuclear fuel sustainability and radioactive waste problems. In term of safety aspect, IMSR design has inherent safe characteristics, i.e. negative power feedback coefficient, and passive safety features. The passive safety features are passive shutdown

  14. ANALISIS SEBARAN RADIONUKLIDA PADA KONDISI NORMAL UNTUK REAKTOR AEC 1000 MW

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2015-03-01

    Full Text Available Telah dilakukan analisis sebaran radionuklida pada reaktor daya Atomic Energy Agency (AEC 3568 MWTh, setara dengan 1000 Mwe untuk kondisi operasi normal. Analisis dilakukan untuk dua reaktor yang terpisah sejauh 500 m dan sudut 90o satu dengan yang lain. Langkah awal dalam melakukan analisis adalah menentukan suku sumber reaktor menggunakan program komputer ORIGEN2 dan EMERALD NORMAL. ORIGEN2 digunakan untuk menentukan inventori radionuklida yang terdapat di reaktor. Selanjutnya dengan dengan menggunakan program EMERALD NORMAL dihitung suku sumber yang sampai ke cerobong reaktor. Untuk menganalisis dosis yang diterima penduduk dilakukan dengan menggunakan program PC-CREAM. Perhitungan dilakukan untuk satu dan dua PLTN di calon tapak PLTN. Hasil yang diperoleh adalah sebaran radionuklida terbesar untuk satu PLTN pada jarak 1 km dan kearah zona 9 (191,25o dan untuk dua PLTN pada jarak 1 km dan kearah zona 10 (213,75o. Radionuklida yang sampai ke penduduk melalui dua alur yaitu alur makanan dan hirupan. Untuk alur makanan berasal dari radionuklida I-131, dan terbesar melalui alur produk susu sebesar 53,40 % untuk satu maupun dua PLTN . Untuk alur hirupan ranionuklida pemberi kontribusi paparan terbesar berasal dari Kr-85m sebesar 53,80 %. Dosis total terbesar yang diterima penduduk terdapat pada jarak 1 Km untuk bayi yaitu sebesar 4,10 μSi dan 11,26 μSi untuk satu dan dua PLTN. Hasil ini sangat kecil dibandingkan dengan batas dosis yang diijinkan oleh badan pengawas (BAPETEN untuk penduduk yaitu sebesar 1 mSi. Kata Kunci : Reaktor daya, komputer code, radionuklida, alur makanan, hirupan   Analysis for radionuclide dispersion for the Atomic Energy Agency (AEC 3568 MWth Power Reactor, equal to the 1000 MWe at normal condition has been done. Analysis was done for two piles that is separated by 500 m distance and angle of 90o one to other. Initial pace in doing the analysis is to determine reactors source term using ORIGEN2 and EMERALD NORMAL

  15. ANALISIS DESAIN PROSES SISTEM PENDINGIN PADA REAKTOR RISET INOVATIF 50 MW

    Directory of Open Access Journals (Sweden)

    Sukmanto Dibyo

    2015-03-01

    Full Text Available Reaktor Riset Inovatif (RRI merupakan jenis MTR (Material Testing Reactor yang dipersiapkan ke depan sebagai desain reaktor baru. Daya RRI telah ditetapkan dari perhitungan neutronik dan termohidrolika teras yaitu 50 MW termal. Reaktor bertekanan 8 kgf/cm2 dan laju aliran massa pendingin primer 900 kg/s. Tantangan yang penting dalam menindak lanjuti desain reaktor ini adalah analisis desain pada sistem pendingin. Makalah ini bertujuan untuk menganalisis desain proses sistem pendingin utama reaktor RRI daya 50 MW (RRI-50 dengan menggunakan program Chemcad 6.1.4. Dalam analisis ini dilakukan perhitungan neraca massa dan energi (mass/energy balances pada sistem pendingin primer dan sekunder sebagai pendingin utama. Masing-masing sistem pendingin tersebut terdiri dari 2 jalur beroperasi secara paralel dan 1 jalur redundansi. Disamping itu untuk desain termal unit komponen telah dianalisis dengan program RELAP5, frenchcreek dan Metoda Analitik. Hasil analisis yang diperoleh adalah desain diagram sistem pendingin yang mencakup data parameter entalpi, temperatur, tekanan dan laju aliran massa pendingin untuk masing-masing jalur. Adapun hasil desain unit komponen utama pada RRI-50 adalah tangki tunda dengan volume 51,5 m3, 2 unit pompa sentrifugal dan 1 unit pompa cadangan pada pendingin primer daya 141 kW/pompa dan pendingin sekunder daya 206 kW/pompa, 2 unit penukar panas tipe shell-tube dengan koefisien termal overall 1377 W/m2.oC dan 4 unit menara pendingin yang mampu melepaskan panas ke udara dengan desain temperatur approach 5,0 oC dan temperatur range 9,0 oC. Desain sistem pendingin reaktor RRI-50 ini telah menetapkan parameter operasi sistem pendingin yaitu temperatur, tekanan dan laju aliran massa pendingin dengan mempertimbangkan tuntutan aspek keselamatan teras reaktor sehingga desain temperatur maksimum pendingin masuk ke teras 44,5 oC. Kata kunci : RRI 50 MW, desain sistem pendingin, program Chemcad 6.1.4   Innovative Research Reactor RRI

  16. PENGARUH DAYA DAN DURASI OPERASI REAKTOR TERHADAP KONSENTRASI 3H DAN 14C DI AIR SISTEM PENDINGIN PRIMER REAKTOR RSG-GAS

    Directory of Open Access Journals (Sweden)

    Pande Made Udiyani

    2015-03-01

    Full Text Available Telah dilakukan penelitian terhadap pengaruh daya dan durasi operasi reaktor terhadap konsentrasi 3H dan 14C dalam air sistem pendingin primer reaktor RSG-GAS. Keberadaan nuklida 3H dan 14C di dalam air sistem pendingin primer reaktor RSG-GAS merupakan hasil produk fisi dan aktivasi. Nuklida radioaktif ini mempunyai potensi bahaya radiasi interna dan eksterna, karena mempunyai umur paro yang panjang yaitu 12,26 tahun untuk 3H dan 5568 tahun untuk 14C, sehingga mempunyai dampak radiologis yang sangat berarti. Analisis dan pengukuran contoh cuplikan air pendingin primer dilakukan dengan menggunakan alat LSC (Liquid Scintillation Counter. Tujuan dari penelitian ini adalah mengetahui pengaruh daya dan durasi operasi reaktor terhadap konsentrasi nuklida 3H dan 14C dalam air sistem pendingin primer, korelasi konsentrasi kedua nuklida dengan komponen sistem reaktor yang berkaitan dengan penuaan komponen, dan estimasi penerimaan radiasi terhadap pekerja radiasi di reaktor RSG-GAS dalam kaitan dengan keselamatan daerah kerja dan keselamatan personil. Hasil penelitian menunjukkan bahwa besarnya konsentrasi 3H dan 14C di air sistem pendingin primer reaktor RSG-GAS sebanding dengan daya yang dibangkitkan dan durasi operasi reaktor. Pertambahan konsentrasi 3H dan 14C di kolam reaktor RSG-GAS yang pesat setelah lima tahun pertama operasi reaktor diperkirakan karena intensitas pengoperasian reaktor yang tinggi, dan adanya proses akumulasi nuklida yang mempunyai umur paro yang panjang. Hasil penelitian ini dapat dimanfaatkan untuk mengkaji keselamatan operasi reaktor, keselamatan personil, keselamatan kerja, dan proses penuaan reaktor. Kata kunci : air pendingin primer, 3H, 14C, reaktor RSG-GAS   The influence of reactor power and operation duration on concentration of 3H and 14C in primary coolant water system RSG-GAS reactor has been studied. The existence of nuclides 3H and 14C in primary coolant system RSG-GAS reactor is a result of fission product and

  17. KINETIKA REAKSI OKSIDASI KATALITIK FERO SULFAT DARI LIMBAH BESI DALAM REAKTOR LULUHAN

    Directory of Open Access Journals (Sweden)

    Hary Sulistyo

    2012-02-01

    Full Text Available Limbah besi yang berupa serbuk direaksikan dengan asam sulfat membentuk larutan fero sulfat. Larutan fero sulfat dapat dioksidasi menjadi feri sulfat. Oksidasi dijalankan dalam reaktor drift pada tekanan dan suhu tetap. Percobaan dilakukan pada kisaran suhu 323K sampai 353K dan konsentrasi katalisator dari 1,7 sampai 6,7 g/L, waktu reaksi 150 menit pada tekanan atmosferis. Nilai konversi tertinggi fero sulfat menjadi feri sulfat yang diperoleh 39,5%. Nilai koefisien perpindahan massa gas ke cairan dan cairan ke permukaan padatan berturut-turut 37,18 cm/s dan 180 cm/s. Hubungan antara konstante kecepatan reaksi permukaan dengan suhu dapat dinyatakan dalam bentuk persamaan Arrhenius, k = 2,8092x107exp(-8794/RT. Hasil penelitian yang diperoleh sesuai dengan data di pustaka dan kinetika reaksi ditentukan oleh gabungan antara perpindahan massa gas ke cairan dan reaksi pada permukaan katalisator. 

  18. OPTIMASI GEOMETRI TERAS REAKTOR DAN KOMPOSISI BAHAN BAKAR BERBENTUK BOLA PADA DESAIN HIGH TEMPERATURE FAST REACTOR (HTFR

    Directory of Open Access Journals (Sweden)

    Agustina Mega

    2015-04-01

    Full Text Available Telah dilakukan desain High Temperature Fast Reactor (HTFR tipe pebble dengan bahan bakar uranium plutonium nitrida berpendingin Pb-Bi. Parameter yang dianalisis adalah kritikalitas teras, koefisien reaktivitas temperatur bahan bakar, koefisien reaktivitas void pendingin dan kemampuan breeding reaktor. Perhitungan dilakukan dengan paket program SRAC2K3. Dari penelitian ini diharapkan diperoleh desain teras berumur lama dan memiliki fitur keselamatan melekat. Dari penelitian ini diperoleh desain reaktor dengan diameter 520 cm dan tinggi 480 cm. Bahan bakar berbentuk pebble dengan 63 % UN-37 % PuN pada zona core dan 95,5 % UN-4,5 % PuN pada zona blanket. Reaktor tidak kritis setelah kurang lebih 800 hari dan keff pada BoL 1,078223 dan keff setelah 800 hari adalah 0,986379. Dari penelitian ini diperoleh koefisien reaktivitas temperatur bahan bakar sebesar -2,190014E-05 pada saat BoL dan -1,390773E-05 setelah 800 hari serta koefisien reaktivitas void pendingin sebesar -2,160402E-04/% void pada saat BoL dan setelah 800 hari sebesar -2,942364E-03/% void. Reaktor merupakan jenis fast breeder ditandai dengan naiknya densitas plutonium 239. Kata kunci : desain, teras, HTFR, keselamatan, umur, koefisien reaktivitas.   Design of pebble bed type High Temperature Fast Reactor (HTFR with uranium plutonium nitride fuel and Pb-Bi cooled has been done. The parameters being analyzed were core criticality, fuel temperature coefficient, void coefficient and reactor breeding ability. Calculation was done by using SRAC2K3 computer code. This research is expected to obtaine the design with long life core and inherent safety features. This research obtained core design with a diameter of 520 cm and 480 cm core high. Shaped pebble fuel bed with the 63 % UN-37 % PUN on core zone and 95.5 % UN-4.5 % Pu on blanket zone and keff value is 1.078223 with approximately 800 day of core life. The fuel temperature coefficient is -2.190014E-05 at BOL and is 1.390773E-05 at EOL and

  19. STUDI DESAIN DOWN SCALE TERAS REAKTOR DAN BAHAN BAKAR PLTN JENIS PEBBLE BED MODULAR REACTOR – HTR 100 MWe

    Directory of Open Access Journals (Sweden)

    Slamet Parmanto

    2015-04-01

    Full Text Available Telah dilakukan penelitian terhadap teras reaktor Pebble Bed Modular Reactor (PBMR dengan daya 100 Mwe berbahan bakar UO2. Reaktor ini menggunakan moderator grafit dan helium sebagai pendingin. Studi down scale dilakukan tanpa mengubah geometri teras maupun geometri bahan bakar. Parameter yang dianalisis adalah kritikalitas teras, reaktivitas lebih, koefisien reaktivitas temperatur bahan bakar, moderator dan pendingin serta nilai ekonomis bahan bakar. Dari penelitian ini diharapkan diperoleh desain bahan bakar yang bernilai ekonomis dan memiliki fitur keselamatan melekat. Penelitian dilakukan dengan menggunakan program SRAC 2003. Hasil yang diperoleh adalah desain bahan bakar UO2 berbentuk pebble dengan pengkayaan 10% U235 dan 90 ppm racun dapat bakar Gd2O3. Nilai faktor multipilkasi effektif keff pada beginning of life (BOL adalah 1,01115 dan menjadi 1,00588 setelah 2658 hari operasi reaktor (EOL. Koefisien reaktivitas temperatur total diperoleh sebesar - 3,25900E-05 ∆k/k/K saat BOL dan -1,10615E-04 ∆k/k/K saat end of life (EOL. Reaktor ini memenuhi karakteristik keselamatan melekat ditandai dengan nilai koefisien reaktivitas temperatur yang negatif. Kata kunci: PBMR, desain bahan bakar, faktor multipilkasi effektif, reaktivitas lebih, koefisien reaktivitas temperatur.   Research of Pebble Bed Modular Reactor (PBMR 100 MWe which used UO2 fuel has been done. This reactor uses graphite as moderator and helium as coolant. Down scale studies performed without changing the core and fuel geometry. The parameter being analyzed were core criticality, excess reactivity, fuel, moderator, coolant temperature reactivity coefficient, and fuel economy. This research is expected to obtain the design that has fuel economy and inherent safety features. In this research, we have employed SRAC 2003 code. The calculation show that the UO2 pebble fuel design with 10% enrichment of U235 and 90 ppm burnable poison of Gd2O3 results in the effective multiplication

  20. PENINGKATAN KINERJA SISTEM KESELAMATAN PASIF PADA REAKTOR NUKLIR DENGAN PENAMBAHAN KOMPONEN RVACS

    Directory of Open Access Journals (Sweden)

    A. G. Abdullah

    2014-07-01

    Full Text Available Kelengkapan sistem keselamatan pasif dan inheren pada reaktor lanjut merupakan prasyarat utama. Makalah ini mengeksplorasi hasil desain konseptual sistem pembuang sisa panas pada pusat listrik tenaga nuklir berjenis Very High-Temperature Reactor. Tujuan riset ini untuk merancang sistem pembuang sisa panas pusat listrik tenaga nuklir yang terdapat pada dinding reaktor. Studi kinerja Reactor Vessel Auxliary Cooling System (RVACS dilakukan pada dua jenis pendingin yaitu Timbal-Bismut dan Liquid Salt. Panas dari dinding reaktor dihapus melalui sirkulasi alamiah pada keadaan tunak. Analisis melibatkan sistem perpindahan panas secara radiasi, konduksi dan konveksi alami. Perhitungan perpindahan panas dilakukan pada elemen reaktor vessel, dinding luar guard vessel, dan pelat pemisah. Hasil analisis kecelakaan menunjukkan kedua jenis sistem pendingin reaktor dan sistem pasif sisa pembuangan panas cukup menghapus sisa panas hasil peluruhan dengan sirkulasi alami.ABSTRACTCompleteness of passive safety systems and inherent in advanced reactors is a major prerequisite. This paper explores the results of a conceptual design of the heat removal system at the nuclear power plant (NPP type Very High-Temperature Reactor. The purpose of this research was to design the reactor vessel auxiliary cooling system (RVACS of NPP located within the reactor walls. The RVACS performance study was conducted on two types of coolant: Lead-Bismuth and Liquid Salt. Heat was removed from the reactor vessel through the natural circulation in the steady state. Analyses of heat transfer systems involved radiation, conduction and natural convection. Heat transfer calculations were performed on the reactor vessel, guard vessel, and perforated plate. The results from the accident analysis showed that both types, the reactor coolant system and the passive residual heat removal system, adequately remove remaining heat of the decay by a natural circulation.

  1. VERIFIKASI PAKET PROGRAM MVP-II DAN SRAC2006 PADA KASUS TERAS REAKTOR VERA BENCHMARK.

    Directory of Open Access Journals (Sweden)

    Jati Susilo

    2015-03-01

    Full Text Available Dalam penelitian ini dilakukan verifikasi perhitungan benchmark VERA pada kasus Zero Power Physical Test (ZPPT teras reaktor Watts Bar 1. Reaktor tersebut merupakan jenis PWR kelas 1000 MWe yang didesain oleh Westinghouse, tersusun dari 193 perangkat bahan bakar 17×17 dengan 3 jenis pengkayaan UO2 yaitu 2,1wt%, 2,619wt% dan 3,1wt%. Perhitungan nilai k-eff dan distribusi faktor daya dilakukan pada siklus operasi pertama teras dengan kondisi beginning of cycle (BOC dan hot zero power (HZP. Posisi batang kendali dibedakan menjadi uncontrolled (semua batang kendali berada di luar teras, dan controlled (batang kendali Bank D didalam teras. Paket program komputer yang digunakan dalam perhitungan adalah MVP-II dan SRAC2006 modul CITATION dengan data pustaka tampang lintang ENDF/B-VII.0. Hasil perhitungan menunjukkan bahwa perbedaan nilai k-eff teras pada kondisi controlled dan uncontrolled antara referensi dengan MVP-II (-0,07% dan -0,014% dan SRAC2006 (0,92% dan 0,99% sangat kecil atau masih dibawah 1%. Perbedaan faktor daya maksimum teras pada kondisi controlled dan uncontrolled dengan referensi dengan MVP-II adalah 0,38% dan 1,53%, sedangkan dengan SRAC2006 adalah 1,13% dan -2,45%. Dapat dikatakan bahwa kedua paket program komputer menunjukkan hasil perhitungan yang sesuai dengan nilai referensi. Dalam hal penentuan kekritisan teras, maka hasil perhitungan MVP-II lebih konservatif dibandingkan dengan SRAC2006. Kata kunci : MVP-II, SRAC2006, PWR, VERA   In this research, verification calculation for VERA core physics benchmark on the Zero Power Physical Test (ZPPT of the nuclear reactor Watts Bar 1. The reactor is a 1000 MWe class of PWR designed by Westinghouse, arranged from 193 unit of 17×17 fuel assembly consisting 3 type enrichment of UO2 that are 2.1wt%, 2.619wt% and 3.1wt%. Core power factor distribution and k-eff calculation has been done for the first cycle operation of the core at beginning of cycle (BOC and hot zero power (HZP. In this

  2. ANALISIS MODEL TERAS 3-DIMENSI UNTUK EVALUASI PARAMETER KRITIKALITAS REAKTOR PWR MAJU KELAS 1000 MW

    Directory of Open Access Journals (Sweden)

    Tagor Malem Sembiring

    2015-04-01

    Full Text Available Setelah kejadian Fukushima, penggunaan sistem keselamatan pasif menjadi persyaratan yang penting untuk PLTN. PLTN jenis PWR maju kelas 1000 yang didesain oleh Westinghouse, AP1000, memiliki fitur keselamatan pasif disamping sederhana dan modular. Sebelum memilih suatu PLTN, maka perlu dilakukan suatu evaluasi terhadap parameter desainnya. Salah satu parameter yang penting dalam keselamatan adalah kritikalitas teras. Permasalahan pokok dalam mengevaluasi parameter kritikalitas teras AP1000 tidak adanya data komposisi material SS304 dan H2O di daerah reflektor dan diameter penyerap SS304. Dengan demikian tujuan penelitian ini adalah mendapatkan model teras 3-dimensi AP1000 dan siap diaplikasikan dalam evaluasi parameter kritikalitas teras. Hasil perhitungan menunjukkan bahwa komposisi terbaik SS304 dan H2O di reflektor teras bagian atas dan bawah masing-masing 50 vol%, sedangkan diameter penyerap SS304 adalah 0,960 cm. Evaluasi konsentrasi boron kritis menunjukkan perbedaan yang signifikan dengan nilai desain. Meskipun penyebab utama dari perbedaan ini belum diketahui, akan tetapi dapat dibuktikan bahwa konsentrasi boron kritis sangat sensitif dengan densitas UO2. Untuk reaktivitas padam, reaktor AP1000 memiliki margin subkritikalitas teras yang besar untuk satu siklus operasi. Dengan demikian teras yang diusulkan dapat digunakan sebagai acuan untuk evaluasi parameter teras lainnya atau perangkat analitis lainnya dalam rangka mengevaluasi desain reaktor AP1000. Kata kunci: AP1000, kritikalitas, konsentrasi boron kritis, reaktivitas padam   After the Fukushima accident, the use of passive safety system becomes an important requirement for the nuclear power plant (NPP. The advanced PWR NPP with 1000 MW (electric class, designed by Westinghouse, AP1000, a reactor with the passive safety features as well as simple and modular. Before selecting a nuclear power plant, there should be an evaluation of the design parameter. One important parameter in

  3. Penentuan Konversi CO Yang Menjadi Metanol Pada Metanol Reaktor Di PT. Kaltim Metanol Industri

    OpenAIRE

    Marduansyah, Muhammad

    2015-01-01

    Telah dilakukan penelitian tentang penentuan konversi CO yang menjadi metanol pada reaktor metanol, di PT. Kaltim Metanol Industri dimana dalam penelitian ini digunakan data laju alir dan komposisi gas yang didapat dari control room. Dari perhitungan yang dilakukan maka didapat hasil konversi CO pada tanggal 25 februari 2013 yaitu 74,93%. Selain itu juga didapat hasil data perhitungan yang sebelumnya telah dilakukan yaitu 61,21% pada 12 november 2012; 68,53% pada 13 april 2012; 66,89% pada 14...

  4. STUDI KARAKTERISTIK PEMBENTUKAN UAP DALAM PEMBANGKIT UAP HELIKAL PADA REAKTOR MODULAR DAYA KECIL

    Directory of Open Access Journals (Sweden)

    Susyadi Susyadi

    2015-06-01

    Full Text Available Reaktor modular daya kecil (SMR sangat cocok untuk  dibangun Indonesia, terutama pada lokasi-lokasi dengan kapasitas jaringan listrik yang rendah sehingga investigasi lebih jauh tentang reaktor ini sangat diperlukan. Umumnya SMR memiliki bentuk pembangkit uap yang kompak dan terintegrasi di dalam bejana tekan. Disain tersebut menyebabkan perbedaan pendekatan dalam memproduksi uap dibandingkan reaktor nuklir konvensional yang menggunakan pembangkit uap tabung-u terbalik. Oleh karena itu tujuan dari penelitian ini adalah untuk mengetahui karakteristik uap dan pola pembentukkannya di dalam pembangkit uap tipe helikal yang banyak digunakan oleh SMR. Metoda yang dipakai adalah dengan melakukan pemodelan dan perhitungan numerik menggunakan program RELAP5. Dalam pemodelan, aliran air umpan  bertekanan dan temperatur rendah dimasukkan ke dalam tabung helikal sementara aliran fluida bertekanan dan temperatur tinggi, yang mewakili pendingin sistem primer reaktor, berada di sisi luar tabung. Hasil perhitungan menunjukkan bahwa uap yang dihasilkan oleh pembangkit uap helikal bersifat lewat jenuh yakni sekitar 25 K di atas titik jenuhnya. Hal ini memberikan keunggulan komparatif dari segi disain dan operasional pada SMR dibanding reaktor konvensional karena uap lewat jenuh yang dihasilkan dapat mengurangi kerugian turbin dan sekaligus meningkatkan efisiensi termodinamika. Kata kunci: pembangkit uap helikal, SMR, PWR, uap lewat jenuh, RELAP5   Small modular reactor (SMR is very suitable to be deployed in Indonesia especially for locations having low electrical grid capacity, so  further investigation on the characteritic of this reactor is needed. In general SMR has a compact and integrated-to-vessel steam generator design. This design implies different approach in producing steam as compared to conventional nuclear power plant  having inverted u-tube steam generator. For that reason, this research is intended to investigate the steam characteristic and

  5. ANALISIS LAJU DOSIS NEUTRON REAKTOR PLTN PWR 1000 MWe MENGGUNAKAN PROGRAM MCNP

    Directory of Open Access Journals (Sweden)

    Amir Hamzah

    2015-03-01

    Full Text Available Dalam rangka menyongsong PLTN pertama di Indonesia, dilakukan kajian dan analisis berbagai aspek teknologi reaktor tersebut. Tujuan dari penelitian ini adalah menentukan laju dosis neutron di luar perisai biologik reaktor PLTN PWR 1000 MWe yang merupakan bagian dari kegiatan besar di atas. Data hasil analisis laju dosis radiasi pada posisi tertentu sangat dibutuhkan untuk menunjukkan tingkat paparan radiasi di posisi tersebut. Analisis laju dosis neutron ditentukan berdasarkan hasil analisis fluks dan spektrum neutron. Analisis fluks dan spektrum neutron di teras reaktor daya PWR 1000 Mwe dilakukan menggunakan program MCNP. Model perhitungan yang dilakukan meliputi 9 zona material yaitu, teras, air, selimut, air, tong, air, bejana tekan, beton dan lapisan udara luar. Penentuan distribusi fluks dan spektrum neutron dilakukan ke arah radial hingga di luar perisai beton dengan akurasi antara 10% hingga 30% dalam tiap kelompok energi yang jumlahnya 1 dan 50 kelompok. Hasil analisis laju dosis neutron di permukaan perisai biologik reaktor PLTN PWR 1000 MWe pada kondisi reaktor beroperasi daya penuh sudah di bawah nilai batas keselamatan. Maka dapat disimpulkan bahwa dari segi paparan radiasi neutron, penggunaan perisai radiasi beton setebal dua meter sudah memenuhi persyaratan keselamatan. Kata kunci: PLTN PWR, fluks neutron, perisai, laju dosis neutron, MCNP.   In order to meet the first nuclear power plant in Indonesia, it has been conducted a study and analysis of various aspects of reactor technology. The purpose of this study was to determine the neutron dose rates at the outside of biological shield of NPP PWR 1000 MWe reactor that is a part of the activities described above. The analysis data of radiation dose rate at a specific position is needed to show the level of radiation exposure in those positions. Analysis neutron dose rate is determined based on the results of the analysis of neutron flux. Analysis of flux and neutron spectrum in

  6. PERHITUNGAN SUHU ELEMEN BAKAR REAKTOR TRIGA 2000 DALAM TABUNG SIPPING TEST MENGGUNAKAN CFD

    Directory of Open Access Journals (Sweden)

    K.A. Sudjatmi

    2015-03-01

    Full Text Available Telah dihitung suhu elemen bakar pada perangkat sipping test reaktor TRIGA 2000 Bandung. Perhitungan perlu dilakukan untuk memastikan bahwa suhu elemen bakar masih dibawah atau pada batas suhu elemen bakar yang diizinkan pada saat reaktor beroperasi, sehingga dapat dipastikan bahwa pada pelaksanaan pengujian dengan menggunakan perangkat ini, suhu masih dalam batas keselamatan. Perhitungan dilakukan dengan membuat model tabung sipping test berisi elemen bakar yang dikelilingi oleh 9 buah elemen bakar, sesuai dengan posisi tabung sipping test di teras reaktor, dengan menggunakan GAMBIT. Dimensi model disesuaikan dengan dimensi tabung dan elemen bakar dalam teras reaktor TRIGA 2000 Bandung. Pengoperasian sipping test untuk tiap elemen bakar dilakukan selama 30 menit pada daya 300 kW. Perhitungan dilakukan dengan menggunakan perangkat lunak Computational Fluid Dynamics (CFD dan sebagai inputan disesuaikan dengan parameter reaktor TRIGA 2000. Simulasi dilakukan pada pengoperasian dari 30, 60, 90, 120 150, 180 sampai 210 menit. Hasil perhitungan menunjukan bahwa suhu pusat bahan bakar dalam tabung sipping test sebesar 236,06 oC, sedangkan suhu dinding elemen bakar adalah sebesar 87,58 oC. Suhu maksimum pusat bahan bakar reaktor TRIGA 2000 pada operasi normal adalah 650 oC, dan tidak diizinkan terjadinya pendidihan di dalam teras reaktor. Jadi dapat disimpulkan bahwa pengoperasian perangkat sipping test masih sangat aman karena suhu bahan bakar berada dibawah batasan suhu bahan bakar yang diizinkan pada kondisi operasi normal demikian juga suhu dinding elemen bakar masih dibawah suhu didih air. Kata kunci: sipping test, TRIGA, elemen bakar, CFD   It has been calculated the fuel element temperature in the sipping test of Bandung TRIGA 2000 reactor. The calculation needs to be done to ascertain that the fuel element temperatures are below or at the limit of the allowable temperature fuel elements during reactor operation, ensuring that the

  7. ANALISIS PENGARUH IRADIASI FLUENS NEUTRON CEPAT TERHADAP BERILIUM REFLEKTOR REAKTOR RSG-GAS

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2015-04-01

    Full Text Available Telah dilakukan analisis iradiasi fluens neutron cepat terhadap berilium reflektor reaktor RSG-GAS. Analisis dilakukan dengan cara melakukan pengukuran fluks neutron di posisi berilium elemen dan berilium blok yang berfungsi sebagai reflector. Selanjutnya dilakukan perhitungan untuk menentukan apakah ada pengaruh fluens neutron selama berilium berada di teras reaktor. Selain cara tersebut dilakukan pula visualisasi untuk memastikan ada tidaknya deformasi pada berilium akibat iradiasi. Hasil pengukuran fluks dan fluens neutron cepat maksimal pada daya 200 kW untuk berilium elemen posisi E-2 sebesar 2,30E+07 n/cm2s dan 4,19E+17 n/cm2, J-8 sebesar 3,70E+07 n/cm2s dan 6,74E+17 n/cm2. Hasil pengukutan pada posisi B-3 sebesar 2,19E+12 n/cm2s dan 3,99E+22 n/cm2, G-10 sebesar 2,12E+12 n/cm2s dan 3,86E+22 n/cm2, serta berilium blok posisi (5-6 sebesar 5,02E+07 n/cm2s dan 9,15E+17 n/cm2, (C-D sebesar 2,32E+07 n/cm2s dan 4,23E+17 n/cm2. Deformasi yang diperoleh untuk berilium elemen (∆L/L posisi E-2 sebesar 1,12E-08, J-8 sebesar 1,84E-08, B-3 sebesar 1,60E-03, posisi G-10 sebesar 1,55E-03, sedangkan pada berilium blok di posisi 5-6 sebesar 2,52E-08 dan C-D sebesar 1,13E-08. Dari hasil ini disimpulkan tidak terjadi deformasi pada berilium elemen dan berilium blok. Hasil ini dibuktikan pula dari pengamatan visual, dimana tidak terlihat adanya deformasi pada berilium tersebut. Kata kunci : fluks, fluens, berilium elemen, berilium blok   Analysis of influence fast neutron fluence irradiated to the RSG-GAS beryllium reflector have been done. Methods of analysis was carried out by measuring fluxs neutron in beryllium element and block positio that function as reflector. The calculation done for determination it is there any influence of neutron as long as beryllium in the core. Bisede that, visualization done to make sure it there is any deformation at beryllium as efect of irradiation. Fluxs and fluences of beryllium element measurement result in 200 k

  8. PERFORMA OKSIDASI METAN PADA REAKTOR KONTINYU DENGAN PENINGKATAN KETEBALAN LAPISAN BIOCOVER LANDFILL

    Directory of Open Access Journals (Sweden)

    Opy Kurniasari

    2013-11-01

    methane through the form of methanol metabolite. ABSTRAKPenanganan sampah kota di Indonesia pada umumnya dilakukan pada tempat pemrosesan akhir sampah (TPA, yang sebagian besar dilakukan dengan cara pengurugan (landfilling yang cenderung bersifat anaerob (tidak ada oksigen. Cara pengurugan ini biasanya dioperasikan lapis perlapis sehingga memungkinkan terjadinya proses anaerob. Pada kondisi ini dipastikan biogas, yaitu gas metana (CH4 dan CO2, akan muncul. Metana adalah gas rumah kaca dengan potensi pemanasan global lebih besar dari CO2, dan dapat mengabsorpsi radiasi infra merah 23 kali lebih efisien dari CO2 pada periode lebih dari 100 tahun. Salah satu cara yang dapat dilakukan untuk mengurangi gas metana dari landfill yang lepas ke alam adalah dengan mengoksidasinya dengan memanfaatkan material penutup landfill (biocover sebagai media mikroorganisma pengoksidasi metana. Aplikasi kompos sebagai material penutup landfill merupakan pendekatan dengan biaya rendah untuk mereduksi emisi gas dari landfill sehingga cocok untuk negara berkembang. Biocover yang digunakan pada penelitian ini adalah kompos landfill mining, yaitu kompos yang terdegradasi secara alami di landfill. Tujuan penelitian ini adalah mengevaluasi kemampuan biocover kompos landfill mining dalam mengoksidasi metana pada ketebalan lapisan tertentu dengan kondisi aliran kontinyu. Tiga buah reaktor kolom yang digunakan terbuat dari flexy glass berukuran tinggi 70 cm dan diameter 15 cm. Gas metana dialirkan dari bawah reaktor secara kontinyu dengan laju alir 5 ml/menit. Kolom diisi dengan biocover kompos landfill mining dengan ketebalan lapisan 5, 25, 35 dan 60 cm. Hasil percobaan menunjukkan bahwa semakin tebal lapisan biocover, semakin tinggi efisiensi oksidasi metana. Efisiensi oksidasi yang diperoleh pada setiap ketebalan lapisan 15, 25, 35 dan 60 cm adalah masing-masing 56,43%, 63,69%, 74,58% dan 80,03%, dengan laju oksidasi 0,287 mol m-2 d-1 dan fraksi oksidasi 97%. Hasil oksidasi yang diperoleh tersebut

  9. ANALISIS DAN PENGUKURAN PARAMETER REAKTOR KARTINI UNTUK PENERAPAN METODE K0-NAA

    Directory of Open Access Journals (Sweden)

    Sri Murniasih

    2015-03-01

    Full Text Available Metode k0-NAA merupakan metode analisis yang banyak digunakan dengan berbagai keunggulan. Dalam penerapan metode k0-NAA diperlukan nilai parameter reaktor (f dan α, maka tujuan penelitian ini adalah akan dilakukan pengukuran nilai parameter f dan α di fasilitas Lazy Susan reaktor Kartini. Metode yang digunakan meliputi metode Cd-ratio dan triple bare. Telah diukur nilai parameter tersebut pada tiga lubang iradiasi di fasilitas Lazy Susan. Diperoleh perbedaan hasil pengukuran nilai parameter yang signifikan pada setiap lubang iradiasi, nilai ƒ berkisar 13,713 - 22,128 dan α berkisar -0,060 – 0,068. Hasil pengukuran f dan α dengan metode Cd-ratio, memberikan nilai yang lebih stabil dibandingkan metode triple bare. Nilai f dan α yang diperoleh dapat dijadikan basis data pada penerapan metode k0-NAA untuk analisis sampel di laboratorium AAN – PSTA. Kata kunci: parameter reaktor, reaktor Kartini, k0-NAA, fluks neutron   The k0-NAA method is an analysis method that widely used by many of the advantages. In the application of k0-NAA method needed valuea of reactor parameters (f and α, then the purpose of the research would be conducted meaasurement parameter values f and α in the Lazy Susan Kartini reactor facilities. The methods used include Cd-ratio and triple bare methods. The parameter value has been measured in three channels in the irradiation facilities Lazy Susan. Differences of measurement results obtained parameter values are significant in each channel irradiation, the value of ƒ ranged from 13.713 to 22.128 and the value of α ranged from -0.060 – 0.068. The results of measurements for the f and α with the Cd-ratio method, providing more stable value than the triple bare method. The value of f and α obtained can be used a database for the application of k0-NAA method for sample analysis in the laboratory NAA – CAST. Keywords: reactor parameter, Kartini reactor, k0-NAA, neutron flux

  10. PENENTUAN KANDUNGAN UNSUR PADA INSTALASI PENGOLAHAN AIR LIMBAH (IPAL RSUP DR. SOERADJI TIRTONEGORO KLATEN DENGAN METODE ANALISIS AKTIVASI NEUTRON REAKTOR KARTINI

    Directory of Open Access Journals (Sweden)

    - Niati

    2012-01-01

    Full Text Available Limbah cair hasil aktivasi manusia misalnya di Rumah Sakit harus diolah terlebih dahulu sebelum dialirkan ke lingkungan. Pengolahan limbah cair ini dilakukan untuk mengantisipasi adanya suatu hal yang berbahaya atau tidak aman bagi lingkungan. Permasalahan yang dikaji adalah dengan mengetahui jenis unsur dan kadarnya apakah melebihi dari batas kadar baku mutu limbah dan air minum. Metode  Analisis Aktivasi Neutron (AAN untuk analisis kualitatif yaitu mengetahui jenis unsur dan analisis kuantitatif yaitu menghitung kadar dari jenis unsur tersebut. Sampel limbah cair diaktivasi menggunakan sumber neutron dari Reaktor Kartini, kemudian dicacah menggunakan Spektrometri-γ, barulah analisis kualitatif dan kuantitatif dapat dilakukan. Hasil penelitian sampel air sumur dan limbah cair RS secara kualitatif terdapat jenis unsur dengan waktu peluruhan pendek seperti : Fe, Cl, dan Al dan waktu peluruhan panjang terdapat jenis unsur Br dan Na. Secara kuantitatif untuk waktu peluruhan pendek dengan evaporasi kadar Cl antara (0,0849-3,01E-06 ppm, kadar Al antara (2,3197-3,9841E-07 ppm; tanpa evaporasi kadar Cl antara (0,65785-2,3197E-07 ppm, kadar Al antara (2,5113-2,7761E-09 ppm. Untuk waktu peluruhan panjang dengan evaporasi kadar Br antara (0,069846-1,9147E-04 ppm, kadar Na antara (0,8058-3,2544E-05 ppm; tanpa evaporasi kadar Br 5,031E-06 ppm, kadar Na antara (6,7857-8,3285E-07 ppm. Dari hasil penelitian tersebut dapat disimpulkan bahwa waktu peluruhan dan perbedaan perlakuan sampel mengakibatkan jenis unsur dan kadar unsur yang dihasilkan juga berbeda-beda. Berdasarkan penghitungan kadar jenis unsur dan setelah dibandingkan dengan kadar baku mutu limbah dan mutu air maka limbah cair RSUP Dr. Soeradji Tirtonegoro Klaten dalam batas aman apabila dibuang ke lingkungan dan air sumur tersebut juga aman untuk dikonsumsi. Kata kunci : Instalasi Pengolahan Air Limbah (IPAL, AAN, Reaktor Kartini

  11. Disain Sistem Pemantauan Lingkungan Untuk Evaluasi Lepasan Radionuklida dari Subsistem pada Kecelakaan Reaktor Daya PWR

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2013-03-01

    Full Text Available PLTN. (Pembangkit Listrik Tenaga Nuklir sebagai sumber energi baru dipilih sebagai alternatif, karena memiliki berbagai kelebihan yaitu ramah lingkungan, pasokan bahan bakar yang tidak bergantung musim, serta harganya yang dapat bersaing dengan pembangkit listrik yang lain. Namun demikian, adanya keraguan sebagian masyarakat tentang keselamatan radiasi PLTN, maka pemerintah harus bisa meyakinkan tentang operasi PLTN yang aman dan selamat. Penelitian tentang disain sistem pemantauan lingkungan untuk evaluasi lepasan radionuklida dari subsistem reaktor dan lingkungan akibat terjadinya kecelakaan pada reaktor daya telah dilakukan. Penelitian dilakukan dengan melakukan perhitungan sebaran radionuklida ke subsistem dan lingkungan serta membuat sistim monitoring radiasi di lingkungan. Sistem monitoring lingkungan terdiri dari system pencacah radiasi, sistem peringatan dini, sistem pengukuran meteorologi, sistem GPS dan system GIS. Sistem pencacah radiasi digunakan untuk mencatat data radiasi, sistem pengukuran meteorologi digunakan untuk mencatat data arah dan kecepatan angin, sedangkan sistem GPS digunakan untuk menentukan data posisi pengukuran. Data tersebut kemudian dikirimkan ke system akuisisi data untuk ditransmisikan ke pusat kendali. Pengumpulan dan pengiriman data dilakukan melalui SMS menggunakan perangkat modem yang ditempatkan di ruang kendali. Ruang kendali menerima data dari berbagai tempat pengukuran. Dalam hal ini ruang kendali memiliki fungsi sebagai SMS gateway. Sistem ini dapat memvisualisasi untuk lokasi pengukuran yang berbeda. Selanjutnya, data posisi dan data radiasi diintegrasikan dengan peta digital. Integrasi sistem tersebut kemudian divisualisasikan dalam personal komputer. Untuk posisi pengukuran terlihat langsung di peta dan untuk data radiasi ditampilkan di monitor dengan tanda lingkaran merah atau hijau yang digunakan sebagai pemonitor batas aman radiasi. Bila tanda lingkaran berwarna merah maka akan menyalakan alarm di

  12. PENGGUNAAN TEKNOLOGI REAKTOR MICROBIAL FUEL CELLS (MFCs DALAM PENGOLAHAN LIMBAH CAIR INDUSTRI TAHU UNTUK MENGHASILKAN ENERGI LISTRIK

    Directory of Open Access Journals (Sweden)

    Purwono

    2015-09-01

    Full Text Available Microbial Fuel Cells (MFCs adalah bioreaktor yang mengubah energi kimia dari senyawa organik menjadi energi listrik melalui reaksi katalitik mikroorganisme dalam kondisi anaerob. Tujuan dari penelitian ini adalah mengetahui pengaruh variasi media terlekat (attached growth media dan variasi konsentrasi COD awal terhadap efisiensi penyisihan konsentrasi COD dan energi listrik yang dihasilkan. Reaktor MFCs didesain dalam betuk dual-chamber yang dihubungkan menggunakan jembatan garam. Kerikil dan bioball digunakan sebagi variasi media lekat pada kompartemen anoda dan konsentrasi limbah awal divariasikan dari 0%, 25%, 50%, dan 100% dari konsentrasi COD limbah cair industri tahu asli dengan cara melakukan pengenceran.Hasil penelitian menunjukkan bahwa media lekat kerikil dengan konsentrasi 50% menghasilkan arus listrik rata-rata tertinggi 7,25 µA dan energi listrik sebesar 179,54 mWh. Voltase dan enegi listrik pada kedua variasi tersebut semakin hari semakin enurun. Variasi konsentrasi 25%, 50%, dan 100% menghasilkan enurunan nilai effisiensi penyisihan COD masing-masing 41,41%; 39,90% dan 18,26%.Pada variasi 100% menghasilkan energi listrik lebih rendah dari pada 50%. Kemungkinan hal ini karena adanya senyawa sulfida yang berperan sebagai akseptor elektron. Pembentukan senyawa sulfida ditandai dengan terbentuknya warna hitam pada substrat. Efisiensi coulombic (εC akibat perbedaan media lekat dan variasi konsentrasi berada pada kisaran 0,001-0,035%. Rendahnya εC kemungkinan karena adanya produkproduk fermentasi dan biofilm pada elektroda anoda yang menghambat transfer elektron menuju elektroda anoda seperti biomassa, bahan organik terlarut, gas H2 dan gas CH4.

  13. PENGARUH GEMPA PATAHAN LEMBANG TERHADAP FLEKSIBILITAS PIPA DAN KEGAGALAN NOZEL PERALATAN SISTEM PENDINGIN PRIMER REAKTOR TRIGA 2000 BANDUNG

    Directory of Open Access Journals (Sweden)

    H.P. Raharjo

    2012-02-01

    Full Text Available Gempa bumi di suatu instalasi nuklir dapat menyebabkan terjadinya kerusakan sistem peralatan karena adanya perubahan fleksibilitas pipa akibat beban berlebih pada sistem perpipaannya. Beban dari sistem perpipaan dapat membebani nozel peralatan seperti pompa, penukar panas, dll. Apabila beban tersebut terlalu besar dan melebihi beban yang diizinkan akan mengakibatkan kegagalan nozel peralatan. Penelitian ini menganalisis besarnya beban-beban yang terjadi di semua nozel  sistem pendingin primer Reaktor TRIGA 2000 Bandung. Analisis dilakukan dengan bantuan perangkat lunak Caesar II yang berbasis metode elemen hingga (finite element method. Acuan analisis yang digunakan adalah code ASME B31.1 yang mengatur tentang perancangan sistem perpipaan untuk sistem pembangkit daya (Power Piping. Hasil analisis menunjukkan bahwa gaya yang terjadi pada nozel masukan pompa arah aksial (FZ melebihi batas yang diijinkan. Oleh karena itu perlu dilakukan modifikasi terhadap jalur perpipaan sistem pendingin tersebut agar nozel tidak menerima gaya yang berlebih. Penyangga pipa titik(node 22 di jalur PriOut dilepas dan/atau dipindahkan pada nozel masukkan pompa. Perpipaan sistem pendingin primer reaktor TRIGA 2000 Bandung akan aman beroperasi jika terjadi gempa.yang berasal dari patahan Lembang Kata kunci : gempa bumi, patahan, perpipaan, reaktor, sistem pendingin

  14. PEMODELAN KOLIMATOR DI RADIAL BEAM PORT REAKTOR KARTINI UNTUK BORON NEUTRON CAPTURE THERAPY

    Directory of Open Access Journals (Sweden)

    Bemby Yulio Vallenry

    2015-03-01

    Full Text Available Salah satu metode terapi kanker adalah Boron Neutron Capture Therapy (BNCT. BNCT memanfaatkan tangkapan neutron oleh 10B yang terendapkan pada sel kanker. Keunggulan BNCT dibandingkan dengan terapi radiasi lainnya adalah tingkat selektivitas yang tinggi karena tingkatannya adalah sel. Pada penelitian ini dilakukan pemodelan kolimator di radial beamport reaktor Kartini sebagai dasar pemilihan material dan manufature kolimator sebagai sumber neutron untuk BNCT. Pemodelan ini dilakukan dengan simulasi menggunakan perangkat lunak Monte Carlo N-Particle versi 5 (MCNP 5. MCNP 5 adalah suatu paket program untuk memodelkan sekaligus menghitung masalah transpor partikel dengan mengikuti sejarah hidup neutron semenjak lahir, bertranspor pada bahan hingga akhirnya hilang karena mengalami reaksi penyerapan atau keluar dari sistem. Pemodelan ini menggunakan variasi material dan ukurannya agar menghasilkan nilai dari tiap parameter-parameter yang sesuai dengan rekomendasi I International Atomic Energy Agency (IAEA untuk BNCT, yaitu fluks neutron epitermal (Фepi > 9 n.cm-2.s-1, rasio antara laju dosis neutron cepat dan fluks neutron epitermal (Ḋf/Фepi 0,7. Berdasarkan hasil optimasi dari pemodelan ini, material dan ukuran penyusun kolimator yang didapatkan yaitu 0,75 cm Ni sebagai dinding kolimator, 22 cm Al sebagai moderator dan 4,5 cm Bi sebagai perisai gamma. Keluaran berkas radiasi yang dihasilkan dari pemodelan kolimator radial beamport yaitu Фepi = 5,25 x 106 n.cm-2s-1, Ḋf/Фepi =1,17 x 10-13 Gy.cm2.n-1, Ḋγ/Фepi = 1,70 x 10-12 Gy.cm2.n-1, Фth/Фepi = 1,51 dan J/Фepi = 0,731. Berdasarkan penelitian ini, hasil optimasi 5 parameter sebagai persyaratan kolimator untuk BNCT yang keluar dari radial beam port tidak sepenuhnya memenuhi kriteria yang direkomendasikan oleh IAEA sehingga perlu dilakukan penelitian lebih lanjut agar tercapainya persyaratan IAEA. Kata kunci: BNCT, radial beamport, MCNP 5, kolimator   One of the cancer therapy methods is

  15. ANALISIS DISTRIBUSI KECEPATAN PENDINGIN DALAM ELEMEN BAKAR TIPE PELAT MENGGUNAKAN METODE CFD UNTUK REAKTOR RISET RSG-GAS

    Directory of Open Access Journals (Sweden)

    Muhammad Subekti

    2015-03-01

    Full Text Available Eksperimen pengukuran distribusi kecepatan pendingin dalam subkanal elemen bakar reaktor riset RSG-GAS sulit dilakukan karena lebar celah yang sangat kecil dan terletak di dalam elemen bakar. Oleh karena itu diperlukan perhitungan untuk memprediksi distribusi kecepatan pendingin dalam subkanal untuk mengkonfirmasi bahwa keberadaan handle tidak merusak distribusi kecepatan pendingin masuk ke dalam setiap subkanal. Perhitungan ini memerlukan metode CFD yang memperhatikan interior 3 dimensi. Perhitungan distribusi kecepatan pendingin dalam subkanal juga belum pernah dilakukan. Tujuan penelitian ini adalah melakukan investigasi distribusi kecepatan pendingin elemen bakar tipe pelat menggunakan metode CFD 3 dimensi untuk reaktor riset RSG-GAS. Penelitian ini juga sangat diperlukan sebagai bagian dari pengembangan desain termohidrolika elemen bakar untuk reaktor riset inovatif. Pemodelan menggunakan ½ model dalam perangkat lunak Gambit dan perhitungan menggunakan persamaan Turbulen dalam perangkat lunak FLUENT 6.3. Hasil perhitungan kecepatan pendingin tiga dimensi dalam subkanal menggunakan metode CFD lebih rendah sekitar 4,06% dari pada hasil perhitungan satu dimensi karena perhitungan satu dimensi mengabaikan keberadaan handle. Kata kunci: Aliran pendingin, elemen bakar, reaktor riset, kondisi tunak, CFD   The measurement experiment for coolant-velocity distribution in the subchannel of fuel element of RSG-GAS research reactor is difficult to be carried out due to too narrow channel and subchannel placed inside the fuel element. Hence, the calculation is required to predict the coolant-velocity distribution inside subchannel to confirm that the handle presence does not ruin the velocity distribution into every subchannel. This calculation utilizes CFD method, which respect to 3-dimension interior. Moreover, the calculation of coolant-velocity distribution inside subchannel was not ever carried out. The research object is to investigate the

  16. APLIKASI TEKNIK AAN DI REAKTOR RSG-GAS PADA PENENTUAN UNSUR ESENSIAL DAN TOKSIK DI DALAM IKAN DAN PAKAN IKAN

    Directory of Open Access Journals (Sweden)

    Saeful Yusuf

    2015-03-01

    Full Text Available Pada makalah ini diuraikan tentang aplikasi teknik AAN (Analisis Aktivasi Neutron dalam penentuan konsentrasi unsur-unsur esensial dan cemaran yang terkandung di dalam beberapa spesies ikan dan pakan ikan. Unsur-unsur esensial yang terkandung dalam pakan ikan buatan juga dianalisis untuk mengetahui pengaruhnya terhadap ikan. Penentuan unsur menggunakan teknik AAN dengan metode perbandingan dan metode k0-AAN. Sampel diiradiasi di reaktor RSG-GAS yang memiliki fluks neutron thermal 5 x 1013 n.cm-2.s-1 pada daya 15 MW. Hasil penelitian menunjukkan bahwa 12 unsur di dalam 11 spesies ikan air laut dan air tawar telah ditentukan yaitu As, Br, Cr, Co, Cs, Fe, Hg, K, Na, Rb, Se and Zn. Konsentrasi cemaran As didalam ikan laut sudah melampaui batas maksimum 1 mg/kg, sedangkan konsentrasi cemaran Hg masih dibawah batas maksimum 0,5 mg/kg, baik untuk ikan laut maupun ikan air tawar. Unsur K dan Na merupakan unsur makroesensial sedangkan unsur Cr, Co, Fe, Se and Zn adalah termasuk unsur mikroesensial. Secara umum ditunjukkan bahwa kandungan mineral didalam ikan laut lebih tinggi konsentrasinya dibandingkan ikan air tawar. Br, Cs dan Rb merupakan unsur-unsur non esensial yang teridentifikasi dalam semua ikan yang dianalisis. Penelitian terhadap pakan ikan air tawar menunjukkan bahwa semua unsur yang teridentifikasi juga terdapat di dalam ikan laut dan ikan air tawar. Hal ini menunjukkan bahwa pakan ikan berkontribusi terhadap konsentrasi unsur di dalam ikan air tawar. Kata kunci : Analisis aktivasi neutron, unsur esensial, unsur cemaran, ikan, pakan ikan   This paper reported on the application of NAA (Neutron Activation Analysis Technique in the determination of the concentration of the essential and toxic elements in some species of fish and fish feed. Determination of elements using instrumental NAA technique with comparison and k0-INAA methods. Samples were irradiated in the RSG-GAS which has a thermal neutron flux  5.0E +13 ncm-2s-1. The results

  17. Reactor for biological elimination of poorly degradable hydrocarbons by adjustment of substrate-specific retention times; Reaktor zur biologischen Eliminierung schwer abbaubarer Kohlenwasserstoffe durch Einstellung substratspezifischer Verweilzeiten

    Energy Technology Data Exchange (ETDEWEB)

    Brambach, R.

    1997-11-01

    Industrial waste water cleaning increasingly makes use of biological processes based on immobilized biomass, in order to ensure the aimed elimination of toxic substances. A novel, efficient reactor technique was developed, by which dangerous, poorly degradable dissolved hydrocarbons are selectively retained in the bioreactor thanks to an integrated membrane, while other substances are quickly discharged from the system via the effluent. With a synthetic waste water, this selective retention method achieved substrate-specific retention times which were five to fifty times higher than those of a merely hydrodynamically operated reactor system. In addition, the decoupling of high reactor and low effluent concentrations results in a higher biochemical activity in the reactor in comparison with conventional process techniques. (orig.) [Deutsch] In der industriellen Abwasserreinigung werden verstaerkt Bioverfahrenstechniken mit immobilisierter Biomasse eingesetzt, um eine gezielte Eliminierung gefaehrlicher Stoffe durchzufuehren. - Hierzu wurde eine neuartige leistungsfaehige Reaktortechnik entwickelt, die mittels einer im Bioreaktor integrierten Membran gefaehrliche, schwer abbaubare geloeste Kohlenwasserstoffe selektiv im Bioreaktor zurueckhaelt, waehrend andere Stoffe das System schnell ueber den Ablauf verlassen. Durch den stoffselektiven Rueckhalt wurden an einem synthetischen Abwasser substratspezifische Verweilzeiten erzielt, die um den Faktor 5 bis 50 ueber denen eines rein hydrodynamisch bestimmten Reaktorsystems liegen. Darueber hinaus wird aufgrund der Entkopplung von hoher Reaktor- und niedriger Ablaufkonzentration eine im Vergleich zu herkoemmlichen Verfahrenstechniken hoehere biochemische Aktivitaet im Reaktor erzielt. (orig.)

  18. KINETIKA HIDRODESULFURISASI DIBENZOTHIOPHENE (HDS DBT MENGGUNAKAN KATALIS NiMo/γ-Al2O3

    Directory of Open Access Journals (Sweden)

    Subagjo Subagjo

    2014-12-01

    Full Text Available Evaluasi kinetika reaksi hidrodesulfurisasi (HDS dibenzothiophene dan simulasi nafta hydrotreater yang berada di PT. PERTAMINA Refinery Unit II Dumai menggunakan katalis NiMo/Al2O3 hasil pengembangan telah dilakukan. Kinetika reaksi HDS DBT dilakukan dalan sistem reaktor batch dengan variasi temperatur 280-320oC dan tekanan 30 bar. Data kinetika diolah dengan persamaan hukum pangkat (law power dan persamaan kinetik mekanistik (Langmuir Hinshelwood, LH. Berdasarkan model hukum pangkat, kinetika HDS DBT menggunakan NiMo/Al2O3 hasil pengembangan merupakan  orde satu  terhadap DBT dengan konstanta Arhenius  sebesar 165633 detik-1 dan energi aktivasi 69017 J/mol (16,56 kkal/mol. Model LH yang cocok untuk reaksi HDS DBT menggunakan NiMo/Al2O3 hasil pengembangan adalah model LH yang mengilustrasikan adanya kompetisi antara reaktan DBT dan H2 pada tipe pusat aktif yang sama, dengan DBT teradsorb secara kuat sedangkan H2 teradsorpsi secara lemah. Energi aktifasi dan konstanta Arhenius berdasarkan model LH ini ini berturut-turut adalah 81409 J/mol (19,34 kkal/mol dan 1658133 s-1. Dengan menggunakan persamaan laju reaksi hukum pangkat, model memberikan hasil konversi sulfur yang sama dengan hasil keluaran reaktor nafta hydrotreater RU II-Dumai, yaitu mencapai 98%.

  19. KINERJA KATALIS Ag/Al2O3 UNTUK REDUKSI NOx

    Directory of Open Access Journals (Sweden)

    Rakhman Sarwono

    2012-02-01

    Full Text Available NOx merupakan hasil samping dari suatu reaksi pembakaran. NOx merupakan gas yang beracun sangat berbahaya terhadap kesehatan manusia dan hewan bila terhirup pada waktu bernafas. Untuk mengurangi kadar NOx pada gas buang, banyak penelitian diarahkan pada reduksi NOx dengan katalis secara selektif dengan hidrokarbon dan oksigen berlebihan. Katalis yang digunakan adalah katalis alumina (Al2O3 yang didapat dari katalis komersial (AlO1-7 dan katalis hasil sintesa (ALOA. Katalis Ag/Al2O3 didapat dengan memasukkan logam Ag ke dalam alumina (Al2O3 dengan cara impregnasi dengan larutan perak nitrat. Katalis diuji aktifitasnya pada reaktor fixed bed yang diluarnya terdapat pemanas yang bisa diatur suhunya. Reaktan seperti gas NO, C2H4  dan oksigen dimasukkan kedalam reaktor dengan laju yang ditentukan. Hasil reaksi dianalisa dengan gas chromatography dan dicatat pada recorder, selanjutnya bisa ditentukan kuantitas dan prosentase konversinya. Katalis alumina  ALOA mempunyai kemampuan mereduksi NO dengan konversi  sekitar 40-45% gas NO menjadi N2. Loading logam perak (Ag kedalam Al2O3 sebesar 2-3% berat menambah daya reduksi NO menjadi sekitar 45-50% pada suhu 500oC. Pada umpan NO + C2H4  + O2  reaksi reduksi terjadi pada suhu 300oC, sedangkan pada umpan NO + C2H4   (tanpa oksigen reaksi reduksi baru terjadi pada suhu 450oC, dengan demikian adanya oksigen sangat berperan dalam proses reduksi NOx. Reaksi peruraian C2H4 menjadi COx berkebalikan dengan kinerja katalis pada proses reduksi NOx

  20. PEMBUATAN BAHAN BAKU SPREADS KAYA KAROTEN DARI MINYAK SAWIT MERAH MELALUI INTERESTERIFIKASI ENZIMATIK MENGGUNAKAN REAKTOR BATCH [Preparation of Red Palm Oil Based-Spreads Stock Rich in Carotene Through Enzymatic Interesterification in Batch-type Reactor

    Directory of Open Access Journals (Sweden)

    Nur Wulandari1,2

    2012-12-01

    Full Text Available Enzymatic interesterification of red palm oil (a mixture of red palm olein/RPO and red palm stearin/RPS in 1:1 weight ratio and coconut oil (CNO blends of varying proportions using a non-specific immobilized Candida antartica lipase (Novozyme 435 was studied for the preparation of spread stock. The interesterification reaction was held in a batch-type reactor. Two substrate blends were chosen for the production of spread stock i.e. 77.5:22,5 and 82.5:17.5 (RPO/RPS:CNO, by weight through enzymatic interesterification in three different reaction times (2, 4, and 6 hours. The interesterification reactions were conducted at 60°C, 200 rpm agitation speed and 10% of Novozyme 435. The interesterified products were evaluated for their physical characteristics (slip melting point or SMP and solid fat content or SFC and chemical characteristics (carotene retention, moisture content, and free fatty acid/FFA content. All of the interesterified products had lower SFC and SMP as compared to the initial blends. The SMP and SFC increased in longer reaction times. The SMP ranged from 30.8°C to 34.9°C. The carotene retention ranged from 74.80% to 81.08%, while the moisture content and FFA content increased in longer reaction times. The interesterified products had desirable physical properties for possible use as a spread stock rich in carotene.

  1. Pengaruh Aerasi dan Sumber Nutrien terhadap Kemampuan Alga Filum Chlorophyta dalam Menyerap Karbon (Carbon Sink untuk Mengurangi Emisi CO2 di Kawasan Perkotaan

    Directory of Open Access Journals (Sweden)

    Lancur Setoaji

    2013-09-01

    Full Text Available Penelitian terkait mitigasi pemanasan global, khususnya dalam penyerapan karbon dioksida (CO2, menjadi fokus utama di kalangan ilmuwan dunia. Secara alamiah, karbon dioksida dapat diserap oleh tumbuhan hijau, laut, karbonasi batuan kapur, dan alga. Pigmen hijau dalam alga atau klorofil dapat menyerap karbon dioksida dalam proses fotosintesis. Alga memiliki pertumbuhan yang sangat cepat sehingga cocok digunakan sebagai carbon sink. Penelitian terkait carbon sink ini bertujuan untuk menentukan kemampuan rata-rata serapan CO2 oleh alga di kawasan perkotaan dan menentukan pengaruh aerasi dan variasi sumber N terhadap pertumbuhan dan perkembangan alga. Penelitian ini dilakukan dalam skala laboratorium menggunakan reaktor dengan proses batch. Sampel alga yang digunakan didapatkan dari hasil pengembangbiakan yang bersumber dari perairan di kawasan perkotaan. Penelitian ini menggunakan dua variabel uji, yaitu aerasi dan sumber nutrien. Jumlah karbon dioksida yang diserap didapatkan dari perbandingan stoikiometri pada reaksi fotosintesis.  Berdasarkan perbandingan stoikiometri tersebut diketahui bahwa 1 gram sel alga yang terbentuk sebanding dengan 1,92 gram CO2 yang diserap. Dari hasil penelitian, alga dengan penambahan pupuk urea dapat menyerap 4,87 mg CO2/hari dalam kondisi tanpa aerasi atau 3,84 mg CO2/hari dengan aerasi. Sedangkan alga dengan penambahan pupuk NPK dapat menyerap 3,61 mg CO2/hari dalam kondisi tanpa aerasi atau 3,01 mg CO2/hari dengan aerasi.

  2. Validation of CESAR Thermal-hydraulic Module of ASTEC V1.2 Code on BETHSY Experiments

    Science.gov (United States)

    Tregoures, Nicolas; Bandini, Giacomino; Foucher, Laurent; Fleurot, Joëlle; Meloni, Paride

    The ASTEC V1 system code is being jointly developed by the French Institut de Radioprotection et Sûreté Nucléaire (IRSN) and the German Gesellschaft für Anlagen und ReaktorSicherheit (GRS) to address severe accident sequences in a nuclear power plant. Thermal-hydraulics in primary and secondary system is addressed by the CESAR module. The aim of this paper is to present the validation of the CESAR module, from the ASTEC V1.2 version, on the basis of well instrumented and qualified integral experiments carried out in the BETHSY facility (CEA, France), which simulates a French 900 MWe PWR reactor. Three tests have been thoroughly investigated with CESAR: the loss of coolant 9.1b test (OECD ISP N° 27), the loss of feedwater 5.2e test, and the multiple steam generator tube rupture 4.3b test. In the present paper, the results of the code for the three analyzed tests are presented in comparison with the experimental data. The thermal-hydraulic behavior of the BETHSY facility during the transient phase is well reproduced by CESAR: the occurrence of major events and the time evolution of main thermal-hydraulic parameters of both primary and secondary circuits are well predicted.

  3. PENGOLAHAN LIMBAH Cr(VI DAN FENOL DENGAN FOTOKATALIS SERBUK TiO2 DAN CuO/TiO2

    Directory of Open Access Journals (Sweden)

    Slamet Slamet

    2011-07-01

    Full Text Available Studi tentang pengolahan limbah Cr(VI dan fenol secara fotokatalisis telah dilakukan dengan fotokatalis TiO2 dan CuO/TiO2. Katalis CuO/TiO2 dipreparasi dengan cara impregnasi terhadap TiO2 Degussa P25 menggunakan larutan garam tembaga yang berasal dari berbagai jenis prekursor. Komposisi Cu dalam katalis divariaskani dari 0,2% hingga 5%. Fotokatalis tersebut kemudian dikarakterisasi DRS (Diffuse Reflectance Spectroscopy dan XRD (X-Ray Diffraction. Aktivitas fotokatalis diuji dengan menggunakan sistem reaktor slurry yang bekerja secara batch dan dilengkapi dengan 6 lampu UV black light selama 5 jam, kemudian hasilnya dianalisis dengan UV-VIS Spectrophotometer. Hasil karakterisasi DRS menunjukan bahwa penambahan CuO dari 1% hingga 5% ke dalam TiO2 dapat meningkatkan pita absorbansi katalis dari 398 hingga 413 nm dan menurunkan band gap dari 3,2 hingga 2,58 eV. Hasil karakterisasi XRD menunjukan adanya struktur kristal anatase dan rutil dalam katalis TiO2 dan CuO/TiO2, sementara struktur kristal CuO muncul pada katalis CuO/TiO2 yang dipreparasi dengan prekursor Cu-Asetat dan Cu-Nitrat. Fotokatalis 0,2% CuO/TiO2 dari prekursor Cu-Asetat memiliki aktivitas optimal yang mereduksi Cr(VI 99,67% dan mendegradasi fenol 97,16%. Sementara jika kedua limbah tersebut diolah secara simultan, katalis TiO2 Degussa P25 memiliki aktivitas yang paling tinggi dengan meningkatkan konversi reduksi Cr(VI menjadi 100% dan menurunkan konversi degradasi fenol menjadi 93,81% dengan waktu reaksi 5 jam.

  4. Analisis dan Optimasi Desain Sistem Reaktor Gas Temperatur Tinggi RGTT200K dan RGTT200KT

    Directory of Open Access Journals (Sweden)

    Mohammad Dhandhang Purwadi

    2013-03-01

    dengan penyelesaian persamaan aljabar linier dari model RGTT200K dan RGTT200KT. Dari analisis dan optimasi ini dihasilkan desain konseptual sistem RGTT200K dan RGTT200KT dengan spesifikasi thermal-flow teras sama, dan peningkatan EUF dari 63% menjadi 80,14% (untuk RGTT200K dan dari 63,6% menjadi 78,02% (untuk RGTT200KT.

  5. Theory of nuclear reactors. Vol. 1. Theorie der Kernreaktoren. Bd. 1. Der stationaere Reaktor

    Energy Technology Data Exchange (ETDEWEB)

    Emendoerfer, D.; Hoecker, K.H.

    1982-01-01

    An introduction is given to the elements of reactor physics and reactor calculation which refers to practice from the present point of view. It is demonstrated to the reader how the reactor characteristics relevant to construction can be calculated from atomic factors by means of neutron transport and diffusion theory; these reactor characteristics are: multiplication factor, power density distribution, burn-up, plutonium build-up, xenon vibrations, short-time behaviour. The interaction between thermo- and fluid-dynamic processes is important for this calculation. On grounds of didactics the crucial point of this book is the establishment and calculation of simple models which give a clear description of all important characteristics of the events. Attempts for more exact simulation by computer are dealt with including typical solutions.

  6. UNJUK KERJA REAKTOR PLASMA DIELECTRIC BARRIER DISCHARGE UNTUK PRODUKSI BIODIESEL DARI MINYAK KELAPA SAWIT

    Directory of Open Access Journals (Sweden)

    Ardian Dwi Yudhistira

    2013-10-01

    Full Text Available Biodiesel is one of alternative renewable energy source to substitute diesel fuel. Various biodiesel productionprocesses through transesterification reaction with a variety of catalysts have been developed by previousresearcher. This process still has the disadvantage of a long reaction time, and high energy need. DielectricBarrier Discharge (DBD plasma electro-catalysis may become a solution to overcome the drawbacks in theconventional transesterification process. This process only needs a short time reaction and low energy process.The purpose of this study was to assess the performance of DBD plasma rector in making biodiesel such as: theeffect of high voltage electric value, electrodes gap, mole ratio of methanol / oil, and reaction time. TheResearch method was using GC-MS (Gas Cromatography-Mass Spectrofotometry and FTIR (FourierTransform Infrared Spectrofotometry and then it will be analysed the change of chemical bond betweenreactant and product. So, the reaction mechanism can be predicted. Biodiesel is produced using methanol andpalm oil as reactants and DBD plasma used as reactor in batch system. Then, reactants contacted by highvoltage electric. From the results of this research can be concluded that the reaction mechanism occurs in theprocess is the reaction mechanism of cracking, the higher of electric voltage and the longer of reaction time leadto increasing of product yield. The more of mole ratio of methanol / oil and widening the gap between theelectrodes lead to decreased product yield. From this research, product yield maksimum is 89,8% in the variableof rasio mol metanol/palm oil 3:1, voltage 10 kV, electrode gap 1,5 cm, and reaction time 30 seconds.

  7. Irradiation effects on Zr-2.5Nb in power reactors

    Energy Technology Data Exchange (ETDEWEB)

    Song, C., E-mail: Carol.Song@cnl.ca [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada)

    2016-06-15

    Zirconium alloys are widely used as structural materials in nuclear applications because of their attractive properties such as a low absorption cross-section for thermal neutrons, excellent corrosion resistance in water, and good mechanical properties at reactor operating temperatures. Zr-2.5Nb is one of the most commonly used zirconium alloys and has been used for pressure tube materials in CANDU (Canada Deuterium Uranium) and RBMK (Reaktor Bolshoy Moshchnosti Kanalnyy, 'High Power Channel-type Reactor') reactors for over 40 years. In a recent report from the Electric Power Research Institute, Zr-2.5Nb was identified as one of the candidate materials for use in normal structural applications in light-water reactors owing to its increased resistance to irradiation-induced degradation as compared with currently used materials. Historically, the largest program of in-reactor tests on zirconium alloys was performed by Atomic Energy of Canada Limited. Over many years of in-reactor testing and CANDU operating experience with Zr- 2.5Nb, extensive research has been conducted on the irradiation effects on its microstructures, mechanical properties, deformation behaviours, fracture toughness, delayed hydride cracking, and corrosion. Most of the results on Zr-2.5Nb obtained from CANDU experience could be used to predict the material performance under light water reactors. This paper reviews the irradiation effects on Zr-2.5Nb in power reactors (including heavy-water and light-water reactors) and summarizes the current state of knowledge. (author)

  8. Studi Reaksi Konversi Katalisis 2-Propanol Menggunakan Katalis dan Pendukung Katalis γ-Al2O3

    Directory of Open Access Journals (Sweden)

    Sunardi Sunardi

    2007-10-01

    Full Text Available Katalis padatan basa belum digunakan secara luas bila dibandingkan dengan penggunaan katalis padatan asam, meskipun katalis padatan basa secara efisien juga mampu berperan dalam reaksi-reaksi seperti alkilasi, kondensasi, isomerisasi dan lain-lain. Pada penelitian ini dilakukan studi reaksi konversi katalisis 2-propanol menggunakan katalis padatan basa Mg-Al-Hidrotalsit dan katalis padatan superbasa g-Al2O3-NaOH-Na yang dibandingkan dengan katalis γ-Al2O3. Reaksi katalisis dilakukan dalam fase gas dengan variasi suhu dari 175oC sampai suhu 300oC, menggunakan katalis seberat 3 gram. Produk reaksi katalisis dianalisis dengan kromatografi gas, yang dirangkai secara on-line dengan reaktor katalisis. Propilen dan aseton merupakan produk-produk primer reaksi konversi yang mudah bereaksi lebih lanjut menghasilkan produk-produk sekunder yang stabil. Katalis γ-Al2O3 hanya mengkonversi 2-propanol menjadi propilen, karena sifat basanya tidak cukup kuat untuk mendorong reaksi dehidrogenasi 2-propanol menjadi aseton. Katalis Mg-Al-hidrotalsit mengkonversi hampir 100% 2-propanol menjadi propilen pada suhu 175oC dan menghasilkan aseton paling banyak pada 225oC dengan konversi produk sebesar 53,36 %, sedangkan dengan katalis superbasa γ-Al2O3-NaOH-Na diperoleh konversi aseton sebesar 66,0% pada 225oC. Produkproduksekunder hasil konversi 2-propanol dengan katalis Mg-Al-hidrotalsit secara batch diidentifikasi dengan GC-MS dan diperoleh senyawa yang dominan adalah 4-metil-2-pentanol dan 3,3,5-trimetil sikloheksanol. Copyright (c 2007 BCREC UNDIP. All rights reserved.[Presented at Symposium and Congress of MKICS 2007, 18-19 April 2007, Semarang, Indonesia][How to Cite: W. Wibowo, S. Sunardi, I. Yulia. (2007. Studi Reaksi Konversi Katalisis 2-Propanol Menggunakan Katalis dan Pendukung Katalis γ-Al2O3. Bulletin of Chemical Reaction Engineering and Catalysis, 2 (2-3: 56-61. doi:10.9767/bcrec.2.2-3.11.56-61][How to Link/DOI: http://dx.doi.org/10.9767/bcrec.2.2-3.8.56-61

  9. Studi Reaksi Konversi Katalisis 2-Propanol Menggunakan Katalis dan Pendukung Katalis γ-Al2O3

    Directory of Open Access Journals (Sweden)

    Widajanti Wibowo

    2007-10-01

    Full Text Available Katalis padatan basa belum digunakan secara luas bila dibandingkan dengan penggunaan katalis padatan asam, meskipun katalis padatan basa secara efisien juga mampu berperan dalam reaksi-reaksi seperti alkilasi, kondensasi, isomerisasi dan lain-lain. Pada penelitian ini dilakukan studi reaksi konversi katalisis 2-propanol menggunakan katalis padatan basa Mg-Al-Hidrotalsit dan katalis padatan superbasa g-Al2O3-NaOH-Na yang dibandingkan dengan katalis γ-Al2O3. Reaksi katalisis dilakukan dalam fase gas dengan variasi suhu dari 175oC sampai suhu 300oC, menggunakan katalis seberat 3 gram. Produk reaksi katalisis dianalisis dengan kromatografi gas, yang dirangkai secara on-line dengan reaktor katalisis. Propilen dan aseton merupakan produk-produk primer reaksi konversi yang mudah bereaksi lebih lanjut menghasilkan produk-produk sekunder yang stabil. Katalis γ-Al2O3 hanya mengkonversi 2-propanol menjadi propilen, karena sifat basanya tidak cukup kuat untuk mendorong reaksi dehidrogenasi 2-propanol menjadi aseton. Katalis Mg-Al-hidrotalsit mengkonversi hampir 100% 2-propanol menjadi propilen pada suhu 175oC dan menghasilkan aseton paling banyak pada 225oC dengan konversi produk sebesar 53,36 %, sedangkan dengan katalis superbasa γ-Al2O3-NaOH-Na diperoleh konversi aseton sebesar 66,0% pada 225oC. Produkproduksekunder hasil konversi 2-propanol dengan katalis Mg-Al-hidrotalsit secara batch diidentifikasi dengan GC-MS dan diperoleh senyawa yang dominan adalah 4-metil-2-pentanol dan 3,3,5-trimetil sikloheksanol. Copyright (c 2007 BCREC UNDIP. All rights reserved.[Presented at Symposium and Congress of MKICS 2007, 18-19 April 2007, Semarang, Indonesia][How to Cite: W. Wibowo, S. Sunardi, I. Yulia. (2007. Studi Reaksi Konversi Katalisis 2-Propanol Menggunakan Katalis dan Pendukung Katalis γ-Al2O3. Bulletin of Chemical Reaction Engineering and Catalysis, 2 (2-3: 56-61.  doi:10.9767/bcrec.2.2-3.7131.56-61][How to Link/DOI: http://dx.doi.org/10.9767/bcrec.2.2

  10. KARAKTERISASI DAN AKTIVITAS KATALITIK BERBAGAI VARIASI KOMPOSISI KATALIS Ni DAN ZnBr2 DALAM Γ-Al2O3 UNTUK ISOMERISASI DAN HIDROGENASI (R-(+-SITRONELAL

    Directory of Open Access Journals (Sweden)

    ED Iftitah

    2014-06-01

    Full Text Available Pengaruh sifat dan karakter berbagai variasi komposisi katalis Ni dan ZnBr2 yang terimpregnasi dalam γ-Al2O3 terhadap aktivitas dan selektivitasnya untuk reaksi isomerisasi dan hidrogenasi (R-(+-Sitronelal telah dilakukan. Dalam penelitian ini, terdapat tiga jenis variasi komposisi Ni dan ZnBr2 dalam γ-Al2O3, yaitu: A1=Ni/ZnBr2/γ-Al2O3 (3:2, A2=Ni/ZnBr2/γ-Al2O3 (1:1 dan A3=Ni/ZnBr2/γ-Al2O3 (2:3. Katalis dikarakterisasi menggunakan X-ray diffraction (XRD, Brunauer-Emmett-Teller (BET surface area, dan SEM-EELS. Luas area permukaan spesifik dan porositasnya ditentukan berdasarkan adsorption-desorption gas nitrogen pada 77 K. Distribusi dan volume pori ditentukan dengan desorption isotherm pada P/Po ≥ 0,3. Hasil yang didapat menunjukkan bahwa terdapat hubungan antara karakter dan sifat katalis dengan aktivitas katalitiknya terhadap produk isomerisasi dan hidrogenasi (R-(+-Sitronelal. Uji aktivitas dilakukan dalam sebuah reaktor mini dengan 0,5 g katalis dan 3 mL (R-(+-Sitronelal menggunakan atmosfir gas N2 dan/atau H2 dalam waktu 5 dan 24 jam masing-masing pada suhu 90 dan 120 °C. Komposisi katalis, pemilihan jenis atmosfir gas dan suhu sangat berpengaruh terhadap aktivitas dan selektivitas pembentukan produk isomerisasi dan hidrogenasi. Konversi (R-(+-Sitronelal tertinggi ditunjukkan oleh katalis A3=Ni/ZnBr2/γ-Al2O3 (2:3 dengan kondisi reaksi selama 5 jam (4 jam N2 + 1 jam H2 pada suhu 90 °C dan 24 jam (4 jam N2 + 20 jam H2 pada suhu 120 °C. The influence of catalyst properties and characteristics of Ni and ZnBr2 catalysts impregnated in γ-Al2O3 on the activity and selectivity of (R-(+-Citronellal isomerisation and hydrogenation has been done. In this study, there were three sets of Ni and ZnBr2 in γ-Al2O3 with various composition, they were A1=Ni/ZnBr2/γ-Al2O3 (3:2, A2=Ni/ZnBr2/γ-Al2O3 (1:1, A3=Ni/ZnBr2/γ-Al2O3 (2:3. The catalysts were characterized using X-ray diffraction (XRD, Brunauer-Emmett-Teller (BET surface area and SEM

  11. 2 $\

    CERN Document Server

    Blum, R D

    1999-01-01

    We present 2 um narrow-band images of the core H II region in the Galactic star forming region Sagittarius D. The emission-line images are centered on 2.17 um (Brgamma) and 2.06 um (He I). The H II region appears at the edge of a well defined dark cloud, and the morphology suggests a blister geometry as pointed out in earlier radio continuum work. There is a deficit of stars in general in front of the associated dark cloud indicating the H II region is located in-between the Galactic center and the sun. The lesser spatial extent of the He I line emission relative to Brgamma places the effective temperature of the ionizing radiation field below 40,000 K. The He I 2.06 um to Brgamma ratio and Brgamma / far infrared dust emission put Teff at about 36,500 K to 40,000 K as derived from ionization models.

  12. $2\

    CERN Document Server

    Agostini, M; Bakalyarov, A M; Balata, M; Barabanov, I; Barros, N; Baudis, L; Bauer, C; Becerici-Schmidt, N; Bellotti, E; Belogurov, S; Belyaev, S T; Benato, G; Bettini, A; Bezrukov, L; Bode, T; Borowicz, D; Brudanin, V; Brugnera, R; Budjáš, D; Caldwell, A; Cattadori, C; Chernogorov, A; D'Andrea, V; Demidova, E V; di Vacri, A; Domula, A; Doroshkevich, E; Egorov, V; Falkenstein, R; Fedorova, O; Freund, K; Frodyma, N; Gangapshev, A; Garfagnini, A; Gooch, C; Grabmayr, P; Gurentsov, V; Gusev, K; Hegai, A; Heisel, M; Hemmer, S; Heusser, G; Hofmann, W; Hult, M; Inzhechik, L V; Csáthy, J Janicskó; Jochum, J; Junker, M; Kazalov, V; Kihm, T; Kirpichnikov, I V; Kirsch, A; Klimenko, A; Knöpfle, K T; Kochetov, O; Kornoukhov, V N; Kuzminov, V V; Laubenstein, M; Lazzaro, A; Lebedev, V I; Lehnert, B; Liao, H Y; Lindner, M; Lippi, I; Lubashevskiy, A; Lubsandorzhiev, B; Lutter, G; Macolino, C; Majorovits, B; Maneschg, W; Medinaceli, E; Mi, Y; Misiaszek, M; Moseev, P; Nemchenok, I; Palioselitis, D; Panas, K; Pandola, L; Pelczar, K; Pullia, A; Riboldi, S; Rumyantseva, N; Sada, C; Salathe, M; Schmitt, C; Schneider, B; Schreiner, J; Schulz, O; Schwingenheuer, B; Schönert, S; Schütz, A-K; Selivanenko, O; Shirchenko, M; Simgen, H; Smolnikov, A; Stanco, L; Stepaniuk, M; Ur, C A; Vanhoefer, L; Vasenko, A A; Veresnikova, A; von Sturm, K; Wagner, V; Walter, M; Wegmann, A; Wester, T; Wilsenach, H; Wojcik, M; Yanovich, E; Zavarise, P; Zhitnikov, I; Zhukov, S V; Zinatulina, D; Zuber, K; Zuzel, G

    2015-01-01

    Two neutrino double beta decay of $^{76}$Ge to excited states of $^{76}$Se has been studied using data from Phase I of the GERDA experiment. An array composed of up to 14 germanium detectors including detectors that have been isotopically enriched in $^{76}$Ge was deployed in liquid argon. The analysis of various possible transitions to excited final states is based on coincidence events between pairs of detectors where a de-excitation $\\gamma$ ray is detected in one detector and the two electrons in the other. No signal has been observed and an event counting profile likelihood analysis has been used to determine Frequentist 90\\,\\% C.L. bounds for three transitions: ${0^+_{\\rm g.s.}-2^+_1}$: $T^{2\

  13. Kombinierter biologisch-photokatalytischer Abbau von umweltrelevanten Stickstoffverbindungen zur Reinigung von landwirtschaftlichen Abwässern mit bewachsenen Pflanzenfiltern und TiO 2 /UV

    OpenAIRE

    Ebbinghaus, Thorsten

    2002-01-01

    In dieser Arbeit wurde eine Modelkläranlage aufgebaut, über 18 Monate betrieben und eine Bilanz für die Abwasserfracht aufgestellt. Die Modellkläranlage bestand aus einem vertikalen, bewachsenen Pflanzenfilter, einem Pflanzenteich und einem CPC-Reaktor (Compound Parabolic Collector) mit Bestrahlungszelle. Der Zulauf an Abwasser betrug etwa 18 L / Tag bei einer mittleren organischen Belastung von 1564 mg/L, ausgedrückt als CSB.In der ersten biologischen Stufe (Pflanzenfilter) erfolgte die Oxid...

  14. Svar til: Hvorfor bryder robotter sammen i Tjernobyl-reaktor? (Ingeniøren, lørdag d. 17 nov. 2007)

    DEFF Research Database (Denmark)

    Morgen, Per

    2007-01-01

    stråling i form af partikler eller gamma- og røntgenstråling ioniserer på deres vej igennem siliciummet de atomer, som de møder på deres vej. Derved dannes der inde i chippen løse elektroner og huller, som kan frembringe falske elektroniske signaler i den. Hvis man er uheldig, ændrer disse signaler...

  15. The vegetation as sink and biochemical reactor for airborne pollutants. Final report; Die Vegetation als Senke und biochemischer Reaktor fuer luftgetragene Schadstoffe. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Weissflog, L.; Wenzel, K.D. [UFZ - Umweltforschungszentrum Leipzig-Halle GmbH, Leipzig (Germany). Sektion Chemische Oekotoxikologie

    1997-06-30

    The present project involved extensive studies on the air pollution situation and interactions between organic as well as inorganic air pollutant levels and the vegetation in three east German states. Seven monitoring sites with different emission profiles were selected in Saxony-Anhalt, one typically polluted site in Saxony, and two less polluted sites in Mecklenburg-Western Pomerania. The following emitter types were found to exhibit consistent pollutant patterns: landfills receiving chloroorganic special wastes; hard-coal-fuelled firing installations; commercial charcoal plants; industry; industry - car traffic - domestic fuel combustion; car traffic. [Deutsch] Im Verlauf der Projektarbeiten wurden an sieben durch unterschiedliche Emittententypen belasteten Standorten in Sachsen-Anhalt, einem typisch belasteten Standort in Sachsen und an zwei weniger belasteten Standorten in Mecklenburg/Vorpommern umfangreiche Untersuchungen zur Immissionssituation und der Wechselwirkung der luftgetragenen anorganischen und organischen Schadstofffracht mit der Vegetation durchgefuehrt. Dabei konnten fuer folgende Emittenten charakteristische Schadstoffmuster ermittelt werden: - Deponien mit chlororganischem Sondermuell - Feuerungsanlagen fuer Steinkohle - Gewerbliche Anlagen zur Herstellung von Holzkohle - Industrie - Industrie/Kfz-Verkehr/Hausbrand - Kfz-Verkehr. (orig.)

  16. Pra Desain Pabrik Sorbitol dari Tepung Tapioka dengan Hidrogenasi Katalitik

    Directory of Open Access Journals (Sweden)

    Hellen Kartika Dewi

    2014-03-01

    Full Text Available Sorbitol yang dikenal juga sebagai glusitol, adalah suatu gula alkohol yang dimetabolisme lambat di dalam tubuh. Sorbitol banyak digunakan sebagai bahan baku untuk industri barang konsumsi dan makanan seperti pasta gigi, permen, kosmetika, farmasi, vitamin C, termasuk industri tekstil dan kulit. Pembuatan sorbitol dari bahan baku tepung tapioka. Pabrik sorbitol ini direncanakan akan didirikan di Propinsi Jawa Tengah tepatnya di Kabupaten Batang dengan kapasitas produksi 30.000 ton/tahun. Proses produksi Sorbitol menggunakan proses hidrogenasi katalitik. Pembuatan sorbitol dari bahan baku pati melalui dua tahap proses utama yaitu proses perubahan starch menjadi glukosa melalui hidrolisa double enzym. Enzim yang digunakan yaitu α-amylase dan glukoamylase. Proses hidrogenasi katalitik dilakukan dengan mereaksikan larutan dekstrose dan gas hidrogen bertekanan tinggi dengan menambahkan katalis nikel dalam reaktor (Reaktor Hidrogenasi. Gas hidrogen masuk dari bawah reaktor secara bubbling dan larutan dekstrose diumpankan dari atas reaktor sehingga kontak yang terjadi semakin baik. Sorbitol yang di hasilkan dalam pradesain pabrik sorbitol ini dengan konsentrasi 58,2%. Pendirian pabrik sorbitol memerlukan biaya investasi modal tetap (fixed capital sebesar Rp 168.801.192.952, modal kerja (working capital  Rp 29.788.445.815, investasi total Rp 198.589.638.767, Biaya produksi per tahun Rp 368.832.813.809 dan  hasil penjualan per tahun Rp 540.000.078.750. Dari analisa ekonomi didapatkan BEP sebesar 26,32%. ROI sesudah pajak 48,5 %, POT sesudah pajak 2,14 tahun. Dari segi teknis dan ekonomis, pabrik ini layak untuk didirikan.

  17. Development of a continuous process for microbial elimination of 1,2 dichloropropane in contaminated water; Entwicklung eines kontinuierlichen Verfahrens zur mikrobiellen Elimination von 1,2-Dichlorpropan in kontaminierten Waessern

    Energy Technology Data Exchange (ETDEWEB)

    Hauck, R.

    2000-07-01

    methanogenes and sulfate reducing bacteria resulted in a slower but continued DCP degradation. Due to these results molecular hydrogen was spiked to the reactor whereby an increase of DCP degradation could be achieved. The applied culture showed a high dechlorination potential towards different aliphatic and aromatic chloroorganics, so that an application of the presented technique for groundwater treatment is principally suitable. (orig.) [German] Fuer die Untersuchungen zum biologischen Abbau von 1,2-Dichlorpropan (DCP) wurden sowohl aerobe als auch anaerobe batch- und kontinuierliche Reaktorversuche mit Mischkulturen durchgefuehrt. Fuer die aeroben Versuche wurde eine Mischkultur aus einem mit chlororganischen Stoffen belasteten Grundwasser angereichert und batch-Versuche zur Bestimmung der Cosubstratbeduerfnisse durchgefuehrt. Hierbei konnte jedoch kein wiederholter DCP-Abbau etabliert werden. Fuer die Realisierung des anaeroben DCP-Abbaus wurde eine Mischkultur aus Sedimenten der Saale angereichert. Im sedimenthaltigen batch-Versuch wurde die quantitative Bildung von Propen ermittelt, wobei auch geringe Mengen 1- und 2-Monochlorpropan waehrend des Abbaus nachgewiesen werden konnten. Die Mischkultur aus der Saale wurde auf Polyurethanschaumstoff-Wuerfel immobilisiert und in einem kontinuierlichen Wirbelbettreaktor etabliert. In batch- und Reaktorversuchen wurden unterschiedliche Elektronendonoren eingesetzt, wobei sich Methanol mit einer maximalen DCP-Eliminationsrate von 65 mg/(l x d) als das den Abbau am besten unterstuetzende Einzelsubstrat erwies. Die maximal im Reaktor erreichbaren Eliminationsraten von 90 mg/(l x d) bei einer Verweilzeit von 24 h und DCP-Zulaufkonzentrationen von 100 mg/l wurden mit einer Elektronendonorkombination aus Methanol und Acetat erzielt. Die Charakterisierung der Population durch molekularbiologische Analysen ergab, dass sich im Laufe des Reaktorbetriebs eine Spezies mit hoher 16S rRNA-Sequenzhomologie zu Dehalobacter restricuts in der

  18. 2-(2,2-Dibromoethenylthiophene

    Directory of Open Access Journals (Sweden)

    Sebastien Clément

    2011-02-01

    Full Text Available The title compound, C6H4Br2S, represents a versatile building block for the preparation of π-conjugated redox-active thienyl oligomers and metal-mediated cross-coupling reactions. This is due to the presence of an electrochemically active thienyl heterocycle and a reactive dibromovinyl substituent, which easily undergoes dehydrobromination in the presence of n-butyllithium to afford 2-ethynylthiophene. In the molecule, the alkenyl unit and the thiophene ring are almost coplanar with an angle of 3.5 (2° between the normals of the best planes of the thiophene ring and the vinyl moiety.

  19. The upgrade and conversion of the ET-RR-1 research reactor using plate type fuel elements

    Energy Technology Data Exchange (ETDEWEB)

    Ashoub, N. [Reactor Physics Dept., Nuclear Research Center, Atomic Energy Authority, Cairo (Egypt); Saleh, H.G. [Faculty of Girls for Arts and Education, Ain-Shams Univ., Cairo (Egypt)

    2001-11-01

    The ET-RR-1 research reactor has been operated at 2 MW since 1961 using EK-10 fuel elements with 10% enriched uranium. The reactor has been used for nuclear applied research and isotope production. In order to upgrade the reactor power to a reasonable limit facing up-to-date uses, core conversion by a new type of fuel element available is necessary. Two fuel elements in plate type are suggested in this study to be used in the ET-RR-1 reactor core rather than the utilized ones. The first element has a dimension of 8 x 8 x 50 cm and consists of 19.7% enriched uranium, which is typical for that utilized in the ET-RR-2 reactor, but with a different length. The other element is proposed with a dimension of 7 x 7 x 50 cm and has the same uranium enrichment. To accomplish safety requirements for these fuel elements, thermal-hydraulic evaluation has been carried out using the PARET code. To reach a core conversion of the ET-RR-1 reactor with the above two types of fuel elements, neutronic calculations have been performed using WIMSD4, DIXY2 and EREBUS codes. Some important nuclear parameters needed in the physical design of the reactor were calculated and included in this study. (orig.) [German] Der ET-RR-1 Forschungsreaktor wird seit 1961 unter Verwendung von EK-10 Brennelementen mit einer Leistung von 2 MW betrieben. Der Reaktor wird in der angewandten Forschung und zur Isotopenherstellung eingesetzt. Um die Reaktorleistung im Hinblick auf eine zeitgemaesse Nutzung der Anlage in einem vernuenftigen Mass zu erhoehen, ist eine Umwandlung des Kerns durch Verwendung neuartiger Brennelemente noetig. In der vorliegenden Untersuchung wird vorgeschlagen, anstelle der z. Z. verwendeten Elemente zwei neue, plattenfoermige Brennelemente zu verwenden. Das erste Element hat eine Groesse von 8 x 8 x 50 cm und besteht aus 19,7% angereichertem Uran, was den im ET-RR-2 Reaktor verwendeten Elementen entspricht, allerdings mit einer anderen Groesse. Das zweite Element hat die gleiche

  20. STUDI PEMODELAN DAN PERHITUNGAN TRANSPORT MONTE CARLO DALAM TERAS HTR PEBBLE BED

    Directory of Open Access Journals (Sweden)

    Zuhair .

    2013-01-01

    Full Text Available Konsep sistem energi VHTR baik yang berbahan bakar pebble (VHTR pebble bed maupun blok prismatik (VHTR prismatik menarik perhatian fisikawan reaktor nuklir. Salah satu kelebihan teknologi bahan bakar bola adalah menawarkan terobosan teknologi pengisian bahan bakar tanpa harus menghentikan produksi listrik. Selain itu, partikel bahan bakar pebble dengan kernel uranium oksida (UO2 atau uranium oksikarbida (UCO yang dibalut TRISO dan pelapisan silikon karbida (SiC dianggap sebagai opsi utama dengan pertimbangan performa tinggi pada burn-up bahan bakar dan temperatur tinggi. Makalah ini mendiskusikan pemodelan dan perhitungan transport Monte Carlo dalam teras HTR pebble bed. HTR pebble bed adalah reaktor berpendingin gas temperatur tinggi dan bermoderator grafit dengan kemampuan kogenerasi. Perhitungan dikerjakan dengan program MCNP5 pada temperatur 1200 K. Pustaka data nuklir energi kontinu ENDF/B-V dan ENDF/B-VI dimanfaatkan untuk melengkapi analisis. Hasil perhitungan secara keseluruhan menunjukkan konsistensi dengan nilai keff yang hampir sama untuk pustaka data nuklir yang digunakan. Pustaka ENDF/B-VI (66c selalu memproduksi keff lebih besar dibandingkan ENDF/B-V (50c maupun ENDF/B-VI (60c dengan bias kurang dari 0,25%. Kisi BCC memprediksi keff hampir selalu lebih kecil daripada kisi lainnya, khususnya FCC. Nilai keff kisi BCC lebih dekat dengan kisi FCC dengan bias kurang dari 0,19% sedangkan dengan kisi SH bias perhitungannya kurang dari 0,22%. Fraksi packing yang sedikit berbeda (BCC= 61%, SH= 60,459% tidak membuat bias perhitungan menjadi berbeda jauh. Estimasi keff ketiga model kisi menyimpulkan bahwa model BCC lebih bisa diadopsi dalam perhitungan HTR pebble bed dibandingkan model FCC dan SH. Verifikasi hasil estimasi ini perlu dilakukan dengan simulasi Monte Carlo atau bahkan program deterministik lainnya guna optimisasi perhitungan teras reaktor temperatur tinggi.   Kata-kunci: kernel, TRISO, bahan bakar pebble, HTR pebble bed

  1. Development of a methodology for safety classification on a non-reactor nuclear facility illustrated using an specific example; Entwicklung einer Methodik zur Sicherheitsklassifizierung fuer eine kerntechnische Anlage ohne Reaktor an einem spezifischen Beispiel

    Energy Technology Data Exchange (ETDEWEB)

    Scheuermann, F.; Lehradt, O.; Traichel, A. [NUKEM Technologies Engineering Services GmbH, Alzenau (Germany)

    2015-07-01

    To realize the safety of personnel and environment systems and components of nuclear facilities are classified according to their potential danger into safety classes. Based on this classification different demands on the manufacturing quality result. The objective of this work is to present the standardized method developed by NUKEM Technologies Engineering Services for the categorization into the safety classes restricted to Non-reactor nuclear facilities (NRNF). Exemplary the methodology is used on the complex Russian normative system (four safety classes). For NRNF only the lower two safety classes are relevant. The classification into the lowest safety class 4 is accordingly if the maximum resulting dose following from clean-up actions in case of incidents/accidents remains below 20 mSv and the volume activity restrictions of set in NRB-99/2009 are met. The methodology is illustrated using an example. In short the methodology consists of: - Determination of the working time to remove consequences of incidents, - Calculation of the dose resulting from direct radiation and due to inhalation during these works. The application of this methodology avoids over-conservative approaches. As a result some previously higher classified equipment can be classified into the lower safety class.

  2. Evaluation of chemical phenomena that could have an effect on the performance of recirculation strainers in a Ringhals PWR; Bedoemning av kemiska fenomen med betydelse foer silfunktionen i Ringhals PWR-reaktorer

    Energy Technology Data Exchange (ETDEWEB)

    Liljenzin, Jan-Olov [Liljenzins data och kemikonsult, Goeteborg (Sweden)

    2005-01-15

    An evaluation has been made of the various chemical phenomena that could have an effect on the performance of recirculation strainers after a LOCA in a PWR. Values of pH and concentrations in the water at the bottom of the containment have been calculated as functions of time and temperature for a postulated LOCA. The behaviour of glass wool insulation, its dissolution, and precipitation of amorphous silic acid have been evaluated. Also the corrosion of galvanized surfaces has been considered. Dissolution of zinc by hot boric acid solution can lead to a later precipitation of amorphous zinc hydroxide or phosphate when pH increases and temperature drops. Also a possible growth of microorganisms is discussed. A rough classification of the various phenomena possible along a simplified time scale yields the following conclusions: Hours after the beginning of the LOCA: Precipitation of zinc hydroxide and/or phosphate. Dissolution of glass wool giving rise to an increasing concentration of silic acid in the water. Days after the beginning of the LOCA: Continued dissolution of glass wool and increasing concentration of silica in the water. Perhaps a precipitation of phosphates or carbonates of the metal ions released during dissolution of glass wool. Weeks after the beginning of the LOCA: Continued slow dissolution of glass wool leading to a risk of precipitation of amorphous silica. Perhaps a precipitation of phosphates or carbonates of the metal ions released during dissolution of glass wool. Initial growth of microorganisms in the water and on surfaces after mutations and adaptation to the existing environment. Months after the beginning of the LOCA: Continued slow dissolution of glass wool leading to a risk of precipitation of amorphous silica. Perhaps a precipitation of phosphates or carbonates of the metal ions released during dissolution of glass wool. Continued growth of adapted microorganisms.

  3. Official announcement of recommendations issued by the RSK (Reactor Safety Commission) and the SSK (Radiation Protection Commission). As of 11 October 1994; Bekanntmachung von Empfehlungen der Reaktor-Sicherheitskommission und der Strahlenschutzkommission. Vom 11. Oktober 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-23

    The RSK and the SSK have found satisfactory evidence that the planned surface and underground facilities and equipment of the repository fulfill the safety requirements given, and that the planned operations for emplacement and storage can be performed with due safety. RSK and SSK put emphasis on the fact that the specific types and volumes of the radioactive wastes envisaged for storage at this site will not create a hazardous situation at any place of the entire repository as a result of temperatures, pressures or radioactivity concentrations developing during emplacement or storage, so that the repository`s hazardous potential is assessed to be very low, both in the operational phase and during the post-sealing phase. The RSK and SSK approve of the submitted safety concept for specified normal operation, as well as the submitted regime of preventive measures for protection from accidents, and the results of the accident analyses performed. Engineered and other radiation protection measures provided for specified normal operation are found to guarantee protection of the personnel, the local population and the environment. Calculated radiation doses are below the limits given in section 44, sub-section 1, and sections 45 and 49 of the Radiation Protection Ordinance (StrlSchV). The calculations submitted for emergency-induced radioactivity levels show compliance with the maximum acceptable doses laid down in section 28, sub-sec. 3 StrlSchV. The review of data submitted concerning the longterm safety of the site and the calculation approaches for determining individual doses by way of model calculations for radionuclide migration from the storage site to the biosphere are approved of by the commissions, who found evidence that the waste stored will not create hazardous radiation levels in a post-sealing operation phase extending over a period of 10.000 years. (orig./HP) [Deutsch] RSK und die SSK haben sich davon ueberzeugt, dass alle geplanten ueber- und untertaegigen Anlagen und Einrichtungen des Endlagers den sicherheitstechnischen Anforderungen entsprechen. Der geplante Einlagerungsbetrieb kann sicher durchgefuehrt werden. RSK und SSK weisen darauf hin, dass im gesamten Endlager Konrad auf Grund der spezifischen Abfalleigenschaften und der Menge an radioaktiven Abfaellen weder hohe Temperaturen oder Druecke noch hohe Aktivitaetskonzentrationen auftreten. Aus diesen Gruenden schaetzen sie das Gefaehrdungspotential des Endlagers in der Betriebs- und in der Nachbetriebsphase als sehr niedrig ein. Die RSK und die SSK akzeptieren das vorgestellte Sicherheitskonzept im bestimmungsgemaessen Betrieb sowie die getroffenen Vorsorgemassnahmen gegen Stoerfaelle und die Ergebnisse der Stoerfallanalysen. Der Strahlenschutz des Personals, der Bevoelkerung und der Umwelt ist im bestimmungsgemaessen Betrieb gewaehrleistet. Die berechneten Strahlenexpositionen liegen jeweils unter den in Paragraph 44 Abs. 1, Paragraph 45 und Paragraph 49 StrlSchV festgelegten Grenzwerten. Die Stoerfallplanungswerte gemaess Paragraph 28 Abs. 3 StrlSchV koennen eingehalten werden. Die Beratungen zur Langzeitsicherheit haben keine Einwaende gegen die Vorgehensweise zur Ermittlung der Individualdosen mittels Modellrechnungen zur Radionuklidausbreitung von der Endlagerformation bis in die Biosphaere ergeben. RSK und SSK sehen den Nachweis als erbracht an, dass in der Nachbetriebsphase im Zeitraum von ca. 10000 Jahren keine endlagerbedingte Strahlenexposition auftritt. (orig./HP)

  4. The development of fast reactors - Effects on the Swedish system of management of spent fuel; Utveckling av snabba reaktorer - Paaverkan paa det svenska systemet foer hantering av anvaent braensle

    Energy Technology Data Exchange (ETDEWEB)

    Hans Forsstroem, Hans [SKB International AB, Stockholm (Sweden)

    2013-09-15

    Since the start of the nuclear power era studies have been performed of how to utilise the uranium energy resource in the most effective way. Only about one percent of the energy potential of uranium is utilised in the light water reactors of today. To improve the utilization other types of reactors are needed. With fast reactors theoretically 50-100 times more energy can be extracted from the uranium. This will require reprocessing of the uranium and multiple recycling of the plutonium. Plutonium and uranium can also be recycled in light water reactors, but this will only improve the uranium utilisation by about 20 %. Recycling of plutonium on a routine basis is presently only done in France. The development of fast reactors has been going on since the end of the 1940ies. During the 1970ies the planning was that a large number of fast reactors and their associated fuel cycle facilities would be in operation by the year 2000. The development has, however, for different reasons been much slower than planned. The general assessment today is that fast reactor, if they will be realised, will hardly give an important contribution to energy production until after 2050. Nuclear power production has instead been dominated by light water reactors similar to the ones in use in Sweden. Light water reactors are believed to continue to dominate during the next decades. To start a fast reactor system plutonium (or highly enriched uranium) will be needed. Such plutonium is contained in spent nuclear fuel from light water reactors. This raises the question: Should the spent nuclear fuel be stored so that the potential energy resource in the fuel can be used in the future instead of disposing of it as a waste? The answer to this question will depend on when the material will be useful, i.e. when fast reactors have been introduced on a large scale. It will also depend on the demand for plutonium at this time, i.e. will plutonium be a scarce redundant resource at this point of time. In this context it should be considered that fast reactors will generate their own plutonium, as breeder reactors. Plutonium from other reactors will thus only be needed for the first years of operation. To provide a basis for the answer to the question if the Swedish spent fuel is a resource or a waste this report provides an overview of the present development status for fast reactors and their potential for large scale commercial use. It further describes the impact on the Swedish system for management of spent nuclear fuel if the fuel were to be reprocessed and the uranium and plutonium reused as fuel for fast reactors or for the present reactors.

  5. NPP Grafenrheinfeld. No thank you. Questions and answers concerning the oldest operating crack susceptible reactor in the federal republic; AKW Grafenrheinfeld. Nein danke. Fragen und Antworten zum aeltesten noch laufenden und rissanfaelligsten Reaktor der Republik

    Energy Technology Data Exchange (ETDEWEB)

    Darge, Tobias

    2014-03-15

    The brochure discusses questions on the NPP Grafenrheinfeld. concerning the following issues: reactor type, operating company, nuclear fuel, licensing, radioactive waste management, susceptibility to damage, stress test results, critical arguments concerning the reactor pressure vessel steel and the containment, cracks in the primary circuit, safety in case of an aircraft crash, possibility of a severe accident, consequences of a severe accident, medical emergency plan, public information for an emergency case, shutdown at the end of 2015, necessity of a new power plant for energy security?.

  6. Prediksi Potensi Pencemaran Pengolahan Sampah dengan Metode Gasifikasi Fluidized Bed (Studi Kasus: TPA Benowo, Surabaya

    Directory of Open Access Journals (Sweden)

    Lailatun Nikmah

    2013-03-01

    Full Text Available Sistem pengelolaan sampah di TPA Benowo masih bersistem open dumping dan belum memperhatikan dampak pencemaran terhadap lingkungan. Kuantitas sampah yang masuk ke TPA sebesar 461.705,782 ton pada tahun 2012. Kuantitas sampah diperkirakan meningkat sebanding dengan pertumbuhan penduduk, sehingga dibutuhkan skenario pengolahan sampah yang ramah lingkungan. Skenario pengolahan sampah yang akan dikaji adalah gasifikasi  fluidized bed. Potensi pencemaran gasifikasi  fluidized bed akan dikaji menggunakan metode Life Cycle Assessment (LCA dengan software SimaPro versi 7.1. Satu ton sampah pada studi ini ditentukan sebagai satu fungsi unit. Data input Life Cycle Inventory (LCI meliputi jumlah sampah yang masuk ke reaktor gasifikasi dan energi yang dibutuhkan pada proses gasifikasi berdasarkan pendekatan efisiensi reaktor gasifikasi. Penentuan nilai Life Cycle Impact Assesment (LCIA meliputi Global Warming Potential (GWP dan asidifikasi menggunakan metode Environmental Product Declarations (EPD 2008. Besar dampak dinyatakan dalam faktor emisi yang ekivalen. Kesimpulan pada penelitian ini menunjukkan bahwa skenario pengolahan sampah dengan metode gasifikasi fluidized bed memberikan dampak GWP sebesar 1067,8 kg CO2/fu pada fase start-up dan 875 kg CO2/fu pada fase energy recovery serta asidifikasi sebesar 5,93 kg SO2/fu pada fase start-up dan 4,81 kg SO2/fu pada fase energy recovery.

  7. 2-(Trimethylsiloxyadamantane-2-carbonitrile

    Directory of Open Access Journals (Sweden)

    Richard Betz

    2009-01-01

    Full Text Available In the crystal structure of the title compound, C14H23NOSi, cyclic dimeric units are established by two very weak hydrogen bonds of the type C—H...N with an H...N distance which is only slightly shorter than the sum of the van der Waals radii of 2.75 Å. The graph-set descriptor on the unitary level is R22(14 for the cyclic dimer.

  8. (2,2-Dichlorovinylferrocene

    Directory of Open Access Journals (Sweden)

    2009-03-01

    Full Text Available The title compound, [Fe(C5H5(C7H5Cl2], represents a versatile building block for the preparation of π-conjugated redox-active compounds or polymetallic organometallic systems due to the presence of the electrochemically active ferrocenyl unit. It is therefore a potential starting material for the preperation of the corresponding alkyne. In the crystal, the alkenyl unit and the cyclopentadienide ring are almost parallel, with an angle between the best planes of only 10.6 (4°.

  9. [USA/FRG cooperation in gas-cooled reactor development]. Foreign trip report, June 24--July 2, 1988

    Energy Technology Data Exchange (ETDEWEB)

    Jones, Jr, J E

    1988-07-26

    Reviews were conducted at Kernforschungsanlage (KFA) Juelich of the US and Federal Republic of Germany (FRG) high-temperature gas-cooled reactor (HTGR) programs under the US/FRG Umbrella Agreement, with emphasis on those technology development areas where cooperation is ongoing and planned. Specific subprogram areas are safety; materials; fuels, fission products, and graphite; and Arbeitsgemeinschaft Versuchs-Reaktor (AVR). The purpose was to assess the status of the cooperation, reach agreement on any changes needed, and identify new areas of cooperation. Overall, the agreement has been both effective and beneficial. Ongoing activities complement and support US technology development plans. Discussions were held in the United Kingdom (UK) at the Risley Nuclear Power Development Laboratory regarding a potential graphite technology exchange program between the US Department of Energy and the UK Atomic Energy Authority. A draft agreement was reviewed and appeared to be satisfactory to both parties and ready for signature. A summary of potential areas of activity in the exchange had been prepared by US representatives and was discussed and found to be acceptable to UK representatives.

  10. 2-Tangles

    CERN Document Server

    Baez, J C; Baez, John C.; Langford, Laurel

    1997-01-01

    Just as links may be algebraically described as certain morphisms in the category of tangles, compact surfaces smoothly embedded in R^4 may be described as certain 2-morphisms in the 2-category of `2-tangles in 4 dimensions'. In this announcement we give a purely algebraic characterization of the 2-category of unframed unoriented 2-tangles in 4 dimensions as the `free semistrict braided monoidal 2-category with duals on one unframed self-dual object'. A forthcoming paper will contain a proof of this result using the movie moves of Carter, Rieger and Saito. We comment on how one might use this result to construct invariants of 2-tangles.

  11. 2-Methylpropan-2-aminium 2-(methoxycarbonylbenzoate

    Directory of Open Access Journals (Sweden)

    Jian Li

    2011-10-01

    Full Text Available In the title compound, C4H12N+·C9H7O4−, two C atoms and the N atom of the cation lie on a mirror plane, while all the atoms of the anion are disordered about a mirror plane. In the crystal, N—H...O hydrogen bonds link the components into chains along [010]. In the anion, the mean planes of the methoxycarbonyl and carboxylate groups form dihedral angles of 83.0 (2 and 83.2 (2°, respectively, with the aromatic ring.

  12. Ethyl 2-hydroxy-2-phenyl-2-(thiazol-2-ylacetate

    Directory of Open Access Journals (Sweden)

    Carl J. Mallia

    2015-05-01

    Full Text Available This short note describes the synthesis of the title compound through spontaneous aerobic oxidation of ethyl 2-phenyl-2-(thiazol-2-ylacetate. Due to the prevalence of such functional motifs in biologically active substances, we believe the oxidation encountered highlights an important degradation pathway worthy of note.

  13. N-(2-Chlorophenyl-2-methylbenzamide

    Directory of Open Access Journals (Sweden)

    B. Thimme Gowda

    2008-08-01

    Full Text Available In the structure of the title compound (N2CP2MBA, C14H12ClNO, the conformations of the N—H and C=O bonds are trans to each other. Furthermore, the conformation of the N—H bond is syn to the ortho-chloro group in the aniline ring and the C=O bond is syn to the ortho-methyl substituent in the benzoyl ring, similar to what is observed in 2-chloro-N-(2-chlorophenylbenzamide and 2-methyl-N-phenylbenzamide. The amide group makes almost the same dihedral angles of 41.2 (14 and 42.2 (13° with the aniline and benzoyl rings, respectively, while the dihedral angle between the benzoyl and aniline rings is only 7.4 (3°. The molecules in N2CP2MBA are packed into chains through N—H...O hydrogen bonds.

  14. sdf2xyz2sdf

    DEFF Research Database (Denmark)

    Tosco, Paolo; Balle, Thomas

    2011-01-01

    Description sdf2xyz2sdf is an open-source software aimed at converting SDF files into TINKER XYZ files (and viceversa) while performing automatic assignment of MMFF94 atom types, bond types and charges. The sdf2xyz2sdf package consists of two programs: •sdf2tinkerxyz •tinkerxyz2sdf sdf2xyz2sdf...... depends on OpenBabel for MMFF atom type and charge assignment. Since input to sdf2tinkerxyz is entered through standard input, and output from tinkerxyz2sdf is printed on standard output, it is possible to pipe output from OpenBabel into sdf2tinkerxyz, or to pipe tinkerxyz2sdf output into OpenBabel, so...... that virtually any format conversion from/to TINKER XYZ may be accomplished. Interestingly, also ionic heteroaromatic rings which could not be assigned proper charges by the original TINKER-MMFF code are correctly accounted for by sdf2xyz2sdf....

  15. Nicotinamide–2,2,2-trifluoroethanol (2/1

    Directory of Open Access Journals (Sweden)

    Julie Bardin

    2009-04-01

    Full Text Available The nicotinamide (NA molecules of the title compound, 2C6H6N2O·C2H3F3O, form centrosymmetric R22(8 hydrogen-bonded dimers via N—H...O contacts. The asymmetric unit contains two molecules of NA and one trifluoroethanol molecule disordered over two sites of equal occupancy. The packing consists of alternating layers of nicotinamide dimers and disordered 2,2,2-trifluoroethanol molecules stacking in the c-axis direction. Intramolecular C—H...O and intermolecular N—H...N, O—H...N, C—H...N, C—H...O and C—H...F interactions are present.

  16. Naturfag2

    DEFF Research Database (Denmark)

    Rasmussen, Henning Vinther

    Naturfag 2 er til social- og sundhedsassistentelever. Bogen indeholder den viden, der kræves under uddannelsen, og hvis man vil gå videre i uddannelsessystemet. Naturfag 2 er opbygget med øvelser i naturfaglige metoder som eksperimenter, modeller, beregninger, informationssøgning, it og formidling...

  17. Search for 2K(2\

    CERN Document Server

    Gavrilyuk, Yu M; Kazalov, V V; Kuzminov, V V; Panasenko, S I; Ratkevich, S S; Tekueva, D A; Yakimenko, S P

    2015-01-01

    The results of a search for two neutrino mode of double K-capture of Xe-124 using a large copper low-background proportional counter are presented. Data collected during 3220 hours of measurements with 58.6 g of $^{124}$Xe provides us to a new limit on the half-life of Xe-124 regarding 2K-capture at the level: T_{1/2} >= 2.0*10^{21} years at a 90\\% confidence level.

  18. SDF2XYZ2SDF

    DEFF Research Database (Denmark)

    Tosco, Paolo; Balle, Thomas; Shiri, Fereshteh

    2011-01-01

    An open-source tool capable of converting SD files (and virtually any other format through OpenBabel) into MMFF-typed XYZ coordinate files to be used with TINKER is described. SDF2XYZ2SDF allows including the power of TINKER molecular mechanics computations in automated cheminformatics workflows...

  19. D2 to D2

    Science.gov (United States)

    Ezhuthachan, Bobby; Mukhi, Sunil; Papageorgakis, Constantinos

    2008-07-01

    Starting from maximally supersymmetric (2+1)d Yang-Mills theory and using a duality transformation due to de Wit, Nicolai and Samtleben, we obtain the ghost-free Lorentzian 3-algebra theory that has recently been proposed to describe M2-branes. Our derivation does not invoke any properties of 3-algebras. Being derivable from SYM, the final theory is manifestly equivalent to it on-shell and should not be thought of as the IR limit that describes M2-branes, though it does have enhanced R-symmetry as well as superconformal symmetry off-shell.

  20. D2 to D2

    CERN Document Server

    Ezhuthachan, Bobby; Papageorgakis, Constantinos

    2008-01-01

    Starting from maximally supersymmetric (2+1)d Yang-Mills theory and using a duality transformation due to de Wit, Nicolai and Samtleben, we obtain the ghost-free Lorentzian 3-algebra theory that has recently been proposed to describe M2-branes. Our derivation does not invoke any properties of 3-algebras. Being derivable from SYM, the final theory is manifestly equivalent to it on-shell and should not be thought of as the IR limit that describes M2-branes, though it does have enhanced R-symmetry as well as superconformal symmetry off-shell.

  1. Search for 2K(2\

    CERN Document Server

    Gavriljuk, Ju M; Kazalov, V V; Kuzminov, V V; Panasenko, S I; Ratkevich, S S; Zhantudueva, D A; Yakimenko, S P

    2011-01-01

    Results of a search for Kr-78 double K-capture at the second stage of the experiment with high-pressure copper proportional counters are presented. The method is based on comparison of spectra measured with natural and enriched krypton. The total exposure of the low background measurements is for Kr-78 152 g*yr and for Kr-nat 106 g*yr. An excess of events was observed in the analysis of Kr-78 selected data collected during 2008-2010 years. This excess could correspond to a double K-capture of Kr-78 with the half-life of T_{1/2}(2K,2\

  2. LEADER 2

    DEFF Research Database (Denmark)

    Daniels, G H; Hegedüs, L; Marso, S P

    2015-01-01

    AIMS: To report preliminary data on baseline serum calcitonin concentrations and associated clinical characteristics in a global population with type 2 diabetes before liraglutide or placebo randomization. METHODS: The ongoing LEADER trial has enrolled 9340 people with type 2 diabetes and at high...... committee of thyroid experts will oversee calcitonin monitoring throughout the trial and will review all calcitonin concentrations ≥20 ng/l. RESULTS: The mean age of participants was 64.3 ± 7.2 years, 64.3% were men, and mean the body mass index was 32.5 ± 6.3 kg/m(2) . The median (interquartile range...... with higher serum calcitonin concentrations that were statistically significant. A 20 ml/min/1.73 m(2) decrease in estimated GFR (eGFR) was associated with a 14% increase in serum calcitonin in women and an 11% increase in men. CONCLUSIONS: In the LEADER population, the prevalence of elevated serum calcitonin...

  3. Meddelelser 2

    DEFF Research Database (Denmark)

    Jacobsen, Moust; Jørgensen, Mogens B.; Lund, Willy

    Meddelelser udsendes med det formål at orientere om de aktiviteter, der foregår ved Aalborg Universitetscenters funderingslaboratorium. Det første nummer udsendtes i 1980, men det er stadig vort håb, at der set over en længere årrrække vil blive udsendt et nyt nummer hvert år. Nærværerende »Medde...... »Meddelelser 2« indeholder 2 undersøgelser, som Laboratoriet for Fundering har udført for Aalborg kommune i samarbejde med Geodan....

  4. ATF2 Proposal v. 2

    CERN Document Server

    Grishanov, B I; Alabau-Pons, M; Angal-Kalinin, Deepa; Appleby, R; Araki, S; Bailey, I; Bambade, P; Bane, Karl Leopold Freitag; Barlow, R; Blair, G A; Bolzon, B; Boorman, G; Bosco, A; Brachmann, A; Braun, Hans Heinrich; Burrows, P N; Carter, J; Choi, J; Christian, Glenn B; Clarke, C; Dabiri-Khah, A; Dadoun, O; Danagulyan, S; Delerue, N; Dixit, S; Driouichi, C; Elsen E; Gao, J; Geffroy, N; Gronberg, J; Hartin, Anthony F; Hayano, H; Higashi, Y; Himel, T; Honda, Y; Howell, D; Huang, J Y; Iwashita, Y; Jenner, L; Jones, J; Jones, R; Jérémie, A; Kalinin, A; Kanazawa, K; Kang, H S; Karyotakis, Yu; Kim, E S; Kim, S; Komamiya, S; Kourevlev, German Yu; Kubo, K; Kumada, M; Kume, T; Kuriki, M; Kuroda, S; Liu, W; Logatchev, P V; Lyapin, A; Malton, S; Markiewicz, T W; Masuzawa, M; Mihara, T; Miller, D J; Molloy, S; Mtingwa, S; Naito, T; Nan-Phinney, Y; Napoly, O; Nelson, J; Okugi, T; Payet, J; Pei, G X; Pivi, M T F; Podgorny, F; Price, M; Raubenheimer, T O; Reichold, A; Ross, M; Sanuki, T; Schulte, Daniel; Seryi, R A; Solyak, N; Soo Ko In; Spencer, C M; Suehara, T; Sugahara, R; Takahashi, T; Takashi-Boogert, S; Tauchi, T; Telnov, Valery I; Tenenbaum, P G; Terunuma, N; Toge, N; Torrence, E; Urakawa, J; Urner, D; Vogel, V; Walker, N; Wang, J Q; Wendt, M; White, G; Wing, M; Wolski, A; Woodley, M; Yamaoka, H; Yokoya, K; Zimmermann, Frank

    2006-01-01

    For achieving the high luminosity required at the International Linear Collider (ILC), it is critical to focus the beams to nanometer size with the ILC Beam Delivery System (BDS), and to maintain the beam collision with a nanometer-scale stability. To establish the technologies associated with this ultra-high precision beam handling, it has been proposed to implement an ILC-like final focus optics in an extension of the existing extraction beamline of ATF at KEK. The ATF is considered to be the best platform for this exercise, since it provides an adequate ultra-low emittance electron beam in a manner dedicated to the development of ILC. The two major goals for this facility, called ATF2, are : (A) Achievement of a 37 nm beam size, and (B) control of beam position down to 2 nm level. The scientific justification for the ATF2 project and its technical design have been described in Volume 1 of the ATF2 Proposal [1]. We present here Volume 2 of the ATF2 Proposal, in which we present specifics of the construction...

  5. ggplot2

    CERN Document Server

    Wickham, Hadley

    2009-01-01

    Describes ggplot2, a data visualization package for R that uses the insights from Leland Wilkison's "Grammar of Graphics" to create a powerful and flexible system for creating data graphics. This book is suitable for those who have struggled with displaying their data in an informative and attractive way

  6. 1-[4-(2-Aminoanilinophenyl]-2,2,2-trifluoroethanone

    Directory of Open Access Journals (Sweden)

    Angelika Dorn

    2010-05-01

    Full Text Available In the title compound, C14H11F3N2O, the two aromatic rings are oriented at a dihedral angle of 70.84 (8°. The crystal structure displays intermolecular N—H...O and N—H...F interactions.

  7. Kinetics of HO2 + HO2 -> H2O2 + O2: Implications for Stratospheric H2O2

    Science.gov (United States)

    Christensen, L. E.; Okumura, M.; Sander, S. P.; Salawitch, R. J.; Toon, G. C.; Sen, B.; Blavier, J.-F.; Jucks, K. W.

    2002-05-01

    The reaction HO2 + HO2 -> H2O2 + O2refid="df01" type="formula">(1) has been studied at 100 Torr and 222 K to 295 K. Experiments employing photolysis of Cl2/CH3OH/O2/N2 and F2/H2/O2/N2 gas mixtures to produce HO2 confirmed that methanol enhanced the observed reaction rate. At 100 Torr, zero methanol, k1 = (8.8 +/- 0.9) 10-13 × exp[(210 +/- 26)/T] cm3 molecule-1 s-1 (2σ uncertainties), which agrees with current recommendations at 295 K but is nearly 2 times slower at 231 K. The general expression for k1, which includes the dependence on bath gas density, is k1 = (1.5 +/- 0.2) × 10-12 × exp[(19 +/- 31)/T] + 1.7 × 10-33 × [M] × exp[1000/T], where the second term is taken from the JPL00-3 recommendation. The revised rate largely accounts for a discrepancy between modeled and measured [H2O2] in the lower to middle stratosphere.

  8. ANALISA PENGARUH PERIODIK CHARGING DAN DISCHARGING PADA WAKTU CHARGING DAN DISCHARGING DARI METAL HYDRIDE REACTOR (MHR

    Directory of Open Access Journals (Sweden)

    Taurista Perdana Syawitri

    2015-01-01

    Full Text Available Perpindahan panas merupakan faktor penting yang mempengaruhi kinerja tangki penyimpanan hydrogen dalam bentuk metal hydride. Penelitian sebelumnya menyimpulkan bahwa penambahan sejumlah kecil metal foam pada interior metal hydride reactor (MHR merupakan cara yang efektif untuk meningkatkan perpindahan panas pada reaktor, sehingga mengurangi waktu charging. Namun, proses charging dan discharging MHR dilakukan secara terpisah dalam studi ini. Oleh karena itu, penelitian ini menyimulasikan model 2-D axisymmetric menggunakan software COMSOL untuk menginvestigasi pengaruh dari periodik charging dan discharging dari MHR yang mengandung metal foam dengan fraksi volume tertentu. Hasil simulasi menunjukkan bahwa model saat ini mempunyai hasil yang sesuai dengan hasil yang ditunjukkan di dalam literatur. Selain itu, ditemukan bahwa terdapat nilai optimum dari fraksi volume metal foam di setiap proses charging dan proses discharging yang memberikan waktu charging dan discharging lebih pendek.

  9. (E-2-(2-Nitroethenylfuran

    Directory of Open Access Journals (Sweden)

    Pedro Valerga

    2009-08-01

    Full Text Available The title compound, C6H5NO3, was synthesized via condensation of furfural with nitromethane in the presence of isobutylamine. The compound crystallizes exclusively as the E isomer. The angle between the mean planes of the furan ring and the nitroalkenyl group is 1.3 (2°.

  10. Main: O2F2BE2S1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available coxin, the maize b-32 genes and the AP-1 pseudopalindrome; O2; opaque-2; be2S1; seed; Brazil nut tree (Bertholletia excelsa) GCCACCTCAT ... ...O2F2BE2S1 S000163 17-May-1998 (last modified) kehi opaque-2 recognition site F2 in Bertholletia excelsa (Bra...zil nut tree) 2S storage protein gene (be2S1); O2 protein binds to F1, F2 and F3 se

  11. Neurofibromatosis 2

    Directory of Open Access Journals (Sweden)

    Abhijit M Patil

    2015-01-01

    Full Text Available Neurofibromatosis 2 is a rare autosomal dominant neurocutaneous disorder classically characterized by bilateral acoustic schwannomas. Multiple other central, as well as peripheral central nervous system neoplasms as meningiomas and ependymomas, are also associated. We present here a case of 18-year-old female with bilateral hearing loss. Magnetic resonance imaging (MRI of the brain and spine showed multiple intracranial and intra-spinal neoplasms. Bilateral large acoustic and other cranial nerve schwannomas, along with multiple spinal neurofibromas were present. Based on these MRI findings a diagnosis of neurofibromatosis was made.

  12. 2-(2-Isopropylphenoxyacetic acid

    Directory of Open Access Journals (Sweden)

    Yasser Hussein Issa Mohammed

    2016-10-01

    Full Text Available In the title compound, C11H14O3, the pendant –OCH2COOH chain is in an extended conformation and almost lies in the plane of the benzene ring, as indicated by the dihedral angle of 2.61 (5°. In the crystal, molecules are linked by a pair of O—H...O hydrogen bonds, forming classical carboxylic acid inversion dimers, with an R22(8 loop. The crystal structure of this compound have been reported previously [Smith et al. (1992. Aust. J. Chem. 45, 1101–1108], however, in that report, the unit-cell dimensions differ significantly from those of the title structure and the carboxyl H atom was disordered within a cyclic hydrogen-bonded dimer.

  13. DESAIN KONSEP TANGKI PENAMPUNG BAHAN BAKAR PASSIVE COMPACT MOLTEN SALT REACTOR

    Directory of Open Access Journals (Sweden)

    A. Hadiwinata

    2015-04-01

    Full Text Available Passive Compact Molten Salt Reactor (PCMSR merupakan pengembangan dari reaktor MSR. Desain reaktor PCMSR membutuhkan tempat khusus penampung sementara bahan bakar pada saat terjadi insiden, misalnya kecelakaan yang menyebabkan peningkatan suhu bahan bakar. Tangki penampung bahan bakar tersusun dari 3 bagian yang saling terhubung yaitu bagian penampung cairan bahan bakar, cerobong (chimney, dan penukar kalor. Dalam penelitian ini, tangki dimodelkan secara lump dan dilakukan variasi daya awal reaktor dan ketinggian cerobong. Syarat batas model ditetapkan suhu bahan bakar maksimum 1400 °C, yang didasarkan pada titik didih larutan garam LiF-BeF2-ThF4-UF4. Analisis dilakukan dengan cara menghitung rugi tekanan total dan transfer kalor untuk variasi daya awal antara 1800-3000 MWth dan ketinggian cerobong antara 1-10 m. Hasil penelitian menunjukan semakin besar daya reaktor, maka tinggi tangki penampung bahan bakar dan tinggi alat penukar kalor yang dibutuhkan akan semakin besar, tejadi kenaikan suhu fluida pendingin dan suhu udara pendingin, dan menyebabkan kenaikan laju aliran masa fluida pendingin, sedangkan laju aliran masa udara menurun. Peningkatan ketinggian cerobong menyebabkan ketinggian tangki penampung bahan bakar dan ketinggian alat penukar kalor semakin menurun, penurunan suhu fluida pendingin, tetapi suhu udara meningkat, dan menyebabkan peningkatan laju aliran masa fluida pendingin, tetapi laju aliran masa udara akan semakin menurun. Kata kunci: PCMSR, cerobong, alat penukar kalor, variasi daya.   The Passsive Compact Molten Salat Reactor (PCMSR reactor is developed from MSR reactor. The PCMSR reactor design requires special place to temporarily storage for reactor fuel when incident occurs, such as when there is an accident which caused the temperature of the fuel increases. The tank consist of three interconnected parts, the reservoir liquid fuel, chimney, and the heat exchanger. In this research, the tank system is modeled based on

  14. NEUTRONICS ANALYSIS ON MINI TEST FUEL IN THE RSG-GAS CORE

    Directory of Open Access Journals (Sweden)

    Tukiran Surbakti

    2016-03-01

    Full Text Available Abstract NEUTRONICS ANALYSIS ON MINI TEST FUEL IN THE RSG-GAS CORE. Research of UMo fuel for research reactor has been developing  right now. The fuel of  research reactor used is uranium low enrichment with high density. For supporting the development of fuel, an assessment of mini fuel in the RSG-GAS core was performed. The mini fuel are U7Mo-Al and U6Zr-Al with densitis of 7.0gU/cc and 5.2 gU/cc, respectively. The size of both fuel are the same namely 630x70.75x1.30 mm were inserted to the 3 plates of dummy fuel. Before being irradiated in the core, a calculation for safety analysis  from neutronics and thermohydrolics aspects were required. However, in this paper will discuss safety analysis of the U7Mo-Al and U6Zr-Al mini fuels from neutronic point of view.  The calculation was done using WIMSD-5B and Batan-3DIFF code. The result showed that both of the mini fuels could be irradiated in the RSG-GAS core with burn up less than 70 % within 12 cycles of operation without over limiting the safety margin. Power density of U7Mo-Al mini fuel bigger than U6Zr-Al fuel.   Key words: mini fuel, neutronics analysis, reactor core, safety analysis   Abstrak ANALISIS NEUTRONIK ELEMEN BAKAR UJI MINI DI TERAS RSG-GAS. Penelitian tentang bahan bakar UMo untuk reaktor riset terus berkembang saat ini. Bahan bakar reaktor riset yang digunakan adalah uranium pengkayaan rendah namun densitas tinggi.  Untuk mendukung pengembangan bahan bakar dilakukan uji elemen bakar mini di teras reakror RSG-GAS dengan tujuan menentukan jumlah siklus di dalam teras sehingga tercapai fraksi bakar maksimum. Bahan bakar yang diuji adalah U7Mo-Al dengan densitas 7,0 gU/cc dan U6Zr-Al densitas 5,2 gU/cc. Ukuran kedua bahan bakar uji tersebut adalah sama 630x70,75x1,30 mm dimasukkan masing masing kedalam 3 pelat dummy bahan bakar. Sebelum diiradiasi ke dalam teras reaktor maka perlu dilakukan perhitungan keselamatan baik secara neutronik maupun termohidrolik. Dalam makalah ini

  15. Session 2

    Science.gov (United States)

    2014-01-01

    3.1 Systems Analysis of Mitochondrial Pathogenesis Vamsi Mootha Harvard Medical School, Boston, MA, USA Mitochondrial dysfunction underlies a wide range of human diseases, including rare, monogenic diseases, common diseases, as well as the aging process itself. How cells cope with mitochondrial dysfunction is not fully understood. We performed complementary RNA, protein, and metabolite profiling of a cellular model of inducible mitochondrial dysfunction. In this talk I will describe these profiling results, as well as an adaptive pathway that they point to. The study provides insight into the pathogenesis of mitochondrial disorders 3.2 PTMomics – Towards Comprehensive Quantitative Analysis of Multiple PTMs from Biological Material Martin R. Larsen,1, Honggang Huang1, Cristina Alarcón2, Alistair V.G. Edwards1, Christopher Rhodes2, Giuseppe Palmisano3 1University of Southern Denmark, Odense, Denmark; 2University of Chicago, IL, USA; 3University of Sao Paulo, Brazil Post- or co-translational modifications (PTMs) of proteins refer to the reversible or irreversible addition of chemical modifying groups to proteins after or during their synthesis. Proteins have often multiple PTMs decorating the primary amino acid sequence and often these affect each other to produce a given function or activity of a protein. PTMomics can be defined as the global study of PTMs and is a relatively new research area aiming at understanding the function and consequences of PTMs of proteins in a cell. The success of PTMomics relies on the ability to efficiently purify the relevant PTMs and subsequently identify and characterize the nature and function of the PTM using for example mass spectrometric analysis. Previously, we have developed a number of successful methods for enrichment of phosphorylated peptides (1–3), sialylated N-linked glycopeptides (4, 5) and O-GLcNAcylated peptides (6) and we have combined some of these methods into strategies for simultaneous enrichment of several

  16. #CERNJOBSEnigma2

    CERN Multimedia

    Stephanie Hills

    2015-01-01

    Curiosity is an essential attribute for anyone who works at CERN, and the HR recruitment team is about to pique the interest of its social media followers with the release of its second Enigma challenge, #CERNJOBSEnigma2. Starting on 29 May, daily clues will be revealed and social media followers can work together to solve the enigma before the answer is revealed on 5 June.   The first Enigma challenge in 2013 was designed to build interest and excitement in the CERN Jobs social media presence ahead of the launch of a radical new web site. One of the surprising aspects of the first Enigma challenge was how collaboratively social media followers worked together to solve the clues. One of those followers was Dom Nicosia. At the time, Dom was working in the UK as a medical linear accelerator technician in the National Health Service. #CERNJOBSEnigma was never intended to be a direct recruitment tool, but it sparked Dom’s interest in CERN and he is now working as a technician in the Be...

  17. N-(2-Nitrophenylthiophene-2-carboxamide

    Directory of Open Access Journals (Sweden)

    Rodolfo Moreno-Fuquen

    2014-05-01

    Full Text Available The title compound, C11H8N2O3S, shows two molecules per asymmetric unit, with the dihedral angles between the benzene and thiophene rings of 13.53 (6 and 8.50 (5° being a notable difference between them. An intramolecular N—H...O hydrogen-bond in each molecule generates an S(6 ring motif. The crystal packing shows no classical hydrogen bonds with the molecules being packed to form weak C—H...O and C—H...S interactions leading to R22(9 and R44(25 rings which are edge-shared, giving layers parallel to (010.

  18. A novel synthetic route for 2-[2-(2,2,2-trifluoroethoxy)phenoxy] ethanamine

    Institute of Scientific and Technical Information of China (English)

    Xiao Chuan Luo; Guo Hua Chen; Hui Bin Zhang; Wen Long Huang

    2008-01-01

    2-[2-(2,2,2-Trifluoroethoxy)phenoxy]ethanamine is the key intermediate of Silodosin, the α1-adrenoceptor antagonist for thetreatment of benign prostatic hyperplasia. In order to obtain this intermediate, we developed a novel synthetic route by utilizing 2-nitrochlorobenzene as the starting material via O-alkylation, reduction, diazotization, acidolysis, etherification, condensation andhydrazinolysis. The highlight of this method lies on its convenience and economy in accessing this intermediate.

  19. INVESTIGATION ON THERMAL-FLOW CHARACTERISTICS OF HTGR CORE USING THERMIX-KONVEK MODULE AND VSOP'94 CODE

    Directory of Open Access Journals (Sweden)

    Sudarmono Sudarmono

    2015-03-01

      Kegagalan sistem pembuangan panas pada reaktor berpendingin air jenis PWR, Three Mile Islands dan reaktor BWR Fukushima Daiichi, menyebabkan masyarakat nuklir mulai memikirkan penggunaan reaktor pembangkit daya jenis temperatur tinggi berpendingin gas (HTGR. Bidang Fisika dan Teknologi Reaktor di Pusat Teknologi Reaktor dan Keselamatan Nuklir (PTRKN mempunyai tugas melaksanakan kegiatan litbang desain konseptual reaktor kogenerasi dengan tingkat daya menengah yang berpendingin gas helium dengan daya 200 MWt. Desain HTGR200K merupakan salah satu sistem pembangkit energi yang memiliki efisiensi energi paling besar, dan tingkat keselamatan inheren yang tinggi dan bersih. Komposisi geometri dan struktur teras didesain agar dapat menghasilkan keluaran pendingin gas helium bertemperatur 950 0C sehingga dapat digunakan untuk produksi hidrogen dan atau unit industri proses lainnya secara kogeneratif. Luaran gas helium bertemperatur sangat tinggi ini akan menimbulkan tegangan termal pada bola bahan bakar yang mengancam integritas sistem pengungkungan produk fisi di dalamnya. Oleh karena itu perlu dilakukan evaluasi karakteristika termal flow untuk menentukan distribusi temperatur bahan bakar bola dan outlet temperatur pendingin gas helium teras HTGR. Hal ini dilakukan dengan menggunakan modul Thermix-Konvek yang terintegrasi dalam program VSOP’94. Geometri teras HTGR dikerjakan dalam modul BIRGIT untuk model teras 2-D (R-Z dengan 5 kanal aliran pebble dalam teras aktif arah radial. Hasil evaluasi menunjukkan bahwa nilai tertinggi dan terendah temperatur yang terdapat pada teras   adalah sebesar 999.3 °C dan 886,5 °C. Demikian pula hasil temperatur tertinggi bahan bakar TRISO dan bahan bakar pebble di dalam teras, yaitu diperoleh sebesar  1510,20°C yang terletak pada lapisan bahan bakar inti UO2, di posisi z= 335.51 cm dan  r=0 cm. Analysis di lakukan pada laju massa aliran pendingin, tekanan dan daya masing-masing sebesar 120 kg/s, 7 Mpa dan 200MWth. Hasil

  20. 2~(1/2)/2是分数吗?

    Institute of Scientific and Technical Information of China (English)

    李厚明

    2003-01-01

    同学们遇到一道题: 2~(1/2)/2________(填是或不是)分数。同学们争论不休,有的认为2~(1/2)/2是分数,有的认为2~(1/2)/2不是分数,各执一辞,意见不能统一。那么,2~(1/2)/2究竟是不是分数呢? 下面从两方面加以辨析。

  1. Heat utilization (2); Netsuriyo (2)

    Energy Technology Data Exchange (ETDEWEB)

    Akizawa, Jun [Tokyo University of Agriculture and Tecnology, Tokyo (Japan)

    1999-01-31

    (102) The application of the carbon dioxide separation and collection system using CPC to the thermal power plant. (103) The effect of the scattered light on collection of heat of solar pond. (104) The development of the Basin- multiple-effect compound type solar heat distiller. (Production and performance test of the small plant.) (105) On the plan of the new-model solar heat engine. (106) The performance prediction of solar power system using Stirling engine. (Part 2 The case in which the divided condenser was used.) (107) The trial manufacture of the sun cooker. It was announced and was made of 6 from various regions in this session on the heat utilization. On the multiple-effect compound type solar heat distiller, the comment that the feasibility could be expected from the simple structure was made. And, the question on system operation of allocation of the distillation quantity, etc. was actively made. On 2 of plan of the new-model solar heat engine and trial manufacture of the sun cooker, it was not possible that the publicator came for the aged to Okinawa, and instead, it became an announcement by tape and OHP blown in self. Though it was the form which there was no in the convention, it could be heard of that it is major field. It was thought, because there was some an announcement on the Stirling engine in the this session, place be able to. And, photograph and experimental result of the prototype are also included for the announcement of the sun cooker and want to desire the opportunities which hear the direct announcement. It wants to be thankful for hardship Mr.Naito the Science and Technology Agency National Aerospace Laboratory that it carried tape and OHP and assisted the announcement. The biomass. (108) The measurement approach of the environment resuscitation acceleration effect. (109) The basic research on the biogas storage by the clathration. The behavior of the carbon dioxide in the clathrate generation. (111) The solar thermal application

  2. Ethyl (2E-2-(hydroxyiminopropanoate

    Directory of Open Access Journals (Sweden)

    Igor Vasyl Nikolayenko

    2010-04-01

    Full Text Available The molecule of the title compound, C5H9NO3, is essentially planar [the maximum deviation for a non-H atom from the mean plane is 0.021 (3 Å] due to the π-conjugation of the hydroxyimino and carbonyl groups, which are trans to each other; ab initio calculations in vacuo at the DFT (B3LYP/6–311G**++ level of theory confirmed that E conformer is indeed the lowest in energy. The packing in crystal structure is influenced by strong intermolecular O—H...N hydrogen-bonding interactions between oxime groups and also by π-stacking of the molecules due to the carbonyl and oxime group orbital overlap [interplanar distance between adjacent molecules = 3.143 (4 Å]. Jointly, these factors afford infinite 6.32 Å thick molecular sheets, where the plane of each molecule is perpendicular to the plane of the sheet. Seen from above, the molecules within the sheet are arranged in a herringbone pattern. Such sheets form a stack due to weak van der Waals interactions; the gap between adjacent sheets is 2.07 Å.

  3. 2-minute Gridded Global Relief Data (ETOPO2) v2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Two-minute gridded global relief for both ocean and land areas are available in the ETOPO2v2 (2006) database. ETOPO2v2 replaced ETOPO2 (2001). The historic 2-minute...

  4. Adamkus : EU might be willing to negotiate on postponing Ignalina reactor closure

    Index Scriptorium Estoniae

    2008-01-01

    President Valdas Adamkus teatas võimalusest, et EL alustab arutelu Ignalina tuumaelektrijaama sulgemise edasilükkamisest. Uue jaama valmimise aeg pole teada ning praegune reaktor on tänu rootslaste abile turvaline

  5. Põhja-Korea lubas taas jätta tuumaplaanid / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2007-01-01

    Pekingis toimunud kuuepoolsete desarmeerimiskõneluste tulemusena on Põhja-Korea nõus andma ülevaate riigi tuumarajatistest ning alustama nende likvideerimist. 14. juulil suleti Yongbyoni tuumakeskuse reaktor. Lisa: Tuumavaidlus

  6. Main: BOX2PSGS2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available BOX2PSGS2 S000204 17-May-1998 (last modified) kehi Box 2 in glutamine synthetase (GS...2) gene in pea (P.s.); Repeated in tandem with a partial palindrome located between the repeats; Located at ca. -300 of pea GS...2; Box 2; glutamine synthetase; GS2; pea (Pisum sativum); TCTAAGCAAAG ...

  7. Main: 2CI2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 2CI2 大麦 Barley Hordeum vulgare l. Subtilisin-Chymotrypsin Inhibitor-2a Hordeum Vulg...DB; 1YPC; X-ray; I=20-83.|PDB; 2CI2; X-ray; I=1-83.|PDB; 2SNI; X-ray; I=1-83.|PDB; 3CI2...ecular weight: 9250 Da SSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQVPRVG barley_2CI2.jpg ...

  8. PENGARUH NILAI BAKAR TERHADAP INTEGRITAS KELONGSONG ELEMEN BAKAR TRIGA 2000

    OpenAIRE

    K.A. Sudjatmi

    2015-01-01

    Bentuk elemen bakar reaktor TRIGA Bandung adalah silinder padat yang merupakan campuran homogen paduan uranium dan zirkonium hidrida. Pada saat reaktor beroperasi, suhu elemen bakar akan bertambah, akibatnya akan menaikan tekanan gas-gas yang ada di dalam kelongsong elemen bakar. Tekanan gas yang timbul dalam kelongsong elemen bakar merupakan penjumlahan tiga komponen tekanan yaitu tekanan akibat udara yang terperangkap antara kelongsong dengan bahan bakar, tekanan oleh gas hasil fisi yang te...

  9. Modifikasi Mekanisme Koufopanos pada Kinetika Reaksi Pirolisis Ampas Tebu (Bagasse)

    OpenAIRE

    Erawati, Emi; Sediawan, Wahyudi Budi; Mulyono, Panut

    2014-01-01

    Ampas tebu merupakan produk samping dari ekstraksi gula. Ampas tebu yang dihasilkan di pabrik gula sekitar 13% dari tebu yang digiling. Tujuan penelitian ini adalah menentukan energi aktivasi dan pre-exponential factor pada persamaan kinetika reaksi pirolisis ampas tebu. Pirolisis dilakukan dalam reaktor yang terbuat dari pipa besi jenis 5737 dengan diameter 7,62 cm dan panjang 37 cm. Reaktor ini dimasukkan ke dalam furnace yang berdiameter 15,24 cm dan panjang 40 cm. Seratus lima puluh...

  10. Enatioselective[2+2+2] Cycloaddition as A Synthetic Tool

    Institute of Scientific and Technical Information of China (English)

    T.Shibata; S.Yoshida; M.Otsuka; Y.Arai; K.Endo

    2007-01-01

    1 Results Transition metal-catalyzed [2+2+2] cycloaddition is one of the most efficient protocols for the construction of six-membered ring system.Our group has comprehensively studied various types of highly enantioselective [2+2+2] cycloaddition for the synthesis of chiral cycloadducts; we already reported an iridium-catalyzed intermolecular [2+2+2] cycloaddition between α,ω-diynes,having various tethers and substituents on the alkyne termini,and monoalkynes,possessing oxygen or/and nitrogen functiona...

  11. Main: IDE2HVIDS2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available IDE2HVIDS2 S000464 24-April-2005 (last modified) kehi IDE2 (iron-deficiency-respons...ive element 2) found at -262/-236 of barley IDS2 (iron deficiency specific clone 2) gene promoter; See also S000463; iron; root; Hordeum vulgare (barley) TTGAACGGCAAGTTTCACGCTGTCACT ...

  12. Efek Durasi Pencahayaan Pada Sistem HRAR Untuk Menurunkan Kandungan Minyak Solar Dalam Air Limbah

    Directory of Open Access Journals (Sweden)

    Dian Puspitasari

    2014-09-01

    Full Text Available Kandungan minyak di dalam air limbah industri perminyakan umumnya bersifat toksik terhadap mikroorganisme dan mengganggu proses pengolahan secara biologis. Sistem HRAR diperkirakan dapat mengatasi hambatan tersebut melalui proses fotosintesis untuk menghasilkan oksigen yang dibutuhkan mikroorganisme dalam mendegradasi senyawa hidrokarbon. Penelitian ini bertujuan mengkaji pengaruh perpanjangan waktu pencahayaan pada kemampuan HRAR dalam menurunkan kandungan minyak di dalam limbah. Variabel yang digunakan pada penelitian ini adalah variasi durasi pencahayaan dan variasi penambahan volume minyak solar yang ditambahkan ke dalam reaktor. Variasi durasi pencahayaan yang digunakan adalah pencahayaan selama 12 jam dan pencahayaan selama 24 jam. Sedangkan penambahan volume minyak solar ke dalam masing-masing reaktor adalah sebesar 346 ppm, 519 ppm dan 692 ppm. Hasil yang didapatkan dari penelitian ini adalah durasi pencahayaan selama 12 jam memiliki efek yang lebih baik terhadap penurunan konsentrasi minyak dibandingkan pencahayaan selama 24 jam. Hal ini dapat terlihat dari baiknya pertumbuhan alga dan bakteri di dalam reaktor serta tingginya penurunan konsentrasi minyak solar di dalamnya. Penurunan konsentrasi minyak solar terbaik terdapat pada reaktor dengan penambahan minyak solar sebesar 346 ppm. Pada reaktor dengan durasi pencahayaan selama 12 jam terjadi penurunan konsentrasi minyak sebesar 78,4%. Sedangkan penurunan kandungan minyak solar pada reaktor dengan durasi pencahayaan selama 24 jam adalah sebesar 73,9%.

  13. T2-Filtered T2 - T2 Exchange NMR

    Science.gov (United States)

    d'Eurydice, Marcel Nogueira; Montrazi, Elton Tadeu; Fortulan, Carlos Alberto; Bonagamba, Tito José

    2016-05-01

    This work introduces an alternative way to perform the T2 - T2 Exchange NMR experiment. Rather than varying the number of π pulses in the first CPMG cycle of the T2 - T2 Exchange NMR pulse sequence, as used to obtain the 2D correlation maps, it is fixed and small enough to act as a short T2-filter. By varying the storage time, a set of 1D measurements of T2 distributions can be obtained to reveal the effects of the migration dynamics combined with relaxation effects. This significantly reduces the required time to perform the experiment, allowing a more in-depth study of exchange dynamics and relaxation processes with improved signal-to-noise ratio. These aspects stand as basis of this novel experiment, T2-Filtered T2 - T2 Exchange NMR or simply T2 F-TREx.

  14. 2-[2-(2,6-Dichlorobenzyloxy-2-phenylethyl]-2H-indazole

    Directory of Open Access Journals (Sweden)

    Özden Özel Güven

    2014-04-01

    Full Text Available In the title compound, C22H18Cl2N2O, the indazole ring system is approximately planar [maximum deviation = 0.031 (2 Å], its mean plane is oriented at 3.17 (4 and 19.34 (4° with respect to the phenyl and benzene rings. In the crystal, weak C—H...π interactions link the molecules into supramolecular chains running along the b-axis direction.

  15. Cy2NH2NO3SnBu2Cl2•H2O AND Cy2NH2NO3SnPh2Cl22H2O: SYNTHESIS AND INFRARED STUDY

    Directory of Open Access Journals (Sweden)

    ABDOU MBAYE

    2014-11-01

    Full Text Available On allowing Cy2NH2NO3 to react with SnBu2Cl2 and SnPh2Cl2, the two studied adducts were obtained. While considering the complex-anions [SnBu2Cl2NO3.H2O]- and [NO3.SnPh2Cl2 H2O]-, discrete structures were suggested with monocoordinating nitrate and octahedral environment around the tin centre. When the cation is involved through N-H----O or N-H----Cl hydrogen bonds, suppramolecular architectures are obtained.

  16. Strain engineering of WS2, WSe2, and WTe2

    KAUST Repository

    Amin, Bin

    2014-01-01

    We perform first-principles calculations to investigate the structural, electronic, and vibrational properties of WS2, WSe2, and WTe2 monolayers, taking into account the strong spin orbit coupling. A transition from a direct to an indirect band gap is achieved for compressive strain of 1% for WS2, 1.5% for WSe2, and 2% for WTe 2, while the nature of the band gap remains direct in the case of tensile strain. The size of the band gap passes through a maximum under compressive strain and decreases monotonically under tensile strain. A strong spin splitting is found for the valence band in all three compounds, which is further enhanced by tensile strain. The mobility of the electrons grows along the series WS2 < WSe2 < WTe2. This journal is © the Partner Organisations 2014.

  17. Na2MoO2As2O7

    Directory of Open Access Journals (Sweden)

    Raja Jouini

    2012-12-01

    Full Text Available Disodium molybdenum dioxide diarsenate, Na2MoO2As2O7, has been synthesized by a solid-state reaction. The structure is built up from MoAs2O12 linear units sharing corners to form a three-dimensional framework containing tunnels running along the a-axis direction in which the Na+ cations are located. In this framework, the AsV atoms are tetrahedrally coordinated and form an As2O7 group. The MoVI atom is displaced from the center of an octahedron of O atoms. Two Na+ cations are disordered about inversion centres. Structural relationships between different compounds: A2MoO2As2O7 (A = K, Rb, AMOP2O7 (A = Na, K, Rb; M = Mo, Nb and MoP2O7 are discussed.

  18. Superconductivity in 2-2-3 system Y2Ba2Cu2O(8+delta)

    Science.gov (United States)

    Joshi, H. H.; Baldha, G. J.; Jotania, R. B.; Joshi, S. M.; Mohan, H.; Pandya, P. B.; Pandya, H. N.; Kulkarni, R. G.

    1991-01-01

    Researchers synthesized a new high T(sub c) 2-2-3 superconductor Y2Ba2Cu3O(8+delta) by a special preparation technique and characterized it by ac-susceptibility measurements. Diamagnetism and Meissner effect sets in at low fields and superconducting transition onsets at 90 K. The systematic investigation of the real and imaginary components of ac-susceptibility as a function of temperature and applied ac magnetic field reveals that the magnetic behavior is that of a granular type superconductor.

  19. Main: TE2F2NTPCNA [PLACE

    Lifescience Database Archive (English)

    Full Text Available TE2F2NTPCNA S000397 05-November-2005 (last modified) kehi te2f-2 found in the promoter of tobacco PCN...riptional activation in actively dividing cells and tissue; E2F; PCNA; meristematic tissue; cell cycle; tobacco (Nicotiana tabacum) ATTCCCGC ...

  20. SAFIRA. Sub-project B 1.3: Development of coupled in-situ reactors and optimisation of the geochemical processes in the discharge of different in situ reactor sytems. Final report; SAFIRA. Teilprojekt B 1.3: Entwicklung von gekoppelten in situ-Reaktoren und Optimierung der geochemischen Prozesse im Abstrom von verschiedenen in situ-Reaktor-Systemen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Dahmke, A.; Schaefer, D.; Koeber, R.; Plagentz, V.

    2002-12-01

    The Bitterfeld ground water is contaminated with many different pollutants over a large area. Long-term measures like reactive barriers for purification are required. However, groundwater contaminated with multiple contaminants cannot be purified by a single reactive material; for this reason, the effectivity of combinations of different reactive materials was investigated. Of the combinations investigated, reducing iron and activated carbon connected in series was the most effective: The iron will remove the reducible chlorinated hydrocarbons, while the rest of the contaminants are adsorbed to the activated carbon. Iron and ORC was another interesting option, but the combination of iron and activated carbon was found to be the most favourable option. Until a better method is available, it is recommended to connect iron and activated carbon in parallel for removing contaminant mixtures. Directly behind reactive iron barriers (also when combined with activated carbon), the limiting values of the Freshwater Ordinance for Fe(II) and pH are exceeded. Directly behind ORC reactors, the limiting values for Mg and pH are exceeded. Investigations in the outflow of these reactive materials showed that the high pH values are buffered by contact with the aquifer material to values typical of aquifers, which usually are below the limiting values of the Freshwater Ordinance. However, as the buffer capacity of the soil is exhausted, a zone with a higher pH starts to grow in the aquifer. The growth of this zone depends on the pH and on the aquifer material. Especially in soils as found at Bitterfeld, with a high concentration of organic matter, we find long-term desorption of pollutants from the aquifer materials which will burden the purified water leaving the water treatment system and prohibit its utilization. [German] Der Grundwasserleiter im Raum Bitterfeld ist grossraeumig mit vielen verschiedenen Substanzen kontaminiert. Aufgrund der grossraeumigen Erstreckung kommen nur langfristig kostenguenstige passive Massnahmen wie reaktive Barrieren zur Sanierung in Frage. Grundwasser, das mit mehreren und unterschiedlich reagierenden Stoffen kontaminiert ist, kann jedoch nicht mit Hilfe eines einzelnen reaktiven Materials gereinigt werden, daher wurde die Effektivitaet von Kombinationen unterschiedlicher reaktiver Materialien zur Sanierung untersucht. Von den untersuchten Kombinationen erwies sich die Hintereinanderschaltung von reduzierendem Eisen und Aktivkohle als besonders effektiv. Reduzierbare chlorierte Kohlenwasserstoffe werden im Eisen entfernt, die verbleibenden Kontaminanten adsorbieren auf der Aktivkohle. Auch die Hintereinanderschaltung von Eisen und Sauerstoff abgebenden ORC, in denen ein aerober mikrobieller Abbau statt findet, ist zur Entfernung von Mischkontaminationen geeignet. Eine Kostenschaetzung zeigt, dass die Kombination von Eisen und Aktivkohle in Abhaengigkeit von der Zusammensetzung der Kontamination guenstiger als Aktivkohle allein sein kann und generell guenstiger als die Kombination von Eisen und ORC ist. Ohne ein guenstigeres Verfahren zum Einbringen von Sauerstoff in den Aquifer wird die Hintereinanderschaltung von Eisen und Aktivkohle zur Sanierung von Mischkontaminationen empfohlen. Im direkten Abstrom von reaktiven Eisenbarrieren (auch in Kombination mit Aktivkohle) sind die Grenzwerte fuer Fe(II) und pH entsprechend der Trinkwasserverordnung ueberschritten. Im Abstrom von ORC-Reaktoren werden die zulaessigen Werte fuer Mg und pH ueberschritten. Untersuchungen im Abstrom dieser reaktiven Materialien zeigen, dass die hohen pH-Werte durch den Kontakt mit dem Aquifermaterial auf Aquifer-typische Werte gepuffert werden, die ueblicherweise unter den Grenzwerten der Trinkwasserverordnung liegen. Mit Erschoepfen der Pufferkapazitaet des Bodens breitet sich jedoch eine Zone mit erhoehtem pH-Wert im Aquifer aus. Die Geschwindigkeit dieser Ausbreitung haengt vom pH-Wert und dem Aquifermaterial ab. Gerade fuer sehr Organik reiche Boeden wie in Bitterfeld wird auch eine lange anhaltende Desorption von Schadstoffen a

  1. Application of ultrasonic array transducers and robotics for external inspection of reactor pressure vessels - practical experience from refuelling operations at the Kruemmel NPP in 2000; Einsatz von Ultraschall-Gruppenstrahlerprueftechniken und neuer Robotik bei der Aussenpruefung von Reaktor-Druckbehaeltern - Einsatzerfahrungen im Kernkraftwerk Kruemmel im Brennelementwechsel 2000

    Energy Technology Data Exchange (ETDEWEB)

    Eggers, H.; Hein, E.; Zwahr, B. [Hamburgische Electricitaets-Werke AG, Hamburg (Germany). Abt. Oeffentlichkeitsarbeit; Rathgeb, W.; Schirner, G. [Siemens NDT, Erlangen (Germany)

    2000-07-01

    The performance of a novel testing robot of Siemens NDT and novel testing techniques for inspection of a welded joint for longitudinal and transverse defects is described in great detail. (orig./CB) [German] Im Rahmen einer Pruefgeraetelieferung ist HEW und Siemens NDT uebereingekommen, die gesamte Prueftechnik fuer die Siedewasseraussenpruefung effizienter zu gestalten. Ziel war, mit einem voellig neuen Pruefroboter und neuer Prueftechnik eine Schweissnaht in einem Prueflauf vollstaendig auf Laengs- und Querfehler zu pruefen. Dabei sollten die Umbaumassnahmen zwischen den einzelnen Pruefbereichen, wie den Rundnaehten und den Stutzeneinschweissnaehten, sowie der Stutzenkante entfallen. Die Prueftechnik wurde auf eine moderne Gruppenstrahlerprueftechnik umgestellt. Die dabei erreichbare Pruefdichte sollte zumindest so, wie mit herkoemmlichen Pruefsystemen oder dichter sein. Grundlegende Untersuchungen wurden zur Tandemtechnik angestellt, um mit einer modifizierten Tandemtechnik, bestehend aus zwei Gruppenstrahlerpruefkoepfen, die Wanddicke des SWR-Reaktordruckbehaelters mit maximal fuenf Tandemzonen zu pruefen. (orig.)

  2. SAFIRA. Sub-project B 1.3: Development of coupled in-situ reactors and optimisation of the geochemical processes in the discharge of different in situ reactor sytems. Final report; SAFIRA. Teilprojekt B 1.3: Entwicklung von gekoppelten in situ-Reaktoren und Optimierung der geochemischen Prozesse im Abstrom von verschiedenen in situ-Reaktor-Systemen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Dahmke, A.; Schaefer, D.; Koeber, R.; Plagentz, V.

    2002-12-01

    The Bitterfeld ground water is contaminated with many different pollutants over a large area. Long-term measures like reactive barriers for purification are required. However, groundwater contaminated with multiple contaminants cannot be purified by a single reactive material; for this reason, the effectivity of combinations of different reactive materials was investigated. Of the combinations investigated, reducing iron and activated carbon connected in series was the most effective: The iron will remove the reducible chlorinated hydrocarbons, while the rest of the contaminants are adsorbed to the activated carbon. Iron and ORC was another interesting option, but the combination of iron and activated carbon was found to be the most favourable option. Until a better method is available, it is recommended to connect iron and activated carbon in parallel for removing contaminant mixtures. Directly behind reactive iron barriers (also when combined with activated carbon), the limiting values of the Freshwater Ordinance for Fe(II) and pH are exceeded. Directly behind ORC reactors, the limiting values for Mg and pH are exceeded. Investigations in the outflow of these reactive materials showed that the high pH values are buffered by contact with the aquifer material to values typical of aquifers, which usually are below the limiting values of the Freshwater Ordinance. However, as the buffer capacity of the soil is exhausted, a zone with a higher pH starts to grow in the aquifer. The growth of this zone depends on the pH and on the aquifer material. Especially in soils as found at Bitterfeld, with a high concentration of organic matter, we find long-term desorption of pollutants from the aquifer materials which will burden the purified water leaving the water treatment system and prohibit its utilization. [German] Der Grundwasserleiter im Raum Bitterfeld ist grossraeumig mit vielen verschiedenen Substanzen kontaminiert. Aufgrund der grossraeumigen Erstreckung kommen nur langfristig kostenguenstige passive Massnahmen wie reaktive Barrieren zur Sanierung in Frage. Grundwasser, das mit mehreren und unterschiedlich reagierenden Stoffen kontaminiert ist, kann jedoch nicht mit Hilfe eines einzelnen reaktiven Materials gereinigt werden, daher wurde die Effektivitaet von Kombinationen unterschiedlicher reaktiver Materialien zur Sanierung untersucht. Von den untersuchten Kombinationen erwies sich die Hintereinanderschaltung von reduzierendem Eisen und Aktivkohle als besonders effektiv. Reduzierbare chlorierte Kohlenwasserstoffe werden im Eisen entfernt, die verbleibenden Kontaminanten adsorbieren auf der Aktivkohle. Auch die Hintereinanderschaltung von Eisen und Sauerstoff abgebenden ORC, in denen ein aerober mikrobieller Abbau statt findet, ist zur Entfernung von Mischkontaminationen geeignet. Eine Kostenschaetzung zeigt, dass die Kombination von Eisen und Aktivkohle in Abhaengigkeit von der Zusammensetzung der Kontamination guenstiger als Aktivkohle allein sein kann und generell guenstiger als die Kombination von Eisen und ORC ist. Ohne ein guenstigeres Verfahren zum Einbringen von Sauerstoff in den Aquifer wird die Hintereinanderschaltung von Eisen und Aktivkohle zur Sanierung von Mischkontaminationen empfohlen. Im direkten Abstrom von reaktiven Eisenbarrieren (auch in Kombination mit Aktivkohle) sind die Grenzwerte fuer Fe(II) und pH entsprechend der Trinkwasserverordnung ueberschritten. Im Abstrom von ORC-Reaktoren werden die zulaessigen Werte fuer Mg und pH ueberschritten. Untersuchungen im Abstrom dieser reaktiven Materialien zeigen, dass die hohen pH-Werte durch den Kontakt mit dem Aquifermaterial auf Aquifer-typische Werte gepuffert werden, die ueblicherweise unter den Grenzwerten der Trinkwasserverordnung liegen. Mit Erschoepfen der Pufferkapazitaet des Bodens breitet sich jedoch eine Zone mit erhoehtem pH-Wert im Aquifer aus. Die Geschwindigkeit dieser Ausbreitung haengt vom pH-Wert und dem Aquifermaterial ab. Gerade fuer sehr Organik reiche Boeden wie in Bitterfeld wird auch eine lange anhaltende Desorption von Schadstoffen aus dem Aquifermaterial beobachtet, durch die das saubere Wasser, das die Sanierungsanlage verlaesst, wieder mit Schadstoffen beladen wird, was zu einer anhaltenden Nutzungseinschraenkung fuehrt. (orig.)

  3. Development of an improved methodology for the determination of the neutron load of the pressure vessel steel of WWER-1000 type reactors. Final report; Entwicklung einer fortgeschrittenen Methodik zur Bestimmung der Neutronenbelastung des Druckbehaeltermaterials vom Reaktor des Typs WWER-1000. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Barz, H.U.; Boehmer, B.; Konheiser, J.; Stephan, I.

    1998-05-01

    The investigations, reported on here, are aimed at the theoretical and experimental determination of the neutron exposure of the VVER-1000 reactors Balakovo-3 and Rovno-3. The overall approach, partially developed and at least improved in the frame of this project, comprises the pure calculation part, the gamma spectrometric analysis of neutron activation detectors and the comparison of experimental and theoretical results using the spectrum adjustment procedure. The approach is not restricted to neutron embrittlement but can be applied to neutron fluence problems in general. (orig./GL) [Deutsch] In diesem Projekt wurden fuer die WWER-1000 Reaktoren Balakovo-3 und Rovno-3 die Parameter der Neutronenbelastung experimentell und theoretisch bestimmt. Der vorliegende Bericht beschreibt das methodische Vorgehen, welches aus dem reinen Berechnungsteil, der gammaspektrometrischen Analyse der Ativierungsdetektoren und dem Vergleich der gemessenen und berechneten Werte einschliesslich der Spektrumsjustierung besteht. Dieses Instrumentarium, welches allgemein bei der Bestimmung der Neutronenfluenz anwendbar ist, wurde im Projektzeitraum weiter verbessert. (orig./GL)

  4. 75 FR 4292 - 2-Propenoic acid, 2-ethylhexyl ester, polymer with ethenylbenzene and 2-methylpropyl 2-methyl-2...

    Science.gov (United States)

    2010-01-27

    ... AGENCY 40 CFR Part 180 2-Propenoic acid, 2-ethylhexyl ester, polymer with ethenylbenzene and 2... residues of 2-propenoic acid, 2-ethylhexyl ester, polymer with ethenylbenzene and 2-methylpropyl 2-methyl-2... permissible level for residues of 2-propenoic acid, 2-ethylhexyl ester, polymer with ethenylbenzene and...

  5. Reference: IDE2HVIDS2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available IDE2HVIDS2 Kobayashi T, Nakayama Y, Itai RN, Nakanishi H, Yoshihara T, Mori S, Nish...izawa NK. Identification of novel cis-acting elements, IDE1 and IDE2, of the barley IDS2 gene promoter confe

  6. 36 CFR 2.2 - Wildlife protection.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Wildlife protection. 2.2... PROTECTION, PUBLIC USE AND RECREATION § 2.2 Wildlife protection. (a) The following are prohibited: (1) The taking of wildlife, except by authorized hunting and trapping activities conducted in accordance...

  7. 18 CFR 2.2 - Transmission lines.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Transmission lines. 2.2 Section 2.2 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY GENERAL RULES GENERAL POLICY AND INTERPRETATIONS Statements of General Policy and...

  8. Novel thioarsenates {[Mn(2,2'-bipy)2(SCN)][Mn(2,2'-bipy)](As(V)S4)}2 and {[Mn(2,2'-bipy)2(SCN)]2[As(III)2(S2)2S2]}: introducing an anionic second ligand to modify MnII complex cations of 2,2'-bipyridine.

    Science.gov (United States)

    Liu, Guang-Ning; Guo, Guo-Cong; Wang, Ming-Sheng; Huang, Jin-Shun

    2014-03-14

    Two novel manganese thioarsenates, {[Mn(2,2'-bipy)2(SCN)][Mn(2,2'-bipy)](As(V)S4)}2 (1, 2,2'-bipy = 2,2'-bipyridine) and {[Mn(2,2'-bipy)2(SCN)]2[As(III)2(S2)2S2]} (2), containing thiocyanate-modified Mn-2,2'-bipy complex cations were synthesized. They feature two terminal [Mn(2,2'-bipy)2(SCN)](+) complex cations bridged by a polyanion {[Mn(2,2'-bipy)]2(As(V)S4)2}(2-) for 1 and a cyclic thioarsenate anion (As(III)2S6)(2-) for 2. In 2, the [As(III)2(S2)2S2](2-) anion can be described as two (As(III)S3)(3-) trigonal-pyramids interlinked through S-S bonds. The method to obtain new metal complex cations shown here, introducing an anionic second ligand to modify the number of coordination sites and the charges of the metal complex cations simultaneously, is different from the traditional methods, varying either the TM center or the organic ligand or employing mixed neutral organic ligands, and may open up a new route for preparing novel chalcogenidometalates. Compounds 1 and 2 exhibit wide optical gaps of 2.20 and 2.67 eV, respectively, and photoluminescence with the emission maxima occurring around 440 nm. Magnetic measurements show the presence of antiferromagnetic interactions between Mn(II) centers in the two compounds.

  9. Status of the T2L2/Jason2 Experiment

    Science.gov (United States)

    Exertier, Pierre; Samain, Etienne; Bonnefond, Pascal; Guillemot, Philippe

    2010-12-01

    The T2L2 (Time Transfer by Laser Link) project, developed by CNES and OCA will permit the synchronization of remote ultra stable clocks and the determination of their performances over intercontinental distances. The principle of the experiment derives from Satellite Laser Ranging (SLR) technology with dedicated space equipment. T2L2 was accepted in 2005 to be on board the Jason2 altimetry satellite. The payload consists of both event timer and photo detection modules. The system uses the ultra-stable quartz oscillator of DORIS as on-board reference clock on one hand, and the Laser Reflector Array, making T2L2 a real two-way time transfer system on the other hand. The expected time stability of the T2L2 instrument (detection and timing), referenced by the DORIS oscillator and including all internal error sources should be at the level of 10-12 ps at 1 s and T2L2 should permit to maintain a precision of 1 to a few ps when measuring the phase of a clock during around 1000 seconds. First analysis of T2L2 data permitted to validate some important characteristics of the experiment such as the sensitivity of the instrument to laser pulse amplitude (from single to multi-photon detection mode), data noises (of different sources, SLR and T2L2), and first error budget and time stability of ground to space time transfers. The paper describes the space experiment and highlights the different steps of the data processing after a first year of operations (between July 2008 and June 2009). We show the time stability which can be reached when a laser station is equipped with an Hydrogen Maser or a Cesium clock as a time reference; thus, the first estimations give 7 ps over 30 s. We conclude by presenting the campaigns of ground to ground time transfers already planned between the Paris Observatory and different places in Europe.

  10. [(2-Morpholinoethyl(2-pyridylmethyleneamine]dithiocyanatozinc(II

    Directory of Open Access Journals (Sweden)

    Bang-Hong Cai

    2009-02-01

    Full Text Available The title compound, [Zn(NCS2(C12H17N3O], was prepared by the reaction of zinc acetate with pyridine-2-carbaldehyde, 2-morpholinoethylamine and ammonium thiocyanate in an ethanol solution. The ZnII atom is five coordinate with a distorted trigonal–bipyramidal geometry, coordinating with three N atoms of the Schiff base (2-morpholinoethyl(2-pyridylmethylideneamine and two N atoms from two thiocyanate ligands. The morpholine ring adopts a chair configuration.

  11. N′-(Butan-2-ylidenefuran-2-carbohydrazide

    Directory of Open Access Journals (Sweden)

    He-ping Li

    2010-10-01

    Full Text Available The title Schiff base compound, C9H12N2O2, was obtained from a condensation reaction of butan-2-one and furan-2-carbohydrazide. The furan ring and the hydrazide fragment are roughly planar, the largest deviation from the mean plane being 0.069 (2Å, but the butanylidene group is twisted slightly with respect to this plane by a dihedral angle of 5.2 (3°. In the crystal, intermolecular N—H...O hydrogen bonds link pairs of inversion-related molecules, forming dimers of R22(8 graph-set motif.

  12. Main: HDZIP2ATATHB2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available HDZIP2ATATHB2 S000373 31-Jul-2001 (last modified) uchi Binding site of the Arabidop...sis (A.T.) homeobox gene (ATHB-2) found in its own promoter; Located between -72 and -80; Similar to the HD-...lator of its own gene; M=C/A; ATHB-2; HAT4; HD-ZIP; shade avoidance responses; Arabidopsis thaliana TAATMATTA ... ...ZIP-2 binding consensus sequence; ATHB-2 is regulated by light signals which function as a negative autoregu

  13. ITOUGH2 user`s guide version 2.2

    Energy Technology Data Exchange (ETDEWEB)

    Finsterle, S.

    1993-08-01

    ITOUGH2 is a program to estimate hydrogeologic model parameters for the numerical simulator TOUGH2. TOUGH2 was developed by Karsten Pruess at Lawrence Berkeley Laboratory for simulating non-isothermal flows of multicomponent, multiphase fluids in porous and fractured media. ITOUGH2 solves the inverse problem by automatic model calibration based on an indirect approach, in which some function of the difference between observed and model-predicted system response and appropriately weighted prior information about the parameters is minimized using standard optimization techniques. ITOUGH2 also provides a detailed error analysis of the estimated parameter set, and employs some procedures to study error propagation for prediction runs. This report includes a review of the inverse modeling theory, and a detailed description of the program architecture, input language, and the various user features provided by ITOUGH2. A sample problem is given to illustrate code application.

  14. R+D works for the further development of high temperature reactors. (1) Captive bearing experiments for active magnetic bearings. (2) Captive bearing test for HTR blowers. Final report 1.10.1983 - 31.3.1991; F+E-Arbeiten fuer die Weiterentwicklung von Hochtemperaturreaktoren. (1) Fanglagerversuche fuer aktive Magnetlager. (2) Fanglagertest fuer HTR-Geblaese. Abschlussbericht. 1.10.1983 - 31.3.1991

    Energy Technology Data Exchange (ETDEWEB)

    1991-03-14

    When using active magnetic bearings as blower shaft bearings, blower motors and bearings must be protected against mechanical damage in case of faults (example: total electrical supply failure due to the supply cables breaking). So-called captive bearings are provided, in order to be able to shut the blowers down safely in such faults. These captive bearings are roller bearings which are additionally fitted in the area of the blower shaft bearings, to prevent mechanical contact between the blower rotor and stator. As there was little experience available for the given boundary conditions, such as - speed, - acceleration, - bearing load, - bearing dimensions, - ambient conditions, appropriate development and tests had to be carried out. It was important to determine suitable captive bearings and the necessary ambient conditions, which will make it possible to support the failures of the magnetic bearings to be expected in 40 years` operation of the reactor without damage and to meet the requirements of the captive bearings. (orig./GL). [Deutsch] Beim Einsatz von aktiven Magnetlagern als Geblaesewellenlagerung sind Geblaesemotor und -lager vor mechanischer Schaedigung im Stoerfall (Beispiel: totaler Stromausfall durch Bruch der Versorgungskabel) zu schuetzen. Um bei derartigen Stoerfaellen die Geblaese sicher abfahren zu koennen, werden sogenannte Fanglager vorgesehen. Diese Fanglager sind Waelzlager, die im Bereich der Geblaesewellenlagerung zusaetzlich angebracht werden, um einen mechanischen Kontakt zwischen Geblaesemotor und -stator zu verhindern. Da fuer die vorgegebenen Randbedingungen, wie - Drehzahl, - Beschleunigung, - Lagerbelastung, - Lagerabmessungen, Umgebungsbedingungen nur geringe Erfahrungen vorlagen, mussten entsprechende Entwicklungen und Versuche durchgefuehrt werden. Hierbei galt es, geeignete Fanglager und die erforderlichen Umgebungsbedingungen zu ermitteln, die es ermoeglichen, die in 40 Betriebsjahren des Reaktors zu erwartenden Ausfaelle der

  15. Difluoro[2-(quinolin-2-ylphenolato]borane

    Directory of Open Access Journals (Sweden)

    Xi Yang

    2011-05-01

    Full Text Available The title compound, C15H10BF2NO, was synthesized by the reaction of 2-(quinolin-2-ylphenol and boron trifluoride etherate. The quinoline ring system and the benzene ring are twisted, making a dihedral angle of 8.3 (2°. In the crystal, π–π interactions between the aromatic rings [centroid–centroid distance = 3.638 (9 Å] link the molecules into chains propagating in [100].

  16. Photodriven [2]rotaxane-[2]catenane interconversion.

    Science.gov (United States)

    Tron, Arnaud; Jacquot de Rouville, Henri-Pierre; Ducrot, Aurélien; Tucker, James H R; Baroncini, Massimo; Credi, Alberto; McClenaghan, Nathan D

    2015-02-18

    A [2]rotaxane, whose thread component comprises a central dibenzylammonium group and 9-alkoxyanthracene stoppers and is hosted by a 24-dibenzo-8-crown bead, undergoes an efficient photocatenation step resulting in a [2]rotaxane-to-[2]catenane topology interconversion via a fully reversible [4π+4π] photocyclomerization of terminal anthracene groups.

  17. Peculiar magnetism of UAu2Si2

    Science.gov (United States)

    Tabata, Chihiro; Miura, Naoyuki; Uhlířová, Klára; Vališka, Michal; Saito, Hiraku; Hidaka, Hiroyuki; Yanagisawa, Tatsuya; Sechovský, Vladimír; Amitsuka, Hiroshi

    2016-12-01

    Single-crystalline UAu2Si2 has been grown by a floating-zone melting method, and its magnetic, thermal, and transport properties have been investigated through measurements of magnetization, specific heat, and electrical resistivity to reveal its peculiar magnetism. It is shown that UAu2Si2 undergoes a second-order phase transition at Tm = 19 K, which had been believed to be ferromagnetic ordering in the literature, from a paramagnetic phase to an uncompensated antiferromagnetic phase with spontaneous magnetization along the tetragonal c axis (the easy magnetization direction). The magnetic entropy analysis points to the itinerant character of 5 f electrons in the magnetic ordered state of UAu2Si2 with large enhancement of the electronic specific heat coefficient of γ ˜150 mJ/K2mol at 2 K. It also reveals the relatively isotropic crystalline electric field effect of this compound, with contrast to the other relative isostructural compounds. The observed magnetization curves strongly suggest that there is a parasitic ferromagnetic component developing below ˜50 K in high coercivity with the easy axis along the tetragonal c axis. The results are discussed in the context of evolution of magnetism within the entire family of isostructural U T2Si2 compounds.

  18. A simple and versatile sup 2 sup 2 sup 2 Rn/ sup 2 sup 2 sup 0 Rn exposure chamber

    CERN Document Server

    Yu, K N; Guan, Z J

    2002-01-01

    A simple sup 2 sup 2 sup 2 Rn/ sup 2 sup 2 sup 0 Rn exposure chamber is described. The chamber is made of acrylic and has a volume of 0.41 m sup 3. The sup 2 sup 2 sup 2 Rn and sup 2 sup 2 sup 0 Rn sources can be operated independently or simultaneously. The concentrations of sup 2 sup 2 sup 2 Rn and sup 2 sup 2 sup 0 Rn were monitored by a continuous alpha spectrometer called RAD7. The capability of alpha spectrometry has removed the mutual interference between sup 2 sup 2 sup 0 Rn and sup 2 sup 2 sup 2 Rn, which is a major problem in measuring sup 2 sup 2 sup 0 Rn. Furthermore, the capability can also provide fast response to changes in the sup 2 sup 2 sup 2 Rn level and sup 2 sup 2 sup 0 Rn level in the exposure chamber, with temporal resolutions of about 20 and 2 min, respectively.

  19. SU(2|2) supersymmetric mechanics

    CERN Document Server

    Ivanov, Evgeny; Sidorov, Stepan

    2016-01-01

    We introduce a new kind of non-relativistic ${\\cal N}{=}\\,8$ supersymmetric mechanics, associated with worldline realizations of the supergroup $SU(2|2)$ treated as a deformation of flat ${\\cal N}{=}\\,8$, $d{=}1$ supersymmetry. Various worldline $SU(2|2)$ superspaces are constructed as coset manifolds of this supergroup, and the corresponding superfield techniques are developed. For the off-shell $SU(2|2)$ multiplets $({\\bf 3,8,5})$, $({\\bf 4,8,4})$ and $({\\bf 5,8,3})$, we construct and analyze the most general superfield and component actions. Common features are mass oscillator-type terms proportional to the deformation parameter and a trigonometric realization of the superconformal group $OSp(4^*|4)$ in the conformal cases. For the simplest $({\\bf 5, 8, 3})$ model the quantization is performed.

  20. Potassium (1-methoxycarbonyl-2-methylprop-2-en-2-ylideneazinate

    Directory of Open Access Journals (Sweden)

    Cédric Reuter

    2010-04-01

    Full Text Available In the title compound, K+·C6H8NO4−, the K+ cations have a coordination number of seven and are surrounded by four bidentate azinate anions. The methylene groups of the anions are always directed towards the coordinated potassium cations. The N—C—C—C torsion angle is 101.2 (2°. The orthogonal non-conjugated nature of the salt confirms the supposed geometry and reactivity of this compound.

  1. (2-Pyridyl[5-(2-pyridylcarbonyl-2-pyridyl]methanone

    Directory of Open Access Journals (Sweden)

    Zi-jia Wang

    2010-10-01

    Full Text Available In the centrosymmetric title compound, C17H11N3O2, the dihedral angle between the central and pendant pyridyl rings is 50.29 (9°. In the crystal, molecules stack along the a axis by π–π interactions between the pyridine rings with centroid–centroid distances of 3.845 (2 Å. The N atom and one of the C atoms of the central ring are disordered by symmetry.

  2. 2-Methoxy-N′-(2-methoxybenzylidenebenzohydrazide

    Directory of Open Access Journals (Sweden)

    Zhong-Hai Dang

    2008-09-01

    Full Text Available The title Schiff base compound, C16H16N2O3, was derived from the condensation of 2-methoxybenzaldehyde with 2-methoxybenzohydrazide in an ethanol solution. The dihedral angle between the two aromatic rings is 87.5 (3°. In the crystal structure, the molecules are linked into chains running parallel to the a axis by intermolecular N—H...O hydrogen bonds.

  3. A tristable [2]pseudo[2]rotaxane

    KAUST Repository

    Trabolsi, Ali

    2010-01-01

    A strategy towards increasing the lifetime of the metastable state of a [2]rotaxane incorporating tetrathiafulvalene, 1,5-dioxynaphthalene and bipyridinium (BIPY 2+) is presented. Incorporation of BIPY 2+ served multiple roles as an electrostatic barrier to relaxation, a supramolecular recognition site for bis-1,5-dioxynaphthalene[38]crown-10 macrocycle, and upon reduction a recognition site for the mechanically bonded cyclobis(paraquat-p-phenylene) ring. © The Royal Society of Chemistry 2010.

  4. K2SC: K2 Systematics Correction

    Science.gov (United States)

    Aigrain, Suzanne; Parviainen, Hannu; Pope, Benjamin

    2016-05-01

    K2SC (K2 Systematics Correction) models instrumental systematics and astrophysical variability in light curves from the K2 mission. It enables the user to remove both position-dependent systematics and time-dependent variability (e.g., for transit searches) or to remove systematics while preserving variability (for variability studies). K2SC automatically computes estimates of the period, amplitude and evolution timescale of the variability for periodic variables and can be run on ASCII and FITS light curve files. Written in Python, this pipeline requires NumPy, SciPy, MPI4Py, Astropy (ascl:1304.002), and George (ascl:1511.015).

  5. THERMAL-HYDRAULIC ANALYSIS OF SMR WITH NATURALLY CIRCULATING PRIMARY SYSTEM DURING LOSS OF FEED WATER ACCIDENT

    Directory of Open Access Journals (Sweden)

    Susyadi Susyadi

    2016-09-01

    ABSTRAK Reaktor daya kecil modular (SMR memiliki beberapa keunggulan dibanding reaktor daya besar konvensional. Dengan disain yang lebih sederhana dan terintegrasi, penerapan hukum alamiah untuk sistem keselamatannya dan biaya modal yang rendah, reaktor ini sangat cocok untuk dibangun di Indonesia. Salah satunya disain SMR yang sedang dikembangkan menerapkan gaya penggerak alami untuk sistim pendingin primernya. Dengan disain seperti itu, adalah sangat penting untuk memahami implikasinya terhadap aspek keselamatan pada seluruh kondisi operasi. Salah satu yang perlu diinvestigasi adalah kecelakaan kehilangan air umpan (LoFW. Pada studi ini, dilakukan analisis kinerja thermal hidrolik SMR yang menggunakan sistim pendinginan primer sirkulasi alam saat kecelakaan LoFW. Tujuannya adalah untuk menginvestigasi karakteristik aliran sistem primer saat kecelakaan LoFW dan untuk memastikan apakah aliran sirkulasi alam cukup untuk memindahkan panas dari teras guna menjaga kondisi tetap aman selama kecelakaan tersebut. Metoda yang digunakan adalah dengan merepresentasikan sistem reaktor ke dalam model-model generik program RELAP5 dan melakukan simulasi numerik. Hasil perhitungan menunjukkan bahwa setelah kejadian pemicu dan trip reaktor, pada sisi primer laju alirnya berfluktuasi secara signifikan dan temperatur pendinginnya menurun secara bertahap sedangkan  pada sisi sekunder kondisi uap berubah menjadi uap jenuh. Laju alir turun dari ~711 kg/detik menjadi ~263 kg/detik sebelum kembali naik lagi pada t=~46 detik. Saat laju alir di titik terendah, temperatur pusat bahan bakar dan fluida pendingin adalah sekitar  ~565 K dan  ~554 K, yang menujukkan bahwa temperatur bahan bakar masih jauh di bawah batas disain dan temperatur fluidanya juga berada di bawah titik saturasi. Keadaan ini menunjukkan bahwa saat transien kedua parameter utama termohidrolik reaktor tetap dalam kondisi yang dapat diterima sehingga dapat disimpulkan  bahwa saat  kecelakaan kehilangan air umpan, SMR

  6. Phospholipase A2 Biochemistry

    OpenAIRE

    Burke, John E.; Dennis, Edward A.

    2008-01-01

    The phospholipase A2 (PLA2) superfamily consists of many different groups of enzymes that catalyze the hydrolysis of the sn-2 ester bond in a variety of different phospholipids. The products of this reaction, a free fatty acid, and lysophospholipid have many different important physiological roles. There are five main types of PLA2: the secreted sPLA2’s, the cytosolic cPLA2’s, the Ca2+ independent iPLA2’s, the PAF acetylhydrolases, and the lysosomal PLA2’s. This review focuses on the superfam...

  7. CO2-Neutral Fuels

    Science.gov (United States)

    Goede, Adelbert; van de Sanden, Richard

    2016-06-01

    Mimicking the biogeochemical cycle of System Earth, synthetic hydrocarbon fuels are produced from recycled CO2 and H2O powered by renewable energy. Recapturing CO2 after use closes the carbon cycle, rendering the fuel cycle CO2 neutral. Non-equilibrium molecular CO2 vibrations are key to high energy efficiency.

  8. CO2-Neutral Fuels

    NARCIS (Netherlands)

    Goede, A.; van de Sanden, M. C. M.

    2016-01-01

    Mimicking the biogeochemical cycle of System Earth, synthetic hydrocarbon fuels are produced from recycled CO2 and H2O powered by renewable energy. Recapturing CO2 after use closes the carbon cycle, rendering the fuel cycle CO2 neutral. Non-equilibrium molecular CO2 vibrations are key to high energy

  9. (E-2-Methoxy-6-(thiazol-2-yliminomethylphenol

    Directory of Open Access Journals (Sweden)

    Wenkuan Li

    2009-11-01

    Full Text Available The title compound, C11H10N2O2S, displays an E configuration about the C=N bond. The mean planes of the thiazole and benzene rings make a dihedral angle of 9.32 (18°. Intramolecular O—H...N hydrogen bonds are found in the crystal structure.

  10. Vibrational investigations of CO2-H2O, CO2-(H2O)2, and (CO2)2-H2O complexes isolated in solid neon.

    Science.gov (United States)

    Soulard, P; Tremblay, B

    2015-12-14

    The van der Waals complex of H2O with CO2 has attracted considerable theoretical interest as a typical example of a weak binding complex with a dissociation energy less than 3 kcal/mol. Up to now, experimental vibrational data are sparse. We have studied by FTIR the complexes involving CO2 and water molecules in solid neon. Many new absorption bands close to the well known monomers fundamentals give evidence for at least three (CO2)n-(H2O)m complexes, noted n:m. Concentration effects combined with a detailed vibrational analysis allow for the identification of sixteen, twelve, and five transitions for the 1:1, 1:2, and 2:1 complexes, respectively. Careful examination of the far infrared spectral region allows the assignment of several 1:1 and 1:2 intermolecular modes, confirmed by the observation of combinations of intra + intermolecular transitions, and anharmonic coupling constants have been derived. Our results demonstrate the high sensibility of the solid neon isolation to investigate the hydrogen-bonded complexes in contrast with the gas phase experiments for which two quanta transitions cannot be easily observed.

  11. Maladi Kolera 2 PSA (:30) (Cholera 2)

    Centers for Disease Control (CDC) Podcasts

    2010-02-18

    This is an important public health announcement about cholera prevention and food preparation tips you can use to prevent the spread of disease. Language: Haitian Creole.  Created: 2/18/2010 by Centers for Disease Control and Prevention (CDC).   Date Released: 2/18/2010.

  12. Vibrational investigations of CO2-H2O, CO2-(H2O)2, and (CO2)2-H2O complexes isolated in solid neon

    Science.gov (United States)

    Soulard, P.; Tremblay, B.

    2015-12-01

    The van der Waals complex of H2O with CO2 has attracted considerable theoretical interest as a typical example of a weak binding complex with a dissociation energy less than 3 kcal/mol. Up to now, experimental vibrational data are sparse. We have studied by FTIR the complexes involving CO2 and water molecules in solid neon. Many new absorption bands close to the well known monomers fundamentals give evidence for at least three (CO2)n-(H2O)m complexes, noted n:m. Concentration effects combined with a detailed vibrational analysis allow for the identification of sixteen, twelve, and five transitions for the 1:1, 1:2, and 2:1 complexes, respectively. Careful examination of the far infrared spectral region allows the assignment of several 1:1 and 1:2 intermolecular modes, confirmed by the observation of combinations of intra + intermolecular transitions, and anharmonic coupling constants have been derived. Our results demonstrate the high sensibility of the solid neon isolation to investigate the hydrogen-bonded complexes in contrast with the gas phase experiments for which two quanta transitions cannot be easily observed.

  13. 2-Amino-5-bromopyridinium 2-hydroxybenzoate

    Directory of Open Access Journals (Sweden)

    Ching Kheng Quah

    2010-08-01

    Full Text Available In the title compound, C5H6BrN2+·C7H5O3−, the 2-amino-5-bromopyridinium cation and 2-hydroxybenzoate anion are essentially planar with maximum deviations of 0.020 (1 and 0.018 (2 Å, respectively. The anion is stabilized by an intramolecular O—H...O hydrogen bond, which generates an S(6 ring motif. In the crystal, the cations and anions are linked by N—H...O hydrogen bonds into chains propagating along [010]. The chains contain R22(8 ring motifs. The structure is further stabilized by π–π stacking interactions [centroid–centroid distances = 3.4908 (10 and 3.5927 (10 Å] and also features short Br...O contacts [2.9671 (13 Å].

  14. Safety Testing of AGR-2 UCO Compacts 5-2-2, 2-2-2, and 5-4-1

    Energy Technology Data Exchange (ETDEWEB)

    Hunn, John D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Fusion and Materials for Nuclear Systems Division; Morris, Robert Noel [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Fusion and Materials for Nuclear Systems Division; Baldwin, Charles A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Fusion and Materials for Nuclear Systems Division; Montgomery, Fred C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Fusion and Materials for Nuclear Systems Division

    2016-08-01

    Post-irradiation examination (PIE) is being performed on tristructural-isotropic (TRISO) coated-particle fuel compacts from the Advanced Gas Reactor (AGR) Fuel Development and Qualification Program second irradiation experiment (AGR-2). This effort builds upon the understanding acquired throughout the AGR-1 PIE campaign, and is establishing a database for the different AGR-2 fuel designs. The AGR-2 irradiation experiment included TRISO fuel particles coated at BWX Technologies (BWXT) with a 150-mm-diameter engineering-scale coater. Two coating batches were tested in the AGR-2 irradiation experiment. Batch 93085 had 508-μm-diameter uranium dioxide (UO2) kernels. Batch 93073 had 427-μm-diameter UCO kernels, which is a kernel design where some of the uranium oxide is converted to uranium carbide during fabrication to provide a getter for oxygen liberated during fission and limit CO production. Fabrication and property data for the AGR-2 coating batches have been compiled and compared to those for AGR-1. The AGR-2 TRISO coatings were most like the AGR-1 Variant 3 TRISO deposited in the 50-mm-diameter ORNL lab-scale coater. In both cases argon-dilution of the hydrogen and methyltrichlorosilane coating gas mixture employed to deposit the SiC was used to produce a finer-grain, more equiaxed SiC microstructure. In addition to the fact that AGR-1 fuel had smaller, 350-μm-diameter UCO kernels, notable differences in the TRISO particle properties included the pyrocarbon anisotropy, which was slightly higher in the particles coated in the engineering-scale coater, and the exposed kernel defect fraction, which was higher for AGR-2 fuel due to the detected presence of particles with impact damage introduced during TRISO particle handling.

  15. Safety Testing of AGR-2 UCO Compacts 5-2-2, 2-2-2, and 5-4-1

    Energy Technology Data Exchange (ETDEWEB)

    Hunn, John D [ORNL; Morris, Robert Noel [ORNL; Baldwin, Charles A [ORNL; Montgomery, Fred C [ORNL

    2016-10-01

    Post-irradiation examination (PIE) is being performed on tristructural-isotropic (TRISO) coated-particle fuel compacts from the Advanced Gas Reactor (AGR) Fuel Development and Qualification Program second irradiation experiment (AGR-2) [Collin 2014]. This effort builds upon the understanding acquired throughout the AGR-1 PIE campaign [Demkowicz et al. 2015a] and is establishing a database for the different AGR-2 fuel designs. The AGR-2 irradiation experiment included TRISO fuel particles coated at BWX Technologies (BWXT) with a 150-mm-diameter engineering-scale coater. Two coating batches were tested in the AGR-2 irradiation experiment. Batch 93085 had 508-μm-diameter uranium dioxide (UO2) kernels. Batch 93073 had 427-μm-diameter UCO kernels, which is a kernel design where some of the uranium oxide is converted to uranium carbide during fabrication to provide a getter for oxygen liberated during fission and limit CO production. Fabrication and property data for the AGR-2 coating batches have been compiled [Barnes and Marshall 2009] and compared to AGR-1 [Phillips, Barnes, and Hunn 2010]. The AGR-2 TRISO coatings were most like the AGR-1 Variant 3 TRISO deposited in the 50-mm-diameter ORNL lab-scale coater [Hunn and Lowden 2006]. In both cases argon-dilution of the hydrogen and methyltrichlorosilane coating gas mixture employed to deposit the SiC was used to produce a finer-grain, more equiaxed SiC microstructure [Lowden 2006; Gerczak et al. 2016]. In addition to the fact that AGR-1 fuel had smaller, 350-μm-diameter UCO kernels, notable differences in the TRISO particle properties included the pyrocarbon anisotropy, which was slightly higher in the particles coated in the engineeringscale coater, and the exposed kernel defect fraction, which was higher for AGR-2 fuel due to the detected presence of particles with impact damage introduced during TRISO particle handling [Hunn 2010].

  16. 2-Aminopyridinium (2-aminopyridinetrichloridonickelate(II

    Directory of Open Access Journals (Sweden)

    T. Balasubramanian

    2008-04-01

    Full Text Available In the title compound, (C5H7N2[NiCl3(C5H6N2], the NiII atom is four-coordinated by three chloride anions and one N atom of a 2-aminopyridine ligand, forming a distorted tetrahedral coordination. In the crystal structure, cations and complex anions are linked into chains along the a, b and c axes by N—H...Cl hydrogen bonds, leading to the formation of a three-dimensional framework.

  17. N′-[(2-Hydroxy-1-naphthylmethylidene]-2-nitrobenzohydrazide

    Directory of Open Access Journals (Sweden)

    Yu-Mei Hao

    2010-05-01

    Full Text Available In the title Schiff base compound, C18H13N3O4, prepared by the reaction of 2-hydroxy-1-naphthaldehyde with 2-nitrobenzohydrazide, the dihedral angle between the benzene ring and naphthyl ring system is 23.0 (2°. There is an intramolecular O—H...N hydrogen bond involving the naphthalene hydroxy substituent and a hydrazide N atom. In the crystal structure, symmetry-related molecules are linked through intermolecular N—H...O hydrogen bonds, forming chains propagating in [101].

  18. 单群2D2n(2)的拟刻画%Quasirecognition of the Simple Group 2 D2n (2)

    Institute of Scientific and Technical Information of China (English)

    李立莉

    2015-01-01

    Let G be finite group such that M(G) = M(2 D2n (2)) where 2n -1 prime .Then G has a nor‐mal subgroup isomorphic to 2 D2n (2) .Especially ,if | G | = |2 D2n (2)| ,then G ≌ 2 D2n (2) .%设 G为有限群,且满足 M(G)= M(2 D2n (2)),其中2n -1为素数。则 G必有正规子群同构于2 D2n (2)。特别地,若|G|=|2 D2n (2)|,则G ≌2 D2n (2)。

  19. Synthesis of 2-Alkenyl-2H-indazoles from 2-(2-Carbonylmethyl)-2H-indazoles.

    Science.gov (United States)

    Lin, Mei-Huey; Liang, Kung-Yu; Tsai, Chang-Hsien; Chen, Yu-Chun; Hsiao, Hung-Chang; Li, Yi-Syuan; Chen, Chung-Hao; Wu, Hau-Chun

    2016-02-19

    A procedure has been developed for synthesis of 2-alkenyl-2H-indazoles starting from 2-(2-carbonylmethyl)-2H-indazoles, which are prepared by gallium/aluminium- and aluminium-mediated, direct, regioselective alkylation of indazoles with α-bromocarbonyl compounds. The structure of 3-(2H-indazol-2-yl)-2H-chromen-2-one was proven by X-ray crystallography. The styrene- and coumarin-2H-indazoles produced by using the new method were found to have interesting fluorescence properties.

  20. Geometry of 2×2 hermitian matrices

    Institute of Scientific and Technical Information of China (English)

    HUANG; Liping(黄礼平); WAN; Zhexian(万哲先)

    2002-01-01

    Let D be a division ring which possesses an involution a→ā. Assume that F = {a∈D|a=ā} is a proper subfield of D and is contained in the center of D. It is pointed out that if D is of characteristic not two, D is either a separable quadratic extension of F or a division ring of generalized quaternions over F and that if D is of characteristic two, D is a separable quadratic extension of F. Thus the trace map Tr: D→F,hermitian matrices over D when n≥3 and now can be deleted. When D is a field, the fundamental theorem of 2×2 hermitian matrices over D has already been proved. This paper proves the fundamental theorem of 2×2 hermitian matrices over any division ring of generalized quaternions of characteristic not two.

  1. 2-Aminopyridinium 2,4-dinitrophenolate

    Directory of Open Access Journals (Sweden)

    S. Reena Devi

    2016-09-01

    Full Text Available The asymmetric unit of the title organic salt, C5H7N2+·C6H3N2O5−, comprises two 2-aminopyridinium cations and two 2,4-dinitrophenolate anions. The cations are protonated at the pyridine N atoms, while the anions are deprotonated at hydroxyl O atoms. In the crystal, bifurcated N—H...O hydrogen bonds generate two R12(6, two R21(6, and one R21(4 ring motifs. Adjacent anions and cations are linked by N—H...O hydrogen bonds into infinite chains along [110]. Weak C—H...O contacts and π–π interactions further link the components, forming a complex three-dimensional supramolecular network.

  2. Herwig++ 2.2 Release Note

    CERN Document Server

    Bahr, M; Gigg, M; Grellscheid, D; Hamilton, K; Latunde-Dada, O; Platzer, S; Richardson, P; Seymour, M H; Sherstnev, AUniversity of Cambridge; Webber, Bryan R

    2008-01-01

    A new release of the Monte Carlo program Herwig++ (version 2.2) is now available. This version includes a number of improvements including: matrix elements for the production of an electroweak gauge boson, W and Z, in association with a jet; several new processes for Higgs production in association with an electroweak gauge boson; and the matrix element correction for QCD radiation in Higgs production via gluon fusion.

  3. Crystal structure of 2-[2-(2,5-dichlorobenzyloxy-2-(furan-2-ylethyl]-2H-indazole

    Directory of Open Access Journals (Sweden)

    Özden Özel Güven

    2016-10-01

    Full Text Available In the title compound, C20H16Cl2N2O2, the indazole ring system is approximately planar [maximum deviation = 0.033 (1 Å], its mean plane is oriented at dihedral angles of 25.04 (4 and 5.10 (4° to the furan and benzene rings, respectively. In the crystal, pairs of C—Hind...Obo (ind = indazole and bo = benzyloxy hydrogen bonds link the molecules into centrosymmetric dimers with graph-set motif R22(12. Weak C—H...π interactions is also observed. Aromatic π–π stacking between the benzene and the pyrazole rings from neighbouring molecules [centroid–centroid distance = 3.8894 (7 Å] further consolidates the crystal packing.

  4. Main: ACIIIPVPAL2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACIIIPVPAL2 S000194 15-September-2006 (last modified) kehi ACIII element found at -...246 to -238 of bean (P.v.) PAL2 promoter; ACIII element is required for vascular-specific gene expression; See also ACIPV...PAL2 (S000192) and ACIIPVPAL2 (S000193); Three AC-elements, which are possible Myb protein bind

  5. Main: ACIIPVPAL2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACIIPVPAL2 S000193 15-September-2006 (last modified) kehi ACII element found at -13...1 to -120 of bean (P.v.) PAL2 promoter; ACII element is required for vascular-specific gene expression; See also ACIPV...PAL2 (S000192) and ACIIIPVPAL2 (S000194); Three AC-elements, which are possible Myb protein bindin

  6. MECP2 Duplication Syndrome

    DEFF Research Database (Denmark)

    Signorini, Cinzia; De Felice, Claudio; Leoncini, Silvia;

    2016-01-01

    Rett syndrome (RTT) and MECP2 duplication syndrome (MDS) are neurodevelopmental disorders caused by alterations in the methyl-CpG binding protein 2 (MECP2) gene expression. A relationship between MECP2 loss-of-function mutations and oxidative stress has been previously documented in RTT patients ...

  7. N = 2 W Supergravity

    NARCIS (Netherlands)

    Bergshoeff, E.; Roo, M. de

    1993-01-01

    We quantize the classical gauge theory of N = 2 w∞ supergravity and show how the underlying N = 2 super-w∞ algebra gets deformed into an N = 2 super-W∞ algebra. Both algebras contain the N = 2 super-Virasoro algebra as a subalgebra. We discuss how one can extract from these results information

  8. Facts about Type 2

    Medline Plus

    Full Text Available ... Alert Day Diabetes Basics Home Symptoms Diagnosis America's Diabetes Challenge Type 1 Type 2 Facts About Type 2 Enroll in ... Where Do I Begin With Type2? Living With Type 1 Diabetes Enroll in the Living WIth Type 2 Diabetes ...

  9. 2-(2-Chlorophenyl-N-cyclohexyl-2-oxoacetamide

    Directory of Open Access Journals (Sweden)

    Xiu-Dan Jin

    2013-04-01

    Full Text Available In the title compound, C14H16ClNO2, the cyclohexyl ring has a chair conformation. The dihedral angle between the benzene ring and the mean plane of the four planar C atoms of the cyclohexyl ring is 45.2 (3°. The two carbonyl groups are trans to one another, with an O=C—C=O torsion angle of −137.1 (3°. In the crystal, molecules are linked by N—H...O hydrogen bonds forming chains propagating along [001]. A region of disordered electron density, situated near the unit-cell corners, was treated using the SQUEEZE routine in PLATON [Spek (2009. Acta Cryst. D65, 148–155]. It gave a solvent-accessible void of ca 400 Å3 for only 21 electrons. It is probably due to traces of the solvent of crystallization and was not taken into account during structure refinement.

  10. 1-(But-2-enylidene-2-(2-nitrophenylhydrazine

    Directory of Open Access Journals (Sweden)

    Zhi-Gang Yin

    2009-10-01

    Full Text Available The molecule of the title Schiff base compound, C10H11N3O2, adopts an E geometry with respect to the C=N double bond. The molecule is roughly planar, with the largest deviation from the mean plane being 0.111 (2 Å, The enylidene-hydrazine group is, however, slightly twisted with respect to the phenyl ring, making a dihedral angle of 6.5 (3°. An intramolecular N—H...O hydrogen bond may be responsible for the planar conformation. An intermolecular N—H...O hydrogen bond links two molecules around an inversion center, building a pseudo dimer.

  11. Does dinitrogen hydrogenation follow different mechanisms for [(eta5-C5Me4H)2Zr]2(mu2,eta2,eta2-N2) and {[PhP(CH2SiMe2NSiMe2CH2)PPh]Zr}2(mu2,eta2,eta2-N2) complexes? A computational study.

    Science.gov (United States)

    Bobadova-Parvanova, Petia; Wang, Qingfang; Quinonero-Santiago, David; Morokuma, Keiji; Musaev, Djamaladdin G

    2006-09-06

    The mechanisms of dinitrogen hydrogenation by two different complexes--[(eta(5)-C(5)Me(4)H)(2)Zr](2)(mu(2),eta(2),eta(2)-N(2)), synthesized by Chirik and co-workers [Nature 2004, 427, 527], and {[P(2)N(2)]Zr}(2)(mu(2),eta(2),eta(2)-N(2)), where P(2)N(2) = PhP(CH(2)SiMe(2)NSiMe(2)CH(2))(2)PPh, synthesized by Fryzuk and co-workers [Science 1997, 275, 1445]--are compared with density functional theory calculations. The former complex is experimentally known to be capable of adding more than one H(2) molecule to the side-on coordinated N(2) molecule, while the latter does not add more than one H(2). We have shown that the observed difference in the reactivity of these dizirconium complexes is caused by the fact that the former ligand environment is more rigid than the latter. As a result, the addition of the first H(2) molecule leads to two different products: a non-H-bridged intermediate for the Chirik-type complex and a H-bridged intermediate for the Fryzuk-type complex. The non-H-bridged intermediate requires a smaller energy barrier for the second H(2) addition than the H-bridged intermediate. We have also examined the effect of different numbers of methyl substituents in [(eta(5)-C(5)Me(n)H(5)(-)(n))(2)Zr](2)(mu(2),eta(2),eta(2)-N(2)) for n = 0, 4, and 5 (n = 5 is hypothetical) and [(eta(5)-C(5)H(2)-1,2,4-Me(3))(eta(5)-C(5)Me(5))(2)Zr](2)(mu(2),eta(2),eta(2)-N(2)) and have shown that all complexes of this type would follow a similar H(2) addition mechanism. We have also performed an extensive analysis on the factors (side-on coordination of N(2) to two Zr centers, availability of the frontier orbitals with appropriate symmetry, and inflexibility of the catalyst ligand environment) that are required for successful hydrogenation of the coordinated dinitrogen.

  12. Photocatalytic removal of M(2+) (Ni(2+), Cu(2+), Zn(2+), Cd(2+), Hg(2+) and Ag(+)) over new catalyst CuCrO(2).

    Science.gov (United States)

    Ketir, W; Bouguelia, A; Trari, M

    2008-10-30

    The metal ions M(2+) (Ni(2+), Cu(2+), Zn(2+), Cd(2+), Hg(2+) and Ag(+)) are potentially toxic. Their electro deposition has been carried out in aqueous air-equilibrated CuCrO(2) suspension upon visible illumination. The delafossite CuCrO(2) is p-type semiconductor characterized by a low band gap (1.28 eV) and a long-term chemical stability. The corrosion rate is found to be 10(-2) micromol m(-2)month(-1) in aqua regia. The oxide has been elaborated through nitrate route where the specific surface area is increased via the surface/bulk ratio. A correlation exists between the dark M(2+) adsorption, the redox potential of M(2+/0) couple and the conduction band of CuCrO(2) positioned at -1.06 V(SCE). Ag(+) cannot be photoreduced because of its positive potential located far above the valence band. By contrast, Zn(2+) is efficiently deposited due to the large driving force at the interface. The improved photoactivity of copper with a deposition percentage (90%) is attributed to the strong dark adsorption onto the surface catalyst. The results indicate a competitive effect with the water reduction; it has been observed that the M(2+) deposition goes parallel with the hydrogen evolution. Such behavior is attributed to the low H(2) over voltage when ultra fine aggregate of M islands are photodeposited onto CuCrO(2) substrate.

  13. CO2 laser modeling

    Science.gov (United States)

    Johnson, Barry

    1992-01-01

    The topics covered include the following: (1) CO2 laser kinetics modeling; (2) gas lifetimes in pulsed CO2 lasers; (3) frequency chirp and laser pulse spectral analysis; (4) LAWS A' Design Study; and (5) discharge circuit components for LAWS. The appendices include LAWS Memos, computer modeling of pulsed CO2 lasers for lidar applications, discharge circuit considerations for pulsed CO2 lidars, and presentation made at the Code RC Review.

  14. H2O2 space shuttle APU

    Science.gov (United States)

    1975-01-01

    A cryogenic H2-O2 auxiliary power unit (APU) was developed and successfully demonstrated. It has potential application as a minimum weight alternate to the space shuttle baseline APU because of its (1) low specific propellant consumption and (2) heat sink capabilities that reduce the amount of expendable evaporants. A reference system was designed with the necessary heat exchangers, combustor, turbine-gearbox, valves, and electronic controls to provide 400 shp to two aircraft hydraulic pumps. Development testing was carried out first on the combustor and control valves. This was followed by development of the control subsystem including the controller, the hydrogen and oxygen control valves, the combustor, and a turbine simulator. The complete APU system was hot tested for 10 hr with ambient and cryogenic propellants. Demonstrated at 95 percent of design power was 2.25 lb/hp-hr. At 10 percent design power, specific propellant consumption was 4 lb/hp-hr with space simulated exhaust and 5.2 lb/hp-hr with ambient exhaust. A 10 percent specific propellant consumption improvement is possible with some seal modifications. It was demonstrated that APU power levels could be changed by several hundred horsepower in less than 100 msec without exceeding allowable turbine inlet temperatures or turbine speed.

  15. 2-Amino-3-(hydroxymethylpyridinium 2-benzoylbenzoate monohydrate

    Directory of Open Access Journals (Sweden)

    Mustafa Odabaşoğlu

    2012-03-01

    Full Text Available In the title hydrated salt, C6H9N2O+·C14H9O3−·H2O, the dihedral angle between the benzene rings of the 2-benzoylbenzoate anion is 82.04 (14°, while the angles between the aromatic ring of the pyridinium cation and each of the benzene rings of the anion are 4.42 (14 and 82.04 (14°. In the crystal, molecules are linked by N—H...O and O—H...O hydrogen bonds, generating a three-dimensional network with R22(8, R66(16 and R44(6 motifs. The crystal packing is further stabilized by two π–π interactions, one between pyridinium rings, and another between the benzene benzoate and pyridinium rings of neighbouring molecules, with centroid-to-centroid distances of 3.559 (2 and 3.606 (2 Å, respectively.

  16. Mated Fingerprint Card Pairs 2 (MFCP2)

    Science.gov (United States)

    NIST Mated Fingerprint Card Pairs 2 (MFCP2) (PC database for purchase)   NIST Special Database 14 is being distributed for use in development and testing of automated fingerprint classification and matching systems on a set of images which approximate a natural horizontal distribution of the National Crime Information Center (NCIC) fingerprint classes. A newer version of the compression/decompression software on the CDROM can be found at the website http://www.nist.gov/itl/iad/ig/nigos.cfm as part of the NBIS package.

  17. 2-[2-(2,6-Dichloroanilinophenyl]-N′-(4-propylcyclohexylideneacetohydrazide

    Directory of Open Access Journals (Sweden)

    Mehmet Akkurt

    2010-02-01

    Full Text Available The asymmetric unit of the title compound, C23H27Cl2N3O, contains two crystallographically independent molecules in which the dihedral angles between the benzene rings are 70.1 (3 and 63.8 (3°. In each molecule an intramolecular N—H...O hydrogen bond generates an S(7 ring. The atoms of the propyl grouping of one molecule are disordered over two orientations with occupancies of 0.666 (6 and 0.334 (6. The crystal structure is stabilized by N—H...O and C—H...O hydrogen-bonding interactions.

  18. 2,6-Bis(2-chlorobenzylidenecyclohexanone

    Directory of Open Access Journals (Sweden)

    Deyun Liu

    2009-04-01

    Full Text Available In the title molecule, C20H16Cl2O, the central cyclohexanone ring adopts an envelope conformation. The two aromatic rings form a dihedral angle of 30.0 (1°. The crystal packing exhibits weak intermolecular C—H...O hydrogen bonds and short Cl...O contacts [3.213 (3 Å].

  19. Project 2nd Periodic Report - Section 2

    DEFF Research Database (Denmark)

    Healy, Mark; Knowles, Emma; Johnstone, Cameron

    The work described in this publication has received support from the European Community - Research Infrastructure Action under the FP7 “Capacities” Specific Programme through grant agreement number 262552, MaRINET. Project Periodic Report. 2nd Period: October 2012 – March 2014 inclusive....

  20. Unified Modern Mathematics, Course 2, Part 2.

    Science.gov (United States)

    Secondary School Mathematics Curriculum Improvement Study, New York, NY.

    Topics included in Part 2 of Course II are: real functions; descriptive statistics; transformations in the plane; length, area, and volume; combinatorics; and mass points. The chapter on real functions includes a discussion of properties of functions, composition of functions, inverses of functions and other topics. The chapter on descriptive…

  1. CCQE, 2p2h excitations and \

    CERN Document Server

    Nieves, J; Sánchez, F; Vacas, M J Vicente

    2013-01-01

    We analyze the MiniBooNE muon neutrino CCQE-like d\\sigma/dT_\\mu/dcos\\theta_\\mu data using a theoretical model that, among other nuclear effects, includes RPA correlations and 2p2h (multinucleon) mechanisms. These corrections turn out to be essential for the description of the data. We find that MiniBooNE CCQE-like data are fully compatible with former determinations of the nucleon axial mass M_A ~ 1.05 GeV. This is in sharp contrast with several previous analysis where anomalously large values of M_A ~ 1.4 GeV have been suggested. We also show that because of the the multinucleon mechanism effects, the algorithm used to reconstruct the neutrino energy is not adequate when dealing with quasielastic-like events. Finally, we analyze the MiniBooNE unfolded cross section, and show that it exhibits an excess (deficit) of low (high) energy neutrinos, which is an artifact of the unfolding process that ignores 2p2h mechanisms.

  2. Ciencias 2 (Science 2). [Student's Workbook].

    Science.gov (United States)

    Raposo, Lucilia

    Ciencias 2 is the second in a series of elementary science textbooks written for Portuguese-speaking students. The text develops the basic skills that students need to study their surroundings and observe natural facts and phenomena by following scientific methods. The book is composed of 10 chapters and includes 57 lessons. Topics included are…

  3. N-Cyclohexyl-2-oxo-2-phenylacetamide

    Directory of Open Access Journals (Sweden)

    Ze-Jun Jia

    2012-06-01

    Full Text Available In the title compound, C14H17NO2, the two carbonyl groups are oriented with respect to each other with a torsion angle of −129.9 (3°. The cyclohexane ring adopts a chair conformation. In the crystal, molecules are linked by N—H...O hydrogen bonds into a chain running along the a axis.

  4. Facts about Type 2

    Medline Plus

    Full Text Available ... or heart. Some people with type 2 can control their blood glucose with healthy eating and being ... 2 Recently Diagnosed Treatment and Care Blood Glucose Control Complications Medication Doctors, Nurses & More Enroll in the ...

  5. CO2 -Responsive polymers.

    Science.gov (United States)

    Lin, Shaojian; Theato, Patrick

    2013-07-25

    This Review focuses on the recent progress in the area of CO2 -responsive polymers and provides detailed descriptions of these existing examples. CO2 -responsive polymers can be categorized into three types based on their CO2 -responsive groups: amidine, amine, and carboxyl groups. Compared with traditional temperature, pH, or light stimuli-responsive polymers, CO2 -responsive polymers provide the advantage to use CO2 as a "green" trigger as well as to capture CO2 directly from air. In addition, the current challenges of CO2 -responsive polymers are discussed and the different solution methods are compared. Noteworthy, CO2 -responsive polymers are considered to have a prosperous future in various scientific areas.

  6. Reference: ARELIKEGHPGDFR2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ARELIKEGHPGDFR2 Lesnick ML, Chandler VL. Activation of the maize anthocyanin gene a...2 is mediated by an element conserved in many anthocyanin promoters. Plant Physiol. 117: 437-445 (1998). PubMed: 9625696 ...

  7. Facts about Type 2

    Medline Plus

    Full Text Available ... August 1, 2013 Last Edited: October 27, 2015 Articles from Diabetes Forecast® magazine: lp-type-2, In ... Basics Symptoms Type 1 Type 2 Gestational Myths Statistics Common Terms Genetics Living With Diabetes Recently Diagnosed ...

  8. Main: ACIPVPAL2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACIPVPAL2 S000192 15-September-2006 (last modified) kehi ACI element found at -83 t...o -74 of bean (P.v.) PAL2 promoter; AC-rich element; ACI element is required for vascular-specific gene expression; See also ACIIPV...PAL2 (S000193) and ACIIIPVPAL2 (S000194); Three AC-elements, which are possible Myb p

  9. Cryptanalysis of C2

    DEFF Research Database (Denmark)

    Borghoff, Julia; Knudsen, Lars Ramkilde; Leander, Gregor;

    2009-01-01

    We present several attacks on the block cipher C2, which is used for encrypting DVD Audio discs and Secure Digital cards. C2 has a 56 bit key and a secret 8 to 8 bit S-box. We show that if the attacker is allowed to choose the key, the S-box can be recovered in 2^24 C2 encryptions. Attacking the ...

  10. Cryptanalysis of MDC-2

    DEFF Research Database (Denmark)

    Knudsen, Lars Ramkilde; Mendel, Florian; Rechberger, Christian;

    2009-01-01

    We provide a collision attack and preimage attacks on the MDC-2 construction, which is a method (dating back to 1988) of turning an $n$-bit block cipher into a $2n$-bit hash function. The collision attack is the first below the birthday bound to be described for MDC-2 and, with $n=128$, it has co...

  11. Main: RYREPEATGMGY2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available RYREPEATGMGY2 S000105 11-May-2006 (last modified) kehi RY repeat motif (CATGCAT); P...resent in the 5' region of the soybean (G.m.) glycinin gene (Gy2); glycinin; CATGCAT; Gy2; seed; soybean (Glycine max); CATGCAT ...

  12. Facts about Type 2

    Medline Plus

    Full Text Available ... Home Prevention Diagnosing Diabetes and Learning About Prediabetes Type 2 Diabetes Risk Test Lower Your Risk Healthy Eating Overweight ... About Type 2 Enroll in the Living WIth Type 2 Diabetes Program Gestational What is Gestational Diabetes? How to ...

  13. Cryptanalysis of MD2

    DEFF Research Database (Denmark)

    Knudsen, Lars Ramkilde; Mathiassen, John Erik; Muller, Frédéric

    2010-01-01

    This paper considers the hash function MD2 which was developed by Ron Rivest in 1989. Despite its age, MD2 has withstood cryptanalytic attacks until recently. This paper contains the state-of-the-art cryptanalytic results on MD2, in particular collision and preimage attacks on the full hash...

  14. The USSO2 Auction

    DEFF Research Database (Denmark)

    Svendsen, Gert Tinggaard; Christensen, J.L.

    1999-01-01

    An annual discriminative and revenue-neutral auction is linked to the new Acid Rain Program which allows electric utilities all over the US to trade SO2 emission permits. This innovative SO2 auction distributes 2% of the permits in circulation and takes place at the Chicago Board of Trade. Early...

  15. CO2 blood test

    Science.gov (United States)

    Bicarbonate test; HCO3-; Carbon dioxide test; TCO2; Total CO2; CO2 test - serum ... Many medicines can interfere with blood test results. Your health care provider will tell you if you need to stop taking any medicines before you have this test. DO ...

  16. 1-Methoxy-3-o-tolylbicyclo[2.2.2]oct-5-ene-2,2-dicarbonitrile

    Directory of Open Access Journals (Sweden)

    Orhan Büyükgüngör

    2009-09-01

    Full Text Available In the title compound, C18H18N2O, the cyclohexene and cyclohexane rings of the bicyclo[2.2.2]oct-5-ene unit adopt distorted boat conformations. In the crystal, molecules exist as C—H...N hydrogen-bonded centrosymmetric R22(14 dimers, which are further linked by C—H...π interactions.

  17. 2-Methoxybenzaldehyde 2,4-dinitrophenylhydrazone

    Directory of Open Access Journals (Sweden)

    Hadi Kargar

    2009-02-01

    Full Text Available In the title compound, C14H12N4O5, an intramolecular N—H...O hydrogen bond generates an S(6 ring motif. The dihedral angle between the two benzene rings is 3.91 (3°, which shows the molecule is almost planar. The para-nitro group is twisted from the benzene ring to which it is attached, making a dihedral angle of 8.50 (9°. In the crystal structure, molecules are linked together by intermolecular C—H...O and intermolecular three-centred O...O [2.8646 (12–2.9213 (11 Å] and O...N [3.0518 (11 Å] interactions. The crystal structure is further stabilized by intermolecular π–π interactions [centroid-to-centroid distances 3.5708 (6–3.9728 (12 Å].

  18. 2-Amino-5-bromopyridinium 2-phenoxyacetate

    Directory of Open Access Journals (Sweden)

    Nallathambi Dhanabalan

    2016-12-01

    Full Text Available The phenoxyacetate anion of the title salt, C5H6BrN2+·C8H7O3−, is essentially planar, with a dihedral angle of 7.6 (5° between the carboxylate group and the benzene ring. In the crystal, the cation and the anion are linked via N—H...O hydrogen bonds, forming a helical chain along a 21 screw axis. In the chain, a π–π stacking interaction between the pyridinium and benzene rings, with a centroid–centroid distance of 3.854 (2 Å, and a C—H...O interaction are observed. The chains are further linked through another C—H...O hydrogen bond, forming a three-dimensional network.

  19. 2-Amino-4-methylpyridinium 2-hydroxybenzoate

    Directory of Open Access Journals (Sweden)

    Madhukar Hemamalini

    2010-08-01

    Full Text Available The asymmetric unit of the title molecular salt, C6H9N2+·C7H5O3−, contains two cations and two anions. Both the salicylate anions contain an intramolecular O—H...O hydrogen bond, which generates an S(6 ring. Both the 2-amino-4-methylpyridine molecules are protonated at their pyridine N atoms. In the crystal, both cations form two N—H...O hydrogen bonds to their adjacent anions, forming ion pairs. Further N—H...O links generate sheets lying parallel to the ab plane. In addition, weak C—H...O bonds and aromatic π–π stacking interactions [centroid–centroid distances = 3.5691 (9 and 3.6215 (9 Å] are observed between the cations and anions.

  20. N′-(Adamantan-2-ylidenethiophene-2-carbohydrazide

    Directory of Open Access Journals (Sweden)

    Adnan A. Kadi

    2011-11-01

    Full Text Available In the title molecule, C15H18N2OS, a small twist is noted, with the dihedral angle between the central carbohydrazone residue (r.m.s. deviation = 0.029 Å and the thiophene ring being 12.47 (10°. The syn arrangement of the amide H and carbonyl O atoms allows for the formation of centrosymmetric dimers via N—H...O hydrogen bonds. These are linked in the three-dimensional structure by C—H...π interactions. The thiophene ring is disordered over two co-planar orientations, the major component having a site-occupancy factor of 0.833 (2.

  1. (E-1-Benzylidene-2,2-diphenylhydrazine

    Directory of Open Access Journals (Sweden)

    Angel Mendoza

    2012-02-01

    Full Text Available The asymmetric unit of the title compound, C19H16N2, contains two independent molecules, both of which show an E configuration with respect to the C=N bond. The dihedral angles between the phenyl rings bonded to the hydrazine group are 81.00 (10 and 88.34 (8° in the two molecules. Intermolecular C—H...π interactions are observed in the crystal structure.

  2. N-(2-Pyridylmethylphthalimide

    Directory of Open Access Journals (Sweden)

    Olga Garduño-Beltrán

    2009-10-01

    Full Text Available In the title compound, C14H10N2O2, the phtalimide and 2-pyridylmethyl units are almost perpendicular, with an interplanar angle of 85.74 (2°. In the crystal, molecules are linked by weak C—H...O interactions, forming chains running along the b axis. The packing is further stabilized by offset π–π interactions between adjacent pyridine rings, with a centroid–centroid distance of 3.855 (2 Å.

  3. Crystal structure of 3-(2,2-dibromoacetyl-4-hydroxy-2H-chromen-2-one

    Directory of Open Access Journals (Sweden)

    Ameni Brahmia

    2015-02-01

    Full Text Available The title compound, C11H6Br2O4, is a new coumarin derivative obtained from the reaction of 3-acetyl-4-hydroxy-2H-chromen-2-one with bromine in acetic acid. The hydroxyl group in involved in an intramolecular O—H...O hydrogen bond. In the crystal, π–π interactions between the rings of the bicycle [intercentroid distances = 3.498 (2 and 3.539 (2 Å] pack molecules into stacks along the b axis, and weak intermolecular C—H...O hydrogen bonds further link these stacks into layers parallel to the ab plane.

  4. 2-Acetylpyridinium bromanilate

    Directory of Open Access Journals (Sweden)

    Lynne H. Thomas

    2009-06-01

    Full Text Available In the crystal of the title molecular salt (systematic name: 2-acetylpyridinium 2,5-dibromo-4-hydroxy-3,6-dioxocyclohexa-1,4-dienolate, C7H8NO+·C6HBr2O4−, centrosymmetric rings consisting of two cations and two anions are formed, with the components linked by alternating O—H...O and N—H...O hydrogen bonds. Short O...Br contacts [3.243 (2 and 3.359 (2 Å] may help to consolidate the packing.

  5. (0,2) trialities

    Energy Technology Data Exchange (ETDEWEB)

    Gadde, Abhijit [California Institute of Technology,Pasadena, CA 91125 (United States); Gukov, Sergei [California Institute of Technology,Pasadena, CA 91125 (United States); Max-Planck-Institut für Mathematik,Vivatsgasse 7, D-53111 Bonn (Germany); Putrov, Pavel [California Institute of Technology,Pasadena, CA 91125 (United States)

    2014-03-17

    Motivated by the connection between 4-manifolds and 2d N=(0,2) theories, we study the dynamics of a fairly large class of 2d N=(0,2) gauge theories. We see that physics of such theories is very rich, much as the physics of 4d N=1 theories. We discover a new type of duality that is very reminiscent of the 4d Seiberg duality. Surprisingly, the new 2d duality is an operation of order three: it is IR equivalence of three different theories and, as such, is actually a triality. We also consider quiver theories and study their triality webs. Given a quiver graph, we find that supersymmetry is dynamically broken unless the ranks of the gauge groups and flavor groups satisfy stringent inequalities. In fact, for most of the graphs these inequalities have no solutions. This supports the folklore theorem that generic 2d N=(0,2) theories break supersymmetry dynamically.

  6. (0,2) Trialities

    CERN Document Server

    Gadde, Abhijit; Putrov, Pavel

    2013-01-01

    Motivated by the connection between 4-manifolds and 2d N=(0,2) theories, we study the dynamics of a fairly large class of 2d N=(0,2) gauge theories. We see that physics of such theories is very rich, much as the physics of 4d N=1 theories. We discover a new type of duality that is very reminiscent of the 4d Seiberg duality. Surprisingly, the new 2d duality is an operation of order three: it is IR equivalence of three different theories and, as such, is actually a triality. We also consider quiver theories and study their triality webs. Given a quiver graph, we find that supersymmetry is dynamically broken unless the ranks of the gauge groups and flavor groups satisfy stringent inequalities. In fact, for most of the graphs these inequalities have no solutions. This supports the folklore theorem that generic 2d N=(0,2) theories break supersymmetry dynamically.

  7. A search for superdeformed and hyperdeformed states in $^{2}^{2}^{2}Th$ and $^{2}^{3}^{2}U$

    CERN Document Server

    Hawcroft, D

    2000-01-01

    sup 2 sup 2 Th potential energy surface which would be emitted prior to a decay out of the well by fission. Nuclear states in sup 2 sup 3 sup 2 U were investigated through conversion electron spectroscopy using the SACRED multi-element electron detection system. The high segmentation of the silicon detector array enabled us to detect multiple electrons simultaneously and therefore enhance the sensitivity of the experiment towards bands with high electron multiplicity. The sup 2 sup 3 sup 2 Th (alpha,4n) sup 2 sup 3 sup 2 U reaction was used with a beam energy of 42 MeV. In all three cases no evidence towards the existence of superdeformed states in sup 2 sup 2 sup 2 Th or sup 2 sup 3 sup 2 U or hyperdeformed states in sup 2 sup 3 sup 2 U were found. The experimental data were used to determine upper limits for the reaction cross sections leading to the population of states in the second or third minima in the potential energy surfaces. These upper limit cross sections were evaluated as: 900 mu b for the popul...

  8. Photolysis of H2O-H2O2 Mixtures: The Destruction of H2O2

    Science.gov (United States)

    Loeffler, M. J.; Fama, M.; Baragiola, R. A.; Carlson, R. W.

    2013-01-01

    We present laboratory results on the loss of H2O2 in solid H2O + H2O2 mixtures at temperatures between 21 and 145 K initiated by UV photolysis (193 nm). Using infrared spectroscopy and microbalance gravimetry, we measured the decrease of the 3.5 micrometer infrared absorption band during UV irradiation and obtained a photodestruction cross section that varies with temperature, being lowest at 70 K. We use our results, along with our previously measured H2O2 production rates via ionizing radiation and ion energy fluxes from the spacecraft to compare H2O2 creation and destruction at icy satellites by ions from their planetary magnetosphere and from solar UV photons. We conclude that, in many cases, H2O2 is not observed on icy satellite surfaces because the H2O2 photodestruction rate is much higher than the production rate via energetic particles, effectively keeping the H2O2 infrared signature at or below the noise level.

  9. NEW 2-(2-PHENYLETHYL) CHROMONES FROM BOTHRIOCHLOA ISCHAEMUM

    Institute of Scientific and Technical Information of China (English)

    TAO WANG; LAN-FANG LI; KUI ZHANG; WEN-YAN ZHANG; YUE-HU PEI

    2001-01-01

    Two new 2-(2-Phenylethyl) chromones were isolated from Bothriochloa ischaemum (Grami neae). They were characterized as 5-hydroxy-6-methoxy-2-[2-(2-hydroxyphenyl)-ethyl]-chro mone(1) and 5-hydroxy-2-[2-(2-hydroxyphenyl)-ethyl]-chromone(2) by means of spectroscopic analysis, especially 2D-NMR experiments.

  10. ALOS-2 initial results

    Science.gov (United States)

    Kankaku, Yukihiro; Suzuki, Shinichi; Shimada, Masanobu

    2015-10-01

    The Advanced Land Observing Satellite-2 (ALOS-2) was launched from Tanegashima Space Center by H-IIA rocket successfully on 24th May 2014. ALOS-2 carries the Phased Array type L-band Synthetic Aperture Radar-2 (PALSAR-2) as the state-of-the-art L-band SAR system which succeeds to PALSAR onboard ALOS. PALSAR-2 uses almost whole bandwidth allocated for L-band active sensor of Earth Exploration Satellites Service specified by the Radio Regulation in order to realize the high resolution observation, and also, it transmits more than 6 kW power for lower Noise Equivalent Sigma Zero using 180 TRMs driven by Gallium Nitride (GaN) amplifier which is the first use in space. Furthermore, because ALOS-2 carries the SAR system only, PALSAR-2 antenna can be mounted under the satellite body. It enables to observe right-/left-looking observation by satellite maneuvering. And the high accuracy orbit control to maintain the satellite within 500 m radius tube against the reference orbit enables high coherence for the InSAR processing. Using these new technologies, ALOS-2 has been operating to fulfill the mission requirements such as disaster monitoring and so on. This document introduces the initial result of ALOS-2 from the first year operation.

  11. (S-2-[(2-Hydroxybenzylazaniumyl]-4-(methylsulfanylbutanoate

    Directory of Open Access Journals (Sweden)

    Giovanna Brancatelli

    2011-06-01

    Full Text Available The zwitterionic title compound, C12H17NO3S, is a reduced Schiff base derived from (S-N-(2-hydroxybenzylidenemethionine. An intramolecular interaction between the N—H and carboxylate groups forms a roughly planar (r.m.s. deviation = 0.1405 Å five-membered ring containing the H(N, N, Cα, C(carboxylate and O atoms in a pentagonal conformation. In the crystal, a supramolecular triangle-shaped motif is generated by molecules held together by O—H...O and N—H...O hydrogen bonds.

  12. European wind turbine standards 2 (EWTS-2)

    Energy Technology Data Exchange (ETDEWEB)

    Pierik, J.T.G.; Dekker, J.W.M.; Braam, H. [and others

    1999-03-01

    A summary is given of the main results of the European Wind Turbine Standards II project. EWTS-II was completed in 1998 and included investigations on: 1) wind farms-wind field and turbine loading; 2) complex terrain and fatigue loading; 3) extreme wind conditions; 4) quantification of failure probabilities; 5) integration of blade tests in design; 6) power performance in complex terrain; 7) site evaluation. In addition to these scientific evaluations, the EWTS-II participants established an organization of qualified measuring institute in the field of wind energy, the MEASNET organization. MEASNET unified measurement procedures of the participating institutes and guarantees qualified measurements and mutual acceptance among its members. (LN)

  13. Analyzing Evolving Social Network 2 (EVOLVE2)

    Science.gov (United States)

    2015-04-01

    paradigm (red) by the challenger paradigm (blue) can be visualized as the decline of Φ of the complement cascade (green). (c) An example cascade... visualized as the area between the red and green curves in Figure 1(b) from t0 to t0 + τ . The disruption score allows us to identify and measure the... AeT is taken as out-degree centrality [2]. Alpha-Centrality gives the steady state distribution of an epidemic process on a network [10], where α is

  14. (E-2-[(2-Ethylphenyliminomethyl]-6-methoxyphenol

    Directory of Open Access Journals (Sweden)

    Serap Yazıcı

    2010-02-01

    Full Text Available The molecule of the title compound, C16H17NO2, adopts the phenol–imine tautomeric form with a strong intramolecular O—H...N hydrogen bond and an E conformation with respect to the azomethine C=N bond. The dihedral angle between the aromatic rings is 21.23 (9°. The ethyl group is disordered over two orientations with occupancies of 0.598 (6 and 0.402 (6. In the crystal, the molecules are linked into chains along the b axis by C—H...π interactions.

  15. CO2NNIE

    DEFF Research Database (Denmark)

    Krogh, Benjamin Bjerre; Andersen, Ove; Lewis-Kelham, Edwin;

    2015-01-01

    We propose a system for calculating the personalized annual fuel consumption and CO2 emissions from transportation. The system, named CO2NNIE, estimates the fuel consumption on the fastest route between the frequent destinations of the user. The travel time and fuel consumption estimated are based......% of the actual fuel consumption (4.6% deviation on average). We conclude, that the system provides new detailed information on CO2 emissions and fuel consumption for any make and model....

  16. The Delta 2 launcher

    Science.gov (United States)

    Ousley, Gilbert W., Sr.

    1991-12-01

    The utilization of the Delta 2 as the vehicle for launching Aristoteles into its near Sun synchronous orbit is addressed. Delta is NASA's most reliable launch vehicle and is well suited for placing the present Aristoteles spacecraft into a 400 m circular orbit. A summary of some of the Delta 2 flight parameters is presented. Diagrams of a typical Delta 2 two stage separation are included along with statistics on delta reliability and launch plans.

  17. 2-(Methylsulfanylcyclododecanone tosylhydrazone

    Directory of Open Access Journals (Sweden)

    Dao-Quan Wang

    2008-04-01

    Full Text Available The title compound, C20H32N2O2S2, has been synthesized by the reaction of α-methylsulfanylcyclododecanone and p-toluenesulfonylhydrazine. In the crystal structure, the conformation of the non-benzenoid ring is [3333] and the methylsulfanyl group is in the α-side exo position. The molecules are linked by intermolecular N—H...S hydrogen bonds.

  18. ABCG2: A Perspective

    OpenAIRE

    Robey, Robert W.; To, Kenneth K. K.; Polgar, Orsolya; Dohse, Marius; Fetsch, Patricia; Dean, Michael; Bates, Susan E.

    2008-01-01

    ABCG2, or Breast Cancer Resistance Protein (BCRP), is an ABC transporter that has been the subject of intense study since its discovery a decade ago. With high normal tissue expression in the brain endothelium, gastrointestinal tract, and placenta, ABCG2 is believed to be important in protection from xenobiotics, regulating oral bioavailability, forming part of the blood-brain barrier, the blood-testis barrier, and the maternal-fetal barrier. Notably, ABCG2 is often expressed in stem cell pop...

  19. Deletion (2)(q37)

    Energy Technology Data Exchange (ETDEWEB)

    Stratton, R.F.; Tolworthy, J.A.; Young, R.S. [South Texas Genetics Center, San Antonio, TX (United States)

    1994-06-01

    We report on a 5-month-old girl with widely spaced nipples, redundant nuchal skin, coarctation of the aorta, anal atresia with distal fistula, postnatal growth retardation, hypotonia, and sparse scalp hair. Initial clinical assessment suggested the diagnosis of Ullrich-Turner syndrome. Chromosome analysis showed a 46,XX,del(2)(q37) karyotype in peripheral lymphocytes. We compare her findings to those of other reported patients with terminal deletions of 2q. 8 refs., 2 figs., 1 tab.

  20. Wearable CO2 sensor

    OpenAIRE

    Radu, Tanja; Fay, Cormac; Lau, King-Tong; Waite, Rhys; Diamond, Dermot

    2009-01-01

    High concentrations of CO2 may develop particularly in the closed spaces during fires and can endanger the health of emergency personnel by causing serious physiological effects. The proposed prototype provides real-time continuous monitoring of CO2 in a wearable configuration sensing platform. A commercially available electrochemical CO2 sensor was selected due to its selectivity, sensitivity and low power demand. This was integrated onto an electronics platform that performed signal capture...

  1. B2B marketing

    OpenAIRE

    Pospíšilová, Lucie

    2010-01-01

    The main goal of this bachelor thesis is to apply theoretical knowledge in B2B marketing to the example of marketing processes in a particular company, to evaluate the current situation of its activities with regard to B2B principles and to suggest relevant recommendations. The theoretical part focuses on specific characteristics of B2B marketing, describes its differences from marketing on consumer markets, deals with buying behaviour of organizations and specifies particular features of mar...

  2. 2-Hydroxy-4-(prop-2-ynyloxybenzaldehyde

    Directory of Open Access Journals (Sweden)

    D. Velmurugan

    2013-01-01

    Full Text Available The asymmetric unit of the title compound, C10H8O3, contains two independent molecules, both of which are almost planar (r.m.s deviations for all non-H atoms of 0.044 and 0.053 Å. The dihedral angles between the benzene ring and the prop-1-yne group are 3.47 (1 and 3.07 (1° in the two molecules, and the prop-1-yne groups adopt extended conformations. In each molecule, an intramolecular O—H...O hydrogen bond involving the OH and aldehyde substituents forms an S(6 ring. In the crystal, molecules are linked into cyclic centrosymmetric dimers via C—H...O hydrogen bonds, generating R22(14 ring motifs. The crystal structure is further stabilized by aromatic π–π stacking interactions between the benzene rings [centroid–centroid distances = 3.813 (2 and 3.843 (2 Å

  3. [2Fe-2S] Proteins in chlorosomes

    DEFF Research Database (Denmark)

    Johnson, T. Wade; Li, Hui; Frigaard, Niels-Ulrik;

    2013-01-01

    The chlorosome envelope of Chlorobaculum tepidum contains 10 polypeptides, three of which, CsmI, CsmJ, and CsmX, have an adrenodoxin-like domain harboring a single [2Fe-2S] cluster. Mutants that produced chlorosomes containing two, one, or none of these Fe-S proteins were constructed [Li, H., et al....... (2013) Biochemistry 52, preceding paper in this issue ( DOI: 10.1021/bi301454g )]. The electron paramagnetic resonance (EPR) spectra, g values, and line widths of the Fe-S clusters in individual CsmI, CsmJ, and CsmX proteins were obtained from studies with isolated chlorosomes. The Fe-S clusters...... in these proteins were characterized by EPR and could be differentiated on the basis of their g values and line widths. The EPR spectrum of wild-type chlorosomes could be simulated by a 1:1 admixture of the CsmI and CsmJ spectra. No contribution of CsmX to the EPR spectrum of chlorosomes was observed because of its...

  4. CRAC2 model description

    Energy Technology Data Exchange (ETDEWEB)

    Ritchie, L.T.; Alpert, D.J.; Burke, R.P.; Johnson, J.D.; Ostmeyer, R.M.; Aldrich, D.C.; Blond, R.M.

    1984-03-01

    The CRAC2 computer code is a revised version of CRAC (Calculation of Reactor Accident Consequences) which was developed for the Reactor Safety Study. This document provides an overview of the CRAC2 code and a description of each of the models used. Significant improvements incorporated into CRAC2 include an improved weather sequence sampling technique, a new evacuation model, and new output capabilities. In addition, refinements have been made to the atmospheric transport and deposition model. Details of the modeling differences between CRAC2 and CRAC are emphasized in the model descriptions.

  5. Synthesis, characterization and antifungal studies of metalloquinolone [Cd2(nal2(phen2(Cl2

    Directory of Open Access Journals (Sweden)

    A. Debnath

    2014-12-01

    Full Text Available A novel dinuclear, distorted octahedral complex of nalidixic acid (nal with Cd(II metal ion with the formula [Cd2(Nal2(Phen2(Cl2] has been synthesized in the presence of N-containing heterocyclic ligand, 1,10-phenanthroline (phen. The synthesized metal complex was characterized using CHN analysis, Fourier transformed infra-red, thermo gravimetric analysis, differential scanning chalorimetry, nuclear magnetic resonance, ultra violet-visible and single-crystal X-ray diffraction. The newly synthesized complex shows more pronounced antifungal activity compared with the parent quinolone against four fungi, namely Pythium aphanidermatum, Sclerotinia rolfsii, Rhizoctonia solani and Rhizoctonia bataticola.

  6. Web 2.0

    CERN Document Server

    Han, Sam

    2012-01-01

    Web 2.0 is a highly accessible introductory text examining all the crucial discussions and issues which surround the changing nature of the World Wide Web. It not only contextualises the Web 2.0 within the history of the Web, but also goes on to explore its position within the broader dispositif of emerging media technologies.The book uncovers the connections between diverse media technologies including mobile smart phones, hand-held multimedia players, ""netbooks"" and electronic book readers such as the Amazon Kindle, all of which are made possible only by the Web 2.0. In addition, Web 2.0 m

  7. 76 FR 41135 - 2-Propenoic acid, 2-methyl-, phenylmethyl ester, polymer with 2-propenoic acid and sodium 2...

    Science.gov (United States)

    2011-07-13

    ... AGENCY 40 CFR Part 180 2-Propenoic acid, 2-methyl-, phenylmethyl ester, polymer with 2- propenoic acid...-Propenoic acid, 2-methyl-, phenylmethyl ester, polymer with 2-propenoic acid and sodium 2-methyl- 2- -1... for residues of 2-Propenoic acid, 2-methyl-,phenylmethyl ester, polymer with 2-propenoic acid...

  8. Comparison of [Ni(PPh2NPh2)2(CH3CN)]2+ and [Pd(PPh2NPh2)2]2+ as Electrocatalysts for H2 Production

    Energy Technology Data Exchange (ETDEWEB)

    Wiedner, Eric S.; Helm, Monte L.

    2014-09-22

    The complexes [Ni(PPh2NPh2)2(CH3CN)]2+ and [Pd(PPh2NPh2)2]2+, where PPh2NPh2 is 1,5-diphenyl-3,7-diphenyl-1,5-diaza-3,7-diphosphacyclooctane, are compared as electrocatalysts for H2 production under identical experimental conditions. With [(DMF)H]+ as the acid in acetonitrile solution, [Pd(PPh2NPh2)2]2+ afforded a turnover frequency (TOF) of 230 s-1 for formation of H2 under dry conditions and a TOF of 640 s-1 when H2O was added. These rates are similar to the TOF’s of 590 s-1 (dry) and 720 s-1 (wet) that were previously measured for [Ni(PPh2NPh2)2(CH3CN)]2+ using [(DMF)H]+. The [Ni(PPh2NPh2)2(CH3CN)]2+ and [Pd(PPh2NPh2)2]2+ complexes both exhibited large current enhancements when treated with trifluoroacetic acid (TFA). At a TFA concentration of 1.8 M, TOF values of 5670 s-1 and 2060 s-1 were measured for [Ni(PPh2NPh2)2(CH3CN)]2+ and [Pd(PPh2NPh2)2]2+, respectively. The fast rates observed using TFA are, in part, attributed to homoconjugation of TFA in acetonitrile solutions, which decreases the effective pKa of the acid. In support of this hypothesis, dramatically lower rates of H2 production were observed using p anisidinium, which has a pKa comparable to TFA but does not homoconjugate significantly in acetonitrile solutions. This research was supported as part of the Center for Molecular Electrocatalysis, an Energy Frontier Research Center funded by the U.S. Department of Energy, Office of Science, Office of Basic Energy Sciences. Pacific Northwest National Laboratory is oper-ated by Battelle for the U.S. Department of Energy.

  9. Hydrothermal Synthesis and Crystal Structure of a Bivanadyl Capped Keggin Polyoxometalate [Zn(2,2'-bpy)2(H2O)]2[HPMo12O40(VO)2

    Institute of Scientific and Technical Information of China (English)

    吕秀清; 陈建新; 兰婷燕; 黄远标

    2005-01-01

    A hydrothermal reaction of zinc acetate with molybdenum trioxide, vanadium pentoxide, phosphorus pentoxide and 2,2'-bpy (2,2'-bipyridine) led to the title compound [Zn(2,2'- bpy)2(H2O)]2[HPMo12O4o(VO)2] 1. Single-crystal X-ray diffraction revealed that 1 (C40H36- N8O44PV2Zn2Mo12) crystallizes in the triclinic system, space group P1 with a = 11.881(2), b = 12.468(2), c = 12.622(2) (A), a = 71.333(8), β = 74.485(4), γ = 86.896(5)°, V = 1705.8(4) (A)3, Mr = 2747.64, Z = 1, Dc = 2.675 g/cm3, μ = 3.201 mm-1, F(000) = 1309, S = 1.070, the final R = 0.0697 and wR = 0.1905 for 5368 observed reflections with I > 2σ(I). Compound 1 is built on a mixed-metal bicapped [HPMoi2V2O42] subunit covalently bonded to two [Zn(2,2'-bpy)2(H2O)]2+ clusters via terminal oxygen atoms of the capping V atoms. Each Zn atom is six-coordinated by four nitrogen atoms from two 2,2'-bpy ligands, one terminal oxygen atom from coordinated water mole cule and another one from the capped {VO} unit.

  10. Outsourcing CO2 Emissions

    Science.gov (United States)

    Davis, S. J.; Caldeira, K. G.

    2009-12-01

    CO2 emissions from the burning of fossil fuels are the primary cause of global warming. Much attention has been focused on the CO2 directly emitted by each country, but relatively little attention has been paid to the amount of emissions associated with consumption of goods and services in each country. This consumption-based emissions inventory differs from the production-based inventory because of imports and exports of goods and services that, either directly or indirectly, involved CO2 emissions. Using the latest available data and reasonable assumptions regarding trans-shipment of embodied carbon through third-party countries, we developed a global consumption-based CO2 emissions inventory and have calculated associated consumption-based energy and carbon intensities. We find that, in 2004, 24% of CO2 emissions are effectively outsourced to other countries, with much of the developed world outsourcing CO2 emissions to emerging markets, principally China. Some wealthy countries, including Switzerland and Sweden, outsource over half of their consumption-based emissions, with many northern Europeans outsourcing more than three tons of emissions per person per year. The United States is both a big importer and exporter of emissions embodied in trade, outsourcing >2.6 tons of CO2 per person and at the same time as >2.0 tons of CO2 per person are outsourced to the United States. These large flows indicate that CO2 emissions embodied in trade must be taken into consideration when considering responsibility for increasing atmospheric greenhouse gas concentrations.

  11. Molecular Photoabsorption Cross Sections In The Ultraviolet: N2, SO2, S2, CO2

    Science.gov (United States)

    Smith, Peter L.; Stark, G.; Blackie, D.; Pickering, J. C.; Lewis, B. R.; Heays, A. N.

    2011-05-01

    Our research program focuses on the measurement of ultraviolet molecular photoabsorption cross sections with the highest practical resolution. It supports efforts to interpret and model observations of planetary atmospheres. Measurement efforts on molecular nitrogen, sulfur dioxide, diatomic sulfur, and carbon dioxide are in progress. N2: We focus on the measurement of line f-values and line widths within the complex spectrum between 80 and 100 nm. Our measurements are incorporated into a theoretical model of N2 which has established the mechanisms responsible for predissociation and reproduces all observed absorption features in 14N2 and its isotopologues as a function of temperature. SO2: Using the Imperial College UV Fourier transform spectrometer, we have completed and published cross sections at room temperature from 198 to 325 nm, at 198 K from 213 to 325 nm, and at 160 K from 199 to 220 nm. S2: Interpretations of atmospheric (Io, Jupiter, cometary comae) S2 absorption features are hindered by a complete lack of laboratory cross section data in the ultraviolet. We are working to quantify the photoabsorption spectrum of S2 from 200 to 300 nm based on laboratory measurements and theoretical calculations. We have designed an experimental apparatus to produce a stable column of S2 vapor. Measurements of the absorption spectrum of S2 at high resolution will be complemented by coupled-channel calculations. CO2: The photodissociation of CO2 is a fundamental photochemical process in the atmospheres of Mars and Venus. Our research centers on the measurement of high resolution cross sections from 87 to 120 nm. We have completed measurements at 295 K and 195 K over the 106 to 120 nm region, and we have recorded preliminary data of the room temperature spectrum in the 87 to 106 nm region.

  12. Single crystal growth and physical properties of SrCu2As2, SrCu2Sb2 and BaCu2Sb2

    Science.gov (United States)

    Anand, V. K.; Perera, P. K.; Pandey, A.; Goetsch, R. J.; Kreyssig, A.; Johnston, D. C.

    2012-02-01

    We present the physical properties of self-flux-grown single crystals of SrCu2As2, SrCu2Sb2, SrCu2(As0.84Sb0.16)2 and BaCu2Sb2 investigated by magnetic susceptibility χ, specific heat Cp and electrical resistivity ρ vs. temperature T measurements. Contrasting structures occur for SrCu2As2 (ThCr2Si2-type), SrCu2Sb2 (CaBe2Ge2-type) and BaCu2Sb2 (a distorted intergrowth of ThCr2Si2-type and CaBe2Ge2-type unit cells). The χ(T) data for all these compounds exhibit weakly anisotropic diamagnetic behaviors. For 1.8 Debye lattice contributions. From the low-T Cp(T) data, we infer Sommerfeld coefficients γ = 2.2--3.9 mJ/mol,^2 and Debye temperatures θD = 204--246 K@. The electronic properties indicate that these compounds are sp metals containing Cu in a nonmagnetic 3d^10 electronic configuration.ootnotetextD. J. Singh, Phys. Rev. B 79, 153102 (2009).

  13. CO2 laser resurfacing.

    Science.gov (United States)

    Fitzpatrick, R E

    2001-07-01

    The CO2 Laser offers a variety of unique features in resurfacing facial photodamage and acne scarring. These include hemostasis, efficient removal of the epidermis in a single pass, thermally induced tissue tightening, and safe, predictable tissue interaction. Knowledge of these mechanisms will result in the capability of using the CO2 laser effectively and safely whether the goal is superficial or deep treatment.

  14. Main: ARELIKEGHPGDFR2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ARELIKEGHPGDFR2 S000437 28-November-2004 (last modified) kehi Sequence highly similar to ARE...ck and Chandler 1998); Binding site of R2R3-type MYB factor, GMYB 10 of G. hybrida; anthocyanina; ARE; DRF;

  15. Main: LECPLEACS2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available LECPLEACS2 S000465 24-April-2005 (last modified) kehi Core element in LeCp (tomato ...Cys protease) binding cis-element (from -715 to -675) in LeAcs2 gene; cysteine protease; ethylene; xylanase; ACS; Lycopersicon esculentum (tomato) TAAAATAT ...

  16. CMD-2 barrel calorimeter

    Energy Technology Data Exchange (ETDEWEB)

    Aulchenko, V.M. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation)); Baibusinov, B.O. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation)); Bondar, A.E. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation)); Kuzmin, A.S. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation)); Leontiev, L.A. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation)); Okhapkin, V.S. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation)); Pestsov, L.V. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation)); Smakhtin, V.P. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation)); Sukhanov, A.I. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation)); Shwartz, B.A. (Budker Inst. of Nuclear Physics, Novosibirsk (Russian Federation))

    1993-11-15

    The barrel calorimeter of the CMD-2 detector for the VEPP-2M collider is described. The calorimeter contains 892 CsI crystals read by PM tubes. Operation with it during the last year demonstrated good performance as well as energy and spatial resolution which are close to the corresponding project values. (orig.)

  17. Jarmers Plads 2

    DEFF Research Database (Denmark)

    Jensen, Thomas Bo

    2008-01-01

    Om Kreditforeningens hus på Jarmers Plads 2, København. Tegnet af arkitekterne Christian, Erik og Aage Holst 1954-59.......Om Kreditforeningens hus på Jarmers Plads 2, København. Tegnet af arkitekterne Christian, Erik og Aage Holst 1954-59....

  18. Diabetes Type 2

    Science.gov (United States)

    Diabetes means your blood glucose, or blood sugar, levels are too high. With type 2 diabetes, the more common type, your body does not ... You have a higher risk of type 2 diabetes if you are older, obese, have a family ...

  19. Comment: 2 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available bottlenosed dolphin Tursiops truncatus Tursiops_truncatus_L.png 2.png Taxonomy icon (c) Database Cen...ter for Life Science licensed under CC Attribution2.1 Japan サンプルの投稿です ttamura 2008/10/29 11:43:57 ...

  20. Thought 2 Talk

    DEFF Research Database (Denmark)

    Hendricks, Vincent F.

    Thought2Talk is a crash course on argument, reasoning and logical method honoring the Swedish poet and Bishop of Lund, Esaias Tegnér, who once said: The words and thoughts of men are born together: To speak obscurely is to think obscurely. In 100 humorous yet erudite pages, Thought2Talk takes...

  1. Facts about Type 2

    Science.gov (United States)

    ... Honor Become a Member En Español Type 1 Type 2 About Us Online Community Meal Planning Sign In Search: Search More Sites Search ≡ Are You At Risk? Diabetes Basics Living with Diabetes Food & Fitness In My ... Diabetes and Learning About Prediabetes Type 2 Diabetes Risk Test Lower Your Risk Healthy ...

  2. Facts about Type 2

    Medline Plus

    Full Text Available ... Honor Become a Member En Español Type 1 Type 2 About Us Online Community Meal Planning Sign In Search: Search More Sites Search ≡ Are You At Risk? Diabetes Basics Living with Diabetes Food & Fitness In My ... Diabetes and Learning About Prediabetes Type 2 Diabetes Risk Test Lower Your Risk Healthy ...

  3. Facts about Type 2

    Medline Plus

    Full Text Available ... Books for Practitioners Professional Membership Please Join Us in the Fight for a Cure Your tax-deductible ... Articles from Diabetes Forecast® magazine: lp-type-2, In this section Diabetes Basics Type 2 Facts About ...

  4. Douglas RD-2 Dolphin

    Science.gov (United States)

    1940-01-01

    Douglas RD-2 Dolphin: Originally purchased with the presumed use as a Presidential aircraft, this Douglas RD-2 was turned over to the NACA in December 1939 without ever fulfilling its intended role. The Dolphin was a type familiar to the NACA, who were testing a Army version of the Douglas amphibian, an OA-4V with a nosewheel.

  5. Multiple Stages 2

    DEFF Research Database (Denmark)

    Andreasen, John

    Multiple stages 2: theatrical futures, set design, community plays, cultural capitals, democracy & drama, WWII dramas, performance on adoption, promenade about emigration, qualities in political theatre, performance analysis, dramaturgical education, Toulmin Variations......Multiple stages 2: theatrical futures, set design, community plays, cultural capitals, democracy & drama, WWII dramas, performance on adoption, promenade about emigration, qualities in political theatre, performance analysis, dramaturgical education, Toulmin Variations...

  6. 2.GENERAL TREATMENT

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    2.2.Physical method of treatment930623 Clinical observation of Budd-Chiari syn-drome treated by balloon angioplasty(report of 24cases).XU Ke,et al.Dept Radiol,1st Hosp,China Med Univ,Shenyang,110001.Chin J Radiol1993;27(7):439—442.

  7. Angiotensin type 2 receptors

    DEFF Research Database (Denmark)

    Sumners, Colin; de Kloet, Annette D; Krause, Eric G;

    2015-01-01

    R blockade. Despite a lack of effect on blood pressure, AT2R stimulation still protects from hypertensive end-organ damage. Current data and evidence therefore suggest that AT2R agonists will not be suitable as future anti-hypertensive drugs, but that they may well be useful for end-organ protection...

  8. Tramadolium 2-chlorobenzoate

    Directory of Open Access Journals (Sweden)

    S. N. Sheshadri

    2016-01-01

    Full Text Available In the title molecular salt, C16H26NO2+·C7H4ClO2−, {systematic name: [2-hydroxy-2-(3-methoxyphenylcyclohexylmethyl]dimethylammonium 2-chlorobenzoate}, the cyclohexane ring of the cation exhibits a chair conformation with the aromatic and amine substituents in equatorial orientations and the hydroxyl group in an axial orientation. In the anion, the dihedral angle between the aromatic ring and the carboxylate group is 39.16 (13°. In the crystal, the cations are linked to the anions by O—H...O, N—H...O and C—H...O hydrogen bonds, generating [010] chains. Further C—H...O and C—H...π interactions are also observed, which link the chains into a three-dimensional framework.

  9. Sp(2) Renormalization

    CERN Document Server

    Lavrov, Peter M

    2010-01-01

    The renormalization of general gauge theories on flat and curved space-time backgrounds is considered within the Sp(2)-covariant quantization method. We assume the existence of a gauge-invariant and diffeomorphism invariant regularization. Using the Sp(2)-covariant formalism one can show that the theory possesses gauge invariant and diffeomorphism invariant renormalizability to all orders in the loop expansion and the extended BRST symmetry after renormalization is preserved. The advantage of the Sp(2)-method compared to the standard Batalin-Vilkovisky approach is that, in reducible theories, the structure of ghosts and ghosts for ghosts and auxiliary fields is described in terms of irreducible representations of the Sp(2) group. This makes the presentation of solutions to the master equations in more simple and systematic way because they are Sp(2)- scalars.

  10. Sp(2) renormalization

    Energy Technology Data Exchange (ETDEWEB)

    Lavrov, Peter M., E-mail: lavrov@tspu.edu.r [Department of Mathematical Analysis, Tomsk State Pedagogical University, Kievskaya St. 60, Tomsk 634061 (Russian Federation)

    2011-08-11

    The renormalization of general gauge theories on flat and curved space-time backgrounds is considered within the Sp(2)-covariant quantization method. We assume the existence of a gauge-invariant and diffeomorphism invariant regularization. Using the Sp(2)-covariant formalism one can show that the theory possesses gauge-invariant and diffeomorphism invariant renormalizability to all orders in the loop expansion and the extended BRST-symmetry after renormalization is preserved. The advantage of the Sp(2) method compared to the standard Batalin-Vilkovisky approach is that, in reducible theories, the structure of ghosts and ghosts for ghosts and auxiliary fields is described in terms of irreducible representations of the Sp(2) group. This makes the presentation of solutions to the master equations in more simple and systematic way because they are Sp(2)-scalars.

  11. DOE-2 basics

    Energy Technology Data Exchange (ETDEWEB)

    1991-08-01

    DOE-2 provides the building design and research communities with an up-to-date, unbiased, well-documented public-domain computer program for building energy analysis. DOE-2 predicts the hourly energy use and energy cost of a building given hourly weather information and a description of the building and its HVAC equipment and utility rate structure. DOE-2 is a portable FORTRAN program that can be used on a large variety of computers, including PC's. Using DOE-2, designers can determine the choice of building parameters that improve energy efficiency while maintaining thermal comfort. The purpose of DOE-2 is to aid in the analysis of energy usage in buildings; it is not intended to be the sole source of information relied upon for the design of buildings. The judgment and experience of the architect/engineer still remain the most important elements of building design.

  12. DOE-2 basics

    Energy Technology Data Exchange (ETDEWEB)

    1991-08-01

    DOE-2 provides the building design and research communities with an up-to-date, unbiased, well-documented public-domain computer program for building energy analysis. DOE-2 predicts the hourly energy use and energy cost of a building given hourly weather information and a description of the building and its HVAC equipment and utility rate structure. DOE-2 is a portable FORTRAN program that can be used on a large variety of computers, including PC`s. Using DOE-2, designers can determine the choice of building parameters that improve energy efficiency while maintaining thermal comfort. The purpose of DOE-2 is to aid in the analysis of energy usage in buildings; it is not intended to be the sole source of information relied upon for the design of buildings. The judgment and experience of the architect/engineer still remain the most important elements of building design.

  13. 2-C-branched glycosides from 2'-carbonylalkyl 2-O-Ms(Ts)-C-glycosides. A tandem SN2-SN2 reaction via 1,2-cyclopropanated sugars.

    Science.gov (United States)

    Shao, Huawu; Ekthawatchai, Sanchai; Wu, Shih-Hsiung; Zou, Wei

    2004-09-30

    [reaction: see text] Under basic conditions, 2'-aldehydo (acetonyl) 2-O-Ms(Ts)-alpha-C-glycosides undergo an intramolecular S(N)2 reaction to form 1,2-cyclopropanated sugars, which react with nucleophiles (alcohols, thiols, and azide) at the anomeric carbon to give 2-C-branched glycosides. By way of contrast, the 1,2-cyclopropanes derived from 2'-ketones only react with thiols to give 2-C-branched thioglycosides.

  14. Bis(2,2′-bipyridine(2-hydroxy-2,2-diphenylacetatocopper(II nitrate dihydrate

    Directory of Open Access Journals (Sweden)

    Xuan Xu

    2010-10-01

    Full Text Available In the title complex, [Cu(C14H11O3(C10H8N22]NO3·2H2O, the CuII atom is coordinated by four N atoms from two 2,2′-bipyridine ligands and two O atoms from one benzilate ligand in a distorted octahedral geometry. A supramolecular network is formed via intermolecular O—H...O and C—H...O hydrogen-bonding interactions. π–π stacking interactions between neighboring pyridine rings are also present, the centroid—centroid distance being 3.808 (2 Å.

  15. SCN2A encephalopathy

    Science.gov (United States)

    Howell, Katherine B.; McMahon, Jacinta M.; Carvill, Gemma L.; Tambunan, Dimira; Mackay, Mark T.; Rodriguez-Casero, Victoria; Webster, Richard; Clark, Damian; Freeman, Jeremy L.; Calvert, Sophie; Olson, Heather E.; Mandelstam, Simone; Poduri, Annapurna; Mefford, Heather C.; Harvey, A. Simon

    2015-01-01

    Objective: De novo SCN2A mutations have recently been associated with severe infantile-onset epilepsies. Herein, we define the phenotypic spectrum of SCN2A encephalopathy. Methods: Twelve patients with an SCN2A epileptic encephalopathy underwent electroclinical phenotyping. Results: Patients were aged 0.7 to 22 years; 3 were deceased. Seizures commenced on day 1–4 in 8, week 2–6 in 2, and after 1 year in 2. Characteristic features included clusters of brief focal seizures with multiple hourly (9 patients), multiple daily (2), or multiple weekly (1) seizures, peaking at maximal frequency within 3 months of onset. Multifocal interictal epileptiform discharges were seen in all. Three of 12 patients had infantile spasms. The epileptic syndrome at presentation was epilepsy of infancy with migrating focal seizures (EIMFS) in 7 and Ohtahara syndrome in 2. Nine patients had improved seizure control with sodium channel blockers including supratherapeutic or high therapeutic phenytoin levels in 5. Eight had severe to profound developmental impairment. Other features included movement disorders (10), axial hypotonia (11) with intermittent or persistent appendicular spasticity, early handedness, and severe gastrointestinal symptoms. Mutations arose de novo in 11 patients; paternal DNA was unavailable in one. Conclusions: Review of our 12 and 34 other reported cases of SCN2A encephalopathy suggests 3 phenotypes: neonatal-infantile–onset groups with severe and intermediate outcomes, and a childhood-onset group. Here, we show that SCN2A is the second most common cause of EIMFS and, importantly, does not always have a poor developmental outcome. Sodium channel blockers, particularly phenytoin, may improve seizure control. PMID:26291284

  16. Synthesis of high-surface-area spinel-type MgAl$_2$O$_4$ nanoparticles by [Al(sal)$_2$(H$_2$O)$_2$]$_2$[Mg(dipic)$_2$] and [Mg(H$_2$O)$_6$][Al(ox)$_2$(H$_2$O)$_2$]$_2$·5H$_2$O: influence of inorganic precursor type

    Indian Academy of Sciences (India)

    2017-02-01

    Spinel-type MgAl$_2$O$_4$ nanoparticles with high surface area were synthesized by thermal decomposition of three different ion-pair complexes precursors, including [Mg(H$_2$O)$_6$][Al(dipic)$_2$]$_2$·6H$_2$O, [Al(sal)$_2$(H$_2$O)$_2$]$_2$[Mg(dipic)$_2$] and [Mg(H$_2$O)$_6$][Al(ox)$_2$(H$_2$O)$_2$]$_2$·5H$_2$O. Influence of the inorganic precursor was investigated on synthesis and textural properties of magnesium aluminate nanopowders. The precursors [Mg(H$_2$O)$_6$][Al(dipic)$_2$]$_2$·6H$_2$O and [Al(sal)$_2$(H$_2$O)$_2$]$_2$[Mg(dipic)$_2$] displayed pure spinel-type MgAl$_2$O$_4$, while the sample synthesized by [Mg(H$_2$O)$_6$][Al(ox)$_2$(H$_2$O)$_2$]$_2$·5H$_2$O precursor consisted of MgAl$_2$O$_4$ and MgO. The MgAl$_2$O$_4$ synthesizedvia [Al(sal)$_2$(H$_2$O)$_2$]$_2$[Mg(dipic)$_2$] precursor exhibited higher BET specific surface area (226.7 m$^2$ g$^{−1}$) and smaller particle size than those of the samples obtained from the two other precursors.

  17. ???????????? ?????? ?????????????????? ???????? 1,2,3-???????? ?? 1?-?????????, ????????? ????????? ??????????????? ??????

    OpenAIRE

    2008-01-01

    ?????????? ?????????? ??????????? ? ???????? ??????? ??????? ????? ???????? 1,2,3-???????? ?? ?????????, ??? ??????????? ?? ???????????? ??????? ??????????????? ??????. ????????? ???? ???????????? ??????? ??????????????? ????(???????)?????? ?? ??????????????? ??????. ?????????? ???????? ??????? ? ?????? ???????? ????? ?????? ???????????????? ???? ?? ?????? ?????????????. ??????????? ???? ???????? ??????? ??????????????? ????(???????)?????? ? ??????????????????? ??-????????? ?????? ?????? (R1C...

  18. [Cyclooxygenase 2 and carcinogenesis].

    Science.gov (United States)

    Rodrigues, Sylvie; Bruyneel, Erik; Rodrigue, Christelle M; Shahin, Emami; Gespach, Christian

    2004-05-01

    The membrane glycoprotein Cox2 is regulated at transcriptional and post-transcriptional levels by pro-inflammatory agents, cytokines, growth factors, oncogenes, and tumor-promoters. Cox2 is expressed during early stages of colorectal carcinogenesis from the premalignant adenoma stage, and adenocarcinomas of stomach, colon, breast, lung and prostate. Its expression is detected in neoplastic, inflammatory, endothelial and stromal cells. Cox2 is involved in the conversion of arachidonic acid into prostaglandins and thromboxanes, as well as the synthesis of malonaldehyde (MDA, a mutagen) and the production of hydrogen peroxide, which promotes carcinogenesis. The Cox2 products act in turn on serpentine receptors coupled to heterotrimeric G-proteins (R-TXA2, R-PG) that are connected to signaling elements implicated in oncogenesis. Thus, Cox2 plays a key role in early stages of carcinogenesis by promoting the proliferation of tumoral cells and their resistance to apoptosis, as well as angiogenesis, tumor cell invasion and setting up of the metastatic process. These mechanisms establish the rationale behind the therapeutic targeting of Cox2 in human solid tumors.

  19. Type 2 diabetes models

    DEFF Research Database (Denmark)

    Gram, Dorte Xenia

    2012-01-01

    This chapter deals with type 2 diabetes in vivo models and techniques suitable for testing new anti-diabetic compounds. In particular, the testing of TRP antagonist for beneficial effects against type 2 diabetes is considered. There are many choices of both in vitro techniques and in vivo models......, impaired glucose tolerance, impaired insulin secretion, and insulin resistance in vivo and should, thus, be sufficient to demonstrate preclinical proof of concept of a TRP antagonist in type 2 diabetes in rodents. The experiments are suggestions and could be replaced or supplemented by others....

  20. 2nd UNet conference

    CERN Document Server

    Menasche, Daniel; Sabir, Essaïd; Pellegrini, Francesco; Benjillali, Mustapha

    2017-01-01

    This volume offers the proceedings of the 2nd UNet conference, held in Casablanca May 30 - June 1, 2016. It presents new trends and findings in hot topics related to ubiquitous computing/networking, covered in three tracks and three special sessions: Main Track 1: Context-Awareness and Autonomy Paradigms Track Main Track 2: Mobile Edge Networking and Virtualization Track Main Track 3: Enablers, Challenges and Applications Special Session 1: Smart Cities and Urban Informatics for Sustainable Development Special Session 2: Unmanned Aerial Vehicles From Theory to Applications Special Session 3: From Data to Knowledge: Big Data applications and solutions.

  1. Pro Android 2

    CERN Document Server

    Hashimi, S; MacLean, Dave

    2010-01-01

    Pro Android 2 shows you how to build real-world and fun mobile applications using Google's latest Android SDK. This new edition is fully updated for Android 2, covering everything from the fundamentals of building applications for embedded devices to advanced concepts such as custom 3D components, OpenGL, and touchscreens including gestures. While other Android development guides simply discuss topics, Pro Android 2 offers the combination of expert insight and real sample applications that work. * Discover the design and architecture of the Android SDK through practical examples, and how to bu

  2. ATF2 COMMISSIONING

    CERN Document Server

    Seryi, A; Parker, B; Schulte, D; Delahaye, J P; Tomas, R; Zimmermann, F; Wolski, A; Elsen, E; Sanuki, T; Gianfelice-Wendt, E; Ross, M; Wendt, M; Takahashi, T; Bai, S; Gao, J; Bolzon, B; Geffroy, N; Jeremie, A; Apsimon, R; Burrows, P; Constance, B; Perry, C; Resta-Lopez, J; Swinson, C; Araki, S; Aryshev, A; Hayano, H; Honda, Y; Kubo, K; Kume, T; Kuroda, S; Masuzawa, M; Naito, T; Okugi, T; Sugahara, R; Tauchi, T; Terunuma, N; Urakawa, J; Yokoya, K; Iwashita, Y; Sugimoto, T; Heo, A Y; Kim, E S; Kim, H S; Bambade, P; Renier, Y; Rimbault, C; Huang, J Y; Kim, S H; Park, Y J; Hwang, W H; Blair, G; Boogert, S; Karataev, P; Molloy, S; Amann, J; Bellomo, P; Lam, B; McCormick, D; Nelson, J; Paterson, E; Pivi, M; Raubenheimer, T; Spencer, C; Wang, M H; White, G; Wittmer, W; Woodley, M; Yan, Y; Zhou, F; Angal-Kalinin, D; Jones, J; Lyapin, A; Scarfe, A; Kamiya, Y; Komamiya, S; Oroku, M; Suehara, T; Yamanaka, T

    2010-01-01

    ATF2 is a final-focus test beam line that aims to focus the low-emittance beam from the ATF damping ring to a beam size of about 37 nm, and at the same time to demonstrate nm beam stability, using numerous advanced beam diagnostics and feedback tools. The construction has been finished at the end of 2008 and the beam commissioning of ATF2 has started in December of 2008. ATF2 is constructed and commissioned by ATF international collaborations with strong US, Asian and European participation.

  3. CO2-neutral fuels

    Directory of Open Access Journals (Sweden)

    Goede A. P. H.

    2015-01-01

    Full Text Available The need for storage of renewable energy (RE generated by photovoltaic, concentrated solar and wind arises from the fact that supply and demand are ill-matched both geographically and temporarily. This already causes problems of overcapacity and grid congestion in countries where the fraction of RE exceeds the 20% level. A system approach is needed, which focusses not only on the energy source, but includes conversion, storage, transport, distribution, use and, last but not least, the recycling of waste. Furthermore, there is a need for more flexibility in the energy system, rather than relying on electrification, integration with other energy systems, for example the gas network, would yield a system less vulnerable to failure and better adapted to requirements. For example, long-term large-scale storage of electrical energy is limited by capacity, yet needed to cover weekly to seasonal demand. This limitation can be overcome by coupling the electricity net to the gas system, considering the fact that the Dutch gas network alone has a storage capacity of 552 TWh, sufficient to cover the entire EU energy demand for over a month. This lecture explores energy storage in chemicals bonds. The focus is on chemicals other than hydrogen, taking advantage of the higher volumetric energy density of hydrocarbons, in this case methane, which has an approximate 3.5 times higher volumetric energy density. More importantly, it allows the ready use of existing gas infrastructure for energy storage, transport and distribution. Intermittent wind electricity generated is converted into synthetic methane, the Power to Gas (P2G scheme, by splitting feedstock CO2 and H2O into synthesis gas, a mixture of CO and H2. Syngas plays a central role in the synthesis of a range of hydrocarbon products, including methane, diesel and dimethyl ether. The splitting is accomplished by innovative means; plasmolysis and high-temperature solid oxygen electrolysis. A CO2-neutral fuel

  4. Toeplitz Operators on H2(T2)%H2(T2)上的Toeplitz算子

    Institute of Scientific and Technical Information of China (English)

    杨立敏

    2001-01-01

    给出了H2(T2)上Toeplitz算子的特征方程:T*zTTz=T,T*wTTw=T,及两个Toeplitz算子ψ,ψ∈L∞(T2),Tψ和Tφ的乘积TψTφ仍为Toeplitz算子的充要条件是:ψ对z、w中零个、一个或两个变量共轭解析,φ对余下变量解析,且乘积为Tψφ.

  5. ATF2 Commissioning

    Energy Technology Data Exchange (ETDEWEB)

    Seryi, A.; /SLAC; Christian, G.; /KLTE-ATOMKI; Parker, B.; /BNL; Schulte, D.; Delahaye, J.-P.; Tomas, R.; Zimmermann, F.; /CERN; Wolski, A.; Elsen, E.; /Cockcroft Inst. /DESY; Sanuki, T.; /Tohoku U.; Gianfelice-Wendt, E.; Ross, M.; Wendt, M.; /Fermilab; Takahashi, T.; /Hiroshima U.; Bai, S.; Gao, J.; /Beijing, Inst. High Energy Phys.; Bolzon, B.; Geffroy, N.; Jeremie, A.; /Annecy, LAPP; Apsimon, R.; Burrows, P.; /Oxford U., JAI /Kyoto U., Inst. Chem. Res. /Kyungpook Natl. U. /Orsay, LAL /Phang Accelerator Lab /Royal Holloway, U. of London /SLAC /Daresbury /University Coll. London /Manchester U. /Univ. of Tokyo U.

    2009-10-30

    ATF2 is a final-focus test beam line that aims to focus the low-emittance beam from the ATF damping ring to a beam size of about 37 nm, and at the same time to demonstrate nm beam stability, using numerous advanced beam diagnostics and feedback tools. The construction has been finished at the end of 2008 and the beam commissioning of ATF2 has started in December of 2008. ATF2 is constructed and commissioned by ATF international collaborations with strong US, Asian and European participation.

  6. Type 2 diabetes mellitus

    DEFF Research Database (Denmark)

    DeFronzo, Ralph A; Ferrannini, Ele; Groop, Leif

    2015-01-01

    Type 2 diabetes mellitus (T2DM) is an expanding global health problem, closely linked to the epidemic of obesity. Individuals with T2DM are at high risk for both microvascular complications (including retinopathy, nephropathy and neuropathy) and macrovascular complications (such as cardiovascular...... that multiple antidiabetic agents, used in combination, will be required to maintain normoglycaemia. The treatment must not only be effective and safe but also improve the quality of life. Several novel medications are in development, but the greatest need is for agents that enhance insulin sensitivity, halt...

  7. CO2-neutral fuels

    Science.gov (United States)

    Goede, A. P. H.

    2015-08-01

    The need for storage of renewable energy (RE) generated by photovoltaic, concentrated solar and wind arises from the fact that supply and demand are ill-matched both geographically and temporarily. This already causes problems of overcapacity and grid congestion in countries where the fraction of RE exceeds the 20% level. A system approach is needed, which focusses not only on the energy source, but includes conversion, storage, transport, distribution, use and, last but not least, the recycling of waste. Furthermore, there is a need for more flexibility in the energy system, rather than relying on electrification, integration with other energy systems, for example the gas network, would yield a system less vulnerable to failure and better adapted to requirements. For example, long-term large-scale storage of electrical energy is limited by capacity, yet needed to cover weekly to seasonal demand. This limitation can be overcome by coupling the electricity net to the gas system, considering the fact that the Dutch gas network alone has a storage capacity of 552 TWh, sufficient to cover the entire EU energy demand for over a month. This lecture explores energy storage in chemicals bonds. The focus is on chemicals other than hydrogen, taking advantage of the higher volumetric energy density of hydrocarbons, in this case methane, which has an approximate 3.5 times higher volumetric energy density. More importantly, it allows the ready use of existing gas infrastructure for energy storage, transport and distribution. Intermittent wind electricity generated is converted into synthetic methane, the Power to Gas (P2G) scheme, by splitting feedstock CO2 and H2O into synthesis gas, a mixture of CO and H2. Syngas plays a central role in the synthesis of a range of hydrocarbon products, including methane, diesel and dimethyl ether. The splitting is accomplished by innovative means; plasmolysis and high-temperature solid oxygen electrolysis. A CO2-neutral fuel cycle is

  8. N2C2M2 Experimentation and Validation: Understanding Its C2 Approaches and Implications

    Science.gov (United States)

    2010-06-01

    the organization and execution of the experiments, specifically, Col. Fernando Freire , LtCol. António Flambó, LtCol. José Martins, LtCol. Paulo ...of ELICIT Experimental Data. Paper presented at the 13th ICCRTS, Seattle, USA, 2008. [13.] Manso, Marco, and Paulo Nunes. ELICIT and the Future C2...detailed mapping between C2 CRM variables and ELICIT refer to: MANSO, Marco, and Paulo NUNES. ELICIT and the Future C2: Theoretical Foundations for the

  9. 2-[(2-Hydroxy-2,2-diphenylethyl(methylamino]-N,N-dimethylethanaminium bromide

    Directory of Open Access Journals (Sweden)

    Carsten Strohmann

    2009-02-01

    Full Text Available The title compound, C19H27N2O+·Br−, is the hydrobromide of the trapping product of lithiated N,N,N′,N′-tetramethylethylenediamine (TMEDA with benzophenone. Thereby, the N atom of the NMe2 group is selectively protonated and the respective trapping product represents a potential tridentate ligand with one O and two N donor atoms. The H atoms at N (H2N and O (H1O are involved in hydrogen bonds with the Br−. The molecular structure shows all donor atoms to be arranged on one side of the molecule, thus indicating a potential threefold coordination of a Lewis acid.

  10. Perancangan dan Simulasi MRAC untui Proses Pengendalian Temperatur pada Continuous Stirred Tank Reactor (CSTR

    Directory of Open Access Journals (Sweden)

    Amelia Sylvia

    2014-03-01

    Full Text Available Temperatur merupakan salah satu variabel proses dasar yang dikendalikan untuk menjaga suhu cairan di dalam reaktor. Model Reference Adaptive Controller (MRAC dengan MIT rule dipilih untuk mencapai spesifikasi respon yang diinginkan pada CSTR. Beban yang bervariasi berupa debit aliran likuid yang masuk ke dalam reaktor dapat menyebabkan perubahan parameter yang mempengaruhi perubahan temperatur output produk pada CSTR. Sebuah simulasi dilakukan dengan menggunakan MATLAB dan hasilnya dianalisa. Respon plant dapat melakukan adaptasi parameter – parameter kontrolernya cukup baik pada nilai gain adaptasi dengan rentang 0.00000010000 sampai 0.00000000001. Waktu yang dibutuhkan untuk mengatasi beban yang bervariasi berupa debit aliran yang masuk ke dalam reaktor dengan nilai yang maksimal (1.5 m^3/min menghasilkan respon plant lebih cepat 42 detik dari pada debit aliran masuk dengan nilai yang nominal (1 m^3/min 63 detik dan minimal (0.5 m^3/min 75 detik.

  11. New ALPHA-2 magnet

    CERN Multimedia

    Anaïs Schaeffer

    2012-01-01

    On 21 June, members of the ALPHA collaboration celebrated the handover of the first solenoid designed for the ALPHA-2 experiment. The magnet has since been successfully installed and is working well.   Khalid Mansoor, Sumera Yamin and Jeffrey Hangst in front of the new ALPHA-2 solenoid. “This was the first of three identical solenoids that will be installed between now and September, as the rest of the ALPHA-2 device is installed and commissioned,” explains ALPHA spokesperson Jeffrey Hangst. “These magnets are designed to allow us to transfer particles - antiprotons, electrons and positrons - between various parts of the new ALPHA-2 device by controlling the transverse size of the particle bunch that is being transferred.” Sumera Yamin and Khalid Mansoor, two Pakistani scientists from the National Centre for Physics in Islamabad, came to CERN in February specifically to design and manufacture these magnets. “We had the chance to work on act...

  12. Main: GARE2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available GARE2 S000165 17-May-1998 (last modified) kehi Putative gibberellin responsive elem...ent; Consensus sequence of GA inducible alpha-amylase genes from rice, barley and wheat; gibberellin; GARE;

  13. Nu2U

    DEFF Research Database (Denmark)

    Sørensen, Hans Eibe; Williamson, Trevor

    Abstract In September 2014, nine months after launching a major growth opportunity, Jenny Dunne, managing director of Nu2U, called for an extraordinary status meeting with her COO and CMO. A fast-growing online retailer of refurbished household appliances, Nu2U planned to acquire market share...... by improving internal logistics and delivery services, aided by a new, fully integrated software system. The company's gross profit had been increasing steadily, but recent accounts revealed a fall in net profit margins. It became apparent that implementation of the business plan for the project...... was problematic because of loose governance and poor communication across Nu2U's different specialist functions during planning and implementation. The Nu2U case illustrates how executives' cognition and span of control/overview may be hampered in fast-growing firms and how this ...

  14. Facts about Type 2

    Medline Plus

    Full Text Available ... to Give Close Are You at Risk? Home Prevention Diagnosing Diabetes and Learning About Prediabetes Type 2 ... Dinners! A year of delicious meals to help prevent and manage diabetes. Ways to Give: Show Your ...

  15. Y2K UPDATE

    CERN Multimedia

    Sverre JARP

    1999-01-01

    Concerning Y2K preparation, please note the following:Everybody, who has a NICE installation on his/her PC, needs to log in to NICE at least once before Xmas to get the Y2K update installed. This applies especially to dual boot systems.The test schedule on Y2Kplus.cern.ch will be prolonged. The last restart took place on 10 November and two more will take place on 24 November and 8 December, respectively. The Oracle users responsible for the maintenance of Oracle Forms applications which include PL/SQL blocks where date fields are handled with the default format are requested to contact oracle.support@cern.ch at their earliest convenience.Sverre Jarp (CERN Y2K co-ordinator, phone: 74944)

  16. Reference: ARELIKEGHPGDFR2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ndler VL, Grotewold E. Different mechanisms participate in the R-dependent activity of the R2R3 MYB transcription factor C1. J Biol Chem. 279: 48205-48213 (2004). PubMed: 15347654 ...

  17. The g-2 ring

    CERN Multimedia

    1974-01-01

    The precise measurement of "g-2", the anomalous magnetic moment of the muon, required a special muon storage ring with electrostatic focussing and very accurate knowledge of the magnetic bending field. For more details see under photo 7405430.

  18. Contaminant Candidate List 2

    Data.gov (United States)

    U.S. Environmental Protection Agency — CCL 2 is a list of contaminants that are currently not subject to any proposed or promulgated national primary drinking water regulations, that are known or...

  19. Facts about Type 2

    Medline Plus

    Full Text Available ... Children and Type 2 Diabetes Know Your Rights Employment Discrimination Health Care Professionals Law Enforcement Driver's License ... Find Your Local Office Find your local diabetes education program Calendar of Events Wellness Lives Here Drive ...

  20. NSP2 Target Areas

    Data.gov (United States)

    Department of Housing and Urban Development — The American Recovery and Reinvestment Act (ARRA) provided a second round of funds in 2009. NSP2 provides grants to states, local governments, nonprofits and a...

  1. Figure_2_data

    Data.gov (United States)

    U.S. Environmental Protection Agency — Data for Figure 2. This dataset is associated with the following publication: Sarwar, G., D. Kang, K. Foley, D. Schwede, B. Gantt, and R. Mathur. Technical note:...

  2. Main: ACGTSEED2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACGTSEED2 S000018 17-May-1998 (last modified) kehi ACGT motif related to seed expression; Gene: French... bean phaseolin; transacting factor: 02; phaseolin; seed; ACGT; French bean; bean (Phaseolus vulgaris) ACACACGTCAA ...

  3. Proto-2 seduces America

    CERN Multimedia

    2002-01-01

    Proto-2, an ALICE detector prototype, overcame its prototype status to become a real part of the STAR experiment at the US Brookhaven National Laboratory. After more than two years across the ocean, it has just arrived back at CERN.

  4. Type 2 diabetes

    Science.gov (United States)

    ... medicines (GLP-1 analogs) Meglitinides SGL T2 inhibitors Sulfonylureas Thiazolidinediones You may need to take insulin if ... rule Glucose in blood Alpha-glucosidase inhibitors Biguanides Sulfonylureas drug Thiazolidinediones Food and insulin release Monitoring blood ...

  5. Curiosities at c = -2

    CERN Document Server

    Kausch, H G

    1995-01-01

    Conformal field theory at c=-2 provides the simplest example of a theory with ``logarithmic'' operators. We examine in detail the (\\xi,\\eta) ghost system and Coulomb gas construction at c=-2 and show that, in contradistinction to minimal models, they can not be described in terms of conformal families of {\\em primary\\/} fields alone but necessarily contain reducible but indecomposable representations of the Virasoro algebra. We then present a construction of ``logarithmic'' operators in terms of ``symplectic'' fermions displaying a global SL(2) symmetry. Orbifolds with respect to finite subgroups of SL(2) are reminiscent of the ADE classification of c=1 modular invariant partition functions, but are isolated models and not linked by massless flows.

  6. Facts about Type 2

    Medline Plus

    Full Text Available ... to Give Close Are You at Risk? Home Prevention Diagnosing Diabetes and Learning About Prediabetes Type 2 ... Complications Neuropathy Foot Complications DKA (Ketoacidosis) & Ketones Kidney Disease (Nephropathy) Gastroparesis Mental Health Step On Up Treatment & ...

  7. Facts about Type 2

    Medline Plus

    Full Text Available ... to Give Close Are You at Risk? Home Prevention Diagnosing Diabetes and Learning About Prediabetes Type 2 Diabetes Risk Test Lower Your Risk Healthy Eating Overweight Smoking High Blood Pressure Physical Activity ...

  8. ARLearn 2.0

    NARCIS (Netherlands)

    Ternier, Stefaan; Tabuenca, Bernardo; Klemke, Roland; Specht, Marcus

    2013-01-01

    Ternier, S., Tabuenca, B., Klemke, R., & Specht, M. (2012). ARLearn (version 2.0) [Software]. Heerlen, The Netherlands: Open Universiteit. Available under the GNU Lesser General Public License (LGPL3)

  9. Main: ABADESI2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABADESI2 S000008 29-Sep-1999 (last modified) kehi Synthetic element (hex-3) related... to response to ABA and to desiccation; seed expression; Gene: synthetic; hex-3, mutant of hex-1 sequence fr

  10. Facts about Type 2

    Medline Plus

    Full Text Available ... and Learning About Prediabetes Type 2 Diabetes Risk Test Lower Your Risk Healthy Eating Overweight Smoking High ... You at Risk? Diagnosis Lower Your Risk Risk Test Alert Day Prediabetes My Health Advisor Tools to ...

  11. Facts about Type 2

    Medline Plus

    Full Text Available ... Step On Up Treatment & Care Blood Glucose Testing Medication Doctors, Nurses & More Oral Health & Hygiene Women A1C ... Type 2 is treated with lifestyle changes, oral medications (pills), and insulin. When glucose builds up in ...

  12. 2-(4-Nitrobenzylidenemalononitrile

    Directory of Open Access Journals (Sweden)

    Ming-Jen Chang

    2012-04-01

    Full Text Available In the title compound, C10H5N3O2, the benzylidenemalononitrile unit is nearly planar, with a maximum deviation of 0.129 (2 Å for a terminal N atom; the nitro group is approximately coplanar with the benzene ring [dihedral angle = 8.8 (3°]. An intramolecular C—H...N hydrogen bond stabilizes the molecular conformation.

  13. Spiral 2 Week

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    The main goal of this meeting is to present and discuss the current status of the Spiral-2 project at GANIL in front of a large community of scientists and engineers. Different issues have been tackled particularly the equipment around Spiral-2 like injectors, cryo-modules or beam diagnostics, a workshop was devoted to other facilities dedicated to radioactive ion beam production. This document gathers only the slides of the presentations.

  14. PALEONTOLOGY (2)PALEOBOTANY

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    <正>20071213 Guo Xianpu(Institute of Geology, Chinese Academy of Geological Science,Bei- jing 100037);Wang Naiwen Palaeontolog- ical Proof of the Naij Tal Group-Complex as Melange Aggregation in the Eastern Kun- lun Orogenic Belt and Its Geologic Signifi- cance(Geological Review,ISSN0371-5736, CN11-1952/P,52(3),2006,p.289-294, 2 illus.,2 plates,19 refs.)

  15. Bioinspired Poly(2-oxazolines

    Directory of Open Access Journals (Sweden)

    Helmut Schlaad

    2011-02-01

    Full Text Available Poly(2-oxazolines are regarded as pseudopeptides, thus bioinspired polymers, due to their structural relationship to polypeptides. Materials and solution properties can be tuned by varying the side-chain (hydrophilic-hydrophobic, chiral, bioorganic, etc., opening the way to advanced stimulus-responsive materials and complex colloidal structures. The bioinspired “smart” solution and aggregation behavior of poly(2-oxazolines in aqueous environments are discussed in this review.

  16. At NA2

    CERN Multimedia

    1977-01-01

    One of the NA2 calorimeter sections is moved in. The NA2 calorimeter was divided in two halves, to the left and the right of the beam, each half consisting of sheets of passive high Z material interleaved with blades of plastic scintillators. The photo shows on the right, the upstream 'electron' module with eleven lead plates for a total radiation length of 20.

  17. 2,3-Diaminophenazine

    Directory of Open Access Journals (Sweden)

    Shiyu Fu

    2011-07-01

    Full Text Available Herein, we synthesized 2,3-diaminophenazine (DAP from o-phenylenediamine (OP using fungal laccase as a biocatalyst. The conversion ratio of OP monomer was 85% and the yield of the final purified product, DAP, was 63%. The structure of the main product, DAP, was confirmed by using several spectroscopy techniques (UV-VIS, IR, 2D-NMR, and MS.

  18. 2,6-Diazidotoluene

    Directory of Open Access Journals (Sweden)

    Gunnar Spiess

    2008-02-01

    Full Text Available The structure of the title compound, C7H6N6, consists of almost planar molecules with C—N distances of 1.429 (2 and 1.428 (2 Å. The H atoms of the methyl group are disordered over two sites with occupancy factors of 0.69 and 0.31. The azide groups show typical geometry for covalently bound azides.

  19. COMBINE 2 seminar

    DEFF Research Database (Denmark)

    Sørensen, Lars Schiøtt; Jacobsen, Kim

    1995-01-01

    A seminar about the COMBINE project was described. Further, the project was described in generel, i.e. the COMBINE´s data model (IDM), the data exchange system (DES) and the different I/O-systems included in COMBINE 2......A seminar about the COMBINE project was described. Further, the project was described in generel, i.e. the COMBINE´s data model (IDM), the data exchange system (DES) and the different I/O-systems included in COMBINE 2...

  20. C2 Agility

    DEFF Research Database (Denmark)

    Mitchell, Dr. William; Alberts, David S.; Bernier, Francois

    Agility is the capability to successfully effect, cope with, and/or exploit changes in circumstances. While other factors will also influence outcomes, C2 Agility enables entities to effectively and efficiently employ the resources they have in a timely manner in a variety of missions and circums......Agility is the capability to successfully effect, cope with, and/or exploit changes in circumstances. While other factors will also influence outcomes, C2 Agility enables entities to effectively and efficiently employ the resources they have in a timely manner in a variety of missions...... and circumstances. SAS-085 was formed to improve the understanding of C2 Agility and assess its importance to NATO. SAS-085 accomplished these objectives by articulating the principles of C2 Agility, in the form of a C2 Agility Conceptual Model, substantially validating this model and establishing the importance...... of improving C2 Agility with empirical evidence obtained from a set of retrospective case studies and simulation-based experiments. Further, it identified next steps toward practical implementation in NATO operations and priorities for increasing the rigor and practicality of methods for measuring...

  1. MD-2 binds cholesterol.

    Science.gov (United States)

    Choi, Soo-Ho; Kim, Jungsu; Gonen, Ayelet; Viriyakosol, Suganya; Miller, Yury I

    2016-02-19

    Cholesterol is a structural component of cellular membranes, which is transported from liver to peripheral cells in the form of cholesterol esters (CE), residing in the hydrophobic core of low-density lipoprotein. Oxidized CE (OxCE) is often found in plasma and in atherosclerotic lesions of subjects with cardiovascular disease. Our earlier studies have demonstrated that OxCE activates inflammatory responses in macrophages via toll-like receptor-4 (TLR4). Here we demonstrate that cholesterol binds to myeloid differentiation-2 (MD-2), a TLR4 ancillary molecule, which is a binding receptor for bacterial lipopolysaccharide (LPS) and is indispensable for LPS-induced TLR4 dimerization and signaling. Cholesterol binding to MD-2 was competed by LPS and by OxCE-modified BSA. Furthermore, soluble MD-2 in human plasma and MD-2 in mouse atherosclerotic lesions carried cholesterol, the finding supporting the biological significance of MD-2 cholesterol binding. These results help understand the molecular basis of TLR4 activation by OxCE and mechanisms of chronic inflammation in atherosclerosis.

  2. [Type 2 diabetes complications].

    Science.gov (United States)

    Schlienger, Jean-Louis

    2013-05-01

    People with type 2 diabetes are at increased risk of many complications, which are mainly due to complex and interconnected mechanisms such as hyperglycemia, insulino-resistance, low-grade inflammation and accelerated atherogenesis. Cardi-cerebrovascular disease are frequently associated to type 2 diabetes and may become life threatening, particularly coronaropathy, stroke and heart failure. Their clinical picture are sometimes atypical and silencious for a long time. Type 2 diabetes must be considered as an independent cardiovascular risk factor. Nephropathy is frequent in type 2 diabetes but has a mixed origin. Now it is the highest cause of end-stage renal disease. Better metabolic and blood pressure control and an improved management of microalbuminuria are able to slowdown the course of the disease. Retinopathy which is paradoxically slightly progressive must however be screened and treated in these rather old patients which are globally at high ophthalmologic risk. Diabetic foot is a severe complication secondary to microangiopathy, microangiopathy and neuropathy. It may be considered as a super-complication of several complications. Its screening must be done on a routine basis. Some cancer may be considered as an emerging complication of type 2 diabetes as well as cognitive decline, sleep apnea syndrome, mood disorders and bone metabolism impairments. Most of the type 2 diabetes complications may be prevented by a strategy combining a systematic screening and multi-interventional therapies.

  3. Mineralization of Basalts in the CO2-H2O-SO2-O2 System

    Energy Technology Data Exchange (ETDEWEB)

    Schaef, Herbert T.; Horner, Jacob A.; Owen, Antionette T.; Thompson, Christopher J.; Loring, John S.; McGrail, B. Peter

    2014-05-01

    Sequestering carbon dioxide (CO2) containing minor amounts of co-contaminants in geologic formations was investigated in the laboratory through the use of high pressure static experiments. Five different basalt samples were immersed in water equilibrated with supercritical CO2 containing 1wt% sulfur dioxide (SO2) and 1wt% oxygen (O2) at reservoir conditions (~100 bar, 90°C) for 49 and 98 days. Gypsum (CaSO4) was a common precipitate, occurred early as elongated blades with striations, and served as substrates for other mineral products. Bimodal pulses of water released during dehydroxylation were key indicators along with X-ray diffraction for verifying the presences of jarosite-alunite group minerals. Well-developed pseudocubic jarosite crystals formed surface coatings, and in some instances mixtures of natrojarosite and natroalunite aggregated into spherically shaped structures measuring 100 μm in diameter. Reaction products were also characterized using infrared spectroscopy, which indicated OH and Fe-O stretching modes. The presences of jarosite-alunite group minerals were found in the lower wavenumber region from 700–400 cm-1. A strong preferential incorporation of Fe(III) into natrojarosite was attributed to the oxidation potential of O2. Evidence of CO2 was detected during thermal decomposition of precipitates, suggesting the onset of mineral carbonation.

  4. Frustrated pyrochlore oxides, Y2Mn2O7, Ho2Mn2O7, and Yb2Mn2O7: Bulk magnetism and magnetic microstructure

    DEFF Research Database (Denmark)

    Greedan, J.E.; Raju, N.P.; Maignan, A.

    1996-01-01

    The bulk magnetic properties, including de and ac susceptibilities and heat capacity, of the pyrochlore oxides Ho2Mn2O7 and Yb2Mn2O7 are reported and compared with those of the previously studied Y2Mn2O7. In the latter case the magnetic Mn4+ ions occupy the 16c sites in Fd3m which define...... a potentially frustrated three-dimensional array of corner sharing tetrahedra. For Ho2Mn2O7 and Yb2Mn2O7 magnetic rare earth ions occupy the 16d sites, as shown by powder neutron diffraction, which are topologically equivalent to the 16c sites but displaced by a vector (1/2 1/2 1/2). Ho2Mn2O7 and Yb2Mn2O7....... Surprisingly, neutron diffraction data for both Ho2Mn2O7 and Yb2Mn2O7 show resolution limited reflections of magnetic origin in contrast to the heat capacity results. The resolution of the neutron diffraction data places a minimum on the correlation length of 100 Angstrom. Small angle neutron scattering data...

  5. Synthesis, structure and magnetic properties of the polyoxovanadate cluster [Zn2(NH2(CH2)2NH2)5][{Zn(NH2(CH2)2NH2)2}2{V18O42(H2O)}]$\\cdot x$H2O ( ∼ 12), possessing a layered structure

    Indian Academy of Sciences (India)

    Srinivasan Natarajan; K S Narayan; Swapan K Pati

    2006-01-01

    A hydrothermal reaction of a mixture of ZnCl2, V2O5, ethylenediamine and water gave rise to a layered poly oxovanadate material [Zn2(NH2(CH2)2NH2)5][{Zn(NH2(CH2)2NH2)2}2{V18O42(H2O)}]$\\cdot x$H2O ( = 12) (I) consisting of [V18O42]12- clusters. These clusters, with all the vanadium ions in the +4 state, are connected together through Zn(NH2(CH2)2NH2)2 linkers forming a two-dimensional structure. The layers are also separated by distorted trigonal bipyramidal [Zn2(NH2(CH2)2NH2)5] complexes. The structure, thus, presents a dual role for the Zn-ethylenediamine complex. The magnetic susceptibility studies indicate that the interactions between the V centres in I are predominantly antiferromagnetic in nature and the compound shows highly frustrated behaviour. The magnetic properties are compared to the theoretical calculations based on the Heisenberg model, in addition to correlating to the structure. Crystal data for the complexes are presented.

  6. On The Integral Solutions of Diophantine Equation ax2+by2+cz2=dw2%关于丢番图方程ax2+by2+cz2=dw2的整数解

    Institute of Scientific and Technical Information of China (English)

    张文忠

    2002-01-01

    当丢番图方程ax2+by2+cz2=dw2有整数解x0,y0,z0,w0(w0≠1),(x0,y0,z0,w0)=1时,给出了它满足(x,y,z,w)=1的全部整数解的公式:x=((an2+bm2+cp2)x0-2n(anx0+bmy0+cpz0))/(t), y=((an2+bm2+cp2)y0-2m(anx0+bmy0+cpz0))/(t),z=((an2+bm2+cp2)z0-2p(anx0+bmy0+cpz0))/(t), w=((an2+bm2+cp2)w0)/(t).

  7. EVALUASI PENGGUNAAN METILEN BIRU SEBAGAI MEDIATOR ELEKTRON PADA MICROBIAL FUEL CELL DENGAN BIOKATALIS ACETOBACTER ACETI

    Directory of Open Access Journals (Sweden)

    Dani Permana

    2013-05-01

    Full Text Available Microbial fuel cell (MFC merupakan salah satu teknologi sel bahan bakar alternatif yang dapat diperbarui. MFC memanfaatkan proses oksidasi senyawa kimia oleh biokatalis untuk menghasilkan energi listrik daya rendah. Tujuan dari penelitian ini adalah mengetahui kinerja MFC dengan dan tanpa mediator elektron metilen biru (MB menggunakan biokatalis Acetobacter aceti dan substrat glukosa agar diperoleh energi listrik. Metode yang dilakukan adalah peremajaan kultur A. aceti, persiapan inokulum, persiapan reaktor MFC, persiapan media MFC dengan substrat glukosa 2% dengan dan tanpa mediator MB, pencuplikan secara periodik, penentuan kurva pertumbuhan, arus, potensial, kerapatan daya, energi, kadar glukosa dan tingkat keasaman (pH. Hasil penelitian menunjukkan bahwa MFC dengan mediator menghasilkan kuat arus sebesar 0,040 mA, potensial 878 mV, kerapatan daya 0,395 mW/cm2, energi maksimum 3,685 kJ, pemanfaatan glukosa 93,02% dan pH akhir 3,33, sedangkan MFC tanpa mediator menghasilkan kuat arus 0,035 mA, potensial 773 mV, kerapatan daya 0,290 mW/cm2, energi maksimum 2,434 kJ, pemanfaatan glukosa 90,16% dan pH akhir 3,24. Perolehan kerapatan daya pada kedua jenis MFC masih tergolong kecil dan tidak berbeda secara signifikan. Berdasarkan hasil penelitian dapat disimpulkan bahwa penggunaan mediator MB hanya berpengaruh terhadap perolehan potensial pada MFC dengan kondisi perlakuan yang diterapkan dalam penelitian ini.

  8. Designing HER2 vaccines.

    Science.gov (United States)

    Foy, Teresa M; Fanger, Gary R; Hand, Susan; Gerard, Catherine; Bruck, Claudine; Cheever, Martin A

    2002-06-01

    HER2/neu is a compelling cancer vaccine candidate because it is overexpressed on some cancer cells relative to normal tissues, it is known to be immunogenic in both animal models and in humans, and it is already known to be targetable by the antibody component of the immune system in the form of monoclonal antibody therapy with trastuzumab. Vaccines offer the theoretical advantage of being able to elicit T-cell responses in addition to antibody responses. HER2 vaccines have been shown to provide benefit in animal models and to be immunogenic in humans. However, the optimal vaccine formulation is not yet known and the therapeutic efficacy of the vaccines in humans has not yet been evaluated. HER2 vaccine approaches currently being tested include peptide-based, DNA plasmid-based, and protein-based vaccines. Our group has developed and started testing a protein-based vaccine composed of both the extracellular domain of HER2 and the carboxyl terminal autophosphorylation portion of the intracellular domain. The extracellular domain was retained to provide for antibody targeting. The kinase domain of the intracellular domain was excluded because of its high degree of homology to other human kinases. The carboxyl terminal autophosphorylation domain was retained because it is the most unique and possibly most immunogenic portion of the HER2 molecule with the least homology to other members of the HER family. The vaccine, termed dHER2, is immunogenic in mice and primates. In animal models it can elicit CD8 and CD4 T-cell responses as well as antibody responses that suppress the growth of HER2-positive cancer cells in vitro and in vivo. Vaccine trials are contemplated in patients with breast cancer that will determine whether the vaccine construct is similarly immunogenic in humans.

  9. Protein: FBA2 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available enzyme E2 D2 Ubiquitin carrier protein D2, Ubiquitin-conjugating enzyme E2(17)KB 2, Ubiquitin-conjugating en...zyme E2-17 kDa 2, Ubiquitin-protein ligase D2 9606 Homo sapiens P62837 7322 3TGD, 2ESP, 2ESO, 3JW0, 3L1Y, 2ESK, 2C4O, 2ESQ, 1UR6, 1W4U, 2CLW, 3JVZ 3A33 7322 P62837 20152160 #20100118 ...

  10. SIM2 NERO

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    近期,SIM2推出了最新的NERO系列3D投影机,外壳涂层采用柔软的黑色塑料,造型典雅美观。NERO系列包括NERO 1、NERO 2、NERO HB和NERO 235四款型号。NERO 1是该系列产品的入门级型号,亮度为2000流明,具有PureMovie和PureMotion技术,支持HDMI 1.4版本;NERO 2在NERO 1基础上增加了sim2动态黑技术(加强方案)、极致色彩技术以及电动虹膜控制,对比度达30000:1;NERO HB具有更高的亮度,达3000流明;NERO 235具有新的WQXGA DMD芯片,分辨率为2560×1600像素,这样就可以在没有丢失像素、亮度及无需增加变形镜头的情况下,投射出2.35:1模式的影片。

  11. CO{sub 2} geothermal heat probe - Phase 2; CO{sub 2}-Erdwaermesonde - Phase 2

    Energy Technology Data Exchange (ETDEWEB)

    Grueniger, A.; Wellig, B.

    2009-12-15

    In this project the fluid dynamics and thermodynamics inside a CO{sub 2} geothermal heat probe have been investigated. The functionality of such a probe, which works like a thermosyphon, was analyzed by means of a simulation model in MATLAB. The model couples the behaviour inside the heat probe with the heat conduction in the earth. A parameter study revealed that the self-circulation character of such a probe leads to flattening of the vertical earth temperature profile near the probe and, hence, leads to more uniform heat removal along the probe. The circulation of CO{sub 2} even goes on when the heat pump is off. This might be advantageous for the regeneration phase. The heat transfer resistance of the evaporating CO{sub 2} film flowing down the probe wall is very small compared to the conduction resistance of the earth. Therefore, no difference has been found between the performances of a conventional heat pipe and a configuration where the liquid phase injection is distributed on different height stages along the probe. It is estimated that the seasonal performance factor of heat pumps can be improved by 15-25% with a CO{sub 2} geothermal heat probe. The main advantage is that the heat transfer to the evaporator of the heat pump (condensation of CO{sub 2} / evaporation of refrigerant) is much more efficient than in a conventional brine probe without phase change. Furthermore, no circulation pump is needed. (authors)

  12. Rate constant and thermochemistry for K + O2 + N2 = KO2 + N2

    DEFF Research Database (Denmark)

    Sorvajärvi, Tapio; Viljanen, Jan; Toivonen, Juha;

    2015-01-01

    The addition reaction of potassium atoms with oxygen has been studied using the collinear photofragmentation and atomic absorption spectroscopy (CPFAAS) method. KCl vapor was photolyzed with 266 nm pulses and the absorbance by K atoms at 766.5 nm was measured at various delay times with a narrow...... line width diode laser. Experiments were carried out with O2/N2 mixtures at a total pressure of 1 bar, over 748-1323 K. At the lower temperatures single exponential decays of [K] yielded the third-order rate constant for addition, kR1, whereas at higher temperatures equilibration was observed...... in the form of double exponential decays of [K], which yielded both kR1 and the equilibrium constant for KO2 formation. kR1 can be summarized as 1.07 × 10-30(T/1000 K)-0.733 cm6 molecule-2 s-1. Combination with literature values leads to a recommended kR1 of 5.5 × 10-26T-1.55 exp(-10/T) cm6 molecule-2 s-1...

  13. Kemi 2.0

    DEFF Research Database (Denmark)

    Johannesson, Anne Boie

    2014-01-01

    temaer, hvor eleverne laver deres eget didaktiske design indenfor rammerne af lærerens didaktiske design. Fokus i gruppearbejdet er udarbejdelse af web 2.0-produkter og meningsforhandling. Lærerens rolle er at hjælpe når der er behov for det, fremfor at lave almindelig tavleundervisning. Kemi 2.0 ligger......I dette projekt undersøges det hvordan kemi C på stx kan gøres it-baseret og almendannende. Løsningen er elevaktiverende og temabaseret undervisning samt fokus på kompetencer, fremfor kun på kvalifikationer. Det didaktiske design af kemi 2.0 er baseret på socialkonstruktivismen og inspireret af...... Dewey, Kolb, Illeris, Wenger og Luhmann. De unge karakteriseres med udgangspunkt i forskellige generationsbeskrivelser, og principper for didaktik 2.0, der imødekommer de unges forventninger og måder at lære på, skitseres. Principperne i kemi 2.0 er længerevarende gruppearbejde indenfor vedkommende...

  14. Appropriate green phosphor of SrSi2O2N2:Eu2+,Mn2+ for AC LEDs.

    Science.gov (United States)

    Yeh, Chiao-Wen; Li, Ye; Wang, Jing; Liu, Ru-Shi

    2012-07-30

    An AC (alternating current) LED exhibited the advantages of a low drive current, low static electricity, lack of a need for a rectifier, and high extraction efficiency. The input operating voltage of an AC LED is around 80V, and its operating frequency is 120 Hz or less. When the voltage is converted, a time gap of 1/120 s (10 ms), called dead time, is generated. This time gap is closely related to the scintillation phenomenon. Therefore, AC LEDs that have a phosphor composition, whose half-life composition can compensate for dead time that is generated during the voltage conversion, are sought to solve the problem of scintillation. The object of this work is to provide a phosphor SrSi(2)O(2)N(2):Eu(2+),Mn(2+) for AC LEDs, in which the dead time that is generated during the voltage conversion is compensated for by the half-life of the phosphor.

  15. CO2-strategier

    DEFF Research Database (Denmark)

    Jørgensen, Michael Søgaard

    2008-01-01

    I 2007 henvendte Lyngby-Taarbæk kommunens Agenda 21 koordinator sig til Videnskabsbutikken og spurgte om der var interesse for at samarbejde om CO2-strategier. Da Videnskabsbutikken DTU er en åben dør til DTU for borgerne og deres organisationer, foreslog Videnskabsbutikken DTU at Danmarks...... Naturfredningsforening’s lokalkomité for Lyngby blev en del af samarbejdet for at få borgerne i kommunen involveret i arbejdet med at udvikle strategier for reduktion af CO2. Siden sommeren 2007 har Videnskabsbutikken DTU, Lyngby-Taarbæk kommune og Danmarks Naturfredningsforening i Lyngby-Taarbæk samarbejdet om analyse...... og innovation i forhold til CO2-strategier....

  16. ${\\cal R}^2$ Supergravity

    CERN Document Server

    Ferrara, Sergio; Porrati, Massimo

    2015-01-01

    We formulate $R^2$ pure supergravity as a scale invariant theory built only in terms of superfields describing the geometry of curved superspace. The standard supergravity duals are obtained in both "old" and "new" minimal formulations of auxiliary fields. These theories have massless fields in de Sitter space as they do in their non supersymmetric counterpart. Remarkably, the dual theory of $R^2$ supergravity in the new minimal formulation is an extension of the Freedman model, describing a massless gauge field and a massless chiral multiplet in de Sitter space, with inverse radius proportional to the Fayet-Iliopoulos term. This model can be interpreted as the "de-Higgsed" phase of the dual companion theory of $R+R^2$ supergravity.

  17. TOUGH2 software qualification

    Energy Technology Data Exchange (ETDEWEB)

    Pruess, K.; Simmons, A.; Wu, Y.S.; Moridis, G.

    1996-02-01

    TOUGH2 is a numerical simulation code for multi-dimensional coupled fluid and heat flow of multiphase, multicomponent fluid mixtures in porous and fractured media. It belongs to the MULKOM ({open_quotes}MULti-KOMponent{close_quotes}) family of codes and is a more general version of the TOUGH simulator. The MULKOM family of codes was originally developed with a focus on geothermal reservoir simulation. They are suited to modeling systems which contain different fluid mixtures, with applications to flow problems arising in the context of high-level nuclear waste isolation, oil and gas recovery and storage, and groundwater resource protection. TOUGH2 is essentially a subset of MULKOM, consisting of a selection of the better tested and documented MULKOM program modules. The purpose of this package of reports is to provide all software baseline documents necessary for the software qualification of TOUGH2.

  18. The DR-2 project

    DEFF Research Database (Denmark)

    Ølgaard, Povl Lebeck

    2003-01-01

    DR-2 was a 5 MW tank type, water moderated and cooled research reactor, which was operated at the Risø National Laboratory from 1959 to 1975. After the close-down in1975 the DR-2 has been kept in safe enclosure until now. The aim of the DR-2 projectreported here was to characterize the present...... their activity had been measured. The activity of the radiation shield of the reactor was measured in three different ways: By drilling two cored holes through the shield, by thermo-luminescence dosimeter measurements in vertical tubes in theconcrete shield and by measurements through an open beam hole...... state of the reactor and to determine, which radionuclides remain where in the reactor in what amounts. The first part of the reactor to be investigated was the reactor tank. The lids at the reactor top wereremoved, air samples taken and smear test made in the tank. Then the control rods, the magnet...

  19. N>=2 symmetric superpolynomials

    CERN Document Server

    Alarie-Vézina, L; Mathieu, P

    2015-01-01

    The theory of symmetric functions has been extended to the case where each variable is paired with an anticommuting one. The resulting expressions, dubbed superpolynomials, provide the natural N=1 supersymmetric version of the classical bases of symmetric functions. Here we consider the case where two independent anticommuting variables are attached to each ordinary variable. The N=2 super-version of the monomial, elementary, homogeneous symmetric functions, as well as the power sums, are then constructed systematically (using an exterior-differential formalism for the multiplicative bases), these functions being now indexed by a novel type of superpartitions. Moreover, the scalar product of power sums turns out to have a natural N=2 generalization which preserves the duality between the monomial and homogeneous bases. All these results are then generalized to an arbitrary value of N. Finally, for N=2, the scalar product and the homogenous functions are shown to have a one-parameter deformation, a result that...

  20. WFPC2 Polarization Calibration

    Science.gov (United States)

    Biretta, J.; McMaster, M.

    1997-12-01

    We derive a detailed calibration for WFPC2 polarization data which is accurate to about 1.5%. We begin by computing polarizer flats, and show how they are applied to data. A physical model for the polarization effects of the WFPC2 optics is then created using Mueller matricies. This model includes corrections for the instrumental polarization (diattenuation and phase retardance) of the pick-off mirror, as well as the high cross-polarization transmission of the polarizer filter. We compare this model against the on-orbit observations of polarization calibrators, and show it predicts relative counts in the different polarizer/aperture settings to 1.5% RMS accuracy. We then show how this model can be used to calibrate GO data, and present two WWW tools which allow observers to easily calibrate their data. Detailed examples are given illustrationg the calibration and display of WFPC2 polarization data. In closing we describe future plans and possible improvements.

  1. The E(2) Particle

    CERN Document Server

    Ghosh, Subir

    2009-01-01

    Recently it has been advocated [1] that for describing nature within the minimal symmetry requirement, certain subgroups of Lorentz group (along with translation invariance) may play a fundamental role, (instead of the full Poincare group). One such group is E(2) which induces a Lie algebraic Non-Commutative spacetime [4]. In this new kind of Non-Commutative phase space, (which however is not translation invariant in all directions), we construct a point particle action. Interestingly, contrary to some of the other Lie algebraic Non-Commutative spacetimes, no change in the Einstein dispersion relation $p^2=m^2$ is needed. The model is constructed by exploiting a dual canonical phase space following the scheme developed by us earlier [8].

  2. 2-Bromo-5-fluorobenzaldehyde

    Directory of Open Access Journals (Sweden)

    Joseph M. Tanski

    2013-08-01

    Full Text Available In the title compound, C7H4BrFO, the benzaldehyde O atom is found to be trans to the 2-bromo substituent. In the crystal, short Br...F interactions between the bromine and fluorine substituents are observed at distances of 3.1878 (14, 3.3641 (13 and 3.3675 (14 Å. Offset face-to-face π-stacking interactions are also observed for both of the independent molecules in the asymmetric unit running parallel to the crystallographic b axis, characterized by centroid–centroid distances of 3.8699 (2 and 3.8699 (2 Å.

  3. ATF2 Proposal

    Energy Technology Data Exchange (ETDEWEB)

    Grishanov, Boris Ivanovich; Logachev, Pavel; Podgorny, Fedor; Telnov, Valery; /Novosibirsk, IYF; Angal-Kalinin, Deepa; Appleby, Robert; Jones, James; Kalinin, Alexander; /Daresbury; Napoly, Olivier; Payet, Jacques; /DAPNIA, Saclay; Braun, Hans-Heinrich; Schulte, Daniel; Zimmermann, Frank; /CERN; Barlow, Roger; Bailey, Ian; Jenner, Leo; Jones, Roger; Kourevlev, German; /Daresbury; Walker, Nick; /DESY; Takahasi, Tohru; /Hiroshima U.; Gao, Jie; /Beijing, Inst. High Energy Phys. /Oxford U. /KEK, Tsukuba /Kyoto U., Inst. Chem. Res.

    2005-08-23

    This document is the first of two volumes describing the ATF2 project. The present volume discusses the technical justification for ATF2 and presents a design description. Since the International Committee for Future Accelerator (ICFA) decision on the choice of technology, a world-wide collaboration on the design of the International Linear Collider (ILC) has rapidly progressed [1]. The formation of the Global Design Effort (GDE) will accelerate the work towards a final design. An important technical challenge is obviously the high gradient acceleration but what is similarly challenging is the collision of extremely small beams of a few nanometer size. The latter challenge has three distinct issues: creating small emittance beams, preserving the emittance during acceleration and transport, and focusing the beams to nanometers. Most studies have been done using computer simulations but many issues still remain that require experimental verification. Accelerator Test Facility (ATF) at KEK was built to create small emittance beams, and succeeded in obtaining an emittance that almost satisfies the ILC requirements [2]. In this proposal we present a project, ATF2, which addresses the focusing of the beam into a nanometer spot. The ATF2 project will extend the extraction beamline of the ATF with an ILC-type final focus system to create a tightly focused, stable beam by making use of the small emittance of the ATF. The layout is shown in Figure 1.1. In the longer term, the ATF2 project would also provide invaluable input for the CLIC design of a future multi-TeV collider.

  4. Beginning Android 2

    CERN Document Server

    Murphy, Mark

    2010-01-01

    The Android development platform, created by Google and the Open Handset Alliance, is a platform in its truest sense, encompassing hundreds of classes beyond the traditional Java classes and open source components that ship with the SDK. With Beginning Android 2, you'll learn how to develop applications for Android 2.x mobile devices, using simple examples that are ready to run with your copy of the SDK. Author, Android columnist, writer, developer, and community advocate Mark L. Murphy will show you what you need to know to get started programming Android applications, including how to craft

  5. D2-tree

    DEFF Research Database (Denmark)

    Brodal, Gerth Stølting; Sioutas, Spyros; Pantazos, Kostas;

    2015-01-01

    We present a new overlay, called the Deterministic Decentralized tree (D2-tree). The D2-tree compares favorably to other overlays for the following reasons: (a) it provides matching and better complexities, which are deterministic for the supported operations; (b) the management of nodes (peers......-balancing scheme of elements into nodes is deterministic and general enough to be applied to other hierarchical tree-based overlays. This load-balancing mechanism is based on an innovative lazy weight-balancing mechanism, which is interesting in its own right....

  6. 3-(Pyridin-2-ylcoumarin

    Directory of Open Access Journals (Sweden)

    Yu-Xia Da

    2010-11-01

    Full Text Available In the title compound, C14H9NO2, the dihedral angle between the pyridine ring and the lactone ring is 10.40 (3°. The coumarin ring system is nearly planar, with a dihedral angle of 1.40 (2° between the lactone and benzene rings. An intramolecular C—H...O hydrogen bond occurs. In the crystal, inversion dimers linked by pairs of C—H...O interactions occur, generating R22(14 loops.

  7. Fuzzy CP2

    CERN Document Server

    Alexanian, G G; Immirzi, G; Ydri, B

    2001-01-01

    Regularization of quantum field theories (QFT's) can be achieved by quantizing the underlying manifold (spacetime or spatial slice) thereby replacing it by a non-commutative matrix model or a ``fuzzy manifold''. Such discretization by quantization is remarkably successful in preserving symmetries and topological features, and altogether overcoming the fermion-doubling problem. In this paper, we report on our work on the ``fuzzification'' of the four-dimensional CP2 and its QFT's. CP2 is not spin, but spin${}_c$. Its Dirac operator has many unique features. They are explained and their fuzzy versions are described.

  8. Programming Amazon EC2

    CERN Document Server

    Vliet, Jurg

    2011-01-01

    If you plan to use Amazon Web Services to run applications in the cloud, the end-to-end approach in this book will save you needless trial and error. You'll find practical guidelines for designing and building applications with Amazon Elastic Compute Cloud (EC2) and a host of supporting AWS tools, with a focus on critical issues such as load balancing, monitoring, and automation. How do you move an existing application to AWS, or design your application so that it scales effectively? How much storage will you require? Programming Amazon EC2 not only helps you get started, it will also keep y

  9. Synthesis and Transformations of di-endo-3-Aminobicyclo-[2.2.2]oct-5-ene-2-carboxylic Acid Derivatives

    Directory of Open Access Journals (Sweden)

    Márta Palkó

    2011-09-01

    Full Text Available all-endo-3-amino-5-hydroxybicyclo[2.2.2]octane-2-carboxylic acid (13 and all-endo-5-amino-6-(hydroxymethylbicyclo[2.2.2]octan-2-ol (10 were prepared via dihydro-1,3-oxazine or g-lactone intermediates by the stereoselective functionalization of an N-protected derivative of endo-3-aminobicyclo[2.2.2]oct-5-ene-2-carboxylic acid (2. Ring closure of b-amino ester 4 resulted in tricyclic pyrimidinones 15 and 16. The structures, stereochemistry and relative configurations of the synthesized compounds were determined by IR and NMR.

  10. Two New Dicyanamide Coordination Polymers with Alternating Parallel Chains: {Mn(dmpz)[N(CN)2]2}2 and {Cu(dmpz)[N(CN)2]2}2

    Institute of Scientific and Technical Information of China (English)

    罗俊; 周锡庚; 侯秀峰; 吴惠霞; 翁林红; 李艳荣

    2005-01-01

    Two new dicyanamide coordination polymers, {Mn(dmpz)[N(CN)2]2}2 (1) and {Cu(dmpz)[N(CN)2]2}2 (2)(dmpz=3,5-dimethylpyrazole), were synthesized and characterized by single crystal X-ray diffraction analysis and IR spectroscopy. In 1 and 2 the metal ions have two different coordination modes, where one is coordinated to four dicyanamide anions and two monodentate dmpz molecules to form a slightly distorted octahedral geometry, while the other adopts octahedral geometry, surrounded by four nitrile N atoms and two amide N atoms of the dicyanamide anions. Both complexes contain two alternating chains that are parallel to each other.

  11. Pembuatan Biodiesel Secara Batch Dengan Memanfaatkan Gelombang Mikro (Microwave

    Directory of Open Access Journals (Sweden)

    Rhesa Purnama Putra

    2012-09-01

    Full Text Available Biodiesel merupakan bioenergi atau bahan bakar nabati yang dibuat dari minyak nabati, baik minyak baru atau bekas penggorengan melalui proses transesterifikasi, esterifikasi, atau proses esterifikasi-transesterifikasi. Tujuan penelitian ini adalah untuk membuat biodiesel dari minyak goreng secara batch melalui proses transesterifikasi dengan menggunakan radiasi mikrowave serta mempelajari berapa daya dan waktu optimal yang diperlukan untuk proses pembuatan biodiesel dengan radiasi microwave dengan katalis CaO, H2SO4, dan tanpa katalis. Dalam penelitian ini digunakan tiga variabel, yaitu daya (Watt;100,200,300,400, waktu (menit; 5,10,15,20 dan jenis katalis; CaO, H2SO4, dan tanpa katalis. Pada tahap persiapan menghitung volume minyak dan metanol yang akan dicampur. Kemudian mencampurnya didalam reaktor. Lalu mendinginkan campuran hingga terbentuk dua lapisan atas dan bawah dilanjutkan dengan melakukan pemisahan lapisan atas (biodiesel dari lapisan bawah (gliserol. Adapun pada tahap analisis, biodiesel hasil reaksi transesterfikasi dianalisa untuk mendapatkan data yield metil ester, densitas, viskositas, dan flash point. Dari penelitian diketahui bahwa hasil yang didapatkan masih belum dapat memenuhi standar biodiesel yang ditetapkan. Katalis CaO dapat memberikan hasil yang lebih baik dibandingkan dengan katalis H2SO4 dan tanpa katalis. Kondisi operasi untuk menghasilkan kualitas yield biodiesel terbaik yaitu pada daya 200 Watt selama 20 menit dengan menggunakan katalis CaO. Yield biodiesel terbesar didapatkan yield sebesar 60,11 %.

  12. KONVERSI KATALITIK MINYAK SAWIT UNTUK MENGHASILKAN BIOFUEL MENGGUNAKAN SILIKA ALUMINA DAN HZSM-5 SINTESIS

    Directory of Open Access Journals (Sweden)

    Nurjannah Nurjannah

    2012-02-01

    Full Text Available Terbatasnya sumber energi fosil menyebabkan perlunya pengembangan energi terbarukan yang berasal dari alam dan dapat diperbaharui. Penggunaan bahan bakar minyak bumi, baik dari penggunaan berupa alat transportasi maupun dari penggunaan oleh industri sangat mencemari lingkungan karena tingkat polusi yang ditimbulkan sangat tinggi sehingga perlu mencari bahan bakar alternatif pengganti bahan bakar gasoline, solar, dan kerosene dari minyak nabati. Penelitian dilakukan dalam dua tahapan yaitu sintesa katalis dan proses katalitik cracking. Silika alumina disintesa menggunakan metode Latourette dan HZSM-5 disintesa menggunakan metode Plank. Hasil sintesa dikarakterisasi dengan Penyerapan Spektroskopi Atomis (AAS menunjukkan bahwa silika alumina dan HZSM-5 mempunyai Si/Al 198 dan 243. Luas permukaan  silika alumina dan HZSM-5 diperoleh dari analisa Brunauer Emmet Teller (BET yaitu 149,91-213,35 m2.g-1 dan ukuran pori rata-rata adalah 13oA. Perengkahan katalitik dilakukan dalam suatu mikroreaktor fixed bed pada temperatur 350-500°C dan laju alir gas N2 100-160 ml.min-1 selama 120 min. Hasil perengkahan dianalisa dengan metode gas kromatografi. Hasil yang diperoleh untuk katalis HZSM-5 fraksi gasoline dengan yield tertinggi 28,87%, kerosene 16,70%, dan diesel 12,20%  pada suhu reaktor 4500C dan laju gas N2 100 ml/menit.

  13. Facts about Type 2

    Medline Plus

    Full Text Available ... 1 Type 2 About Us Online Community Meal Planning Sign In Search: Search More Sites Search ≡ Are ... Fitness Home Food MyFoodAdvisor Recipes Association Cookbook Recipes Planning Meals Diabetes Meal Plans Create Your Plate Gluten ...

  14. Complex WS 2 nanostructures

    Science.gov (United States)

    Whitby, R. L. D.; Hsu, W. K.; Lee, T. H.; Boothroyd, C. B.; Kroto, H. W.; Walton, D. R. M.

    2002-06-01

    A range of elegant tubular and conical nanostructures has been created by template growth of (WS 2) n layers on the surfaces of single-walled carbon nanotube bundles. The structures exhibit remarkably perfect straight segments together with interesting complexities at the intersections, which are discussed here in detail in order to enhance understanding of the structural features governing tube growth.

  15. TC-2 Satellite Delivered

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    On April 18, 2005, TC-2, the second satellite of Double Star Program (DSP), which was jointly developed by CNSA and ESA, was approved to be delivered to the user after the on-board test and trial operation. The satellite is working well and the performance can meet the user's need. The satellite has collected large amount of valuable scientific data

  16. Eyeborg 2.0

    OpenAIRE

    Lizana García, Matias

    2011-01-01

    Finalista del Premi Cercle Fiber al millor Projecte Final de Carrera (curs 2010-2011) Les persones amb acromatòpsia no poden captar el color. Eyeborg 2.0 permet, a través d'una càmera integrada en un sistema embedded, captar els colors i transformar-los a sons.

  17. Web 2.0

    Institute of Scientific and Technical Information of China (English)

    胡泳

    2007-01-01

    Web 2.0是现在媒体上常见的名词,但究竟什么是Web 2.0?这个术语的始作俑者蒂姆·欧内利是这样定义的:“Web 2.0指网络作为平台,横跨所有互联设备;Web 2.0应用充分调动这一平台的内在优势:把软件作为不断升级的服务加以提供,使用软件的人越多,软件变得越好;这些应用从多种来源(包括个人用户)吸取和重混数据,与此同时,允许自己的数据和服务被他人重混。”这个定义由于技术化而显得晦涩难解。在另一处,欧内利举例

  18. Wavetrain 2 : Deliverable 29

    DEFF Research Database (Denmark)

    Crom, Izan Le; Pecher, Arthur; Parmeggiani, Stefano

    Deliverable 29 describes a newly proposed methodology to evaluate the power performances of wave (and tidal) energy converters. This methodology has been applied within the Wavetrain2 project to evaluate the production of two wave energy conversion plants: the Pico OWC Plant and the Wave Dragon...

  19. Fit 2-B FATHERS.

    Science.gov (United States)

    Maiorano, Joseph J.

    2001-01-01

    Fit 2-B FATHERS is a parenting-skills education program for incarcerated adult males. The goals of this program are for participants to have reduced recidivism rates and a reduced risk of their children acquiring criminal records. These goals are accomplished by helping participants become physically, practically, and socially fit for the demands…

  20. Main: POLASIG2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available POLASIG2 S000081 17-May-1998 (last modified) kehi PolyA signal; poly A signal found in rice alpha-amylas...e; -10 to -30 in the case of animal genes. AATAAA; AATAAT; AATTAAA; AATAAG; poly A signal; rice (Oryza sativa); animal; AATTAAA ...

  1. Saperi P2P

    Directory of Open Access Journals (Sweden)

    Salvatore Iaconesi

    2009-10-01

    Full Text Available Il paper presenta l'architettura filosofica e logica di un progetto ongoing per la creazione di un'infrastruttura peer to peer per la diffusione dei saperi. Tale infrastruttura p2p vuole essere la base per costruire un framework aperto e orizzontale, che ospiti pratiche innovative di creazione, condivisione e disseminazione di informazioni e conoscenza.

  2. Bike2Work 2014

    CERN Multimedia

    Herterich, Patricia Sigrid

    2014-01-01

    To celebrate the success of the 97 CERN teams, the participants gathered on Thursday 19th June at lunchtime for a "CERN critical mass". The bicyclists started at Restaurant 2 and cruised around the Meyrin site terminating with a photo session outside Restaurant 1. The colleagues based in Prevessin made a "pre-parade" to join their colleagues in Meyrin.

  3. Homogeneous M2 duals

    CERN Document Server

    Figueroa-O'Farrill, José

    2015-01-01

    Motivated by the search for new gravity duals to M2 branes with $N>4$ supersymmetry --- equivalently, M-theory backgrounds with Killing superalgebra $\\mathfrak{osp}(N|4)$ for $N>4$ --- we classify (except for a small gap) homogeneous M-theory backgrounds with symmetry Lie algebra $\\mathfrak{so}(n) \\oplus \\mathfrak{so}(3,2)$ for $n=5,6,7$. We find that there are no new backgrounds with $n=6,7$ but we do find a number of new (to us) backgrounds with $n=5$. All backgrounds are metrically products of the form $\\operatorname{AdS}_4 \\times P^7$, with $P$ riemannian and homogeneous under the action of $\\operatorname{SO}(5)$, or $S^4 \\times Q^7$ with $Q$ lorentzian and homogeneous under the action of $\\operatorname{SO}(3,2)$. At least one of the new backgrounds is supersymmetric (albeit with only $N=2$) and we show that it can be constructed from a supersymmetric Freund--Rubin background via a Wick rotation. Two of the new backgrounds have only been approximated numerically.

  4. At UA2

    CERN Multimedia

    1982-01-01

    The proton-antiproton collider experiment UA2. From centre to outside: the central calorimeter, the recessed toroidal magnets (on temporary supports), and the recessed forward-backward detector structures with their drift chambers in front. (Annual Report 1982 p. 63, Fig. 5)

  5. Heat Capacities and Thermodynamic Properties of 3-(2,2-Dichloroethenyl ) -2,2-dimethylcyclopropanecarboxylic Acid

    Institute of Scientific and Technical Information of China (English)

    XUE Bin; WANG Jian-ya; TAN Zhi-cheng; WU Tong-hao

    2007-01-01

    The heat capacities of 3 - (2,2-dichloroethenyl) -2,2-dimethylcyclopropanecarboxylic acid ( a racemic mixture,molar ratio of cis-/trans-structure is 35/65) in a temperature range from 78 to 389 K were measured with a precise automatic adiabatic calorimeter. The sample was prepared with a purity of 98.75% ( molar fraction). A solid-liquid fusion phase transition was observed in the experimental temperature range. The melting point, Tm, enthalpy and entropy of fusion, △fusHm, △fusSm, of the acid were determined to be ( 331.48 ± 0.03 ) K, ( 16. 321 ± 0.031 ) kJ/mol,and (49.24 ± 0.19) J/( K·mol), respectively. The thermodynamic functions of the sample, HT - H298.15, ST -S298.15 and GT - G298.15, were reported at a temperature intervals of 5 K. The thermal decomposition of the sample was studied using thermogravimetric (TG) analytic technique, the thermal decomposition starts at ca. 418 K and ends at ca. 544 K, the maximum decomposition rate was obtained at 510 K. The order of reaction, preexponential factor and activation energy are n =0.23, A =7. 3 × 107 min -1, E =70.64 KJ/mol, respectively.

  6. Intersection I-2

    CERN Multimedia

    1971-01-01

    Intersection I-2 of the ISR during the installation of experiments. On the left to the crossing region can be seen the massive iron plate structure of the muon detector being used by a British collaboration in a search for the intermediate vector boson. The magnet and hodoscopes on the right are part of the spectrometer arm of the Bristish-Scandinavian Collaration.

  7. Open G(2) strings

    NARCIS (Netherlands)

    de Boer, J.; de Medeiros, P.; El-Showk, S.; Sinkovics, A.

    2008-01-01

    We consider an open string version of the topological twist previously proposed for sigma-models with G(2) target spaces. We determine the cohomology of open strings states and relate these to geometric deformations of calibrated submanifolds and to flat or anti-self-dual connections on such submani

  8. Facts about Type 2

    Medline Plus

    Full Text Available ... first, you may need to later on. Some groups have a higher risk for developing type 2 ... function (data) { $('#survey-errors').remove(); $('.survey-form .form-group .survey-alert-wrap').remove(); if (data.submitSurveyResponse.success == ' ...

  9. Main: OCTAMOTIF2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available OCTAMOTIF2 S000116 17-May-1998 (last modified) kehi Octamer motif found in histone-...gene-specific consensus sequences; 200 base upstream from the initiation codon ATG; Exist in all of seven plant histone genes; octamer; histone; meristem; maize (Zea mays); CGCGGCAT ...

  10. Raising the bar (2)

    NARCIS (Netherlands)

    Elhorst, P.; Abreu, M.; Amaral, P.; Bhattacharjee, A.; Corrado, L.; Fingleton, B.; Fuerst, F.; Garretsen, H.; Igliori, D.; Le Gallo, J.; McCann, P.; Monastiriotis, V.; Pryce, G.; Yu, J.

    2016-01-01

    In this editorial we summarise and comment on the papers published in issue 11.2 so as to raise the bar in applied spatial economic research and highlight new trends. The first paper analyses which regions in Europe were resilient to the great Recession and which ones were not. The second and the th

  11. Facts about Type 2

    Medline Plus

    Full Text Available ... Care Blood Glucose Testing Medication Doctors, Nurses & More Oral Health & Hygiene Women A1C Insulin Pregnancy 8 Tips for ... But, your doctor may need to also prescribe oral medications or insulin to help you meet your target blood glucose levels. Type 2 usually gets worse ... Health Advisor Tools to Know Your Risk Diabetes Basics ...

  12. UNIVERSITET 2.0?

    DEFF Research Database (Denmark)

    Sarauw, Laura Louise

    2011-01-01

    Universitetsloven fra 2003 understreger som noget nyt, at universiteterne ved siden af de traditionelle forpligtelser på forskning og undervisning også skal ‘udveksle viden og kompetencer med det omgivende samfund’ (2003¿2). I de almindelige bemærkninger til loven indskærpes samtidig, at uddannel...

  13. Reference: POLASIG2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available POLASIG2 O'Neill SD, Kumagai MH, Majumdar A, Huand N, Sutliff TD, Rodriguez RL The ...alpha-amylase genes in Oryza sativa: Characterization of cDNA clones and mRNA expression during seed germina

  14. Protein: FEB2 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FEB2 Glutamate receptors Gria2 Glur2 Glutamate receptor 2 AMPA-selective glutamate ...receptor 2, GluR-B, GluR-K2, Glutamate receptor ionotropic, AMPA 2 10090 Mus musculus 14800 P23819 P23819 ...

  15. Atmospheric gas-phase degradation and global warming potentials of 2-fluoroethanol, 2,2-difluoroethanol, and 2,2,2-trifluoroethanol

    Science.gov (United States)

    Sellevåg, Stig Rune; Nielsen, Claus J.; Søvde, Ole Amund; Myhre, Gunnar; Sundet, Jostein K.; Stordal, Frode; Isaksen, Ivar S. A.

    The vapour phase reactions of 2-fluoroethanol, 2,2-difluoroethanol, and 2,2,2-trifluoroethanol with OH radicals and Cl atoms were studied at 298 K and 1013 mbar using long-path FTIR detection. The following reaction rate coefficients were determined by the relative rate method: k298(OH+CH 2FCH 2OH)=(1.42±0.11)×10 -12, k298(OH+CHF 2CH 2OH)=(4.51±0.06)×10 -13, k298(OH+CF 3CH 2OH)=(1.23±0.06)×10 -13, k298(Cl+CH 2FCH 2OH)=(2.67±0.3)×10 -11, k298(Cl+CHF 2CH 2OH)=(3.12±0.06)×10 -12, and k298(Cl+CF 3CH 2OH)=(7.42±0.12)×10 -13 cm 3 molecule -1 s -1; the reported uncertainties represent 3σ from the statistical analyses and do not include any systematic errors or uncertainties in the reference rate coefficients. Quantitative infrared cross-sections of the title compounds at 298 K are reported in the 4000-50 cm -1 region. A 3D chemistry transport model was applied to calculate the atmospheric distributions and lifetimes of the title compounds; the global and yearly averaged lifetimes were calculated as 20 days for CH 2FCH 2OH, 40 days for CHF 2CH 2OH, and 117 days for CF 3CH 2OH. Radiative forcing calculations were carried out assuming either constant vertical profiles or the distribution derived from the chemistry transport model. The Global Warming Potentials for the title compounds are insignificant compared to, e.g. CFC-11 (CCl 3F).

  16. Are 1+1 and 2+2 exceptional signatures?

    CERN Document Server

    Nieto, J A

    2004-01-01

    We prove that 1+1 and 2+2 target `spacetimes' of a 0-brane are exceptional signatures. Our proof is based on the requirement of SL(2,R) and `Lorentz' symmetries of a first order lagrangian. Using a special kind of 0-brane called `quatl', we also show that the exceptional signatures 1+1 and 2+2 are closely related. Moreover, we argue that the 2+2 target `spacetime' can be understood either as 2+2 worldvolume `spacetime' or as `1+1-matrix-brane'. The possibility that the exceptional 2+2-signature implies an exceptional chirotope is briefly outlined.

  17. Main: O2F3BE2S1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available quences of be2S1 promoter; F3 is hybrid of A/G box; O2; opaque-2; be2S1; seed; Brazil nut tree (Bertholletia excelsa) TCCACGTACT ... ...O2F3BE2S1 S000164 17-May-1998 (last modified) kehi opaque-2 recognition site F3 in Bertholletia excelsa (Bra...zil nut tree) 2S storage protein gene (be2S1); O2 protein binds to F1, F2 and F3 se

  18. Main: O2F1BE2S1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available quences of be2S1 promoter; F1 is hybrid C/G box; O2; opaque-2; be2S1; F1; seed; Brazil nut tree (Bertholletia excelsa); TCCACGTCGA ... ...O2F1BE2S1 S000162 17-May-1998 (last modified) kehi opaque-2 recognition site F1 in Bertholletia excelsa (Bra...zil nut tree) 2S storage protein gene (be2S1); O2 protein binds to F1, F2 and F3 se

  19. Measurement of the 2 sup 2 S sub 1/2 -2 sup 2 P sub 3/2 fine structure interval in muonium

    Energy Technology Data Exchange (ETDEWEB)

    Kettell, S.H.

    1990-08-01

    The (2{sup 2}S{sub 1/2} {minus} 2{sup 2}P{sub 3/2}) fine structure transition in muonium has been observed for the first time. The measured value is 9895 {sub {minus}30}{sup {plus}35}MHz. This measurement, when included with the theoretical value for the 2{sup 2}P{sub 1/2} {minus} 2{sup 2}P{sub 3/2} fine structure interval, gives a value for the Lamb shift (2{sup 2}S{sub 1/2} {minus} 2{sup 2}P{sub 1/2}) independent of previous direct measurements. From the theoretical value for the fine structure interval, 10921.833(3) MHz, the value for the Lamb shift determined from this experiment is 1027{sub {minus}35}{sup {plus}30} MHz and is in agreement with the prediction of quantum electrodynamics (QED) of 1047.5(3) MHz. Previous experimental values for the Lamb shift (2{sup 2}S{sub 1/2} {minus}2{sup 2}P{sub 1/2}) in muonium are 1070{sub {minus}15}{sup {plus} 12} MHz and 1042{sub {minus}23}{sup {plus}21} MHz. Combining this result with these previous results gives a new experimental value of 1058{sub {minus}12}{sup {plus}10} for the Lamb shift in muonium. Muonium, the bound state of two structureless leptons ({mu}{sup +}e{sup {minus}}), is an ideal system for testing bound state QED because of the lack of hadronic structure as exists in the hydrogen system. The measurement makes use of the techniques of atomic beam microwave spectroscopy. Muonium atoms ({mu}{sup +}e{sup {minus}}) in the 2S states are produced by the beam-foil technique at the Clinton P. Anderson Meson Physics Facility with a low momentum, sub-surface muon beam. A variable frequency microwave field is applied to drive the atoms from the 2S to the 2P states, with the subsequent observation of the Lyman alpha photon from the decay of the 2P state to the 1S ground state. The frequency is varied from 9.0--11.0 GHz, driving the F = 0 {yields} F = 1, F = 1, F = 1 and F = 1 {yields} F = 2 transitions.

  20. A study of the pseudogap state in Bi2Sr2CaCu2Ox and Bi2Sr2ZnCu2Oy HTSC materials

    Science.gov (United States)

    Aliev, V. M.; Mamedova, A. N.; Raqimov, S. S.; Selim-zade, R. I.; Tairov, B. A.

    2016-10-01

    We examine the effect of replacing calcium by zinc has on the transport properties of the BiSrCaCuO-2221 system. It is shown that the critical temperatures Tc of the Bi2Sr2CaCu2Ox(B1) and Bi2Sr2ZnCu2Oy(B2) samples are close (81 K and 80.72 K). However, the resistivity ρ of the Bi2Sr2ZnCu2Oy sample increases considerably, and the ratio ρB2/ρB1 ≈ 10 at 100 K. We use the local pair model to analyze the mechanism behind the formation of excess conductivity in Bi2Sr2CaCu2Ox and Bi2Sr2ZnCu2Oy(B2), with consideration of the Aslamazov-Larkin theory near Tc. We determined the temperature T0 of the transition from the 2D fluctuation area to the 3D region (i.e., the 2D-3D crossover temperature). We calculated the coherence length of the fluctuation Cooper pairs along the c axis, ξc(0). It is shown that substituting Zn for Ca reduces ξc(0) by almost 1.5 times (4.8 Å and 3.3 Å, respectively), and also leads to a narrowing of both the pseudogap region and the superconducting fluctuation area near Tc. We determined the temperature dependence of the pseudogap Δ * T and Δ * (Tc). The increase of ρ, its specific temperature dependence and the significant decrease of T * in sample B2, all point to the destruction of local pairs at all high temperatures, i.e., to the suppression of the pseudogap by Zn doping.

  1. Sentinel-2 Mission status

    Science.gov (United States)

    Hoersch, Bianca; Colin, Olivier; Gascon, Ferran; Arino, Olivier; Spoto, Francois; Marchese, Franco; Krassenburg, Mike; Koetz, Benjamin

    2016-04-01

    Copernicus is a joint initiative of the European Commission (EC) and the European Space Agency (ESA), designed to establish a European capacity for the provision and use of operational monitoring information for environment and security applications. Within the Copernicus programme, ESA is responsible for the development of the Space Component, a fully operational space-based capability to supply earth-observation data to sustain environmental information Services in Europe. The Sentinel missions are Copernicus dedicated Earth Observation missions composing the essential elements of the Space Component. In the global Copernicus framework, they are complemented by other satellites made available by third-parties or by ESA and coordinated in the synergistic system through the Copernicus Data-Access system versus the Copernicus Services. The Copernicus Sentinel-2 mission provides continuity to services relying on multi-spectral high-resolution optical observations over global terrestrial surfaces. Sentinel-2 capitalizes on the technology and the vast experience acquired in Europe and the US to sustain the operational supply of data for services such as forest monitoring, land cover changes detection or natural disasters management. The Sentinel-2 mission offers an unprecedented combination of the following capabilities: ○ Systematic global coverage of land surfaces: from 56°South to 84°North, coastal waters and Mediterranean sea; ○ High revisit: every 5 days at equator under the same viewing conditions with 2 satellites; ○ High spatial resolution: 10m, 20m and 60m; ○ Multi-spectral information with 13 bands in the visible, near infra-red and short wave infra-red part of the spectrum; ○ Wide field of view: 290 km. The data from the Sentinel-2 mission are available openly and freely for all users with online easy access since December 2015. The presentation will give a status report on the Sentinel-2 mission, and outlook for the remaining ramp-up Phase, the

  2. 28 CFR 2.2 - Eligibility for parole; adult sentences.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Eligibility for parole; adult sentences. 2.2 Section 2.2 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND... § 2.2 Eligibility for parole; adult sentences. (a) A Federal prisoner serving a maximum term or...

  3. Frozen Frozen CO2

    Science.gov (United States)

    2005-01-01

    2 October 2005 This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a view of frozen carbon dioxide in the south polar residual cap of Mars. Much of the south polar residual cap exhibits terrain that resembles stacks of sliced Swiss cheese, but this portion of the cap lacks the typical, circular depressions that characterize much of the region. Carbon dioxide on Mars freezes at a temperature of around 148 Kelvins, which is -125oC or about -193oF. Location near: 87.2oS, 28.4oW Image width: width: 3 km (1.9 mi) Illumination from: upper left Season: Southern Spring

  4. Reactor BR2. Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Gubel, P

    2001-04-01

    The BR2 is a materials testing reactor and is still one of SCK-CEN's important nuclear facilities. After an extensive refurbishment to compensate for the ageing of the installation, the reactor was restarted in April 1997. During the last three years, the availability of the installation was maintained at an average level of 97.6 percent. In the year 2000, the reactor was operated for a total of 104 days at a mean power of 56 MW. In 2000, most irradiation experiments were performed in the CALLISTO PWR loop. The report describes irradiations achieved or under preparation in 2000, including the development of advanced facilities and concept studies for new programmes. An overview of the scientific irradiation programmes as well as of the R and D programme of the BR2 reactor in 2000 is given.

  5. 1-[(E-2-(2-Hydroxy-5-methylphenyldiazen-2-ium-1-yl]naphthalen-2-olate

    Directory of Open Access Journals (Sweden)

    Salah Eddine Bouaoud

    2013-08-01

    Full Text Available The title zwitterion, C17H14N2O2, crystallizes with two independent molecules in the asymmetric unit, both of which are approximately planar, the dihedral angles between the benzene ring and the naphthalene ring system being 4.39 (12° in one molecule and 5.83 (12° in the other, and show an E conformation with respect to the azo double bond. An intramolecular N—H...O hydrogen bond in each molecule helps to establish their near planar conformation. In the crystal, molecules are linked through O—H...O hydrogen bonds into infinite chains running along the a-axis direction. In addition, the chains are stacked along the b axis via π–π interactions between the benzene and the naphthalene rings of adjacent molecules, the centroid–centroid distances being 3.722 (3 and 3.823 (4 Å.

  6. UTSim2 validation

    Science.gov (United States)

    Grandin, Robert; Gray, Tim

    2017-02-01

    The Center for NDE (CNDE) at Iowa State University has a long history of developing physics models for NDE and packaging these models into simulation tools which make the modeling capabilities accessible to CNDEs industrial sponsors. Recent work at CNDE has led to the development of a new ultrasonic simulation package, UTSim2, which aims to continue this tradition of supporting industrial application of CNDE models. In order to meet this goal, UTSim2 has been designed as an extensible software package which can support previously-developed physics models as well as future models yet to be developed. Initial work has focused on the implementation of a Gauss-Hermite beam model, a paraxial approximation, which is implemented as part of the Thompson-Gray measurement model. This paper will present recent validation results and include comparisons against both previously-validated model output and newly-performed experiments.

  7. Spiral 2 workshop

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    The accelerator and experimental facilities at GANIL will be transformed over the next 5-10 years. The centerpiece of the additions to the accelerator complex will be Spiral-2. This is the first phase of a new radioactive beam facility based on the ISOL principle. The main aim of Spiral-2 will be to produce intense, high quality beams of neutron-rich nuclei created in neutron-induced fission of heavy elements and accelerated by the existing CIME cyclotron. The principal aims of this workshop will be a) to publicize the new facilities, b) to discuss and define the science which might be carried out with them, c) to discuss the instrumentation and infrastructure required to exploit the new facilities and d) to help form collaborations of scientists wishing to design and construct the equipment needed to undertake the science programme. This document gathers most of the slides presented in the workshop.

  8. Design basis 2

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, G.; Soerensen, P. [Risoe National Lab., Roskilde (Denmark)

    1996-09-01

    Design Basis Program 2 (DBP2) is comprehensive fully coupled code which has the capability to operate in the time domain as well as in the frequency domain. The code was developed during the period 1991-93 and succeed Design Basis 1, which is a one-blade model presuming stiff tower, transmission system and hub. The package is designed for use on a personal computer and offers a user-friendly environment based on menu-driven editing and control facilities, and with graphics used extensively for the data presentation. Moreover in-data as well as results are dumped on files in Ascii-format. The input data is organized in a in-data base with a structure that easily allows for arbitrary combinations of defined structural components and load cases. (au)

  9. Wavetrain 2 : Deliverable 28

    DEFF Research Database (Denmark)

    Chozas, Julia Fernandez

    Denmark (the Danish TSO) and counts with the interest and collaboration of the wave device developers Pelamis, Wave Dragon and Wavestar. The second case study assesses the macro-economic impact of the introduction of a 100MW farm in Portugal. An Input-Output model based on Leontief theory was developed...... (HMRC) and Hans C. Sorensen (SPOK). It included 3 main parts: a first introduction to microeconomics at project level, a second practical session on the use of economic model Retscreen and a final session introducing macro and socio-economic aspects.......This deliverable presents a selection of case studies on socio-economic aspects of wave energy, developed by Wavetrain2 partners SPOK and WavEC, that represent key areas of research during the WT2 period. More information and a few other case studies can be also found in the previous deliverables D...

  10. Pengaruh Ketebalan Media Geotextile dan Arah Aliran Slow Sand Filter Rangkaian Seri untuk Menyisihkan P Total dan N Total

    Directory of Open Access Journals (Sweden)

    Ayuningtyas Ayuningtyas Ayuningtyas

    2014-03-01

    Full Text Available Pada penelitian ini dilakukan pengujian terhadap parameter-parameter yang berkaitan dengan standar kualitas air minum berdasarkan Peraturan Menteri Kesehatan Republik Indonesia No.492/MENKES/PER/IV/2010 pada air baku Kali Surabaya yang terlebih dahulu diolah pada unit pretreatment di IPAM Ngagel 1 Surabaya dan air yang akan diolah berasal dari outlet prasedimentasi. Air outlet prasedimentasi diolah terlebih dahulu menggunakan 4 unit roughing filter yang disusun secara seri kemudian diolah lebih lanjut ke unit slow sand filter dengan rangkaian seri. Digunakan dua variabel yaitu variasi arah aliran dan variasi ketebalan media geotextile. Media geotextile yang digunakan berjenis geotextile non woven. Ketebalan media geotextile yang digunakan sebesar 4 cm dan 6 cm sedangkan variasi arah aliran yang digunakan yaitu downflow-upflow dan downflow-downflow. Digunakan unit pengolahan slow sand filter dengan rangkaian seri sebanyak 2 reaktor. Pada penelitian ini akan dilakukan penambahan media geotextile di unit slow sand filter dan nantinya diharapkan supaya kandungan N total dan P total dapat diturunkan. Flow rate yang digunakan pada unit slow sand filter sebesara 0,3 m3/m2 jam. Tujuan dari penelitian ini yaitu untuk mengetahui ketebalan media geotextile dan arah aliran yang optimum pada unit slow sand filter dan menganalisis pengaruh penambahan media geotextile terhadap kualitas air hasil olahan unit slow sand filter untuk menyisihkan N total dan P total.

  11. Penurunan Kandungan Zat Kapur dalam Air Tanah dengan Menggunakan Media Zeolit Alam dan Karbon Aktif Menjadi Air Bersih

    Directory of Open Access Journals (Sweden)

    Gianina Qurrata Dinora

    2013-09-01

    Full Text Available Salah satu syarat kimia yang harus dipenuhi dalam air bersih adalah kesadahan. Salah satu penyebab utama terjadinya kesadahan adalah kandungan Ca2+ (kesadahan kalsium atau biasanya disebut air kapur. Selain kandungan air kapur yang tinggi, penyebab air tanah tidak dapat langsung digunakan adalah kadungan besi dan mangan yang tinggi pula. Untuk itu, dibutuhkan unit filter skala rumah tangga yang dapat menjadi pengolahan alternatif untuk memenuhi kebutuhan air bersih. Penelitian ini  bertujuan untuk mendapatkan komposisi media filter yang efektif dan effisien untuk penyisihan kesadahan kalsium, Fe, dan Mn dalam air tanah dan mendapatkan waktu breakthrough. Media filter yang digunakan pada penelitian ini adalah media zeolit alam dan karbon aktif disusun secara stratifikasi dengan perbandingan ketinggian pada masing-masing reaktor filter. Media filter tersebut akan dialiri dengan tiga variasi konsentrasi kesdahan kalsium. Hasil dari penelitian ini, didapatkan komposisi media yang paling efektif dalam menurunkan kandungan kesadahan kalsium adalah komposisi III dengan perbandingan ketinggian media zeolit alam dan karbon aktif sebesar 30 cm : 60 cm. Pada variasi konsentrasi 1 mampu melakukan penyisihan sebesar 96,52%, konsentrasi 2 mampu melakukan penyisihan sampai 94,67%, dan konsentrasi 3 mampu melakukan penyisihan sebesar 90,22%

  12. Neutronic and Thermal-Hydraulic Safety Analysis for the Optimization of the Uranium Foil Target in the RSG-GAS Reactor

    Directory of Open Access Journals (Sweden)

    S. Pinem

    2016-12-01

    Full Text Available The G. A. Siwabessy Multipurpose Reactor (Reaktor Serba Guna G.A. Siwabessy, RSG-GAS has an average thermal neutron flux of 2×1014 neutron/(cm2 sec at the nominal power of 30 MW. With such a high thermal neutron flux, the reactor is suitable for the production of Mo-99 which is widely used as a medical diagnostic radioisotope. This paper describes a safety analysis to determine the optimum LEU foil target by using a coupled neutronic and thermal-hydraulic code, MTR-DYN. The code has been developed based on the three-dimensional multigroup neutron diffusion theory. The best estimated results can be achieved by using a coupled neutronic and thermal-hydraulic code. The calculation results show that the optimum LEU foil target is 54 g corresponding to the reactivity change of less than the limit value of 500 pcm. From the safety analysis for the case when the primary flow rate decreased by 15% from its nominal value, it was found that the peak temperatures of the coolant and cladding are 69.5°C and 127.9°C, respectively. It can be concluded that the optimum LEU foil target can be irradiated safely without exceeding the limit value.

  13. PEMBUATAN KALSIUM KARBONAT DARI BITTERN DAN GAS KARBON DIOKSIDA SECARA KONTINYU

    Directory of Open Access Journals (Sweden)

    Soemargono Soemargono

    2012-01-01

    Full Text Available Kalsium karbonat  yang  digunakan  dalam  industri- industri cat, karet, dan  kertas  harus  mempunyai  mutu yang  tinggi, terutama  kemurnian  dan kehalusannya.Untuk itu, Indonesia masih  mendatangkan  kalsium  karbonat murni dari luar negeri dalam jumlah yang cukup besar. Bittern merupakan bahan buangan industri garam yang disebut juga air tua, mengandung senyawa kalsium. Karbon dioksida biasanya berasal dari hasil pembakaran yang masuk ke udara. Kandungannya di udara kecil, tetapi berpotensi sebagai pencemar. Dengan mereaksikan kalsium yang terkandung dalam bittern dengan gas CO2 akan terbentuk CaCO3 dalam suasana basa. Pembentukan kalsium karbonat dilakukan dengan proses kontinyu dalam reaktor kolom bersekat miring. Dari hasil penelitian diperoleh bahwa pengendapan magnesium dengan larutan ammonia menyebabkan kandungan kalsium ikut terdegradasi. Hasil terbaik yang diperoleh dicapai pada kondisi pH awal, kecepatan alir gas CO2, kecepatan alir cairan, dan suhu masing-masing pada 8,7; 2265 mL/menit; 10 mL/menit; dan 303 K, dengan konversi sebesar 38,40%. Produk berupa CaCO3, yang diperoleh mempunyai kemurnian sebesar 21,34%.

  14. 2(Cy2NH22SO4Sn(SO42Cy2NH2Cl AND 2(Cy2NH22SO4Sn(SO422Cy2NH2Cl: SYNTHESIS AND INFRARED STUDY

    Directory of Open Access Journals (Sweden)

    DAOUDA NDOYE

    2014-01-01

    Full Text Available 2(Cy2NH22SO4Sn(SO42Cy2NH2Cl and 2(Cy2NH22SO4. Sn(SO422Cy2NH2Cl complexes have been obtained on allowing Cy2NH2O2C-SO3H and Cy2NH2HSO4 to react respectively with SnBu2Cl2 and SnBu3Cl in specific ratios.The molecular structures of these compounds have been determined on the basis of the infrared data. The suggested structures are dimeric, the tin atom being octacoordinated by four chelating sulfate anions, the monomeric basic entities being connected by hydrogen bonded cation chloride cation strings.

  15. 2-(2,2-Dimethyl-2,3-dihydro-1-benzofuran-7-yloxyacetic acid monohydrate

    Directory of Open Access Journals (Sweden)

    Lin-Tao Yang

    2010-06-01

    Full Text Available In the title compound, C12H14O4·H2O, the dihydrobenzofuran ring adopts an envelope conformation with the substituted C atom 0.142 (1 Å out of the least-squares plane. In the crystal, the components are linked via intermolecular Owater—H...O and O—H...Owater hydrogen-bonding interactions, forming a three-dimensional network.

  16. Waardenburg syndrome 2

    Directory of Open Access Journals (Sweden)

    Uma Garg

    2012-01-01

    Full Text Available Waardenburg syndrome (WS is a rare disease characterised by sensorineural deafness in association with oculocutaneous pigmentary anomalies and dystopia canthorum. In this article, we report a 6-year-old boy with WS2, one of four clinical types of WS, for its rarity and relative paucity of reports in the otological literature. We also review the relevant literature of this rare disorder.

  17. Great Lakes Demonstration 2

    Science.gov (United States)

    2012-06-01

    without state environmental permission. Alternatively, the antifreeze was drained into a bucket and temporarily stored onboard the tugboat. The...Under Ice Retrieval If capable, the ROV or diver would be utilized to dive under the ice with an appropriate suction hose to find and recover oil...types of skimmers. If the oil is thick enough, it can be removed using direct suction . G.3.5.2 Broken Ice Conditions – Slotting: Objective of this

  18. 2-Cyanoanilinium tetrafluoroborate

    Directory of Open Access Journals (Sweden)

    Yi Zhang

    2009-10-01

    Full Text Available In the title compound, C7H7N2+·BF4−, the non-H atoms of the cation are almost coplanar (r.m.s. deviation = 0.035 Å. The cations and anions are connected by intermolecular N—H...F and N—H...N hydrogen bonds, forming a two-dimensional network parallel to (10overline{1}.

  19. Perhydrobenzimidazole-2-thione

    Directory of Open Access Journals (Sweden)

    XiaoYu Li

    2009-02-01

    Full Text Available The studied crystal of the title compound, C7H12N2S, is a racemic mixture of two isomers, viz. S,S and R,R. The two isomers share the same position on a mirror plane in the space group P21/m; thus all atoms except one are disordered between two positions in a 1:1 ratio. Intermolecular N—H...S hydrogen bonds link the molecules into chains propagating in the [010] direction.

  20. 2-(3-Chloroanilinopyridine

    Directory of Open Access Journals (Sweden)

    Zainal Abidin Fairuz

    2009-06-01

    Full Text Available In the title compound, C11H9ClN, the dihedral angle between the aromatic ring planes is 44.2 (1° and the bridging C—N—C bond angle is 127.60 (19°. The amino N—H grouping makes a hydrogen bond to the pyridyl N atom of an adjacent molecule across a center of inversion, generating a hydrogen-bonded dimer.

  1. Bike2Work 2015

    CERN Multimedia

    AUTHOR|(SzGeCERN)439147

    2015-01-01

    To celebrate the success of the 126 CERN teams (to be compared to the 97 teams of the year before), the participants gathered on Tuesday 23rd June at lunchtime for a "CERN critical mass". The bicyclists started at Restaurant 2 and cruised around the Meyrin site terminating with a photo session outside Restaurant 1. The colleagues based in Prevessin made a "pre-parade" to join their colleagues in Meyrin. The parade was escorted by the CERN Fire Brigade.

  2. Phenyl N-(2-methylphenylcarbamate

    Directory of Open Access Journals (Sweden)

    Durre Shahwar

    2009-07-01

    Full Text Available In the title compound, C14H13NO2, the aromatic rings attached to the O and N atoms make dihedral angles of 62.65 (9 and 38.28 (11°, respectively, with the central carbamate group. The benzene rings are oriented at a dihedral angle of 39.22 (10°. In the crystal, a very weak C—H...π interaction occurs.

  3. Beyond CMOS nanodevices 2

    CERN Document Server

    Balestra, Francis

    2014-01-01

    This book offers a comprehensive review of the state-of-the-art in innovative Beyond-CMOS nanodevices for developing novel functionalities, logic and memories dedicated to researchers, engineers and students. The book will particularly focus on the interest of nanostructures and nanodevices (nanowires, small slope switches, 2D layers, nanostructured materials, etc.) for advanced More than Moore (RF-nanosensors-energy harvesters, on-chip electronic cooling, etc.) and Beyond-CMOS logic and memories applications.

  4. SKIPAL, Phase 2

    Science.gov (United States)

    2009-11-01

    based on the Model-View-Controller ( MVC ) design pattern . New events created in SKIWeb activate a database trigger that captures the id numbers of the...Phase 2, SKIPAL incorporated the Spring Web MVC framework to facilitate future integration efforts with SKIWeb. Spring Web MVC is a web framework...Nonparametric Analysis of Fingerprint Data on Large Data Sets,” Pattern Recognition, vol. 40, no. 9, pp. 2574-2584, Sep. 2007. 4. Davis, J. and Goadrich

  5. 公会2

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    《公会2》是以中世纪为背景的策略游戏《欧洲1400:公会》(Europa 1400:The Guild)的续作,游戏采用了全新的3D引擎,更简明的操作界面和五个可供选择的中世纪城镇。

  6. R^2 Dark Matter

    CERN Document Server

    Cembranos, Jose A R

    2010-01-01

    There is a non-trivial four-derivative extension of the gravitational spectrum that is free of ghosts and phenomenologically viable. It is the so called $R^2$-gravity since it is defined by the only addition of a term proportional to the square of the scalar curvature. Just the presence of this term does not improve the ultraviolet behaviour of Einstein gravity but introduces one additional scalar degree of freedom that can account for the dark matter of our Universe.

  7. Bis(2-thienylacetylene

    Directory of Open Access Journals (Sweden)

    Emily M. Harcourt

    2009-10-01

    Full Text Available The planar [maximum deviation 0.0066 (4 Å] symmetrical molecule of the title compound, C10H6S2, lies across a crystallographic inversion centre. The thiophene rings are rotationally disordered about the acetylene bond, with the two pseudo inversion-related S atoms in 0.80:0.20 occupancy sites. The C[triple-bond]C bond distance is 1.195 (9 Å.

  8. Stability of Fuzzy S^2 x S^2 x S^2 in IIB Type Matrix Models

    CERN Document Server

    Kaneko, H; Tomino, D

    2005-01-01

    We study the stability of fuzzy S^2 x S^2 x S^2 backgrounds in three different IIB type matrix models with respect to the change of the spins of each S^2 at the two loop level. We find that S^2 x S^2 x S^2 background is metastable and the effective action favors a single large S^2 in comparison to the remaining S^2 x S^2 in the models with Myers term. On the other hand, we find that a large S^2 x S^2 in comparison to the remaining S^2 is favored in IIB matrix model itself. We further study the stability of fuzzy S^2 x S^2 background in detail in IIB matrix model with respect to the scale factors of each S^2 as well. In this case, we find unstable directions which lower the effective action away from the most symmetric fuzzy S^2 x S^2 background.

  9. Synthesis and Characterization of Cationic Low-Valent Gallium Complexes of Cryptand[2.2.2].

    Science.gov (United States)

    Bourque, Jeremy L; Boyle, Paul D; Baines, Kim M

    2015-06-26

    The synthesis and characterization of two bimetallic, cationic low-valent gallium-cryptand[2.2.2] complexes is reported. The reaction of cryptand[2.2.2] with Ga2Cl4 gave two different cations, [Ga3Cl4 (crypt-222)](+) (1) or [Ga2Cl2 (crypt-222)](2+) (2), depending on whether or not trimethylsilyl triflate (Me3SiOTf) was added as a co-reagent. Complexes 1 and 2 are the first examples of bimetallic cryptand[2.2.2] complexes, as well as the first low-valent gallium-cryptand[2.2.2] complexes. Computational methods were used to evaluate the bonding in the gallium cores.

  10. T2K & beyond

    CERN Document Server

    Catanesi, M G

    2016-01-01

    This article presents the status of the art of the T2K experiment and the measurements prospects for the incoming years. After a brief description of the experiment, the most recent results will be illustrated. The observation of the electron neutrino appearance in a muon neutrino beam and the new high-precision measurements of the mixing angle theta13 by the reactor experiments have led to a re-evaluation of the expected sensitivity to the oscillation parameters, relative to what was given in the original T2K proposal. For this reason the new physics potential of T2K for 7.8 x 10**21 p.o.t. and for a data exposure 3 times larger than it's expected to be reachable with accelerator and beam line upgrades in 2026 before the start of operation of the next generation of long-baseline neutrino oscillation experiments will also be described in the text. In particular the last challenging scenario opens the door to the possibility to obtain, under some conditions, a 3 sigma measurement excluding sin(deltaCP= 0.

  11. 2-Bromobeclometasone dipropionate

    Directory of Open Access Journals (Sweden)

    Kamal Aziz Ketuly

    2009-08-01

    Full Text Available In the crystal structure of 2-bromobeclometasone dipropionate [systematic name: (8S,9R,10S,11S,13S,14S,16S,17R-2-bromo-9α-chloro-11-hydroxy-10,13,16-trimethyl-3-oxo-17-[2-(propionyloxyacetyl]-6,7,8,9,10,11,12,13,14,15,16,17-dodecahydro-3H-cyclopenta[a]phenanthren-17-yl propionate], C28H36BrClO7, the six-membered ring with the 1,4-diene-3-one composition is planar (r.m.s. deviations = 0.03 and 0.04 Å for the two independent molecules, whereas the remaining six-membered rings have chair conformations. Each of the independent molecules self-associates via O—H...Opropionate hydrogen bonding, generating a supramolecular chain running along the b axis. The crystal is twinned, with the monoclinic unit cell emulating an orthorhomic crystal system; the major twin component constitutes approximately 60%.

  12. H2 Reconstitution

    Science.gov (United States)

    Skipper, Mike

    2002-02-01

    The high power microwave program at the Air Force Research Laboratory (AFRL) includes high power source development in narrow band and wideband technologies. The H2 source is an existing wideband source that was developed at the AFRL. A recent AFRL requirement for a wideband impulse generator to use in materials tests has provided the need to update the H2 source for the current test requirements. The H2 source is composed of a dual resonant transformer that charges a short length of coaxial transmission line. The transmission line is then discharged into an output coaxial transmission line with a self-break hydrogen switch. The dual resonant transformer is driven by a low inductance primary capacitor bank operating through a self-break gas switch. The upgrade of the coaxial hydrogen output switch is the focus of this report. The hydrogen output switch was developed through extensive electrical and mechanical simulations. The switch insulator is made of Ultem 2300 and is designed to operate with a mechanical factor of safety equal to 4.0 at 1,000 psi. The design criteria, design data and operational data will be presented.

  13. Formaldehyde from GOME-2

    Science.gov (United States)

    Comyn-Platt, Edward; Hewson, Will; Bösch, Hartmut; Barkley, Mike

    2014-05-01

    Isoprene is the most abundant non-methane biogenic volatile organic compound (BVOC) emitted into the atmosphere with emissions roughly equal to global methane emissions from all sources. Isoprene strongly influences the oxidation capacity in the troposphere hence influences levels of methane and tropospheric ozone, and is also a precursor to secondary organic aerosol. Isoprene, therefore, plays a significant role in radiative forcing and determining Earth's climate trends. However, the exact mechanisms of isoprene emission from vegetation are poorly understood and current land-surface models often use different parameterisation and meteorological fields to drive such schemes. Furthermore, isoprene emissions measurements are rare and are difficult to extrapolate to regional and continental scales thus resulting in large uncertainties in the total global emissions. Formaldehyde (HCHO) is formed as an intermediate product during the isoprene oxidation process and can be used as a proxy for isoprene emission. Global satellite observations of formaldehyde are now available from a number of satellite sensors which offer a unique ability to study isoprene emissions over large regions. Here, we use formaldehyde observations from the Global Ozone Monitoring Experiment 2 (GOME-2) instrument retrieved with the University of Leicester retrieval (Hewson et al. 2013) to: 1) test state-of-the-art model calculations using the GEOS-CHEM global transport model; 2) investigate the key drivers for regional year-to-year anomalies in formaldehyde (or isoprene) emissions and 3) assess the ability of current land surface models (MEGAN, JULES) to reproduce the observed anomalies and their dependence on climate variations.

  14. UPSS and G2

    Science.gov (United States)

    Dito, Scott J.

    2014-01-01

    The Universal Propellant Servicing System (UPSS) is a dedicated mobile launcher propellant delivery method that will minimize danger and complexity in order to allow vehicles to be serviced and ultimately launched from a variety of locations previously not seen fit for space launch. The UPPS/G2 project is the development of a model, simulation, and ultimately a working application that will control and monitor the cryogenic fluid delivery to the rocket for testing purposes. To accomplish this, the project is using the programming language/environment Gensym G2. The environment is an all-inclusive application that allows development, testing, modeling, and finally operation of the unique application through graphical and programmatic methods. We have learned G2 through classes and trial-and-error, and are now in the process of building the application that will soon be able to be tested on apparatuses here at Kennedy Space Center, and eventually on the actual unit. The UPSS will bring near-autonomous control of launches to those that need it, as well it will be a great addition to NASA and KSC's operational viability and the opportunity to bring space launches to parts of the world, and in time constraints, once not thought possible.

  15. Effects of Cd+2, Cu+2, Ba+2 and Co+2 ions on Entamoeba histolytica cysts

    Institute of Scientific and Technical Information of China (English)

    Umit Aksoy; Sebnem Ustun; Hande Dagci; Suleyman Yazar

    2004-01-01

    AIM: The effects of cobalt, copper, cadmium and barium ions on the cysts of Entamoeba histolytica (E.histolytica),an amebic dysentery agent, cultured in Robinson medium were investigated.METHODS: E. histolytica cysts and trophozoites isolated from a patient with amebiasis were cultivated in the medium,incubated at 37 ℃ for a period of 4 days and 40x104/ml amebic cysts were then transferred to a fresh medium. At the second stage, 0.05, 0.1 and 0.2 mM of selected metal ions were added to the medium, and the effects of these ions on parasitic reproduction compared with the control group were observed.RESULTS: It was determined that the number of living parasites in all the groups containing metal ions decreased significantly rtarting from 30 minutes (P<0.01). CuCl2 showed the highest lethal effect on E.histolytita cysts, whereas the lowest lethal effect was observed with CoCl2. It was also seen that the number of living cells was decreased as the ion concentration and exposure time were increased, and that there were no living paasites in the medium at the end of 24 h (P<0.01).CONCLUSION: It may be stated that the effect of everincreasing contamination of the environment with metal waste materials on parasites should be investigated further.

  16. APL2 in depth

    CERN Document Server

    Thomson, Norman D

    1995-01-01

    This book is designed for people with a working knowledge of APL who would like to increase their fluency in the wide range of extra facilities offered by second-generation APL products. Although the primary product in view is IBM's APL2 as implemented on mainframe, PC and RS/6000, the language fea­ tures covered share considerable common ground with APL *PLUS II and Oyalog APL. This is a book about skills rather than knowledge, and an acquaintance with some variety of APL on the reader's part is assumed from the start. It is designed to be read as a continuous text, interspersed with exer­ cises designed to give progressively deeper insight into what the authors conceive as the features which have the greatest impact on programming techniques. It would also be suitable as a text-book for a second course in APL2, although experience suggests that most programming language learning is now by self­ study, so that this volume is more likely to provide follow-up reading to more elementary texts such as "APL2 a...

  17. CPLOAS_2 User Manual.

    Energy Technology Data Exchange (ETDEWEB)

    Sallaberry, Cedric Jean-Marie [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Helton, Jon C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-05-01

    Weak link (WL)/strong link (SL) systems are important parts of the overall operational design of high - consequence systems. In such designs, the SL system is very robust and is intended to permit operation of the entire system under, and only under, intended conditions. In contrast, the WL system is intended to fail in a predictable and irreversible manner under accident conditions and render the entire system inoperable before an accidental operation of the SL system. The likelihood that the WL system will fail to d eactivate the entire system before the SL system fails (i.e., degrades into a configuration that could allow an accidental operation of the entire system) is referred to as probability of loss of assured safety (PLOAS). This report describes the Fortran 90 program CPLOAS_2 that implements the following representations for PLOAS for situations in which both link physical properties and link failure properties are time - dependent: (i) failure of all SLs before failure of any WL, (ii) failure of any SL before f ailure of any WL, (iii) failure of all SLs before failure of all WLs, and (iv) failure of any SL before failure of all WLs. The effects of aleatory uncertainty and epistemic uncertainty in the definition and numerical evaluation of PLOAS can be included in the calculations performed by CPLOAS_2. Keywords: Aleatory uncertainty, CPLOAS_2, Epistemic uncertainty, Probability of loss of assured safety, Strong link, Uncertainty analysis, Weak link

  18. Interleukin-2 carbohydrate recognition modulates CTLL-2 cell proliferation.

    Science.gov (United States)

    Fukushima, K; Yamashita, K

    2001-03-01

    Interleukin-2 (IL-2) specifically recognizes high-mannose type glycans with five or six mannosyl residues. To determine whether the carbohydrate recognition activity of IL-2 contributes to its physiological activity, the inhibitory effects of high-mannose type glycans on IL-2-dependent CTLL-2 cell proliferation were investigated. Man(5)GlcNAc(2)Asn added to CTLL-2 cell cultures inhibited not only phosphorylation of tyrosine kinases but also IL-2-dependent cell proliferation. We found that a complex of IL-2, IL-2 receptor alpha, beta, gamma subunits, and tyrosine kinases was formed in rhIL-2-stimulated CTLL-2 cells. Among the components of this complex, only the IL-2 receptor alpha subunit was stained with Galanthus nivalis agglutinin which specifically recognizes high-mannose type glycans. This staining was diminished after digestion of the glycans with endo-beta-N-acetylglucosaminidase H or D, suggesting that at least a N-glycan containing Man(5)GlcNAc(2) is linked to the extracellular portion of the IL-2 receptor alpha subunit. Our findings indicate that IL-2 binds the IL-2 receptor alpha subunit through Man(5)GlcNAc(2) and a specific peptide sequence on the surface of CTLL-2 cells. When IL-2 binds to the IL-2Ralpha subunit, this may trigger formation of the high affinity complex of IL-2-IL-2Ralpha, -beta, and -gamma subunits, leading to cellular signaling.

  19. Effects of Pb2+, Cd2+ and Cu2+ on the Aqueous Zn2+ Sorption by Hydroxyapatite

    Institute of Scientific and Technical Information of China (English)

    QI Yong; LIU Yu

    2006-01-01

    In this paper, the behaviors of aqueous zinc sorption by hydroxyapatite in the co-existence of Pb2+, Cd2+ and Cu2+ are investigated, the effects of Pb2+, Cd2+ and Cu2+ on the sorption of Zn2+ are discussed, and the hydroxyapatite sorption capabilities for Pb2+, Cd2+, Cu2+ and Zn2+ are compared.The experimental results show that the Zn2+ removal efficiency decreases gradually with the increase of the Cd2+ concentration of the solution, and there is no sorption preference between Cd2+ and Zn2+. On the other hand, the Zn2+ removal efficiency rapidly decreases rapidly with the increase of the Cu2+ concentration of the solution, and there is a clear sorption preference between Cu2+ and Zn2+. It is noticed that the Zn2+ removal efficiency is hardly changed with the variance of Pb2+ concentration because the removal mechanisms for these two ions are totally different. It is concluded that the adsorption affinities of the heavy metals for the hydroxyapatite follows this sequence: Pb2+> Cu2+>Cd2+> Zn2+.

  20. Topological twist of osp(2|2) + osp(2|2) conformal super algebra in two dimensions

    CERN Document Server

    Ano, N

    1995-01-01

    A Lagrangian of the topological field theory is found in the twisted osp(2|2)\\oplus osp(2|2)conformal super algebra. The reduction on a moduli space is then elaborated through the vanishing Noether current.

  1. Antimicrobial actions of the human epididymis 2 (HE2 protein isoforms, HE2alpha, HE2beta1 and HE2beta2

    Directory of Open Access Journals (Sweden)

    French Frank S

    2004-08-01

    Full Text Available Abstract Background The HE2 gene encodes a group of isoforms with similarities to the antimicrobial beta-defensins. We demonstrated earlier that the antimicrobial activity of HE2 proteins and peptides is salt resistant and structure dependent and involves permeabilization of bacterial membranes. In this study, we further characterize the antimicrobial properties of HE2 peptides in terms of the structural changes induced in E. coli and the inhibition of macromolecular synthesis. Methods E. coli treated with 50 micro g/ml of HE2alpha, HE2beta1 or HE2beta2 peptides for 30 and 60 min were visualized using transmission and scanning electron microscopy to investigate the impact of these peptides on bacterial internal and external structure. The effects of HE2alpha, HE2beta1 and HE2beta2 on E. coli macromolecular synthesis was assayed by incubating the bacteria with 2, 10 and 25 micro g/ml of the individual peptides for 0–60 min and measuring the incorporation of the radioactive precursors [methyl-3H]thymidine, [5-3H]uridine and L-[4,5-3H(N]leucine into DNA, RNA and protein. Statistical analyses using Student's t-test were performed using Sigma Plot software. Values shown are Mean ± S.D. Results E. coli treated with HE2alpha, HE2beta1 and HE2beta2 peptides as visualized by transmission electron microscopy showed extensive damage characterized by membrane blebbing, thickening of the membrane, highly granulated cytoplasm and appearance of vacuoles in contrast to the smooth and continuous membrane structure of the untreated bacteria. Similarly, bacteria observed by scanning electron microscopy after treating with HE2alpha, HE2beta1 or HE2beta2 peptides exhibited membrane blebbing and wrinkling, leakage of cellular contents, especially at the dividing septa, and external accumulation of fibrous materials. In addition, HE2alpha, HE2beta1 and HE2beta2 peptides inhibited E. coli DNA, RNA and protein synthesis. Conclusions The morphological changes observed

  2. Analysis list: Irf2bp2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Irf2bp2 Blood + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf2bp2.1....tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf2bp2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf...2bp2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Irf2bp2.Blood.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Blood.gml ...

  3. AFM imaging reveals the assembly of a P2X receptor complex containing P2X2, P2X4 and P2X6 subunits

    OpenAIRE

    2012-01-01

    Seven P2X purinergic receptor subunits have been identified: P2X1-P2X7. All except P2X6 assemble as homotrimers, and six heteromeric receptors (P2X1/2, P2X1/4, P2X1/5, P2X2/3, P2X2/6 and P2X4/6) have been described. In addition, P2X4 homomers associate with P2X2 or P2X7 homomers as dimers of trimers. The various P2X receptors show individual functional properties, suggesting distinct physiological roles. The overlapping expression of P2X2, P2X4 and P2X6 subunits has been shown in different ce...

  4. The structure, stability, and infrared spectrum of B 2N, B 2N +, B 2N -, BO, B 2O and B 2N 2.

    Science.gov (United States)

    Martin, J. M. L.; François, J. P.; Gijbels, R.

    1992-05-01

    The structure, infrared spectrum, and heat of formation of B 2N, B 2N -, BO, and B 2O have been studied ab initio. B 2N is very stable; B 2O even more so. B 2N, B 2N -, B 2O, and probably B 2N + have symmetric linear ground-state structures; for B 2O, an asymmetric linear structure lies about 12 kcal/mol above the ground state. B 2N +, B 2N - and B 2O have intense asymmetric stretching frequencies, predicted near 870, 1590 and 1400 cm -1, respectively. Our predicted harmonic frequencies and isotopic shifts for B 2O confirm the recent experimental identification by Andrews and Burkholder. Absorptions at 1889.5 and 1998.5 cm -1 in noble-gas trapped boron nitride vapor belong the BNB and BNBN ( 3Π), respectively; a tentative assignment of 882.5 cm -1 to BNB + is proposed. Total atomization energies Σ De (Σ D0) are computed (accuracy ±2 kcal/mol) as: BO 193.1 (190.4), B 2O 292.5 (288.7), B 2N 225.0 (250.3) kcal/mol. The ionization potential and electron affinity of B 2N are predicted to be 8.62±0.1 and 3.34±0.1 eV. The MP4-level additivity approximations involved in G1 theory results in errors on the order of 1 kcal/mol in the Σ De values.

  5. 2-(2-Hydroxypropan-2-yl-6-(prop-2-ynyloxy-1-benzofuran-3(2H-one

    Directory of Open Access Journals (Sweden)

    Henok H. Kinfe

    2012-12-01

    Full Text Available In the title compound, C14H14O4, the prop-2-ynyloxy O—C—C[triple-bond]C plane [maximum deviation = 0.0116 (12 Å] forms a dihedral angle of 78.44 (9° with the benzofuran-3(2H-one ring system. In the crystal, molecules are linked by O—H...O hydrogen bonds, forming a tape along the a-axis direction. C—H...O interactions are observed between the tapes.

  6. ENGINEERING CONTRACT ON FY-2 BATCH 2 SATELLITES SIGNED

    Institute of Scientific and Technical Information of China (English)

    SunQing

    2004-01-01

    The signing ceremony of the Engineering Contract on FY-2 Batch 2 (FY-2 02) Satellites was held in Beijing by Commission of Science, Technology and Industry for National Defense (COSTIND) on August 31, 2004. The contract on the development and manufacture of FY-2 batch 2 satellites and the contract on the launch, test and control of FY-2 Batch 2 satellites were signed by China Meteorological Administration (CMA),

  7. HYLIFE-2 progress report

    Energy Technology Data Exchange (ETDEWEB)

    Moir, R.W.; Adamson, M.G.; Bangerter, R.O.; Bieri, R.L.; Condit, R.H.; Hartman, C.W.; House, P.A.; Langdon, A.B.; Logan, B.G.; Orth, C.D.; Petzoldt, R.W.; Pitts, J.H.; Post, R.F.; Sacks, R.A.; Tobin, M.T.; Williams, W.H. (Lawrence Livermore National Lab., CA (United States)); Dolan, T.J.; Longhurst, G.R. (EG and G Idaho, Inc., Idaho Falls, ID (United States)); Hoffman, M.A. (California Univ., Davis, CA (United S

    1991-12-01

    LIFE-II inertial confinement fusion power plant design study uses a liquid fall, in the form of jets to protect the first structural wall from neutron damage, x rays, and blast to provide a 30-y lifetime. This is a progress report of an incomplete and ongoing study. HYLIFE-I used liquid lithium. HYLIFE-11 avoids the fire hazard of lithium by using a molten salt composed of fluorine, lithium, and beryllium (Li{sub 2}Be{sub 4}) called Flibe. Access for heavy-ion beams is provided. Calculations for assumed heavy-ion beam performance show a nominal gain of 70 at 5 MJ producing 350 MJ, about 5.2 times less yield than the 1.8 GJ from a driver energy of 4.5 MJ with gain of 400 for HYLIFE-I. The nominal 1 GWe of power can be maintained by increasing the repetition rate by a factor of about 5.2, from 1.5 to 8 Hz. A higher repetition rate requires faster re-establishment of the jets after a shot, which can be accomplished in part by decreasing the jet fall height and increasing the jet flow velocity. Multiple chambers may be required.In addition, although not considered for HYLIFE-I there is undoubtedly liquid splash that must be forcibly cleared because gravity is too slow, especially at high repetition rates. Splash removal can be accomplished by either pulsed or oscillating jet flows. The cost of electricity is estimated to be 0.10 $/kW{center dot} in constant 1990 dollars, about twice that of future coal and light water reactor nuclear power. The driver beam cost is about one-half the total cost.

  8. HYLIFE-2 progress report

    Energy Technology Data Exchange (ETDEWEB)

    Moir, R.W.; Adamson, M.G.; Bangerter, R.O.; Bieri, R.L.; Condit, R.H.; Hartman, C.W.; House, P.A.; Langdon, A.B.; Logan, B.G.; Orth, C.D.; Petzoldt, R.W.; Pitts, J.H.; Post, R.F.; Sacks, R.A.; Tobin, M.T.; Williams, W.H. [Lawrence Livermore National Lab., CA (United States); Dolan, T.J.; Longhurst, G.R. [EG and G Idaho, Inc., Idaho Falls, ID (United States); Hoffman, M.A. [California Univ., Davis, CA (United States). Dept. of Mechanical Engineering; Schrock, V.E.; Peterson, P.E.; Bai, R.Y.; Chen, X.M.; Liu, J.C. [California Univ., Berkeley, CA (United States). Dept. of Nuclear Engineering; Sze, D.K. [Argonne National Lab., IL (United States); Meier, W.R. [Schafer (W.J.) Associates, Inc., Pleasanton, CA (United States)

    1991-12-01

    LIFE-II inertial confinement fusion power plant design study uses a liquid fall, in the form of jets to protect the first structural wall from neutron damage, x rays, and blast to provide a 30-y lifetime. This is a progress report of an incomplete and ongoing study. HYLIFE-I used liquid lithium. HYLIFE-11 avoids the fire hazard of lithium by using a molten salt composed of fluorine, lithium, and beryllium (Li{sub 2}Be{sub 4}) called Flibe. Access for heavy-ion beams is provided. Calculations for assumed heavy-ion beam performance show a nominal gain of 70 at 5 MJ producing 350 MJ, about 5.2 times less yield than the 1.8 GJ from a driver energy of 4.5 MJ with gain of 400 for HYLIFE-I. The nominal 1 GWe of power can be maintained by increasing the repetition rate by a factor of about 5.2, from 1.5 to 8 Hz. A higher repetition rate requires faster re-establishment of the jets after a shot, which can be accomplished in part by decreasing the jet fall height and increasing the jet flow velocity. Multiple chambers may be required.In addition, although not considered for HYLIFE-I there is undoubtedly liquid splash that must be forcibly cleared because gravity is too slow, especially at high repetition rates. Splash removal can be accomplished by either pulsed or oscillating jet flows. The cost of electricity is estimated to be 0.10 $/kW{center_dot} in constant 1990 dollars, about twice that of future coal and light water reactor nuclear power. The driver beam cost is about one-half the total cost.

  9. Electronics 2 checkbook

    CERN Document Server

    Knight, S A

    2013-01-01

    Electronics 2 Checkbook is an 11-chapter text that presents problems and worked examples to establish and exemplify the theory contained in technical syllabuses, with a particular emphasis on electronics.The introductory chapters review the elementary theory of semiconductors and the p-n junction diode. The subsequent chapters deal with the applications of diode, the characteristics of bipolar transistors, and the mode of operation of small signal amplifiers. These topics are followed by discussions of the function of the field-effect transistor and power supplies. The concluding chapters expl

  10. Banff Challenge 2

    CERN Document Server

    Junk, Thomas R

    2011-01-01

    Experimental particle physics collaborations constantly seek newer and better ideas for improving the sensitivity of their searches for new particles and phenomena. Statistical techniques are the last step in interpreting the results of an experiment; they are used to make discoveries (hypothesis testing), and to measure parameters (point estimation). They are also used in the first step - experiment and analysis design. Banff Challenge 2 asks participants to test their methods of disco vering hidden signals in simulated datasets and of measuring the properties of these signals. The Challenge problems are described, and the performances of the submitted entries is summarized, for datasets with and without simulated signals present.

  11. Zend framework 2 cookbook

    CERN Document Server

    Callaars, Josephus

    2013-01-01

    This book is written in a practical, cookbook style with numerous examples and recipes. This style allows you to go both directly to your topic of interest or follow topics throughout a chapter to gain an in-depth knowledge of certain areas.'Zend Framework 2 Cookbook"" is for PHP developers who are fairly advanced in programming in PHP. It will also be useful for developers who have a keen interest in expanding their knowledge outside the boundaries of simply scripting pages together. As unit testing and MVC will be discussed, it is beneficial for the reader to know what these technologies are

  12. 2-(3-Nitrophenoxyquinoxaline

    Directory of Open Access Journals (Sweden)

    Noor Doha Hassan

    2010-09-01

    Full Text Available In the title molecule, C14H9N3O3, the dihedral angle between the quinoxaline and benzene rings is 77.13 (9°. The molecule is twisted about the ether–benzene O—C bond, with a C—O—C—C torsion angle of −102.8 (2°. In the crystal, molecules are linked by C—H...O hydrogen bonds, forming layers in the ab plane, with one nitro O atom accepting two such interactions. The layers stack along the c-axis direction via weak C—H...π interactions.

  13. Search for $2\

    CERN Document Server

    :,; Auty, D J; Barbeau, P S; Beck, D; Belov, V; Breidenbach, M; Brunner, T; Burenkov, A; Cao, G F; Chambers, C; Chaves, J; Cleveland, B; Coon, M; Craycraft, A; Daniels, T; Danilov, M; Daugherty, S J; Davis, J; Delaquis, S; Der Mesrobian-Kabakian, A; DeVoe, R; Didberidze, T; Dilling, J; Dolgolenko, A; Dolinski, M J; Dunford, M; Fairbank, W; Farine, J; Feldmeier, W; Feyzbakhsh, S; Fierlinger, P; Fudenberg, D; Gornea, R; Graham, K; Gratta, G; Hall, C; Hughes, M; Jewell, M J; Johnson, A; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; King, J; Koffas, T; Kravitz, S; Krücken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Mong, B; Moore, D; Njoya, O; Nelson, R; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Prescott, C Y; Retière, F; Rowson, P C; Russell, J J; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Tsang, R; Twelker, K; Vogel, P; Vuilleumier, J -L; Waite, A; Walton, J; Walton, T; Weber, M; Wen, L J; Wichoski, U; Winick, T A; Wood, J; Xu, Q Y; Yang, L; Yen, Y -R; Zeldovich, O Ya

    2015-01-01

    EXO-200 is a single phase liquid xenon detector designed to search for neutrinoless double-beta decay of $^{136}$Xe to the ground state of $^{136}$Ba. We report here on a search for the two-neutrino double-beta decay of $^{136}$Xe to the first $0^+$ excited state, $0^+_1$, of $^{136}$Ba based on a 100 kg$\\cdot$yr exposure of $^{136}$Xe. Using a specialized analysis employing a machine learning algorithm, we obtain a 90% CL half-life sensitivity of $1.7 \\times 10^{24}$ yr. We find no statistically significant evidence for the $2\

  14. PALEONTOLOGY (2)PALEOBOTANY

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>20082462 Huang Pin(Nanjing Institute of Geology and Palaeontology,Chinese Acade- my of Sciences,Nanjing 210008,China);Li Jianguo Sporopollen Assemblages from the Xishanyao and Toutunhe Formations at the Honggou Section of the Manasi River,Xin- jiang and Their Stratigraphical Significance (Acta Micropalaeontologica Sinica,ISSN 1000—0674,CN32—1189/Q,24(2),2007,p. 170—193,1 illus.,3 tables,4 plates,59 refs.) Key words:palynological assemblage, biostratigraphy,Xinjiang The Honggou section is located at Manasi

  15. Excited states 2

    CERN Document Server

    Lim, Edward C

    2013-01-01

    Excited States, Volume 2 is a collection of papers that deals with molecules in the excited states. The book describes the geometries of molecules in the excited electronic states. One paper describes the geometries of a diatomic molecule and of polyatomic molecules; it also discusses the determination of the many excited state geometries of molecules with two, three, or four atoms by techniques similar to diatomic spectroscopy. Another paper introduces an ordered theory related to excitons in pure and mixed molecular crystals. This paper also presents some experimental data such as those invo

  16. 2-(4-Pyridylmethoxyphenol

    Directory of Open Access Journals (Sweden)

    Xue-Mei Gao

    2009-12-01

    Full Text Available In the crystal structure of the title compound, C12H11NO2, inversion-related molecules are linked into dimers by pairs of O—H...N hydrogen bonds between the hydroxy group and the pyridyl ring. In addition, a π–π interaction [with a centroid–centroid distance of 3.78 (1 Å] is found between the two pyridyl rings of the dimer. The benzene ring forms a dihedral angle of 71.6 (1° with the pyridine ring

  17. 6-Methylpyridin-2-amine

    Directory of Open Access Journals (Sweden)

    Sergiu Draguta

    2012-12-01

    Full Text Available In the title molecule, C6H8N2, the endocyclic angles are in the range 118.43 (9–122.65 (10°. The molecular skeleton is planar (r.m.s. deviation = 0.007 Å. One of the two amino H atoms is involved in an N—H...N hydrogen bond, forming an inversion dimer, while the other amino H atom participates in N—H...π interactions between the dimers, forming layers parallel to (100.

  18. anticorpo monoclonal her2

    OpenAIRE

    Silva, Ana; Soares, Mariana; Guedes, Cátia

    2005-01-01

    Actualmente as terapêuticas tradicionais para neoplasias com grande invasão tecidular, não são suficientes, optando-se cada vez mais por estratégias de imunoterapia, dependente, claro, das características do tumor e do próprio sistema imunitário. A imunoterapia com anticorpos monoclonais, mais especificamente o Trastuzumab, dirigido para a neoplasia metastizada da mama, cujos tumores primários apresentam amplificação do HER2/neu tem apresentado grande eficácia, proporcionando uma melhoria ...

  19. 2D semiconductor optoelectronics

    Science.gov (United States)

    Novoselov, Kostya

    The advent of graphene and related 2D materials has recently led to a new technology: heterostructures based on these atomically thin crystals. The paradigm proved itself extremely versatile and led to rapid demonstration of tunnelling diodes with negative differential resistance, tunnelling transistors, photovoltaic devices, etc. By taking the complexity and functionality of such van der Waals heterostructures to the next level we introduce quantum wells engineered with one atomic plane precision. Light emission from such quantum wells, quantum dots and polaritonic effects will be discussed.

  20. At UA2

    CERN Multimedia

    1980-01-01

    Working on one of the 24 sectors of the e.m. and hadronic calorimeter. The UA2 central calorimeter extended over a region of polar angles from 40° to 140° (wrt beam axis) each sector covering an azimuth interval of 15°. Starting from its inner part, a sector contained trapezoidal e.m. (lead/scintillator) and hadronic (iron/scintillator) detection elements. The light collected through wave-shifter plates was brought to PMs on the outer surface (centre of the photo).

  1. Fatigue 󈨛. Volume 2,

    Science.gov (United States)

    1987-06-01

    fatigue cracks grown in a nominally elastic field. EXPERIMENTAL DETAILS A low alloy steel (QIN) with a composition closely similar to HY80 , i.e. 2.5...Prediction of Steel Cords - A. PRAKASH, 645 G.A. COSTELLO, R.M. SHEMENSKI AND D.K. KIM Effect of Hold Time on Fatigue of Lead Rich 655 PbSn Solder...S. VAYNMAN, M.E. FINE AND D.A. JEANNOTTE On Cleavage in Fatigue for Rail Steels - 667 ZHU DONG, CAI QIGONG and YAO HENG Influence of Cleavage on

  2. Electrical applications 2

    CERN Document Server

    Tyler, David W

    1998-01-01

    Electrical Applications 2 covers the BTEC NII level objectives in Electrical Applications U86/330. To understand the applications, a knowledge of the underlying principles is needed and these are covered briefly in the text. Key topics discussed are: the transmission and distribution of electrical energy; safety and regulations; tariffs and power factor correction; materials and their applications in the electrical industry; transformers; DC machines; illumination; and fuse protection. Included in each chapter are worked examples which should be carefully worked through before progressing to t

  3. The irradiation effects of Gd2Hf2O7 and Gd2Ti2O7

    Science.gov (United States)

    Li, Y. H.; Wen, J.; Wang, Y. Q.; Wang, Z. G.; Tang, M.; Valdez, J. A.; Sickafus, K. E.

    2012-09-01

    In this report, we present dramatically different behavior between isostructural Gd2Hf2O7 and Gd2Ti2O7 pyrochlore using 400 keV Ne2+ irradiation under cryogenic conditions (˜77 K), in which the lattice volume of the irradiated layer of Gd2Ti2O7 increased with ion fluence up to 1 × 1015 ions/cm2, whereas, the lattice volume of the irradiated layer of Gd2Hf2O7 decreased with increasing fluence from 1 × 1015 to 6 × 1016 ions/cm2. The cation radius ratio rA/rB, the bond-type of A-O and B-O bonds, the order-to-disorder transition energy of Gd2Hf2O7 and Gd2Ti2O7, temperature-composition (T-C) phase diagrams of HfO2-Gd2O3 and TiO2-Gd2O3 mixtures were used to explain the response of Gd2Hf2O7 and Gd2Ti2O7 to ion irradiation-induced structure transformation.

  4. CO2 laser preionisation

    Science.gov (United States)

    Spiers, Gary D.

    1991-01-01

    The final report for work done during the reporting period of January 25, 1990 to January 24, 1991 is presented. A literature survey was conducted to identify the required parameters for effective preionization in TEA CO2 lasers and the methods and techniques for characterizing preionizers are reviewed. A numerical model of the LP-140 cavity was used to determine the cause of the transverse mode stability improvement obtained when the cavity was lengthened. The measurement of the voltage and current discharge pulses on the LP-140 were obtained and their subsequent analysis resulted in an explanation for the low efficiency of the laser. An assortment of items relating to the development of high-voltage power supplies is also provided. A program for analyzing the frequency chirp data files obtained with the HP time and frequency analyzer is included. A program to calculate the theoretical LIMP chirp is also included and a comparison between experiment and theory is made. A program for calculating the CO2 linewidth and its dependence on gas composition and pressure is presented. The program also calculates the number of axial modes under the FWHM of the line for a given resonator length. A graphical plot of the results is plotted.

  5. ALPHA-2: the sequel

    CERN Multimedia

    Katarina Anthony

    2012-01-01

    While many experiments are methodically planning for intense works over the long shutdown, there is one experiment that is already working at full steam: ALPHA-2. Its final components arrived last month and will completely replace the previous ALPHA set-up. Unlike its predecessor, this next generation experiment has been specifically designed to measure the properties of antimatter.   The ALPHA team lower the new superconducting solenoid magnet into place. The ALPHA collaboration is working at full speed to complete the ALPHA-2 set-up for mid-November – this will give them a few weeks of running before the AD shutdown on 17 December. “We really want to get some experience with this device this year so that, if we need to make any changes, we will have time during the long shutdown in which to make them,” says Jeffrey Hangst, ALPHA spokesperson. “Rather than starting the 2014 run in the commissioning stage, we will be up and running from the get go.&...

  6. Microcosm 2.011

    CERN Multimedia

    CERN Bulletin

    2011-01-01

    Microcosm, CERN's first exhibition centre, will soon be upgraded. While keeping its present character and many of its nice features, the use of new cutting-edge exhibition technologies together with an area for student experiments and physics demonstrations will make version 2.011 even more attractive to the general public and school classes.   Layout of the new Microcosm 2.011 exhibition. New Year, and a new look for Microcosm! CERN's popular exhibition centre will undergo a transformation that will see, among other things, the installation of a new area dedicated to modern physics experiments for school groups. “Microcosm will keep its main features and character,” says Rolf Landua, Head of the Education Group, which is in charge of the project. “While some parts will be replaced by more modern exhibition technologies and contemporary scenography, others will be moved to allow a better visitor flow and make room for the brand-new school lab and public demonstration...

  7. COSMICFLOWS-2: THE DATA

    Energy Technology Data Exchange (ETDEWEB)

    Tully, R. Brent; Courtois, Hélène M.; Jacobs, Bradley A.; Wu, Po-Feng [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, HI 96822 (United States); Dolphin, Andrew E. [Raytheon Company, 1151 E Hermans Rd., Tucson, AZ 85756 (United States); Fisher, J. Richard [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Héraudeau, Philippe [Argelander-Institut für Astronomie, Auf dem Hügel 71, D-53121 Bonn (Germany); Karachentsev, Igor D.; Makarov, Dmitry; Makarova, Lidia; Mitronova, Sofia [Special Astrophysical Observatory, N Arkhyz, KChR 369167 (Russian Federation); Rizzi, Luca [W. M. Keck Observatory, 65-1120 Mamalahoa Highway, Waimea, HI 96743 (United States); Shaya, Edward J. [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Sorce, Jenny G. [Université Claude Bernard Lyon I, Institut de Physique Nucleaire, F-69622 Lyon (France)

    2013-10-01

    Cosmicflows-2 is a compilation of distances and peculiar velocities for over 8000 galaxies. Numerically the largest contributions come from the luminosity-line width correlation for spirals, the Tully-Fisher relation (TFR), and the related fundamental plane relation for E/S0 systems, but over 1000 distances are contributed by methods that provide more accurate individual distances: Cepheid, tip of the red giant branch (TRGB), surface brightness fluctuation, Type Ia supernova, and several miscellaneous but accurate procedures. Our collaboration is making important contributions to two of these inputs: TRGB and TFR. A large body of new distance material is presented. In addition, an effort is made to ensure that all the contributions, both our own and those from the literature, are on the same scale. Overall, the distances are found to be compatible with a Hubble constant H {sub 0} = 74.4 ± 3.0 km s{sup –1} Mpc{sup –1}. The great interest going forward with this data set will be with velocity field studies. Cosmicflows-2 is characterized by a great density and high accuracy of distance measures locally, falling to sparse and coarse sampling extending to z = 0.1.

  8. Unobscured Type 2 AGNs

    CERN Document Server

    Shi, Yong; Smith, Paul; Rigby, Jane; Hines, Dean; Donley, Jennifer; Schmidt, Gary; Diamond-Stanic, Aleksandar M; 10.1088/0004-637X/714/1/115

    2010-01-01

    Type 2 AGNs with intrinsically weak broad emission lines (BELs) would be exceptions to the unified model. After examining a number of proposed candidates critically, we find that the sample is contaminated significantly by objects with BELs of strengths indicating that they actually contain intermediate-type AGNs, plus a few Compton-thick sources as revealed by extremely low ratios of X-ray to nuclear IR luminosities. We develop quantitative metrics that show two (NGC 3147 and NGC 4594) of the remaining candidates to have BELs 2-3 orders of magnitude weaker than those of typical type-1 AGNs. Several more galaxies remain as candidates to have anomalously weak BELs, but this status cannot be confirmed with the existing information. Although the parent sample is poorly defined, the two confirmed objects are well under 1% of its total number of members, showing that the absence of a BEL is possible, but very uncommon in AGN. We evaluate these two objects in detail using multi-wavelength measurements. They have li...

  9. UPVG phase 2 report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-08-01

    The Utility PhotoVoltaic Group (UPVG), supported by member dues and a grant from the US Department of Energy, has as its mission the acceleration of the use of cost-effective small-scale and emerging large-scale applications of photovoltaics for the benefit of electric utilities and their customers. Formed in October, 1992, with the support of the American Public Power Association, Edison Electric Institute, and the National Rural Electric Cooperative Association, the UPVG currently has 90 members from all sectors of the electric utility industry. The UPVG`s efforts as conceived were divided into four phases: Phase 0--program plan; Phase 1--organization and strategy development; Phase 2--creating market assurance; and Phase 3--higher volume purchases. The Phase 0 effort developed the program plan and was completed early in 1993. The Phase 1 goal was to develop the necessary background information and analysis to lead to a decision as to which strategies could be undertaken by utilities to promote greater understanding of PV markets and achieve increased volumes of PV purchases. This report provides the details of the UPVG`s Phase 2 efforts to initiate TEAM-UP, its multiyear, 50-MW hardware initiative.

  10. DAFNE and KLOE-2

    CERN Document Server

    De Santis, A

    2015-01-01

    The DAFNE collider, located in the Frascati National Laboratories of INFN, has two main rings, where electrons and positrons are stored to collide at a center of mass energy of 1.02 GeV, the phi resonance mass. KLOE-2 experiment is located at the collider interaction region. The detector is capable to observe and collect data coming from phi decay: charged and neutral kaon pairs, lighter unflavored mesons (eta, eta', f0, a0, omega/rho). In the first half of 2013 the KLOE detector has been upgraded inserting new detector layers in the inner part of the apparatus, around the interaction region in order to improve detector hermeticity and acceptance. The long shutdown has been used to undertake a general consolidation program aimed at improving the DAFNE performances. This contribution presents the phi-factory setup and the achieved performances in terms of beam currents, luminosity and related aspects together with the KLOE-2 physics program, upgrade status report and recent physics results.

  11. 1-(Furan-2-yl-2-(2H-indazol-2-ylethanone

    Directory of Open Access Journals (Sweden)

    Özden Özel Güven

    2014-04-01

    Full Text Available The asymmetric unit of the title compound, C13H10N2O2, contains two crystallographically independent molecules (A and B. The indazole ring systems are approximately planar [maximum deviations = 0.0037 (15 and −0.0198 (15 Å], and their mean planes are oriented at 80.10 (5 and 65.97 (4° with respect to the furan rings in molecules A and B, respectively. In the crystal, pairs of C—H...N hydrogen bonds link the B molecules, forming inversion dimers. These dimers are bridged by the A molecules via C—H...O hydrogen bonds, forming sheets parallel to (011. There are also C—H...π interactions present, and π–π interactions between neighbouring furan and the indazole rings [centroid–centroid distance = 3.8708 (9 Å] of inversion-related molecules, forming a three-dimensional structure.

  12. Cosmicflows-2: The Data

    CERN Document Server

    Tully, R Brent; Dolphin, Andrew E; Fisher, J Richard; Heraudeau, Philippe; Jacobs, Bradley A; Karachentsev, Igor D; Makarov, Dmitry; Makarova, Lidia; Mitronova, Sofia; Rizzi, Luca; Shaya, Edward J; Sorce, Jenny G; Wu, Po-Feng

    2013-01-01

    Cosmicflows-2 is a compilation of distances and peculiar velocities for over 8000 galaxies. Numerically the largest contributions come from the luminosity-linewidth correlation for spirals, the TFR, and the related Fundamental Plane relation for E/S0 systems, but over 1000 distances are contributed by methods that provide more accurate individual distances: Cepheid, Tip of the Red Giant Branch, Surface Brightness Fluctuation, SNIa, and several miscellaneous but accurate procedures. Our collaboration is making important contributions to two of these inputs: Tip of the Red Giant Branch and TFR. A large body of new distance material is presented. In addition, an effort is made to assure that all the contributions, our own and those from the literature, are on the same scale. Overall, the distances are found to be compatible with a Hubble Constant H_0 = 74.4 +-3.0 km/s/Mpc. The great interest going forward with this data set will be with velocity field studies. Cosmicflows-2 is characterized by a great density an...

  13. Mastering JavaServer Faces 2.2

    CERN Document Server

    Leonard, Anghel

    2014-01-01

    A homogenous guide integrating the features of JSF 2.x (2.0, 2.1 and 2.2), following a "learning through examples" paradigm with its main focus on the advanced concepts of JSF. If you are a web developer who uses JSF, this is the book for you. Catering to an intermediate-advanced audience, the book assumes you have fundamental knowledge of JSF. It is intended for the developer who wants to improve their skills with the combined power of JSF 2.0, 2.1, and 2.2.

  14. Diaqua-2κ2O-bis(μ-1-oxido-2-naphthoato-1:2κ3O1,O2:O2′;2:3κ3O2:O1,O2′-bis(1-oxido-2-naphthoato-1κ1O2,O2;3κ2O1,O2-hexapyridine-1κ2N,2κ2N,3κ2N-trimanganese(II/III pyridine disolvate dihydrate

    Directory of Open Access Journals (Sweden)

    Daqi Wang

    2008-12-01

    Full Text Available The title complex, [Mn3(C11H6O34(C5H5N6(H2O22H22C5H5N, is a trinuclear mixed oxidation state complex of overline1 symmetry. The three Mn atoms are six-coordinated in the shape of distorted octahedra, each coordinated with an O4N2 set of donor atoms, where the ligands exhibit mono- and bidentate modes. However, the coordination of the MnII ion located on the inversion centre involves water molecules at two coordination sites, whereas that of the two symmetry-related MnIII ions involves an O4N2 set of donor atoms orginating from the organic ligands. Intramolecular C—H...π interactions between neighbouring pyridine ligands stabilize this arrangement. A two-dimensional network parallel to (001 is formed by intermolecular O—H...O hydrogen bonds.

  15. [2,2-Bis(diphenylphosphanylpropane-κ2P,P′]tetracarbonylchromium(0 dichloromethane monosolvate

    Directory of Open Access Journals (Sweden)

    Normen Peulecke

    2010-11-01

    Full Text Available The title compound, [Cr(C27H26P2(CO4]·CH2Cl2, was obtained by the reaction of Ph2PCMe2PPh2 with Cr(CO6 in refluxing toluene by substitution of two carbonyl ligands. The CrC4P2 coordination geometry at the Cr atom is distorted octahedral, with a P—Cr—P bite angle of 70.27 (2°.

  16. Evaluation of P2-C2 bias estimation

    Science.gov (United States)

    Santos, M. C.; van der Bree, R.; van der Marel, H.; Verhagen, S.; Garcia, C. A.

    2010-12-01

    The availability of the second civilian code C2 created a new issue to be considered: the bias relating P2 and C2 signals. Such an issue is important when merging C2-capable and legacy receivers and when processing data collected by a C2-capable receiver with satellite clock values generated using a legacy receiver network. The P2-C2 bias is essentially a consequence from the fact that receiver and satellite hardware delays for C2 measurements may not be necessarily the same of those for P2. Knowing this bias makes possible the use of C2 as an observable for positioning using IGS clock products. We are using the PPP-based approach for P2-C2 bias estimation developed at the University of New Brunswick. For that purpose, we use GAPS, the GPS Analysis and Positioning Software. We also determine P2-C2 bias directly from the code observations. This poster presents and discusses the evaluation of P2-C2 values estimated from a sub-set of the IGS L2C Test Network. The values are applied to observations collected by C2-capable receivers in the point positioning mode. Coordinate repeatability indicate an improvement of up to 50% when using the P2-C2 bias.

  17. HER2 and COX2 expression in human prostate cancer.

    Science.gov (United States)

    Edwards, J; Mukherjee, R; Munro, A F; Wells, A C; Almushatat, A; Bartlett, J M S

    2004-01-01

    COX2 and HER2 expression are associated with a poor prognosis in prostate cancer and HER2 has been linked to COX2 expression in colorectal cancer. The association between COX2 and HER2 expression was investigated in 117 patients with prostate cancer (89) or Benign prostatic hyperplasia (BPH) (28). Tissue was analysed for HER2 amplification by fluorescent in situ hybridisation, and HER2 and COX2 protein expression by immunohistochemistry (IHC). All tumours analysed expressed COX2 at a significantly higher level than BPH tissue (P=0.041). Only low levels of HER2 gene amplification (8%, 7/89) and HER2 protein expression (12%, 11/89) were observed. HER2 protein expression was rarely observed and did not correlate with HER2 amplification or COX2 expression. Although HER2 does not drive COX2 expression in prostate cancer, this study identified high levels of COX2 expressed in locally advanced prostate cancer, suggesting COX2 could be a potential therapeutic target. COX2 inhibitors are currently being used in clinical trials for the treatment of other tumour types.

  18. Magnetic and structural characterization of the 2D XY-ferromagnet Rb2CrCl2I2 (abstract)

    Science.gov (United States)

    Visser, D.; Bramwell, S. T.; Kremer, R. K.

    1991-04-01

    Rb2CrCl2I2 crystallizes with a Jahn-Teller deformed K2NiF4 structure. This results in a ferromagnetic behavior for this compound. Rb2CrCl2I2 orders ferromagnetically at Tc=56.9(2) K. Magnetization and magnetic susceptibility measurements, using a vibrating sample magnetometer, Faraday balance, and SQUID magnetometer, on polycrystalline samples were used for the magnetic characterization. Rb2CrCl2I2 shows a Curie-Weiss behavior between 150 and 300 K. The intraplanar superexchange constant J/k=5.8 K. The intra- and interplanar anisotropy have been obtained from the magnetization curves at 4.2 K and are estimated at Hintra=0.16(2) T and Hinter=4.5(2) T.

  19. RANCANG BANGUN ALAT PENJERNIH AIR LIMBAH CAIR LAUNDRY DENGAN MENGGUNAKAN MEDIA PENYARING KOMBINASI PASIR – ARANG AKTIF

    Directory of Open Access Journals (Sweden)

    Hery Setyobudiarso

    2014-05-01

    Full Text Available Perkembangan jasa pencucian pakaian (laundry berkontribusi pada peningkatan penggunaan air tanah dan pemakaian deterjen sehingga menghasilkan limbah cair yang dapat mencemari lingkungan. Oleh karena itu, diperlukan sistem pengolahan air limbah laundry menjadi air bersih. Tujuan penelitian ini adalah menentukan pengaruh bahan penyaring pasir silika, zeolit dan arang aktif terhadap hasil olahan air limbah laundry dan mengetahui  pengaruh tekanan dan waktu pemakaian reaktor penyaring. Metode pengolahan yang digunakan adalah filtrasi menggunakan filtrasi pasir silika, adsorpsi karbon aktif, serta gabungan pengolahan filtrasi pasir aktif dan adsorpsi karbon aktif untuk menghasilkan air bersih. Hasil penelitian menunjukkan bahwa metode pengolahan koagulasi dan flokulasi, filtrasi pasir aktif, adsorpsi karbon aktif serta gabungan filtrasi pasir aktif dan adsorpsi karbon aktif mampu menurunkan kekeruhan hingga batas maksimum air bersih. Karakteristik limbah laundry pada tekanan 1 bar memiliki nilai warna, COD dan TSS yang cenderung menurun dari menit ke 20 hingga menit ke 60 , warna nilai 138, COD 908 mg/l dan TSS 215 mg/l. Sedangkan pada tekanan 2 bar memiliki nilai warna, COD dan TSS yang cenderung menurun dari menit ke 20 hingga menit ke 60 , masing-masing masing-masing warna nilai 40, COD 746 mg/l dan TSS 210 mg/l.  Air yang dihasilkan bukan merupakan air bersih tetapi aman untuk dibuang ke lingkungan.

  20. Pembuatan Nitroselulosa dari Kapas (Gossypium sp. dan Jerami (Oryza sativa Melalui Reaksi Nitrasi

    Directory of Open Access Journals (Sweden)

    Adly Rahmada

    2013-09-01

    Full Text Available Tujuan penelitian ini adalah mengetahui pengaruh bahan baku selulosa pada proses pembuatan nitroselulosa dari bahan selulosa kapas dan jerami dengan reaksi nitrasi, mempelajari pengaruh waktu dan suhu reaksi terhadap kualitas nitroselulosa yang dihasilkan, dan membandingkan kualitas nitroselulosa yang dihasilkan dari selulosa kapas dan jerami. Prosedur penelitian ini adalah menimbang dan memasak bahan baku dengan menggunakan larutan pemasak NaOH. Langkah selanjutnya adalah mereaksikan HNO3 dengan H2SO4 dan mengkondisikan reaktor sesuai dengan variabel suhu.Langkah berikutnya adalah mereaksikanbahan bakukapas atau jerami sesuai dengan variabel waktu. Langkah terakhir adalah mencucinya dengan aquadest dan larutan NaHCO3. Kemudian dilakukan pengukuran uji kelarutan untuk memperoleh persen yield dan uji FTIR. Kesimpulan yang dapat diperoleh dari penelitian ini adalah bahan baku selulosa jerami menghasilkan persen yield nitroselulosa produk lebih besar daripada kapas. Persen yield nitroselulosa jerami mencapai 86% sedangkan untuk kapas 68%. Pengaruh waktu reaksi nitrasi terhadap produk nitroselulosa didapatkan semakin bertambah waktu reaksi maka menghasilkan yield dan kandungan gugus nitro semakin besar. Sedangkan untuk pengaruh suhu reaksi didapatkan  semakin rendah suhu reaksi maka persen yield dan gugus nitro yang diperoleh semakin besar. Perbedaan kualitas nitroselulosa dari bahan baku kapas dan jerami ditunjukkan dengan substitusi gugus nitro dari produk nitroselulosa, maka dapat diketahui bahwa nitroselulosa dari kedua bahan baku memiliki kualias yang hampir sama dengan dua substitusi gugus nitro.

  1. Sintesis Molibdenum Oksida Berpenyangga Silika sebagai Katalis pada Reaksi Oksidasi Etanol Menjadi Asetaldehida

    Directory of Open Access Journals (Sweden)

    Achyar Rasyidi

    2015-06-01

    Full Text Available Oksidasi etanol membentuk asetaldehida dengan menggunakan katalis molibdenum oksida berpenyangga silika oksida telah dilakukan. Preparasi katalis dilakukan dengan metode impregnasi dengan rasio Mo : Si 1 : 1, 3 : 1, 6 : 1, 9 : 1. Karakterisasi katalis dilakukan menggunakan X-Ray Difractometer (XRD. Hasil identifikasi menunjukkan bahwa komponen katalis yang telah dibuat mengandung kristal MoO3 dan SiO2. Uji kinerja katalis dilakukan terhadap reaksi oksidasi etanol menjadi asetaldehida. Reaksi oksidasi dilangsungkan dalam reaktor pipa lurus berunggun tetap yang beroperasi pada suhu 200oC, 225oC, 250oC, 275oC, 300oC, 325oC, dan 350oC pada tekanan atmosfir. Hasil uji kinerja menunjukkan bahwa konversi tertinggi diperoleh sebesar 91,99% pada temperatur 350oC menggunakan katalis dengan rasio Mo : Si = 9 : 1. Selektivitas tertinggi diperoleh sebesar 89,10% pada temperatur 200oC dengan rasio Mo : Si = 9 : 1. Yield tertinggi diperoleh sebesar 74,80% pada temperatur 350oC pada katalis dengan rasio Mo : Si = 9 : 1.

  2. Current Status of VHTR Technology Development

    Energy Technology Data Exchange (ETDEWEB)

    David Petti; Hans Gougar; Richard Wright; William Windes; Steve Herring; Richard Schultz; Paul Humrickhouse

    2010-10-01

    Abstract – High Temperature Gas-cooled Reactors (HTGRs) featuring particle fuel reached the stage of commercial deployment in the mid-1980s with the Fort St.Vrain and Thorium HochTemperatur Reaktor feeding electricity to the grids in the United States and West Germany, respectively. The technology was then adopted by Japan and China with the operation of the High Temperature Test Reactor in Oarai, Japan and the High Temperature Reactor (HTR-10) in China. Increasing the outlet temperature of the HTGR to even higher temperatures above 900°C will improve the thermodynamic efficiency of the system and enable application of a new class of gas reactor, the very high temperature reactor, to provide process heat, electricity, and hydrogen to chemical industries with the attendant benefits of improved energy security and reduced CO2 emissions. However, the increase in coolant outlet temperature presents a number of technical challenges associated with fuel, materials, power conversion, and analysis methods for the reactor and hydrogen production. The U.S. Department of Energy is sponsoring a broad program of research and development with a goal of addressing the technical challenges over a broad range of outlet temperatures as part of the Next Generation Nuclear Plant Project. This paper describes the research and development activities that are currently underway to realize the technologies needed for an HTGR that features outlet temperatures of 750 to 950°C.

  3. Crystal Structure, Electronic Structure, and Photocatalytic Activity of Oxysulfides: La2Ta2ZrS2O8, La2Ta2TiS2O8, and La2Nb2TiS2O8.

    Science.gov (United States)

    Goto, Yosuke; Seo, Jeongsuk; Kumamoto, Kazunori; Hisatomi, Takashi; Mizuguchi, Yoshikazu; Kamihara, Yoichi; Katayama, Masao; Minegishi, Tsutomu; Domen, Kazunari

    2016-04-01

    The novel oxysulfides La2Ta2ZrS2O8 (LTZSO), La2Ta2TiS2O8 (LTTSO), and La2Nb2TiS2O8 (LNTSO) were synthesized, and their crystal structures, electronic structures, and photocatalytic activities for water splitting under visible light were investigated. Density functional theory calculations showed that these compounds are direct-band-gap semiconductors. Close to the conduction band minimum, the main contribution to the band structure comes from the d orbitals of Zr or Ti ions, while the region near the valence band maximum is associated with the 3p orbitals of S ions. The absorption-edge wavelength was determined to be 540 nm for LTZSO and 700 nm for LTTSO and LNTSO. An analysis of the crystal structure using synchrotron X-ray diffraction revealed that these compounds contained antisite defects at transition metal ion sites, and these were considered to be the origin of the broad absorption at wavelengths longer than that corresponding to band-gap excitation. LTZSO was revealed to be active in the oxygen evolution reaction from aqueous solution containing a sacrificial electron acceptor under visible-light illumination. This result was supported by the band alignment and flat-band potential determined by photoelectron spectroscopy and Mott-Schottky plots.

  4. 40 CFR 721.10133 - 2-Propenoic acid, 2-methyl, 2-hydroxyethyl ester, homopolymer.

    Science.gov (United States)

    2010-07-01

    ...-hydroxyethyl ester, homopolymer. 721.10133 Section 721.10133 Protection of Environment ENVIRONMENTAL PROTECTION... New Uses for Specific Chemical Substances § 721.10133 2-Propenoic acid, 2-methyl, 2-hydroxyethyl ester... identified as 2-propenoic acid, 2-methyl, 2-hydroxyethyl ester, homopolymer (PMN P-07-401; CAS No....

  5. 40 CFR 721.10064 - 2-Propenoic acid, 2-[2-(ethenyloxy)ethoxy]ethyl ester.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false 2-Propenoic acid, 2- ethyl ester. 721... Substances § 721.10064 2-Propenoic acid, 2- ethyl ester. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as 2-propenoic acid, 2- ethyl ester (PMN...

  6. Antimicrobial, antioxidant, cytotoxic and molecular docking properties of N-benzyl-2,2,2-trifluoroacetamide

    Science.gov (United States)

    Balachandran, C.; Kumar, P. Saravana; Arun, Y.; Duraipandiyan, V.; Sundaram, R. Lakshmi; Vijayakumar, A.; Balakrishna, K.; Ignacimuthu, S.; Al-Dhabi, N. A.; Perumal, P. T.

    2015-02-01

    N-Benzyl-2,2,2-trifluoroacetamide was obtained by acylation of benzylamine with trifluoroacetic anhydride using Friedel-Crafts acylation method. The synthesised compound was confirmed by spectroscopic and crystallographic techniques. N-Benzyl-2,2,2 -trifluoroacetamide was assessed for its antimicrobial, antioxidant, cytotoxic and molecular docking properties. It showed good antifungal activity against tested fungi and moderate antibacterial activity. The minimum inhibitory concentration values of N-benzyl-2,2,2 -trifluoroacetamide against fungi were 15.62 μg/mL against A. flavus, 31.25 μg/mL against B. Cinerea and 62.5 μg/mL against T. mentagrophytes, Scopulariopsis sp., C. albicans and M. pachydermatis. N-Benzyl-2,2,2-trifluoroacetamide showed 78.97 ± 2.24 of antioxidant activity at 1,000 μg/mL. Cupric ion reducing antioxidant capacity of N-benzyl-2,2,2-trifluoroacetamide was dependent on the concentration. Ferric reducing antioxidant power assay of N-benzyl-2,2,2-trifluoroacetamide showed (1.352 ± 0.04 mM Fe(II)/g) twofold higher value compared to the standard. N-Benzyl-2,2,2-trifluoroacetamide showed 75.3 % cytotoxic activity at the dose of 200 μg/mL with IC50 (54.7 %) value of 100 μg/mL. N-Benzyl-2,2,2-trifluoroacetamide was subjected to molecular docking studies for the inhibition AmpC beta-lactamase, Glucosamine-6-Phosphate Synthase and lanosterol 14 alpha-demethylase (CYP51) enzymes which are targets for antibacterial and antifungal drugs. Docking studies of N-benzyl-2,2,2-trifluoroacetamide showed low docking energy. N-Benzyl-2,2,2-trifluoroacetamide can be evaluated further for drug development.

  7. Removal of Heavy Metals Pb2+, Cu2+, Zn2+, Cd2+, Ni2+, Co2+ and Fe3+ from Aqueous Solutions by using Xanthium Pensylvanicum

    Directory of Open Access Journals (Sweden)

    Jaber SALEHZADEH

    2013-11-01

    Full Text Available The hazardous ill effects of heavy metals on the environment and public health is a matter of serious concern. Biosorption is emerging as a sustainable effective technology. Heavy metals in water resources are one of the most important environmental problems of countries. The intensification of industrial activity and environmental stress greatly contributes to the significant rise of heavy metal pollution in water resources making threats on terrestrial and aquatic life. The toxicity of metal pollution is slow and interminable, as these metal ions are non bio-degradable. The adsorption capacity of Xanthium Pensylvanicum towards metal ions such as Pb2+, Cu2+, Zn2+, Cd2+, Ni2+, Co2+ and Fe3+, was studied. The adsorption capacity was performed by batch experiments as a function of process parameters (such as sorption time and pH. Experimental results showed that the removal percentages increasing of metal ions at pH=4, initial concentration of metal ions 10 mg/L, and after 90 min of shaking was: Zn2+ < Cd2+ < Cu2+ < Pb2+ < Ni2+ < Fe3+ < Co2+.

  8. Reliable Potential Energy Surfaces for the Reactions of H2O with ThO2, PaO2(+), UO2(2+), and UO2(.).

    Science.gov (United States)

    Vasiliu, Monica; Peterson, Kirk A; Gibson, John K; Dixon, David A

    2015-11-19

    The potential energy surfaces for the reactions of H2O with ThO2, PaO2(+), UO2(2+), and UO2(+) have been calculated at the coupled cluster CCSD(T) level extrapolated to the complete basis set limit with additional corrections including scalar relativistic and spin-orbit. The reactions proceed by the formation of an initial Lewis acid-base adduct (H2O)AnO2(0/+/2+) followed by a proton transfer to generate the dihydroxide AnO(OH)2(0/+/2+). The results are in excellent agreement with mass spectrometry experiments and prior calculations of hydrolysis reactions of the group 4 transition metal dioxides MO2. The differences in the energies of the stationary points on the potential energy surface are explained in terms of the charges on the system and the populations on the metal center. The use of an improved starting point for the coupled cluster CCSD(T) calculations based on density functional theory with the PW91 exchange-correlation functional or Brueckner orbitals is described. The importance of including second-order spin-orbit corrections for closed-shell molecules is also described. These improvements in the calculations are correlated with the 5f populations on the actinide.

  9. The Vaporization of B2O3(l) to B2O3(g) and B2O2(g)

    Science.gov (United States)

    Jacobson, Nathan S.; Myers, Dwight L.

    2011-01-01

    The vaporization of B2O3 in a reducing environment leads to formation of both B2O3(g) and B2O2(g). While formation of B2O3(g) is well understood, many questions about the formation of B2O2(g) remain. Previous studies using B(s) + B2O3(l) have led to inconsistent thermodynamic data. In this study, it was found that after heating, B(s) and B2O3(l) appear to separate and variations in contact area likely led to the inconsistent vapor pressures of B2O2(g). To circumvent this problem, an activity of boron is fixed with a two-phase mixture of FeB and Fe2B. Both second and third law enthalpies of formation were measured for B2O2(g) and B2O3(g). From these the enthalpies of formation at 298.15 K are calculated to be -479.9 +/- 41.5 kJ/mol for B2O2(g) and -833.4 +/- 13.1 kJ/mol for B2O3(g). Ab initio calculations to determine the enthalpies of formation of B2O2(g) and B2O3(g) were conducted using the W1BD composite method and show good agreement with the experimental values.

  10. (0,2) Elephants

    CERN Document Server

    Aspinwall, Paul S; Plesser, M Ronen

    2010-01-01

    We enumerate massless E6 singlets for (0,2)-compactifications of the heterotic string on a Calabi-Yau threefold with the "standard embedding" in three distinct ways. In the large radius limit of the threefold, these singlets count deformations of the Calabi-Yau together with its tangent bundle. In the "small-radius" limit we apply Landau-Ginzburg methods. In the orbifold limit we use a combination of geometry and free field methods. In general these counts differ. We show how to identify states between these phases and how certain states vanish from the massless spectrum as one deforms the complex structure or Kaehler form away from the Gepner point. The appearance of extra singlets for particular values of complex structure is explored in all three pictures, and our results suggest that this does not depend on the Kaehler moduli.

  11. BPMN2.0

    Institute of Scientific and Technical Information of China (English)

    潘加宇

    2010-01-01

    OMG已经通过Business Process Modeling Notation(BPMN)2.0规格的beta版本,最后的版本预计将于2010年通过。BPMN在过去几年内的采纳率增长得很快,因为它比较简单,容易上手。不过,BPMN1.x只是提供了业务流程建模的图形符号,没有定义交换格式以保证用户在不同厂商的BPMN工具之间以标准方式交换模型,

  12. Volume 7 Issue 2

    Directory of Open Access Journals (Sweden)

    Tracy Creagh

    2016-07-01

    Full Text Available The continuing interest and commitment to improving the student experience in the tertiary sector was reflected in yet another successful Students, Transitions, Achievement, Retention and Success (STARS Conference recently held in Perth, Western Australia (June 29-July 2, 2016.  As is customary, this issue of the journal publishes the top research papers selected via a peer review process and the top Emerging Initiatives selected by the Conference Committee.  As well, a Good Practice Report was selected for this issue.  The Invited Feature in this issue republishes an article from Professor Sally Kift, President of the Australian Learning and Teaching Fellows (and one of the Editors of Student Success. The statement draws on and is representative of the national reaction to the closure of the OLT, highlighting the substantial role it has played in developing and disseminating innovation and good practice in tertiary teaching and learning.

  13. 2-Methylaspartic acid monohydrate

    Directory of Open Access Journals (Sweden)

    Ray J. Butcher

    2013-12-01

    Full Text Available The title compound, C5H9NO4·H2O, is an isomer of the α-amino acid glutamic acid that crystallizes from water in its zwitterionic form as a monohydrate. It is not one of the 20 proteinogenic α-amino acids that are used in living systems and differs from the natural amino acids in that it has an α-methyl group rather than an α-H atom. In the crystal, an O—H...O hydrogen bond is present between the acid and water molecules while extensive N—H...O and O—H...O hydrogen bonds link the components into a three-dimensional array.

  14. Polarization effects. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    Courant, E.

    1981-01-01

    The use of polarized proton beams in ISABELLE is important for several general reasons: (1) With a single longitudinally polarized proton beam, effects involving parity violation can be identified and hence processes involving weak interactions can be separated from those involving strong and electromagnetic interactions. (2) Spin effects are important in the strong interactions and can be useful for testing QCD. The technique for obtaining polarized proton beams in ISABELLE appears promising, particularly in view of the present development of a polarized proton beam for the AGS. Projections for the luminosity in ISABELLE for collisions of polarized protons - one or both beams polarized with longitudinal or transverse polarization - range from 1/100 to 1 times the luminosity for unpolarized protons.

  15. 掠食2

    Institute of Scientific and Technical Information of China (English)

    老黑

    2012-01-01

    在《掠食2》中将要讲述一代外星飞船上被关押的另一个猛男——联邦执法官Samuels在异星世界Exodus上的冒险,制作组宣称本作将会拥有《刺客信条》的高自由度、《质量效益》的角色扮演感……在年初公布的全新资料中.制作组举了这样一个例子来诠释本作的沙盒玩法:身为赏金猎人的你,

  16. 2-[((E-2-{2-[(E-2-Hydroxybenzylidene]hydrazinecarbonyl}hydrazinylidenemethyl]phenol

    Directory of Open Access Journals (Sweden)

    Rahman Bikas

    2012-01-01

    Full Text Available The molecule of the title compound, C15H14N4O3, is completed by the application of crystallographic twofold symmetry, with the carbonyl group lying on the rotation axis. The molecule is close to planar: the greatest deviation of a torsion angle from 0° is 7.3 (2° about the bond linking the phenol ring to the rest of the molecule. An intramolecular O—H...N(imine hydrogen bond is formed in each half of the molecule. The carbonyl O atom is anti with respect to the amine H atoms and this allows for the formation of N—H...O(hydroxyl hydrogen bonds in the crystal, which results in supramolecular layers lying parallel to (100.

  17. 20.2.Infection

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    930385 Determination of serum sialic acidphospholipid and cholesterol and its clinical sig-nificance in patients with Guillain-Barre syn-drome.ZHANG Xiangjian (张祥建),et al.DeptNeurol,2nd Affil Hosp,Hebei Med Coil,Shiji-azhuang,050000.Chin J Nerv & Merit Dis 1992;18(5):271—273.Serum sialie acid (SA) level was measured inthe patients with Guillain-Barre syndrome(GBS) and normal controls.The results showedthat the serum SA level (788.1±23.8mg/L) in51 of patients with GBS was significantly higherthan that(538.1±8.9mg/L) in 50 normal con-trols (P<0.001).The positivity of serum SA inthe patients (36/51) was significantly higherthan that in normal controls (3/50,P<0.001).

  18. Presynaptic P2 receptors?

    Science.gov (United States)

    Stone, T W; O'Kane, E M; Nikbakht, M R; Ross, F M

    2000-07-01

    Although the emphasis in ATP research has been on postjunctional receptors, there is also evidence for presynaptic receptors regulating transmitter release in the autonomic nervous system. Recent work has attempted to identify similar mechanisms in the central nervous system. Some of the existing results can be explained by the metabolism of nucleotides to adenosine or adenosine 5'-monophosphate (AMP). However, studies of presynaptic effects using sensitive electrophysiological tests such as paired-pulse interactions indicate that nucleotides can act at presynaptic sites, but that their effects may be mediated by a release of adenosine. Results are also described which indicate that, under some conditions, nucleotides can mediate phenomena such as long-term potentiation, which probably involves a significant presynaptic element. In part these effects may involve a nucleotide-induced release of adenosine and the simultaneous activation of P1 and P2 receptors.

  19. Porsche 911 GT2

    Institute of Scientific and Technical Information of China (English)

    prometheus

    2007-01-01

    保时捷终于发布了目前997车系中最强的车型:Porsche 911 GT2。新车搭载一台排量为3596cc的水平对向六缸双涡轮增压引擎,最大马力530ps/6500rpm,最大扭力680Nm/2200~460Cmm,0~100km/h加速仅需3.7s,极速为320km/h。新车采用RR(后置引擎、后轮驱动)驱动布局,传动系统只提供六前速手动波箱。

  20. (0,2) elephants

    Science.gov (United States)

    Aspinwall, Paul S.; Melnikov, Ilarion V.; Plesser, M. Ronen

    2012-01-01

    We enumerate massless E6 singlets for (0,2)-compactifications of the heterotic string on a Calabi-Yau threefold with the "standard embedding" in three distinct ways. In the large radius limit of the threefold, these singlets count deformations of the Calabi-Yau together with its tangent bundle. In the "small-radius" limit we apply Landau-Ginzburg methods. In the orbifold limit we use a combination of geometry and free field methods. In general these counts differ. We show how to identify states between these phases and how certain states vanish from the massless spectrum as one deforms the complex structure or Kähler form away from the Gepner point. The appearance of extra singlets for particular values of complex structure is explored in all three pictures, and our results suggest that this does not depend on the Kähler moduli.

  1. 2-Methoxy-9-phenoxyacridine

    Directory of Open Access Journals (Sweden)

    Damian Trzybiński

    2010-04-01

    Full Text Available The molecules in the crystal structure of the title compound, C20H15NO2, form inversion dimers connected through the C—H...N and π–π interactions. These dimers are further linked by C—H...π interactions. The methoxy group is nearly coplanar with the acridine ring system [dihedral angle = 4.5 (1°], whereas the phenoxy fragment is nearly perpendicular to it [dihedral angle = 85.0 (1°]. The mean planes of the acridine ring systems are either parallel or inclined at angles of 14.3 (1, 65.4 (1 and 67.3 (1° in the crystal.

  2. LAPSI 2.0

    DEFF Research Database (Denmark)

    Lundqvist, Björn; Forsberg, Yrsa; de Vries, Marc

    , harming their commercial interests. They argue that by opening up their PSI these governments are conducting unfair competition practices, or at least inflicting damage. This claim merits deeper consideration: if these incumbent players are right, this could impact adoption of Open Data policies...... by governments throughout Europe and in fact frustrate the sound application of the PSI Directive. A possible collision of the PSI Directive and European competition (law) principles – The LAPSI 2.0 Network has adopted it as the subject of a position paper under WP 3 (IP and competition law). The paper...... will initially discuss the PSI Directives and the interface between the PSI Directives and Competition law, so to establish what is encompassed by the directives and what should be judge under competition law, respectively. Thereafter some cases from different Member States will be reviewed and analysed...

  3. Fahr病2

    Institute of Scientific and Technical Information of China (English)

    邹晓毅; 李立; 袁云华; 杨玲

    2006-01-01

    Fahr病又称“特发性基底节钙化症”、“特发性家族性脑血管亚铁钙沉着症”、“锥体外系铁钙沉着症”等,由Fahr于1930年首先描述,是以双侧基底节区、丘脑、小脑齿状核及皮层下中枢对称性钙质沉着为主要病理特征的疾病,现将我们收治的2例报告如下:

  4. UA2 central calorimeter

    CERN Multimedia

    The UA2 central calorimeter measured the energy of individual particles created in proton-antiproton collisions. Accurate calibration allowed the W and Z masses to be measured with a precision of about 1%. The calorimeter had 24 slices like this one, each weighing 4 tons. The slices were arranged like orange segments around the collision point. Incoming particles produced showers of secondary particles in the layers of heavy material. These showers passed through the layers of plastic scintillator, generating light which was taken by light guides (green) to the data collection electronics. The amount of light was proportional to the energy of the original particle. The inner 23 cm of lead and plastic sandwiches measured electrons and photons; the outer 80 cm of iron and plastic sandwiches measured strongly interacting hadrons. The detector was calibrated by injecting light through optical fibres or by placing a radioactive source in the tube on the bottom edge.

  5. External Ballistics. Part 2

    Science.gov (United States)

    1978-07-11

    e:uation of the rotary notion cf TES relative to axis Ox1 takes the fern Pin !L-e~ -in yo 8 8 1* 2 6ŝe Plu =InuIg,,, - the reacticn JlccEs develcFed...the firing Ecsit.icn (Fig. 11.21). 71ey have plus sign the lcngitudinal wind. directed tcward target/Fur~cse (i.e. tailwirid), and the cross wind...rejresented in the form X(1-M.0m(t) + ItVy (t), (13. 37) sIm where mg(t)’ - mathematical Expectaticn cf Lrndcs function; I1(t) 92(t) ...VM- cordi nate f

  6. Io in Eclipse 2

    Science.gov (United States)

    2007-01-01

    This image of Io eclipsed by Jupiter's shadow is a combination of several images taken by the New Horizons Long Range Reconnaissance Imager (LORRI) between 09:35 and 09:41 Universal Time on February 27, 2007, about 28 hours after the spacecraft's closest approach to Jupiter. North is at the top of the image. In the darkness, only glowing hot lava, auroral displays in Io's tenuous atmosphere and the moon's volcanic plumes are visible. The brightest points of light in the image are the glow of incandescent lava at several active volcanoes. The three brightest volcanoes south of the equator are, from left to right, Pele, Reiden and Marduk. North of the equator, near the disk center, a previously unknown volcano near 22 degrees north, 233 degrees west glows brightly. (The dark streak to its right is an artifact.) The edge of Io's disk is outlined by the auroral glow produced as intense radiation from Jupiter's magnetosphere bombards the atmosphere. The glow is patchy because the atmosphere itself is patchy, being denser over active volcanoes. At the 1 o'clock position the giant glowing plume from the Tvashtar volcano rises 330 kilometers (200 miles) above the edge of the disk, and several smaller plumes are also visible as diffuse glows scattered across the disk. Bright glows at the edge of Io on the left and right sides of the disk mark regions where electrical currents connect Io to Jupiter's magnetosphere. New Horizons was 2.8 million kilometers (1.7 million miles) from Io when this picture was taken, and the image is centered at Io coordinates 2 degrees south, 238 degrees west. The image has been heavily processed to remove scattered light from Jupiter, but some artifacts remain, including a horizontal seam where two sets of frames were pieced together. Total exposure time for this image was 56 seconds.

  7. Infinite Three-Dimensional Coordination Polymers: Synthesis and Structures of [Cd (4,4'-bpy)2 (H2O)2]n (pic)2n, [Zn (4,4'-bpy)2 (H2O)2 ]n-(pic)2n (H2O)2n, and [Zn (4,4'-bpy)2 (H2O)2]n (4,4'-bpy)n (H2O)n (pic)2n

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Three Complexes of the formula [ Cd (4,4'-bpy)2 (H2O)2 ]n (pic)2n (1), [ Zn (4,4'-bpy)2 (H2O)2 ]n-(pic)2n (H2O)2n (2) and [ Zn (4,4'-bpy)2 (H2O)2 ]n (4,4'-bpy)n (pic)2n (H2O)n (3) ( 4,4'-bpy = 4,4'-bipyridine; pic = picric anion ) have been synthesized and characterized by elemental analysis and single-crystal x-ray diffraction. They all have infinite three-dimensional network structure, crystallizing in the monoclinic space group C2/c (1) and Cc (2,3).

  8. 1,2-Bis(2-methoxy-6-formylphenoxyethane

    Directory of Open Access Journals (Sweden)

    Hongqi Li

    2011-02-01

    Full Text Available In the title compound [systematic name: 3,3′-dimethoxy-2,2′-(ethane-1,2-diyldioxydibenzaldehyde], C18H18O6, prepared from 1,2-dibromoethane and ortho-vanillin in the presence of sodium carbonate, the two vanillin units are linked via a CH2–CH2 bridge. The two benzene rings are inclined at a dihedral angle of 41.6 (5°.

  9. Bis{(E-3-[2-(hydroxyiminopropanamido]-2,2-dimethylpropan-1-aminium} bis[μ-(E-N-(3-amino-2,2-dimethylpropyl-2-(hydroxyiminopropanamido(2−]bis{[(E-N-(3-amino-2,2-dimethylpropyl-2-(hydroxyiminopropanamide]copper(II} bis((E-{3-[2-(hydroxyiminopropanamido]-2,2-dimethylpropyl}carbamate acetonitrile disolvate

    Directory of Open Access Journals (Sweden)

    Andrii I. Buvailo

    2012-12-01

    Full Text Available The reaction between copper(II nitrate and (E-N-(3-amino-2,2-dimethylpropyl-2-(hydroxyiminopropanamide led to the formation of the dinuclear centrosymmetric copper(II title complex, (C8H18N3O22[Cu2(C8H15N3O22(C8H17N3O22](C9H16N3O42·2CH3CN, in which an inversion center is located at the midpoint of the Cu2 unit in the center of the neutral [Cu2(C8H15N3O22(C8H17N3O22] complex fragment. The Cu2+ ions are connected by two N—O bridging groups [Cu...Cu separation = 4.0608 (5 Å] while the CuII ions are five-coordinated in a square-pyramidal N4O coordination environment. The complex molecule co-crystallizes with two molecules of acetonitrile, two molecules of the protonated ligand (E-3-[2-(hydroxyiminopropanamido]-2,2-dimethylpropan-1-aminium and two negatively charged (E-{3-[2-(hydroxyiminopropanamido]-2,2-dimethylpropyl}carbamate anions, which were probably formed as a result of condensation between (E-N-(3-amino-2,2-dimethylpropyl-2-(hydroxyiminopropanamide and hydrogencarbonate anions. In the crystal, the complex fragment [Cu2(C8H15N3O22(C8H17N3O22] and the ion pair C8H18N3O2+.C9H16N3O4− are connected via an extended system of hydrogen bonds.

  10. Fructose-2,6-bisphosphate

    DEFF Research Database (Denmark)

    Nielsen, Tom Hamborg; Rung, Jesper Henrik; Villadsen, Dorthe

    2004-01-01

    by modifying the Fru-2,6-P2 levels and the enzymes regulated by Fru-2,6-P2. Genes for the bifunctional plant enzyme that synthesizes and degrades Fru-2,6-P2 have been isolated and molecular characterization has provided new insight into structure and molecular regulation of the enzyme. Advances in Fru-2,6-P2......Fructose-2,6-bisphosphate (Fru-2,6-P2) regulates key reactions of the primary carbohydrate metabolism in all eukaryotes. In plants, Fru-2,6-P2 coordinates the photosynthetic carbon flux into sucrose and starch biosynthesis. The use of transgenic plants has allowed the regulatory models to be tested...

  11. The Synthesis of Ternary Acetylides with Tellurium: Li2TeC2 and Na2TeC2

    OpenAIRE

    Nemeth, Karoly; Unni, Aditya K.; Kalnmals, Christopher; Segre, Carlo U.; Kaduk, James

    2015-01-01

    The synthesis of ternary acetylides Li2TeC2 and Na2TeC2 is presented as the first example of ternary acetylides with metalloid elements instead of transition metals. The synthesis was carried out by the direct reaction of the corresponding bialkali acetylides with tellurium powder in liquid ammonia. Alternatively, the synthesis of Na2TeC2 was also carried out by the direct reaction of tellurium powder and two equivalents of NaC2H in liquid ammonia leading to Na2TeC2 and acetylene gas through ...

  12. Atmospheric chemistry of CF3CH2CH2OH

    DEFF Research Database (Denmark)

    Hurley, Michael D.; Misner, Jessica A.; Ball, James C.

    2005-01-01

    Relative rate techniques were used to study the kinetics of the reactions of Cl atoms and OH radicals with CF3CH2C(O)H and CF3CH2CH2OH in 700 Torr of N-2 or air diluent at 296 2 K. The rate constants determined were k(Cl+CF3CH2C(O)H) = (1.81 +/- 0.27) x 10(-11), k(OH+CF3CH2C(O)H) = (2.57 +/- 0.44...

  13. A shock tube study of OH + H(2)O(2) --> H(2)O + HO(2) and H(2)O(2) + M --> 2OH + M using laser absorption of H(2)O and OH.

    Science.gov (United States)

    Hong, Zekai; Cook, Robert D; Davidson, David F; Hanson, Ronald K

    2010-05-13

    The rate constants of the reactions: (1) H2O2+M-->2OH+M, (2) OH+H2O2-->H2O+HO2 were measured in shock-heated H(2)O(2)/Ar mixtures using laser absorption diagnostics for H(2)O and OH. Time-histories of H(2)O were monitored using tunable diode laser absorption at 2550.96 nm, and time-histories of OH were achieved using ring dye laser absorption at 306 nm. Initial H(2)O(2) concentrations were also determined utilizing the H(2)O diagnostic. On the basis of simultaneous time-history measurements of OH and H(2)O, k(2) was found to be 4.6 x 10(13) exp(-2630 K/T) [cm(3) mol(-1) s(-1)] over the temperature range 1020-1460 K at 1.8 atm; additional measurements of k(2) near 1 atm showed no significant pressure dependence. Similarly, k(1) was found to be 9.5 x 10(15) exp(-21 250 K/T) [cm(3) mol(-1) s(-1)] over the same temperature and pressure range.

  14. Modeling char conversion under suspension fired conditions in O2/N2 and O2/CO2 atmospheres

    DEFF Research Database (Denmark)

    Brix, Jacob; Jensen, Peter Arendt; Jensen, Anker Degn

    2011-01-01

    The aim of this investigation has been to model combustion under suspension fired conditions in O2/N2 and O2/CO2 mixtures. Experiments used for model validation have been carried out in an electrically heated Entrained Flow Reactor (EFR) at temperatures between 1173 K and 1673 K with inlet O2...

  15. Main: AGL2ATCONSENSUS [PLACE

    Lifescience Database Archive (English)

    Full Text Available AGL2ATCONSENSUS S000339 16-May-2001 (last modified) uchi Binding consensus sequence... of Arabidopsis (A.t.) AGL2 (AGAMOUS-like 2); AGL2 contains MADS domain; AGL2 binds DNA as a dimer; See S000338; MADS; AGL1; AGAMOUS; flower; Arabidopsis thaliana NNWNCCAWWWWTRGWWAN ...

  16. Critical spin dynamics of the 2D quantum Heisenberg antiferromagnets Sr2CuO2Cl2 and Sr2Cu3O4Cl2.

    Science.gov (United States)

    Kim, Y J; Birgeneau, R J; Chou, F C; Erwin, R W; Kastner, M A

    2001-04-02

    We report a neutron scattering study of the long-wavelength dynamic spin correlations in the model two-dimensional S = 1/2 square lattice Heisenberg antiferromagnets Sr2CuO2Cl2 and Sr2Cu3O4Cl2. The characteristic energy scale, omega(0)(T/J), is determined by measuring the quasielastic peak width in the paramagnetic phase over a wide range of temperature ( 0.2 less similarT/J less similar0.7). The obtained values for omega(0)(T/J) agree quantitatively between the two compounds and also with values deduced from quantum Monte Carlo simulations. The combined data show scaling behavior, omega approximately xi(-z), over the entire temperature range with z = 1.0(1), in agreement with dynamic scaling theory.

  17. Fundamental Unit System and Class Number for Real Number Fields of Type (2,2,2)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Let k=Q(√(D2+md)(D2+nd)(D2+rd)), this paper proves firstly that the fundamental unit of k isε=(√(D2+md)(D2+nd)+√D2(D2+rd))2/(|mn|d2)), where D,d,m,n, and r are rational integers satisfying certain conditions. Consequently, we describe the fundamental unit system of k is k=Q(√(D2+md), √(D2+nd), √(D2+rd)explicitly by the fundamental unit of all the quadratic subfields and the class number hK explicitly by the class numbers of all the quadratic subfields. We also provide the fundamental unit system of some fields of (2,2)-type.

  18. 2-Amino-2-thiazoline and its 1:1 organic salt with 2-naphthoxyacetic acid.

    Science.gov (United States)

    Lynch, Daniel E

    2004-09-01

    The crystal structures of 2-amino-2-thiazoline, C3H6N2S, and 2-amino-2-thiazolinium 2-naphthoxyacetate, C3H7N2S+.C12H9O3-, are reported. The structure of 2-amino-2-thiazoline consists of two unique molecules that construct a convoluted hydrogen-bonded ribbon involving R(2)2(8) graph-set association via both N-H...N and N-H...S interactions. The organic salt structure consists of the two molecules associated via an R(2)2(8) graph-set dimer through N-H...O interactions, with the hydrogen-bonding network propagated via additional N-H...O three-centre interactions from the second 2-amine H atom.

  19. Cyclic Co des over F2+uF2+v F2

    Institute of Scientific and Technical Information of China (English)

    LIU Xiu-sheng; LIU Hua-lu

    2014-01-01

    We study the structure of cyclic codes of an arbitrary length n over the ring F2+uF2+vF2, which is not a finite chain ring. We prove that the Gray image of a cyclic code length n over F2+uF2+vF2 is a 3-quasi-cyclic code length 3n over F2.

  20. Synthesis,Characterization and Crystal Structure of (PhCH2)2Sn(S2CENt2) and (PhCH2)2Sn(S2CNC4H8)2

    Institute of Scientific and Technical Information of China (English)

    尹汉东; 王传华; 等

    2003-01-01

    Two new dibenzyltin bisditiocarbamates(PhCH2)2 Sn(S2CNEt2)2(1) and (PhCH2)2 Sn(S2CNC4H8)2(2) were synthesized by the reaction of dibenzyltin dichloride with dithiocarbamates and characterized by elemental analysis ,IR,1H NMR and MS spectra.The crystal structures were determined by X-ray single crystal diffraction analysis.In both complexes,the tin atom is six-coordinated in a distorted octahedral configuration.In the crystals of 1,the molecular packing in unit cell reveals that the two adjacent molecules are symmetrically linked to each other in dimers by two Sn S interactions of 0.3816nm.In the crystals of 2,the molecules are packed in the unit cell in one-dimensional chain structure linked by weaker intermolecular S S conmtacts.

  1. New SrAl 2B 2O 7:Eu 2+, Mn 2+ phosphors for white light-emitting diodes

    Science.gov (United States)

    Zhou, Liya; Yi, Linghong; Feng, Xiaoming

    2011-12-01

    A series of Eu 2+ and Mn 2+ co-doped SrAl 2B 2O 7 phosphors were prepared by solid-state reaction method. X-ray powder diffraction (XRD) and photoluminescence excitation and emission were employed to characterize the phosphors. The results show that energy transfers between Eu 2+and Mn 2+ ions. As the content of Ca 2+ ions in Ca xSr 0.92- xAl 2B 2O 7:Eu 2+0.06, Mn 2+0.02 phosphors increased, the CIE coordinates decreased and close to the white color standard mandated by the National Television Standard Committee (NTSC). Meanwhile, a white LED (light-emitting diode) was fabricated by combining the Ca 0.5Sr 0.42Al 2B 2O 7:Eu 2+0.06, Mn 2+0.02 phosphors with a 370 nm InGaN chip. The color coordinate of the fabricated white LED was also close to the white color standard, indicating that the Ca 0.5Sr 0.42Al 2B 2O 7:Eu 2+0.06, Mn 2+0.02 phosphor is a promising single-host phosphor that can be used in white LEDs.

  2. Electric field controlled CO2 capture and CO2/N2 separation on MoS2 monolayers.

    Science.gov (United States)

    Sun, Qiao; Qin, Gangqiang; Ma, Yingying; Wang, Weihua; Li, Ping; Du, Aijun; Li, Zhen

    2017-01-07

    Developing new materials and technologies for efficient CO2 capture, particularly for separation of CO2 post-combustion, will significantly reduce the CO2 concentration and its impacts on the environment. A challenge for CO2 capture is to obtain high performance adsorbents with both high selectivity and easy regeneration. Here, CO2 capture/regeneration on MoS2 monolayers controlled by turning on/off external electric fields is comprehensively investigated through a density functional theory calculation. The calculated results indicate that CO2 forms a weak interaction with MoS2 monolayers in the absence of an electric field, but strongly interacts with MoS2 monolayers when an electric field of 0.004 a.u. is applied. Moreover, the adsorbed CO2 can be released from the surface of MoS2 without any energy barrier once the electric field is turned off. Compared with the adsorption of CO2, the interactions between N2 and MoS2 are not affected significantly by the external electric fields, which indicates that MoS2 monolayers can be used as a robust absorbent for controllable capture of CO2 by applying an electric field, especially to separate CO2 from the post-combustion gas mixture where CO2 and N2 are the main components.

  3. Synthesis and Structural Characterization of Cu(pic)2[CO(NH2)2]2 and (picH2)2[Cu(pic)2(SCN)2

    Institute of Scientific and Technical Information of China (English)

    郭光华; 杨春; 周国伟; 郭国聪; 王明盛; 蔡丽珍; 吴阿青; 黄锦顺

    2004-01-01

    Two new compounds Cu(pic)2[CO(NH2)2]2 1 and (picH2)2[Cu(pic)2(SCN)2] 2 were prepared from the reaction of picolinic acid and copper(Ⅱ) per-chlorate by using carbamide to adjust pH=4 in the preparation of compound 1 and KSCN to adjust pH=6 in the preparation of 2. Crystal data for 1: monoclinic system, space group P21/n with a=7.441(1), b=14.291(2), c=7.790(1) A, β=95.855(2)°, V=824.0(2) A3, Dc=1.724 g/cm3, F(000)=438, C14H16N606Cu, Mr=427.87,μ(MoKα)=1.375 mm-1, Z=2 and the final R=0.0365 for 1164 observed reflections. Crystal data for 2: monoclinic system, space group P21/c with a=9.8237(3), b=10.0409(3), c=14.5867(2) A, β -= 104.190(2), V=1394.91(6) A3, Dc= 1.595 g/cm3, F(000)=686, C26H20N6O8S2Cu, Mr=672.14,μ(MoKα)=0.994 mm-1, Z=2 and the final R=0.0442 for .1651 observed reflections. The Cu(Ⅱ)atom in both 1 and 2 has a 4+2 elongated octahedral environment with the pic- ligands locating on the equatorial plane, and carbamide and SCN- occupying the axial sites, respectively. In compound 2,there also exist two protonated picolinate cations for charge balance.

  4. Luminescent nitridophosphates CaP2 N4 :Eu(2+) , SrP2 N4 :Eu(2+) , BaP2 N4 :Eu(2+) , and BaSr2 P6 N12 :Eu(2.).

    Science.gov (United States)

    Pucher, Florian J; Marchuk, Alexey; Schmidt, Peter J; Wiechert, Detlef; Schnick, Wolfgang

    2015-04-20

    Nitridophosphates MP2 N4 :Eu(2+) (M=Ca, Sr, Ba) and BaSr2 P6 N12 :Eu(2+) have been synthesized at elevated pressures and 1100-1300 °C starting from the corresponding azides and P3 N5 with EuCl2 as dopant. Addition of NH4 Cl as mineralizer allowed for the growth of single crystals. This led to the successful structure elucidation of a highly condensed nitridophosphate from single-crystal X-ray diffraction data (CaP2 N4 :Eu(2+) (P63 , no. 173), a=16.847(2), c=7.8592(16) Å, V=1931.7(6) Å(3) , Z=24, 2033 observed reflections, 176 refined parameters, wR2 =0.096). Upon excitation by UV light, luminescence due to parity-allowed 4f(6) ((7) F)5d(1) →4f(7) ((8) S7/2 ) transition was observed in the orange (CaP2 N4 :Eu(2+) , λmax =575 nm), green (SrP2 N4 :Eu(2+) , λmax =529 nm), and blue regions of the visible spectrum (BaSr2 P6 N12 :Eu(2+) and BaP2 N4 :Eu(2+) , λmax =450 and 460 nm, respectively). Thus, the emission wavelength decreases with increasing ionic radius of the alkaline-earth ions. The corresponding full width at half maximum values (2240-2460 cm(-1) ) are comparable to those of other known Eu(2+) -doped (oxo)nitrides emitting in the same region of the visible spectrum. Following recently described quaternary Ba3 P5 N10 Br:Eu(2+) , this investigation represents the first report on the luminescence of Eu(2+) -doped ternary nitridophosphates. Similarly to nitridosilicates and related oxonitrides, Eu(2+) -doped nitridophosphates may have the potential to be further developed into efficient light-emitting diode phosphors.

  5. Pressure induced structural transformation in Gd2Ti2O7 and Gd2Zr2O7

    Energy Technology Data Exchange (ETDEWEB)

    Xiao, Haiyan [Pacific Northwest National Laboratory (PNNL); Weber, William J [ORNL

    2011-01-01

    Ab initio total energy calculations have been performed to study the phase stability of Gd2Ti2O7 and Gd2Zr2O7 pyrochlores over the pressure range from 0 to 60 GPa. Both compounds are unstable under pressure, and phase transformations to the defect-cotunnite structure are predicted. The phase transformation pressure of 43.6 GPa for Gd2Ti2O7 is considerably larger than the value of 13 GPa for Gd2Zr2O7, in good agreement with experiments. The decreased structural stability of Gd2Zr2O7 under pressure, relative to Gd2Ti2O7, is a consequence of the lower compressibility of the Zr O bond and the higher compressibility of the Gd O bond. In addition, the Gd 4f electrons are found to have only a small effect in determining the pressure induced phase transformation.

  6. Pressure Induced Structural Transformation in Gd2Ti2O7 and Gd2Zr2O7

    Energy Technology Data Exchange (ETDEWEB)

    Xiao, Haiyan Y.; Weber, William J.

    2011-01-05

    Ab initio total energy calculations have been performed to study the phase stability of Gd2Ti2O7 and Gd2Zr2O7 pyrochlores over the pressure range from 0 to 60 GPa. Both compounds are unstable under pressure, and phase transformations to the defect-cotunnite structure are predicted. The phase transformation pressure of 43.6 GPa for Gd2Ti2O7 is considerably larger than the value of 13 GPa for Gd2Zr2O7, in good agreement with experiments. The decreased structural stability of Gd2Zr2O7 under pressure, relative to Gd2Ti2O7, is a consequence of the lower compressibility of the langZr–Orang bond and the higher compressibility of the langGd–Orang bond. In addition, the Gd 4f electrons are found to have only a small effect in determining the pressure induced phase transformation.

  7. Pressure induced structural transformation in Gd2Ti2O7 and Gd2Zr2O7

    Science.gov (United States)

    Xiao, H. Y.; Weber, W. J.

    2011-01-01

    Ab initio total energy calculations have been performed to study the phase stability of Gd2Ti2O7 and Gd2Zr2O7 pyrochlores over the pressure range from 0 to 60 GPa. Both compounds are unstable under pressure, and phase transformations to the defect-cotunnite structure are predicted. The phase transformation pressure of 43.6 GPa for Gd2Ti2O7 is considerably larger than the value of 13 GPa for Gd2Zr2O7, in good agreement with experiments. The decreased structural stability of Gd2Zr2O7 under pressure, relative to Gd2Ti2O7, is a consequence of the lower compressibility of the langZr-Orang bond and the higher compressibility of the langGd-Orang bond. In addition, the Gd 4f electrons are found to have only a small effect in determining the pressure induced phase transformation.

  8. Main: E2FAT [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial E2F target genes; most potential E2F targets identified in silico show a cell cycle-regulated expression; Y=T/C; see S000366; E2F; cell cycle; Arabidopsis thaliana TYTCCCGCC ...

  9. TANGO Array.. 2. Simulations

    Science.gov (United States)

    Bauleo, P.; Bonifazi, C.; Filevich, A.

    2004-01-01

    The angular and energy resolutions of the TANGO Array were obtained using extensive Monte Carlo simulations performed with a double purpose: (1) to determine the appropriate parameters for the array fitting to the desired range of sensitivity (the knee energy region), and (2) to construct a reliable shower database required for reference in the analysis of experimental data. The AIRES code, with the SIBYLL hadronic collision package, was used to simulate Extended Air Showers produced by primary cosmic rays (assuming protons and iron nuclei), with energies ranging from 10 14 to 10 18 eV. These data were fed into a realistic code which simulates the response of the detectors (water Cherenkov detectors), including the electronics, pickup noise, and the signal attenuation in the connecting cables. The trigger stage was considered in the simulations in order to estimate the trigger efficiency of the array and to verify the accuracy of the reconstruction codes. This paper delineates the simulations performed to obtain the expected behavior of the array, and describes the simulated data. The results of these simulations suggest that we can expect an error in the energy of the primary cosmic-ray of ˜60% of the estimated value and that the error in the measurement of the direction of arrival can be estimated as ˜4°. The present simulations also indicate that unambiguous assignments of the primary energy cannot be obtained because of the uncertainty in the nature of the primary cosmic ray.

  10. TANGO Array. 2. Simulations

    Energy Technology Data Exchange (ETDEWEB)

    Bauleo, P. E-mail: pablo.bauleo@colostate.edu; Bonifazi, C.; Filevich, A

    2004-01-11

    The angular and energy resolutions of the TANGO Array were obtained using extensive Monte Carlo simulations performed with a double purpose: (1) to determine the appropriate parameters for the array fitting to the desired range of sensitivity (the knee energy region), and (2) to construct a reliable shower database required for reference in the analysis of experimental data. The AIRES code, with the SIBYLL hadronic collision package, was used to simulate Extended Air Showers produced by primary cosmic rays (assuming protons and iron nuclei), with energies ranging from 10{sup 14} to 10{sup 18} eV. These data were fed into a realistic code which simulates the response of the detectors (water Cherenkov detectors), including the electronics, pickup noise, and the signal attenuation in the connecting cables. The trigger stage was considered in the simulations in order to estimate the trigger efficiency of the array and to verify the accuracy of the reconstruction codes. This paper delineates the simulations performed to obtain the expected behavior of the array, and describes the simulated data. The results of these simulations suggest that we can expect an error in the energy of the primary cosmic-ray of {approx}60% of the estimated value and that the error in the measurement of the direction of arrival can be estimated as {approx}4 deg. . The present simulations also indicate that unambiguous assignments of the primary energy cannot be obtained because of the uncertainty in the nature of the primary cosmic ray.

  11. Bike 2 Work

    CERN Multimedia

    Anaïs Schaeffer

    2012-01-01

    Are you a CERN cyclist? If so, join the Bike 2 Work competition that has just started! The more kilometres you travel by bike, the closer you’ll get to winning…   Yngve Inntjore Levinsen works at CERN, in the BE Department, and is one of the many people who travel to work by bike. Convinced by the benefits and the well-being that this mode of transport brings, he decided to promote it by running a competition. “Everyone working at CERN can participate,” says Yngve. “They just need to sign up on the competition website, or via their Facebook login. Then, participants simply have to report regularly the number of kilometres they cover by bike, travelling between home and work, or during the day between different points at CERN. ” The competition began on 1 March and will last all year long. The 2012 results will be announced at the end of the year. Of course, the winner will be the cyclist who has travelled the most kilometres during the ...

  12. Access2innovation

    DEFF Research Database (Denmark)

    Ravn, Jacob

    Gennem de sidste årtier er der blevet sat fokus på samarbejde på tværs af organisatoriske skel som omdrejningspunkt og forudsætning for innovation af produkter, services, forretningsmodeller samt adgang til nye kunder og markeder. Denne udvikling kan også opleves indenfor nødhjælps-­‐ og udviklin......Gennem de sidste årtier er der blevet sat fokus på samarbejde på tværs af organisatoriske skel som omdrejningspunkt og forudsætning for innovation af produkter, services, forretningsmodeller samt adgang til nye kunder og markeder. Denne udvikling kan også opleves indenfor nødhjælps-­‐ og...... succesfuldt eksempel på innovation i netværk ved at have lagt grunden for etablering af Sky Watch og ViewWorld og søsat yderligere to partnerskaber omkring Den Grønne Generator og WorldBarrow. Erfaringen fra access2innovation er dog samtidigt, at udvikling og implementering af samarbejdet har været...

  13. TMIST-2 Transport Test

    Energy Technology Data Exchange (ETDEWEB)

    Glen R. Longhurst

    2008-02-01

    In anticipation of the TMIST-2 experiment in the Advanced Test Reactor, there was a need to determine if the tritium that is expected to be observed at the outlet of the experiment would be seen or if it may be lost on its way from the experiment in the core to the measurement station. To assist in resolving that issue, a bench-scale experiment was conducted in the Idaho National Laboratory’s Safety and Tritium Applied Research (STAR) facility using deuterium and a mass spectrometer in lieu of tritium with ion chambers, bubblers, and scintillation counting. The experiment replicated the concentration of the hydrogen isotope, the flow rates anticipated, and the residence times. It was found that there was initial uptake on tubing walls, presumably due to oxidation of the hydrogen isotopes to water and adsorption or isotopic exchange, but that saturates relatively quickly, and once saturated, the concentration of deuterium at the outlet of the tubing system was essentially the same as it was at the experiment inlet under the conditions modeled in the experiment.

  14. [Universal electrogustometer EG-2].

    Science.gov (United States)

    Wałkanis, Andrzej; Czesak, Michał; Pleskacz, Witold A

    2011-01-01

    Electrogustometry is a method for taste diagnosis and measurement. The EG-2 project is being developed in cooperation between Warsaw University of Technology and Military institute of Medicine in Warsaw. The device is an evolution of the recent universal electrogustometer EG-1 prototype. Due to considerations and experiences acquired during prototype usage, many enhancements have been incorporated into device. The aim was to create an easy-to-use, portable, battery powered device, enabled for fast measurements. Developed electrogustometer is using innovative, low-power microprocessor system, which control whole device. User interface is based on 5.7" graphical LCD (Liquid Crystal Display) and touchscreen. It can be directly operated by finger or with optional stylus. Dedicated GUI (Graphical User Interface) offers simple, predefined measurements and advance settings of signal parameters. It is also possible to store measurements results and patients data in an internal memory. User interface is multilanguage. Signals for patients examinations, supplied with bipolar electrode, are generated by an on-board circuit using DDS (Direct-Digital Synthesis) and DAC (Digital-to-Analog Converter). Electrogustometer is able to generate DC, sinus, triangle or rectangle signals with current amplitude from 0 to 500 pA and frequency form 0 to 500 Hz. Device is designed for manual and automeasurement modes. By using USB (Universal Serial Bus) port it is possible to retrieve data stored in internal memory and charging of built-in Li-lon battery as a source of power.

  15. VLLEEM-2 technical workshop

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    In order to overcome the limits of the energy-environment models, and to benefit at the same time of their past experiences, the VLEEM project proposes a genuine approach and innovative modelling tools to assess the energy-environment systems over the very long term, which are based on the strengths of existing long term energy models, but focussed on two major objectives: to describe normative futures which fit with a set of overall constraints, like the stabilisation of the concentration of green-house gases in the atmosphere, or the stabilisation of the overall inventory of plutonium and minor actinides, etc...; to describe and formalize the association of causalities necessary to bring the system from the present situation to the targeted future, through a '' back-casting '' approach. This first technical workshop presents the state of the art of the different Work Programmes. WP1:Enhancement of the Conceptual framework. WP2: Data base on conventional demand/supply technologies. WP3: Complement and up-date technology monographs. WP4: Formalization and computing of final VLEEM submodels. WP5: Case study 2030, 2050, 2100. (A.L.B.)

  16. Synthesis and Structure of a Novel Compound [Cu2(EDTA)(Py)2(H2O)22H2O

    Institute of Scientific and Technical Information of China (English)

    TANG Ding-Xing; ZHAO Yun

    2005-01-01

    A novel compound [Cu2(EDTA)(Py)2(H2O)22H2O was synthesized by the reaction of CuSO4(5H2O with H4EDTA in pyridine/water (V/V = 1/4) solvent, and characterized by elemental analysis, IR spectrum and X-ray single-crystal diffraction. It crystallizes in the monoclinic system, space group P21/n with a = 1.26974(6), b = 0.67949(3), c = 1.48548(3) nm, β = 91.454(2)o, V = 1.28122(9) nm3, Z = 2, Dc = 1.673 g/cm3, Mr = 645.56, F(000) = 664, μ(MoKα) = 1.729 mm-1, the final R = 0.0353 and wR = 0.0832 for 1920 observed reflections (I > 2((I)). The compound is a centrosymmetric binuclear molecule with bridged EDTA group. Each Cu(II) atom is linked to two oxygen atoms and one nitrogen atom of EDTA, one oxygen atom of water and one nitrogen atom of pyridine to form a distorted square pyramidal environment. There exist face-to-face π-π stacking interactions between pyridine rings from neighboring molecule with the interplanar distance of 0.3670 nm and hydrogen bonding between EDTA and water molecules.

  17. Transcription factor NFE2L2/NRF2 is a regulator of macroautophagy genes

    Science.gov (United States)

    Pajares, Marta; Jiménez-Moreno, Natalia; García-Yagüe, Ángel J.; Escoll, Maribel; de Ceballos, María L.; Van Leuven, Fred; Rábano, Alberto; Yamamoto, Masayuki; Rojo, Ana I.; Cuadrado, Antonio

    2016-01-01

    ABSTRACT Autophagy is a highly coordinated process that is controlled at several levels including transcriptional regulation. Here, we identify the transcription factor NFE2L2/NRF2 (nuclear factor, erythroid 2 like 2) as a regulator of autophagy gene expression and its relevance in a mouse model of Alzheimer disease (AD) that reproduces impaired APP (amyloid β precursor protein) and human (Hs)MAPT/TAU processing, clearance and aggregation. We screened the chromatin immunoprecipitation database ENCODE for 2 proteins, MAFK and BACH1, that bind the NFE2L2-regulated enhancer antioxidant response element (ARE). Using a script generated from the JASPAR's consensus ARE sequence, we identified 27 putative AREs in 16 autophagy-related genes. Twelve of these sequences were validated as NFE2L2 regulated AREs in 9 autophagy genes by additional ChIP assays and quantitative RT-PCR on human and mouse cells after NFE2L2 activation with sulforaphane. Mouse embryo fibroblasts of nfe2l2-knockout mice exhibited reduced expression of autophagy genes, which was rescued by an NFE2L2 expressing lentivirus, and impaired autophagy flux when exposed to hydrogen peroxide. NFE2L2-deficient mice co-expressing HsAPPV717I and HsMAPTP301L, exhibited more intracellular aggregates of these proteins and reduced neuronal levels of SQSTM1/p62, CALCOCO2/NDP52, ULK1, ATG5 and GABARAPL1. Also, colocalization of HsAPPV717I and HsMAPTP301L with the NFE2L2-regulated autophagy marker SQSTM1/p62 was reduced in the absence of NFE2L2. In AD patients, neurons expressing high levels of APP or MAPT also expressed SQSTM1/p62 and nuclear NFE2L2, suggesting their attempt to degrade intraneuronal aggregates through autophagy. This study shows that NFE2L2 modulates autophagy gene expression and suggests a new strategy to combat proteinopathies. PMID:27427974

  18. Adsorption of Pb2+, Zn2+ and Ni2+ from Aqueous Solution by Helix aspera Shell

    OpenAIRE

    A. S. Ekop; Eddy, N. O.

    2009-01-01

    The adsorption capacity of Helix aspera shell for Pb2+, Zn2+ and Ni2+ has been studied. This shell has the potential of adsorbing Pb2+, Zn2+ and Ni2+ from aqueous solution. The adsorption potentials of Helix aspera shell is largely influenced by the ionic character of the ions and occurred according to the order Pb2+ > Ni2+ > Zn2+. The adsorption of Pb(II), Zn(II) and Ni(II) ions from aqueous solutions by Helix aspera shell is thermodynamically feasible and is consistent with the models of La...

  19. Pyruvate protects pathogenic spirochetes from H2O2 killing.

    Directory of Open Access Journals (Sweden)

    Bryan Troxell

    Full Text Available Pathogenic spirochetes cause clinically relevant diseases in humans and animals, such as Lyme disease and leptospirosis. The causative agent of Lyme disease, Borrelia burgdorferi, and the causative agent of leptospirosis, Leptospria interrogans, encounter reactive oxygen species (ROS during their enzootic cycles. This report demonstrated that physiologically relevant concentrations of pyruvate, a potent H2O2 scavenger, and provided passive protection to B. burgdorferi and L. interrogans against H2O2. When extracellular pyruvate was absent, both spirochetes were sensitive to a low dose of H2O2 (≈0.6 µM per h generated by glucose oxidase (GOX. Despite encoding a functional catalase, L. interrogans was more sensitive than B. burgdorferi to H2O2 generated by GOX, which may be due to the inherent resistance of B. burgdorferi because of the virtual absence of intracellular iron. In B. burgdorferi, the nucleotide excision repair (NER and the DNA mismatch repair (MMR pathways were important for survival during H2O2 challenge since deletion of the uvrB or the mutS genes enhanced its sensitivity to H2O2 killing; however, the presence of pyruvate fully protected ΔuvrB and ΔmutS from H2O2 killing further demonstrating the importance of pyruvate in protection. These findings demonstrated that pyruvate, in addition to its classical role in central carbon metabolism, serves as an important H2O2 scavenger for pathogenic spirochetes. Furthermore, pyruvate reduced ROS generated by human neutrophils in response to the Toll-like receptor 2 (TLR2 agonist zymosan. In addition, pyruvate reduced neutrophil-derived ROS in response to B. burgdorferi, which also activates host expression through TLR2 signaling. Thus, pathogenic spirochetes may exploit the metabolite pyruvate, present in blood and tissues, to survive H2O2 generated by the host antibacterial response generated during infection.

  20. Heat capacity of the frustrated magnetic pyrochlores Gd2Zr2O7 and Gd2Hf2O7

    Science.gov (United States)

    Durand, Alice M.; Klavins, Peter; Corruccini, L. R.

    2008-06-01

    The heat capacities of Gd2Zr2O7 and Gd2Hf2O7 both show sharp peaks in the vicinity of 0.77 K, consistent with the existence of long range magnetic order. They are superimposed in both cases on broader maxima centered at approximately 1 K, presumably due to short range spin correlations. Both compounds exhibit antiferromagnetic interactions, with Weiss constants of approximately -7 K. Comparisons are made to earlier results for the isomorphic compounds Gd2Ti2O7 and Gd2Sn2O7.