WorldWideScience

Sample records for basf-industriekernkraftwerk reaktor 1

  1. DISTRIBUSI ALIRAN DALAM REAKTOR BERKANAL MIKRO

    Directory of Open Access Journals (Sweden)

    Y. W. Budhi

    2012-01-01

    Full Text Available Reaktor mikro telah menempatkan diri pada posisi yang diminati dalam pengembangan teknologi reaktor modern yang memiliki karakteristik pokok dalam hal percepatan laju perpindahan massa dan panas yang berlipat ganda. Dengan dimensi yang berskala mikron, distribusi aliran dari pipa induk menuju masing-masing kanal merupakan salah satu persoalan penting untuk menjamin keseragaman aliran di setiap kanal. Makalah ini mengkaji distribusi aliran dalam lima model reaktor dan mempelajari karakteristik pemanasan awal dari keadaan dingin (cold start. Fokus ditujukan dalam shift converter yang mengkonversikan CO menjadi CO2 agar tidak meracuni katalis dalam sel bahan bakar. Selanjutnya pada model reaktor dengan distribusi terbaik, karakteristik cold start up ditelaah lebih mendalam melalui teknik reaksi kimia tak tunak. Hasil studi menunjukkan bahwa start up pada shift converter dapat dilakukan dalam waktu yang sangat singkat yang menunjukkan bahwa secara praktis unit reaktor mikro ini dapat diterapkan.

  2. Hybridní jaderný reaktor

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    2009-01-01

    Roč. 2, prosinec (2009), s. 12-13 Institutional research plan: CEZ:AV0Z20430508 Keywords : Fusion * tokamak * ZETA * JET * Golem * Sacharos * Tamm * Richter Subject RIV: BL - Plasma and Gas Discharge Physics http://www.tretipol.cz/801-hybridni-jaderny-reaktor

  3. Theoretical investigations on the determination of cavitation-free primary flow after compacting the reactor FRG-1; Theoretische Untersuchungen zur Bestimmung des kavitationsfreien Primaerdurchsatzes nach Kernkompaktierung des Reaktors FRG-1

    Energy Technology Data Exchange (ETDEWEB)

    Pihowicz, W. [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Zentralabteilung Forschungsreaktoren

    1997-12-31

    Basing on an extensive analysis of the influence of compacting the FRG-1 reactor core upon the change in flow, heat exchange, as well as cavitation behavior of the primary circuit the underlying principles of the determination procedure for a cavitations-free primary flow have been developed theoretically. It was found that the problem has to be treated in a complex manner, i.e. considering the coupled flow, temperature, as well as cavitation fields, and that for a successful solution of the problem it is absolutely necessary to simultaneously induce an optimized fixation of the main primary coolant pump. (orig.) [Deutsch] Auf der Basis einer umfangreichen Analyse des Einflusses einer Kernkompaktierung des Reaktors FRG-1 auf die Aenderung der Stroemungs-, Waermeaustausch- und Kavitationsverhaeltnisse im Reaktorkuehlkreislauf wurden theoretische Grundlagen der Vorgehensweise zur Bestimmung des kavitationsfreien Primaerdurchsatzes entwickelt. Es wurde nachgewiesen, dass das Problem komplex, d.h. unter Beruecksichtigung der gegenseitigen Kopplung von Stroemungs-, Temperatur- und Kavitationsfeldern betrachtet werden muss und, dass es zur erfolgreichen Loesung der Aufgabe noch unbedingt erforderlich ist, parallel eine optimale Festlegung der Hauptprimaerumwaelzpumpe herbeizufuehren. (orig.)

  4. ANALISIS KECELAKAAN REAKTOR AKIBAT KEGAGALAN SISTEM PEMBUANG PANAS PADA REAKTOR NUKLIR GENERASI IV

    Directory of Open Access Journals (Sweden)

    A. G. Abdullah

    2012-05-01

    Full Text Available Salah satu aspek terpenting dalam proses desain reaktor nuklir adalah aspek keselamatan reaktor. Sebelum membangun reaktor secara fisik, terlebih dahulu dibuat perencaaan perhitungan yang matang termasuk melakukan simulasi kinerja keselamatannya dalam menghadapi kemungkinan kecelakaan. Penelitian ini bertujuan untuk mengembangkan model simulasi kecelakaan Pembangkit Listrik Tenaga Nuklir (PLTN yang disebabkan  gagalnya sistem pembuang panas. Kecelakaan akibat gagalnya sistem pembuang panas dipicu oleh hilangnya kemampuan pendinginan dari pembangkit uap. Urutan kecelakaan ini diawali dengan hilangnya kemampuan reaktor untuk membuang panas dari loop pendingin sekunder. Selama kecelakaan, laju pembuangan panas mengalami penurunan sedangkan temperatur masukan pendingin mengalami peningkatan. Hasil simulasi memberikan gambaran bahwa reaktor dapat bertahan dari kecelakaan. Hasil analisis kecelakaan menunjukkan bahwa temperatur maksimum bahan bakar, selongsong dan pendingin memiliki batas keselamatan yang sangat besar.One of the most important aspects in nuclear reactor design process is the safety aspect. Advanced and accurate safety simulation must be performed before it can be built.  This research aims to develop a simulation model of Nuclear Power Plant (NPP accidents due to the loss of  heat sink system. Loss of heat sink accident was triggered by the loss of cooling capability of steam generators.  This  accident  sequence  began with the loss of the reactor’s ability to remove heat from the secondary cooling loop. During the accident, the heat dissipation rate decreased whereas the coolant inlet temperatures increased till a new equilibrium level. The analysis results of the accident showed that there are large safety margin to the maximum temperature of the fuel, cladding, and coolant.

  5. Fire modeling of the Heiss Dampf Reaktor containment

    International Nuclear Information System (INIS)

    This report summarizes Sandia National Laboratories' participation in the fire modeling activities for the German Heiss Dampf Reaktor (HDR) containment building, under the sponsorship of the United States Nuclear Regulatory Commission. The purpose of this report is twofold: (1) to summarize Sandia's participation in the HDR fire modeling efforts and (2) to summarize the results of the international fire modeling community involved in modeling the HDR fire tests. Additional comments, on the state of fire modeling and trends in the international fire modeling community are also included. It is noted that, although the trend internationally in fire modeling is toward the development of the more complex fire field models, each type of fire model has something to contribute to the understanding of fires in nuclear power plants

  6. Fire modeling of the Heiss Dampf Reaktor containment

    Energy Technology Data Exchange (ETDEWEB)

    Nicolette, V.F. [Sandia National Labs., Albuquerque, NM (United States); Yang, K.T. [Notre Dame Univ., IN (United States)

    1995-09-01

    This report summarizes Sandia National Laboratories` participation in the fire modeling activities for the German Heiss Dampf Reaktor (HDR) containment building, under the sponsorship of the United States Nuclear Regulatory Commission. The purpose of this report is twofold: (1) to summarize Sandia`s participation in the HDR fire modeling efforts and (2) to summarize the results of the international fire modeling community involved in modeling the HDR fire tests. Additional comments, on the state of fire modeling and trends in the international fire modeling community are also included. It is noted that, although the trend internationally in fire modeling is toward the development of the more complex fire field models, each type of fire model has something to contribute to the understanding of fires in nuclear power plants.

  7. PENGARUH GEMPA PATAHAN LEMBANG TERHADAP FLEKSIBILITAS PIPA DAN KEGAGALAN NOZEL PERALATAN SISTEM PENDINGIN PRIMER REAKTOR TRIGA 2000 BANDUNG

    Directory of Open Access Journals (Sweden)

    H.P. Raharjo

    2012-02-01

    Full Text Available Gempa bumi di suatu instalasi nuklir dapat menyebabkan terjadinya kerusakan sistem peralatan karena adanya perubahan fleksibilitas pipa akibat beban berlebih pada sistem perpipaannya. Beban dari sistem perpipaan dapat membebani nozel peralatan seperti pompa, penukar panas, dll. Apabila beban tersebut terlalu besar dan melebihi beban yang diizinkan akan mengakibatkan kegagalan nozel peralatan. Penelitian ini menganalisis besarnya beban-beban yang terjadi di semua nozel  sistem pendingin primer Reaktor TRIGA 2000 Bandung. Analisis dilakukan dengan bantuan perangkat lunak Caesar II yang berbasis metode elemen hingga (finite element method. Acuan analisis yang digunakan adalah code ASME B31.1 yang mengatur tentang perancangan sistem perpipaan untuk sistem pembangkit daya (Power Piping. Hasil analisis menunjukkan bahwa gaya yang terjadi pada nozel masukan pompa arah aksial (FZ melebihi batas yang diijinkan. Oleh karena itu perlu dilakukan modifikasi terhadap jalur perpipaan sistem pendingin tersebut agar nozel tidak menerima gaya yang berlebih. Penyangga pipa titik(node 22 di jalur PriOut dilepas dan/atau dipindahkan pada nozel masukkan pompa. Perpipaan sistem pendingin primer reaktor TRIGA 2000 Bandung akan aman beroperasi jika terjadi gempa.yang berasal dari patahan Lembang Kata kunci : gempa bumi, patahan, perpipaan, reaktor, sistem pendingin

  8. Isotopic composition of precipitation at the station Ljubljana (Reaktor, Slovenia – period 2007–2010

    Directory of Open Access Journals (Sweden)

    Polona Vreča

    2014-12-01

    Full Text Available The stable isotopic composition of hydrogen and oxygen (δ2H and δ18O and the tritium activity (A were monitored in monthly collected precipitation at Ljubljana (Reaktor during the period 2007–2010. Monthly and yearly isotope variations are discussed and compared with those observed over the period 1981–2006 and with the basic meteorological parameters for Ljubljana (Bežigrad and Ljubljana (Hrastje stations for the period 2007−2010. The mean values for δ2H and δ18O, weighted by precipitation amount at Ljubljana (Reaktor, are –59.4 ‰ and –8.71 ‰. The reduced major axis local meteoric water line (LMWLRMA is δ2H = (8.19 ± 0.22×δ18O + (11.52 ± 1.97, while the precipitation weighted least square regression results in LMWLPWLSR-Re δ2H = (7.94 ± 0.21×δ18O + (9.76 ± 1.93. The lack of significant difference in the LMWL slopes indicates a relatively homogeneous distribution of monthly precipitation as well as the small number of low-amount monthly precipitation events with low deuterium excess. The deuterium excess weighted mean value is 10.3 ‰ which indicates the prevailing influence of the Atlantic air masses. The temperature coefficient of δ18O is 0.30 ‰/°C. Tritium activity in monthly precipitation shows typical seasonal variations, with a weighted mean tritium activity in this period of 8.5 TU. No decrease of mean annual activity is observed.

  9. Kutil vyrobil termojaderný reaktor

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    2007-01-01

    Roč. 17, 17.3.2007 (2007), s. 11. ISSN 0862-5921 Institutional research plan: CEZ:AV0Z20430508 Keywords : fusion * tokamak * stellarator * UST-1 * Queral V * Olson T. Subject RIV: BL - Plasma and Gas Discharge Physics

  10. PENINGKATAN KINERJA SISTEM KESELAMATAN PASIF PADA REAKTOR NUKLIR DENGAN PENAMBAHAN KOMPONEN RVACS

    Directory of Open Access Journals (Sweden)

    A. G. Abdullah

    2014-07-01

    Full Text Available Kelengkapan sistem keselamatan pasif dan inheren pada reaktor lanjut merupakan prasyarat utama. Makalah ini mengeksplorasi hasil desain konseptual sistem pembuang sisa panas pada pusat listrik tenaga nuklir berjenis Very High-Temperature Reactor. Tujuan riset ini untuk merancang sistem pembuang sisa panas pusat listrik tenaga nuklir yang terdapat pada dinding reaktor. Studi kinerja Reactor Vessel Auxliary Cooling System (RVACS dilakukan pada dua jenis pendingin yaitu Timbal-Bismut dan Liquid Salt. Panas dari dinding reaktor dihapus melalui sirkulasi alamiah pada keadaan tunak. Analisis melibatkan sistem perpindahan panas secara radiasi, konduksi dan konveksi alami. Perhitungan perpindahan panas dilakukan pada elemen reaktor vessel, dinding luar guard vessel, dan pelat pemisah. Hasil analisis kecelakaan menunjukkan kedua jenis sistem pendingin reaktor dan sistem pasif sisa pembuangan panas cukup menghapus sisa panas hasil peluruhan dengan sirkulasi alami.ABSTRACTCompleteness of passive safety systems and inherent in advanced reactors is a major prerequisite. This paper explores the results of a conceptual design of the heat removal system at the nuclear power plant (NPP type Very High-Temperature Reactor. The purpose of this research was to design the reactor vessel auxiliary cooling system (RVACS of NPP located within the reactor walls. The RVACS performance study was conducted on two types of coolant: Lead-Bismuth and Liquid Salt. Heat was removed from the reactor vessel through the natural circulation in the steady state. Analyses of heat transfer systems involved radiation, conduction and natural convection. Heat transfer calculations were performed on the reactor vessel, guard vessel, and perforated plate. The results from the accident analysis showed that both types, the reactor coolant system and the passive residual heat removal system, adequately remove remaining heat of the decay by a natural circulation.

  11. Studi Pembuatan Pupuk Kalium Sulfat dari Abu Sekam Padi dan Gipsum Alam Menggunakan Reaktor Tangki Berpengaduk

    Directory of Open Access Journals (Sweden)

    Muhammad Husin Ismayanda

    2015-07-01

    Full Text Available Proses pembuatan pupuk kalium sulfat umumnya dibuat dari asam klorida dan bahan baku yang mengandung anion sulfat (SO4. Dalam penelitian ini, pembuatan pupuk kalium sulfat dari bahan baku batuan gipsum alam sebagai sumber sulfat dan abu sekam padi sebagai sumber kalium telah dilakukan. Penelitian ini bertujuan mengkaji kemungkinan pembuatan pupuk kalium sulfat dari gipsum alam dan abu sekam padi dan juga mengetahui pengaruh kecepatan pengadukan, temperatur operasi dan waktu proses terhadap persentase konversi kalium sulfat yang dihasilkan. Dalam penelitian ini juga dipelajari kinetika reaksi yang terjadi selama proses pembentukan kalium sulfat. Proses pembuatan pupuk kalium sulfat dilakukan dalam reaktor tangki berpengaduk. Varibel berubah dari penelitian ini adalah kecepatan putaran pengaduk, temperatur proses, dan waktu reaksi. Untuk menganalisis produk yang dihasilkan, metode yang digunakan mengacu pada Standar Nasional Indonesia (SNI 02-2809-2005. Hasil penelitian menunjukkan bahwa pupuk kalium sulfat dapat dihasilkan dari reaksi antara gipsum yang mengandung kalsium sulfat dan abu sekam padi yang mengandung kalium karbonat dengan konversi kalium dari endapan sebesar 99,87% dan konversi kalium dari filtrat sebanyak 18,22%. Nilai konversi sulfat dari endapan hanya sebesar 0,69% dan nilai konversi sulfat dari filtrat 0,26%.Dalam penelitian ini kondisi terbaikproses pembuatan pupuk kalium sulfat adalah pada waktu reaksi 80 menit, kecepatan putaran pengaduk 400 rpm dan temperatur operasi 90ºC. Hasil analisis juga menunjukkan bahwa produk pupuk kalium sulfat tidak mengandung asam bebas sebagai H2SO4 dan klorida (Cl, akan tetapi mengandung kalium dan sulfat. Nilai konstanta kecepatan reaksi (k yang didapat dalam penelitian ini adalah sebesar 0,00218 ppm-1 menit-1 dan nilai laju pengurangan reaktan (rA sebesar 8,129 x 10-5 ppm/menit.

  12. PERFORMA OKSIDASI METAN PADA REAKTOR KONTINYU DENGAN PENINGKATAN KETEBALAN LAPISAN BIOCOVER LANDFILL

    Directory of Open Access Journals (Sweden)

    Opy Kurniasari

    2013-11-01

    methane through the form of methanol metabolite. ABSTRAKPenanganan sampah kota di Indonesia pada umumnya dilakukan pada tempat pemrosesan akhir sampah (TPA, yang sebagian besar dilakukan dengan cara pengurugan (landfilling yang cenderung bersifat anaerob (tidak ada oksigen. Cara pengurugan ini biasanya dioperasikan lapis perlapis sehingga memungkinkan terjadinya proses anaerob. Pada kondisi ini dipastikan biogas, yaitu gas metana (CH4 dan CO2, akan muncul. Metana adalah gas rumah kaca dengan potensi pemanasan global lebih besar dari CO2, dan dapat mengabsorpsi radiasi infra merah 23 kali lebih efisien dari CO2 pada periode lebih dari 100 tahun. Salah satu cara yang dapat dilakukan untuk mengurangi gas metana dari landfill yang lepas ke alam adalah dengan mengoksidasinya dengan memanfaatkan material penutup landfill (biocover sebagai media mikroorganisma pengoksidasi metana. Aplikasi kompos sebagai material penutup landfill merupakan pendekatan dengan biaya rendah untuk mereduksi emisi gas dari landfill sehingga cocok untuk negara berkembang. Biocover yang digunakan pada penelitian ini adalah kompos landfill mining, yaitu kompos yang terdegradasi secara alami di landfill. Tujuan penelitian ini adalah mengevaluasi kemampuan biocover kompos landfill mining dalam mengoksidasi metana pada ketebalan lapisan tertentu dengan kondisi aliran kontinyu. Tiga buah reaktor kolom yang digunakan terbuat dari flexy glass berukuran tinggi 70 cm dan diameter 15 cm. Gas metana dialirkan dari bawah reaktor secara kontinyu dengan laju alir 5 ml/menit. Kolom diisi dengan biocover kompos landfill mining dengan ketebalan lapisan 5, 25, 35 dan 60 cm. Hasil percobaan menunjukkan bahwa semakin tebal lapisan biocover, semakin tinggi efisiensi oksidasi metana. Efisiensi oksidasi yang diperoleh pada setiap ketebalan lapisan 15, 25, 35 dan 60 cm adalah masing-masing 56,43%, 63,69%, 74,58% dan 80,03%, dengan laju oksidasi 0,287 mol m-2 d-1 dan fraksi oksidasi 97%. Hasil oksidasi yang diperoleh tersebut

  13. Plate type heat exchanger for Reaktor TRIGA PUSPATI

    International Nuclear Information System (INIS)

    The PUSPATI TRIGA reactor (RTP) reached its first criticality status on 28 June 1982 with an installed capacity of 1 MW. After 26 years in operation, the ageing process has set in and many systems in the reactor need maintenance and replacement. Among these systems, the more critical one is the heat exchanger system. Currently, the shell and tube type heat exchanger is being used. It has been observed that the performance of the heat exchanger has dropped significantly over the years. Visual inspections indicate that the tubes are corroded or even to the extent of being totally blocked. With this in mind and also with the setting up of the new Nuclear Power Division, whose mission includes upgrading the present reactor to 3 MW, the heat exchanger system is essential and a critical component. Literature indicates that the use of plate type exchangers are more efficient than the current shell and tube type. This paper will look into the engineering and safety aspects of using the plate type heat exchanger to the current TRIGA PUSPATI reactor. (Author)

  14. Theory of nuclear reactors. Vol. 1. Theorie der Kernreaktoren. Bd. 1. Der stationaere Reaktor

    Energy Technology Data Exchange (ETDEWEB)

    Emendoerfer, D.; Hoecker, K.H.

    1982-01-01

    An introduction is given to the elements of reactor physics and reactor calculation which refers to practice from the present point of view. It is demonstrated to the reader how the reactor characteristics relevant to construction can be calculated from atomic factors by means of neutron transport and diffusion theory; these reactor characteristics are: multiplication factor, power density distribution, burn-up, plutonium build-up, xenon vibrations, short-time behaviour. The interaction between thermo- and fluid-dynamic processes is important for this calculation. On grounds of didactics the crucial point of this book is the establishment and calculation of simple models which give a clear description of all important characteristics of the events. Attempts for more exact simulation by computer are dealt with including typical solutions.

  15. Návrh parního generátoru pro modulární reaktor

    OpenAIRE

    Černý, Marian

    2012-01-01

    Obsahem této diplomové práce je návrh parního generátoru pro modulární reaktor. Práce se skládá z rešeršní části, kde jsou popsané vybrané výměníky a parní generátory používané v jaderných zařízeních. Na rešerši navazuje část s teorií výpočtů v prvním přiblížení (tepelný, hydraulický a pevností výpočet). Následuje část návrhu konkrétních variant parního generátoru. Na autorem zvolenou variantu jsou provedeny výše uvedené výpočty a zhotovena výkresová dokumentace vybraných částí. Závěr této pr...

  16. Pembuatan Biodiesel Dari Minyak Kelapa Sawit RBD Dengan Menggunakan Katalis Berpromotor Ganda Berpenyangga γ-Alumina (CaO/MgO/ γ-Al2O3 Dalam Reaktor Fluidized Bed

    Directory of Open Access Journals (Sweden)

    Niar Kurnia Julianti

    2014-09-01

    Full Text Available Biodiesel merupakan salah satu energi alternatif pengganti bahan bakar fosil dari hasil reaksi transesterifikasi minyak nabati dengan metanol. Proses pembuatan biodiesel selama ini menggunakan katalis homogen NaOH atau KOH yang memiliki kelemahan terbentuknya produk samping berupa sabun dan rumitnya pemisahan produk biodiesel dengan katalis. Maka dari itu, mulai dikembangkan katalis heterogen. Penelitian ini mengembangkan katalis berpromotor ganda berpenyangga y-alumina (CaO/MgO/y-Al2O3 dalam reaktor fluidized bed. Pembuatan katalis melalui metode presipitasi CaO dan MgO pada y-Al2O3 serta asam asetat sebagai larutan precursor. Kemudian, katalis dioven selama 12 jam pada suhu 110C dan dikalsinasi pada suhu 700 C selama 5 jam. Katalis yang diperoleh digunakan untuk proses transesterifikasi dengan ratio molar minyak metanol 1:36; variabel massa katalis 4, 7, 10, 13, 16 gram; laju alir reaktan 4, 7, 10, 13, 16 ml/menit; dan suhu 125, 150, 175, 200, 225 C. Dimana yield dan % konversi terbaik dari penelitian diperoleh sebesar 0,642 gr biodiesel/gr minyak dan 63,975% pada massa katalis 16 gram, suhu 225 C dan laju alir reaktan 4 ml/menit.

  17. PENJERAPAN GAS CO HASIL PEMBAKARAN SAMPAH MENGGUNAKAN SORBENT TERMODIFIKASI DALAM REAKTOR FIXED BED

    Directory of Open Access Journals (Sweden)

    Mariana Mariana

    2013-11-01

    Full Text Available ADSORPTION OF CO FROM WASTE COMBUSTION USING MODIFIED SORBENT IN A FIXED BED REACTOR. Gases produced by garbage burning consist of dangerous gases such as CO, SO2 and other gases. Technology for reducing dangerous gases from incinerator outlet can be done by using a dry or wet process. The dry process is more economical process because of simple process, easy maintenance and no liquid waste as product. However, the weakness of the dry process is low absorption conversion and low gas removal efficiency. One way to overcome these problems is to use sorbent which has high reactivity. An inexpensive sorbent that commonly used is Ca(OH2. The aim of this research was to increase the reactivity of Ca(OH2 sorbent by using diatomaceous earth and compost as a source of silica and biosorbent, respectively. Diatomaceous earth contains CaO, SiO2 and Al2O3 and compost contains bacteria as a biosorbent that can convert CO to CO2 and CH4. The reaction between SiO2 and Ca(OH2 would form calcium silicate hydrate (CaO.SiO2.2H2O that has a high porosity and reactivity. The results showed that the reactivity of Ca(OH2 sorbent increased by addition of diatomaceous earth and compost. The results also showed that the sorption of CO gas increases with increasing of height of sorbent bed and temperature. The highest CO gas sorption was obtained at temperature of 150oC and sorbent bed height of 6 cm using the modified sorbent with Ca(OH2/DE/compost ratio of 3:1:1. Gas hasil pembakaran sampah terdiri dari gas-gas yang berbahaya seperti CO, SO2 dan lain sebagainya. Teknologi penghilangan gas-gas tersebut dapat dilakukan dengan menggunakan proses kering maupun proses basah. Penghilangan dengan proses kering lebih ekonomis karena sederhana, mudah pemeliharaan dan tidak menghasilkan limbah cair. Namun demikian, kelemahan proses kering adalah konversi absorpsi rendah dan efisiensi penyisihan  gas relatif kecil. Salah satu cara mengatasi masalah tersebut di atas adalah dengan

  18. UNJUK KERJA REAKTOR PLASMA DIELECTRIC BARRIER DISCHARGE UNTUK PRODUKSI BIODIESEL DARI MINYAK KELAPA SAWIT

    Directory of Open Access Journals (Sweden)

    Ardian Dwi Yudhistira

    2013-10-01

    Full Text Available Biodiesel is one of alternative renewable energy source to substitute diesel fuel. Various biodiesel productionprocesses through transesterification reaction with a variety of catalysts have been developed by previousresearcher. This process still has the disadvantage of a long reaction time, and high energy need. DielectricBarrier Discharge (DBD plasma electro-catalysis may become a solution to overcome the drawbacks in theconventional transesterification process. This process only needs a short time reaction and low energy process.The purpose of this study was to assess the performance of DBD plasma rector in making biodiesel such as: theeffect of high voltage electric value, electrodes gap, mole ratio of methanol / oil, and reaction time. TheResearch method was using GC-MS (Gas Cromatography-Mass Spectrofotometry and FTIR (FourierTransform Infrared Spectrofotometry and then it will be analysed the change of chemical bond betweenreactant and product. So, the reaction mechanism can be predicted. Biodiesel is produced using methanol andpalm oil as reactants and DBD plasma used as reactor in batch system. Then, reactants contacted by highvoltage electric. From the results of this research can be concluded that the reaction mechanism occurs in theprocess is the reaction mechanism of cracking, the higher of electric voltage and the longer of reaction time leadto increasing of product yield. The more of mole ratio of methanol / oil and widening the gap between theelectrodes lead to decreased product yield. From this research, product yield maksimum is 89,8% in the variableof rasio mol metanol/palm oil 3:1, voltage 10 kV, electrode gap 1,5 cm, and reaction time 30 seconds.

  19. The Text of the Agreement of 22 July 1977 between Argentina and the Agency for the Application of Safeguards in Connection with a Contract Concluded between the Comision Nacional de Energia Atomica (Argentina) and the Reaktor Brennelement Union Gmbh Hanau (Federal Republic of Germany) for Co-Operation in the Field of Fabrication of Fuel Elements for Peaceful Nuclear Activities

    International Nuclear Information System (INIS)

    The text of the Agreement of 22 July 1977 between Argentina and the Agency for the application of safeguards in connection with the Contract of 13 August 1976 concluded between the Comision Nacional de Energia Atomica (Argentina) and the Reaktor Brennelement Union GmbH (Federal Republic of Germany) for co-operation in the field of fabrication of fuel elements for peaceful nuclear activities is reproduced in this document for the information of all Members. The Agreement entered into force, pursuant to Section 26, on 22 July 1977.

  20. Reaktor pro přípravu nanočástic v plazmovém výboji

    Czech Academy of Sciences Publication Activity Database

    Brožek, Vlastimil; Benešová, L.; Mastný, L.; Sýkora, V.

    Praha: Česká společnost chemického inženýrství, 2013, P44 1-P44 1. ISBN 978-80-02-02500-9. [CHISA 2013 - Konference chemického a procesního inženýrství /60./. Srní (CZ), 14.10.2013-17.10.2013] Institutional support: RVO:61389021 Keywords : water stabilized plasma * plasmachemical reactor * plasma spraying * nanoparticles formation * nanostructured coatings Subject RIV: CA - Inorganic Chemistry www.chisa.cz/2013

  1. PEMBUATAN BAHAN BAKU SPREADS KAYA KAROTEN DARI MINYAK SAWIT MERAH MELALUI INTERESTERIFIKASI ENZIMATIK MENGGUNAKAN REAKTOR BATCH [Preparation of Red Palm Oil Based-Spreads Stock Rich in Carotene Through Enzymatic Interesterification in Batch-type Reactor

    Directory of Open Access Journals (Sweden)

    Nur Wulandari1,2

    2012-12-01

    Full Text Available Enzymatic interesterification of red palm oil (a mixture of red palm olein/RPO and red palm stearin/RPS in 1:1 weight ratio and coconut oil (CNO blends of varying proportions using a non-specific immobilized Candida antartica lipase (Novozyme 435 was studied for the preparation of spread stock. The interesterification reaction was held in a batch-type reactor. Two substrate blends were chosen for the production of spread stock i.e. 77.5:22,5 and 82.5:17.5 (RPO/RPS:CNO, by weight through enzymatic interesterification in three different reaction times (2, 4, and 6 hours. The interesterification reactions were conducted at 60°C, 200 rpm agitation speed and 10% of Novozyme 435. The interesterified products were evaluated for their physical characteristics (slip melting point or SMP and solid fat content or SFC and chemical characteristics (carotene retention, moisture content, and free fatty acid/FFA content. All of the interesterified products had lower SFC and SMP as compared to the initial blends. The SMP and SFC increased in longer reaction times. The SMP ranged from 30.8°C to 34.9°C. The carotene retention ranged from 74.80% to 81.08%, while the moisture content and FFA content increased in longer reaction times. The interesterified products had desirable physical properties for possible use as a spread stock rich in carotene.

  2. Studies of the effectiveness of a passive heat removal system for a new Soviet-designed WWER reactor. Untersuchungen zur Wirksamkeit eines passiven Waermeabfuhrsystems fuer einen neuen WWER-Reaktor sowjetischer Bauart

    Energy Technology Data Exchange (ETDEWEB)

    Kirmse, R.E.; Loy, D.G. (Gesellschaft fuer Reaktorsicherheit mbH (GRS), Garching (Germany, F.R.)); Berkovich, V.M. (Institut Atomnoj Ehnergii, Moscow (USSR)); Silin, V.A.; Voznesensky, V.A.

    1990-04-01

    A new Soviet WWER 1000 reactor concept is at present under development. These activities are supported under a contract of cooperation between the German partners, i.e. Siemens and GRS, and the Soviet Minatomenergo. Loss-of-coolant accidents postulated under the assumption of a complete loss of AC power supply for a period of 24 hours were examined in the light of measures initiated to avoid and mitigate the consequences of core melting by means of passive systems. Two cases of a minor leakage from a leak size of 1% were analyzed by means of the ATHLET computer code to study the effectiveness of a fundamentally new passive heat removal system and of pressure accumulators. Comparisons of the two calculations showed that an additional period of more than one hour can be gained by raising the power of the passive heat removal system from 2% to 3% of the rated thermal reactor power. (orig.).

  3. Untersuchung von Gasphasen-Methanoxidation mit Profil-Reaktor-Messungen und mikrokinetischer Modellierung

    OpenAIRE

    Mavlyankariev, S.

    2013-01-01

    Gas-phase reactions of oxidative coupling of methane (OCM) – one of the reaction channels of gas-phase methane oxidation – play a crucial role during a catalytic OCM reaction which is currently conducted at high temperatures (above 500 °C). For this reason, understanding the mechanism of gas-phase OCM reaction quantitatively on an atomic basis is crucial for further disentangling the complex interplay of gas-phase and surface chemistry in a catalytic OCM. In this thesis, a contribution to qu...

  4. Parogenerátory tlakovodních reaktorů

    OpenAIRE

    Michalica, Martin

    2015-01-01

    Tato bakalářská práce se zabývá popisem jednotlivých konstrukčních řešení parogenerátorů. V první části bakalářské práce je popsán počátek jaderného průmyslu v Rusku. Samostatná práce se věnuje jednotlivým konstrukčním řešením. Poslední kapitola detailně popisuje jednotlivé části parogenerátoru VVER 1000. Součástí práce je tvorba 3D modelu parogenerátoru VVER 1000, který bude sloužit jako učební pomůcka v projektu Cenelín. This bachelors thesis describes various designs of steam generators...

  5. Start-up and Performance Characteristics of a Trickle Bed Reaktor Degrading Toluene

    Czech Academy of Sciences Publication Activity Database

    Misiaczek, O.; Paca, J.; Halecký, M.; Gerrard, A. M.; Sobotka, Miroslav; Soccol, C. R.

    2007-01-01

    Roč. 50, č. 5 (2007), s. 871-877. ISSN 1516-8913 Grant ostatní: GA ČR(CZ) GA104/05/0194 Institutional research plan: CEZ:AV0Z50200510 Source of funding: V - iné verejné zdroje Keywords : biotrickling filter * constructed mixed population * toluene Subject RIV: EE - Microbiology, Virology Impact factor: 0.349, year: 2007

  6. Earthquake experiments at the HDR (Heissdampf Reaktor) test facility using an eccentric mass vibrator

    International Nuclear Information System (INIS)

    As part of he earthquake investigations carried out by the Karlsruhe Nuclear Research Center, Project HDR, at the HDR Test Facility near Frankfurt/Main, high level shaker test were performed during June/July 1986. The purpose of these tests, supported by the German and U.S. governments was to investigate full scale structural response involving significant concrete and soil strain as well as strong indirect excitation of vessels, pipes and other mechanical equipment. The calculational efforts included predictions of the building and piping response stress analyses. Within these test series, the reactor building was brought to its ultimate loading capacity. (author)

  7. Biosand Filter Dengan Reaktor Karbon Aktif Dalam Pengolahan Limbah Cair Laundry

    OpenAIRE

    Halim, Putri Aulia

    2013-01-01

    In Makassar in general an increase in the number of people from year to year . With a city population of increase , there will be also an increase in demand for goods and services , one of which is in great demand services are laundry services . On the other hand , laundry services this negative impact is the generation of waste generated from the rest of the laundry process tigak treated before it is disposed so that raises the potential for pollution to the environment, especially on water ...

  8. Identifikasi Potensi Produksi Biogas dari Limbah Cair Tahu dengan Reaktor Upflow Anaerobic Sludge Blanket (UASB)

    OpenAIRE

    WAGIMAN

    2007-01-01

    Limbah cair tahu mengandung bahan organik sehingga dapat digunakansebagai bahan baku produksi biogas. Sebagai produk samping sistempengolahan limbah secara anaerobik, biogas masih belum banyak dikajinilai tambahnya. Penelitian ini bertujuan untuk mengevaluasi potensilimbah cair tahu sebagai bahan baku produksi biogas dengan menggunkanreaktor Upflow Anaerobic Sludge Blanket (UASB). Dari aspek teknik dilihat laju produksi biogas dan laju degadasi bahan organik (COD), sedangkan dari sisi ekonomi...

  9. Degradace 17α-ethynylestradiolu ve dvou typech fotokatalytických reaktorů

    Czech Academy of Sciences Publication Activity Database

    Spáčilová, Lucie

    Praha : Ústav chemických procesů AV ČR, v. v. i, 2013 - (Bendová, M.; Wagner, Z.), s. 28-29 ISBN 978-80-86186-46-7. [Bažantova konference doktorandů 2013. Praha (CZ), 14.06.2013] Institutional support: RVO:67985858 Keywords : photocatalytic reactors * 17α-ethynylestradiol * water purification Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  10. PERFORMA OKSIDASI METAN PADA REAKTOR KONTINYU DENGAN PENINGKATAN KETEBALAN LAPISAN BIOCOVER LANDFILL

    OpenAIRE

    Opy Kurniasari; Tri Padmi; Edwan Kardena; Enri Damanhuri

    2013-01-01

    PERFORMANCE OF METHANE OXIDATION IN CONTINUOUS REACTOR BY BIOCOVER LANDFILL FILM THICKNESS IMPROVEMENT. Municipal solid waste (MSW) handling in Indonesia is currently highly dependent on landfilling at the final disposal facility (TPA), which generally operated in layer-by-layer basis, allowing the anaerobic (absent of oxygen) process. This condition will certainly generate biogas in the form of methane (CH4) and CO2. Methane is a greenhouse gas with a global warming potential greater than CO...

  11. UNJUK KERJA REAKTOR PLASMA DIELECTRIC BARRIER DISCHARGE UNTUK PRODUKSI BIODIESEL DARI MINYAK KELAPA SAWIT

    OpenAIRE

    Ardian Dwi Yudhistira; Istadi Istadi

    2013-01-01

    Biodiesel is one of alternative renewable energy source to substitute diesel fuel. Various biodiesel productionprocesses through transesterification reaction with a variety of catalysts have been developed by previousresearcher. This process still has the disadvantage of a long reaction time, and high energy need. DielectricBarrier Discharge (DBD) plasma electro-catalysis may become a solution to overcome the drawbacks in theconventional transesterification process. This process only needs a ...

  12. PENGARUH GEMPA PATAHAN LEMBANG TERHADAP FLEKSIBILITAS PIPA DAN KEGAGALAN NOZEL PERALATAN SISTEM PENDINGIN PRIMER REAKTOR TRIGA 2000 BANDUNG

    OpenAIRE

    H.P. Raharjo

    2012-01-01

    Gempa bumi di suatu instalasi nuklir dapat menyebabkan terjadinya kerusakan sistem peralatan karena adanya perubahan fleksibilitas pipa akibat beban berlebih pada sistem perpipaannya. Beban dari sistem perpipaan dapat membebani nozel peralatan seperti pompa, penukar panas, dll. Apabila beban tersebut terlalu besar dan melebihi beban yang diizinkan akan mengakibatkan kegagalan nozel peralatan. Penelitian ini menganalisis besarnya beban-beban yang terjadi di semua nozel  sistem pendingin prime...

  13. Pengolahan Limbah Cair Organik dengan Microbial Fuel Cell

    Directory of Open Access Journals (Sweden)

    Wahyu Rinaldi

    2015-07-01

    Full Text Available Penelitian ini mengusulkan sebuah prototipe reaktor microbial fuel cell (MFC tanpa membran beraliran kontinyu. Dinding Reaktor dibuat dari pipa PVC dan elektroda dari serat karbon. Mikroba yang ditambatkan di anoda bersumber dari larutan FloTank®. Pada penelitian ini digunakan limbah organik artifisial yang dibuat dari glukosa monohidrat dengan konsentrasi 250 mg/L COD. Waktu tinggal limbah divariasikan pada 0,5; 1; 1,5; dan 2 hari. Nilai rata-rata daya listrik yang dihasilkan untuk waktu tinggal limbah 0,5; 1; 1,5; dan 2 hari berturut-turut adalah 38,02; 43,01; 45,35; 46,71 mW/m2, dan daya volumetrik yang dihasilkan adalah 111,25; 125,86; 132,71; dan 136,69 mW/m3. Persentase penurunan Chemical Oxygen Demand (COD limbah paling tinggi diperoleh pada waktu tinggal 1,5 hari yaitu sebesar 32,26%.

  14. Svar til: Hvorfor bryder robotter sammen i Tjernobyl-reaktor? (Ingeniøren, lørdag d. 17 nov. 2007)

    DEFF Research Database (Denmark)

    Morgen, Per

    2007-01-01

    Symposium 'Image Engineering and Vision Metrology'. Det er kendt af folk, der beskæftiger sig med mikroelektronik, at computerchips og hukommelseskredse kan blive sat ud af spillet, når de bliver udsat for radioaktivitet, og derfor vil også en computerstyret robot være sårbar overfor dette. Radioaktiv...... fra Århus Universitet, af N. Bassler: Radiation damage in scientific chargecoupled devices. Master's Thesis, Institute of Physics and Astronomy, University of Aarhus, Aarhus, Denmark (fra 2002). Konlusionen af deres undersøgelser er, at radioaktiv stråling (de undersøger gammastråling, som der må...

  15. Proses Pembuatan Biodiesel dari Palm Fatty Acid Distillate (PFAD) dan Dimethyl Carbonate dengan Reaktor Packed Bed Menggunakan Katalis Novozym® 435

    OpenAIRE

    Senjaya, Johan

    2016-01-01

    Palm Fatty Acid Distillate (PFAD) is a byproduct produced in the refining process in the palm oil that could potentially be a raw material in the manufacturing process of biodiesel and the price is much cheaper than virgin oil. The purpose of this study was to utilize PFAD in the manufacture of biodiesel by using Dimethyl Carbonate (DMC) as the reactant and Novozym® 435 as a catalyst. The production of biodiesel is done in two ways which are batch and continuous. For batch, PFA...

  16. The Siemens-Argonaut reactor as a driver zone for a high-temperature reactor cell. Der Siemens-Argonaut-Reaktor als Treiberzone fuer eine Hochtemperaturreaktorzelle

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, H.; Schuerrer, F.; Ninaus, W.; Oswald, K.; Rabitsch, H.; Kreiner, H. (Technische Univ., Graz (Austria). Inst. fuer Theoretische Physik und Reaktorphysik); Neef, R.D. (Kernforschungsanlage Juelich G.m.b.H. (Germany, F.R.). Inst. fuer Reaktorentwicklung)

    1984-12-15

    To enable a validation of neutron physics calculation methods for pebble bed reactors the inner reflector of an Argonaut research reactor was substituted by a full of about 1200 fuel elements of the AVR-Juelich type. The report describes the measuring instruments and the reactor physical layout of the arrangement by the code packages GAMTEREX, ZUT-D.G.L. and MUPO. Comparison of calculated reaction rates with measurements show good agreement. Application of the codes to high-temperature reactors in abnormal states is envisaged. (Author, translated by G.Q.)

  17. Pengaruh Rasio Udara Pembakaran Antara Udara Primer Dan Sekunder Terhadap Efisiensi Pembakaran Serat Buah Sawit Pada Reaktor Pembakaran Fixed-Bed

    OpenAIRE

    Yudanto, Bagus Giri

    2012-01-01

    Study of the oil palm fiber (mesocarp) combustion process in the laboratory scale has been conducting. The purpose of this research was to known the effect of various combustion air ratio between primary air (PA) and secondary air (SA) to combustion qualities of mesocarp. The ratio of combustion air (PA:SA) were variated at (20:80), (35:65), (50:50), (65:35) and (80:20). The research experimental was conducted using by a fixed bed reactor. The Controlling of combustion air flow rate using by ...

  18. Modeling and simulation of a biogas reactor; Modellierung und Simulation eines Biogasreaktors

    Energy Technology Data Exchange (ETDEWEB)

    Muha, Ivo

    2012-11-22

    The anaerobic fermentation describes the decomposition of organic material in the absence of oxygen and consists four phases of the process (hydrolysis, acidogenesis, acetogenesis and methanogenesis). In this work, the distribution of these four phases of the process could be determined exactly on both stages of a two-stage two-phase biogas reactor. The distribution is of crucial importance for future work, as this can be determined exactly which substances must be taken into account in the measurements and in the modeling. In 2002, the IWA Task Group published the ADM1 model, which takes into account all four process stages of anaerobic fermentation. In the present work, a spatially resolved model for the anaerobic fermentation is developed, in which the ADM1 model is coupled with a flow model. Subsequently, a reduced simulation model for acetoclastic methanogenesis in a two-stage two-phase biogas reactor is created. Based on measurement data the decomposition of methane to acetic acid in the reactor by the simulation model can be reproduced well. Subsequently, the validated model is used to affiliate rules for optimal control of the reactor and furthermore, the efficiency of the reactor is determined by the local production of methane. The information obtained can be used to optimize the biogas reactor. [German] Die anaerobe Fermentation beschreibt den Abbau organischen Materials unter Ausschluss von Sauerstoff und setzt sich aus vier Prozessphasen (Hydrolyse, Acidogenese, Acetogenese und Methanogenese) zusammen. Im Rahmen dieser Arbeit konnte die Aufteilung dieser vier Prozessphasen auf die beiden Stufen eines zweistufigen zweiphasigen Biogas-Reaktors genau bestimmt werden. Die Aufteilung ist von entscheidender Bedeutung fuer zukuenftige Arbeiten, da dadurch genau festgelegt werden kann, welche Stoffe bei den Messungen und bei der Modellierung beruecksichtigt werden muessen. Im Jahre 2002 wurde von der IWA Taskgroup das ADM1-Modell, welches alle vier

  19. Studio 1:1

    Index Scriptorium Estoniae

    2011-01-01

    Projekteerimis- ja disainistuudiost STUDIO 1:1 (Eindhoven), mis tegeleb avaliku ruumi loomise ja selle kasutamise kujundamisega. Projektidest "Linnulinn - linn lindude segakogukonna jaoks" ja ICT kogemuskeskus "De Verdieping"

  20. WOOD 1:1

    DEFF Research Database (Denmark)

    2013-01-01

    Report from 1:1 workshop at Virserum Konsthall in May 2013 with a team of Master's students from Royal Academy of Fine Arts, School of Architecture, Dpt. 3.......Report from 1:1 workshop at Virserum Konsthall in May 2013 with a team of Master's students from Royal Academy of Fine Arts, School of Architecture, Dpt. 3....

  1. Untersuchungen zur CO-Oxidation und Wassergas-Shift Reaktion an Au/TiO2 und Au/CeO2 Katalysatoren - Aufbau eines Niederdruck- und eines Temporal Analysis of Products Reaktors

    OpenAIRE

    Leppelt, Rainer

    2007-01-01

    The reaction order for the WGS reaction over Au/CeO2 was determined. The influence of the Au content was studied on eight catalysts with increasing gold loading. The apparent activation energy for all catalysts was determined to be 40 ± 3 kJ/mol. In DRIFTS measurements formates and carbonates were identified as main surface species. The decomposition rate of formates is the same as the reaction rate and therefore the decomposition of formates is regarded as rate limiting step. By TPD-experime...

  2. The development of fast reactors - Effects on the Swedish system of management of spent fuel; Utveckling av snabba reaktorer - Paaverkan paa det svenska systemet foer hantering av anvaent braensle

    Energy Technology Data Exchange (ETDEWEB)

    Hans Forsstroem, Hans [SKB International AB, Stockholm (Sweden)

    2013-09-15

    Since the start of the nuclear power era studies have been performed of how to utilise the uranium energy resource in the most effective way. Only about one percent of the energy potential of uranium is utilised in the light water reactors of today. To improve the utilization other types of reactors are needed. With fast reactors theoretically 50-100 times more energy can be extracted from the uranium. This will require reprocessing of the uranium and multiple recycling of the plutonium. Plutonium and uranium can also be recycled in light water reactors, but this will only improve the uranium utilisation by about 20 %. Recycling of plutonium on a routine basis is presently only done in France. The development of fast reactors has been going on since the end of the 1940ies. During the 1970ies the planning was that a large number of fast reactors and their associated fuel cycle facilities would be in operation by the year 2000. The development has, however, for different reasons been much slower than planned. The general assessment today is that fast reactor, if they will be realised, will hardly give an important contribution to energy production until after 2050. Nuclear power production has instead been dominated by light water reactors similar to the ones in use in Sweden. Light water reactors are believed to continue to dominate during the next decades. To start a fast reactor system plutonium (or highly enriched uranium) will be needed. Such plutonium is contained in spent nuclear fuel from light water reactors. This raises the question: Should the spent nuclear fuel be stored so that the potential energy resource in the fuel can be used in the future instead of disposing of it as a waste? The answer to this question will depend on when the material will be useful, i.e. when fast reactors have been introduced on a large scale. It will also depend on the demand for plutonium at this time, i.e. will plutonium be a scarce redundant resource at this point of time. In this context it should be considered that fast reactors will generate their own plutonium, as breeder reactors. Plutonium from other reactors will thus only be needed for the first years of operation. To provide a basis for the answer to the question if the Swedish spent fuel is a resource or a waste this report provides an overview of the present development status for fast reactors and their potential for large scale commercial use. It further describes the impact on the Swedish system for management of spent nuclear fuel if the fuel were to be reprocessed and the uranium and plutonium reused as fuel for fast reactors or for the present reactors.

  3. Report on the interpretation of critical experiments in the Siemens-Argonaut-Reactor Graz to study water ingress into spherical elements. Ergebnisbericht zur Auslegung kritischer Experimente am Siemens-Argonaut-Reaktor Graz zum Studium des Wassereinbruches im Kugelhaufen

    Energy Technology Data Exchange (ETDEWEB)

    Schuerrer, F. (Technische Univ., Graz (Austria). Inst. fuer Theoretische Physik und Reaktorphysik); Neef, R.D. (Kernforschungsanlage Juelich G.m.b.H. (Germany, F.R.). Inst. fuer Reaktorentwicklung)

    1979-04-15

    The experiments described are of interest in the study of water contamination in HTR fuel elements. The Siemens Argonaut Reactor (SAR) has been considered as a research tool for a simulation experiment. Following a brief description of the SAR, planned programs are discussed in 'dry' and 'wet' cores. Detector foil types and locations are noted. A theoretical model is developed and nuclide concentrations estimated in the various spectral zones. Reactivity calculations have been made and are summarised for various H{sub 2}O percentage concentrations. The discussion is supported by simplified core layout diagrams and graphs of core flux distributions. Neutron diffusion and spectra calculations are referenced to computer programs used by KFA-Juelich, published elsewhere, and include GAM, THERMOS, MUPO and EXTERMINATOR-2. (G.C.)

  4. NPP Grafenrheinfeld. No thank you. Questions and answers concerning the oldest operating crack susceptible reactor in the federal republic; AKW Grafenrheinfeld. Nein danke. Fragen und Antworten zum aeltesten noch laufenden und rissanfaelligsten Reaktor der Republik

    Energy Technology Data Exchange (ETDEWEB)

    Darge, Tobias

    2014-03-15

    The brochure discusses questions on the NPP Grafenrheinfeld. concerning the following issues: reactor type, operating company, nuclear fuel, licensing, radioactive waste management, susceptibility to damage, stress test results, critical arguments concerning the reactor pressure vessel steel and the containment, cracks in the primary circuit, safety in case of an aircraft crash, possibility of a severe accident, consequences of a severe accident, medical emergency plan, public information for an emergency case, shutdown at the end of 2015, necessity of a new power plant for energy security?.

  5. Joint statement of the chairmen of the Groupe Permanent Reacteurs (GPR) and the Reaktor-Sicherheitskommission (RSK) on safety documents worked out by the German-French commission for safety problems in nuclear installations (DFK)

    International Nuclear Information System (INIS)

    The GPR (Groupe Permanent Reacteurs) and RSK (Reaktorsicherheitskommission) meeting was focusing on topical supplements to the notices and recommendations concerning the 1982 comments of the TUEV Baden and TUEV Rheinland as well as on replies to the public allegations concerning the lacking safety of the Cattenom nuclear power plant. The chairmen express their opinions about the safety, radiological aspects, characteristic features of the site and particular problems in a joint statement. (DG)

  6. Development of a methodology for safety classification on a non-reactor nuclear facility illustrated using an specific example; Entwicklung einer Methodik zur Sicherheitsklassifizierung fuer eine kerntechnische Anlage ohne Reaktor an einem spezifischen Beispiel

    Energy Technology Data Exchange (ETDEWEB)

    Scheuermann, F.; Lehradt, O.; Traichel, A. [NUKEM Technologies Engineering Services GmbH, Alzenau (Germany)

    2015-07-01

    To realize the safety of personnel and environment systems and components of nuclear facilities are classified according to their potential danger into safety classes. Based on this classification different demands on the manufacturing quality result. The objective of this work is to present the standardized method developed by NUKEM Technologies Engineering Services for the categorization into the safety classes restricted to Non-reactor nuclear facilities (NRNF). Exemplary the methodology is used on the complex Russian normative system (four safety classes). For NRNF only the lower two safety classes are relevant. The classification into the lowest safety class 4 is accordingly if the maximum resulting dose following from clean-up actions in case of incidents/accidents remains below 20 mSv and the volume activity restrictions of set in NRB-99/2009 are met. The methodology is illustrated using an example. In short the methodology consists of: - Determination of the working time to remove consequences of incidents, - Calculation of the dose resulting from direct radiation and due to inhalation during these works. The application of this methodology avoids over-conservative approaches. As a result some previously higher classified equipment can be classified into the lower safety class.

  7. Juba teine "1+1 = 1"

    Index Scriptorium Estoniae

    2004-01-01

    15. III Okupatsioonimuuseumis toimuva "1+1=1" teise ürituse kavast. Presentatsioonide õhtu keskendub konkreetse ruumikogemuse vahendamisele kunstis (helis, slaidi-installatsioonis, tänava-aktsioonis, skulptuuris, videos, filmis). Esinevad Cevdet Erek, Andres Lõo, Andres Kurg (arhitektuur ja interjöörid Marko Raadi filmis "Agent Sinikael") jt.

  8. Determination of Selected U-ZrH1.6 Fuel Element Depletion at PUSPATI TRIGA Reactor

    International Nuclear Information System (INIS)

    Determination of nuclear fuel depletion in reactor after a long time of operation is very important. This allows the remaining fuel material in the reactor core to be fully utilized before transferred into storage area. Indeed, in order to properly handle nuclear spent fuel, we need to determine the level of burn-up and radiation generated prior to any activity. In this study, the fuel depletion of selected TRIGA fuel elements was determined at the Reaktor TRIGA PUSPATI (RTP), Malaysian Nuclear Agency. Parameter used was based on operational data of particular fuel elements until December 2012 where some of the fuel elements have been used since June 1982. Between these periods, the reactor core has been reloaded and/or reshuffled 14th times. Power distribution and burn-up level was calculated using TRIGLAV computer code. Further calculation was also made using ORIGEN2 computer code particularly in determining the fission product concentrations and radioactivity levels. Results of calculation are analysed and discussed in this paper. (author)

  9. Analysis of changes in the chemical composition of the blast furnace coke at high temperatures

    Directory of Open Access Journals (Sweden)

    A. Konstanciak

    2012-12-01

    Full Text Available Purpose: The main purpose of this paper was to analyze the behavior of coke in the blast furnace. The analysis of changes in chemical composition of coke due to impact of inert gas and air at different temperatures was made. The impact of the application of the thermoabrasion coefficient on the porosity of coke was also analyzed.Design/methodology/approach: By applying the Computer Thermochemical Database of the TERMO system (REAKTOR1 and REAKTOR3 three groups of substances can be distinguished. The chemical composition of blast furnace coke and the results of calculations of changes of chemical composition of coke heat treated under certain conditions were compared. The structural studies of these materials were presented.Findings: The results of the analysis of ash produced from one of Polish cokes was taken for consideration. This is not the average composition of Polish coke ashes, nevertheless it is representative of most commonly occurring chemical compositions.Practical implications: Thanks to the thermochemical calculations it is possible to predict ash composition after the treatment in a blast furnace. Those information was crucial and had an actual impact on determining the coke quality.Originality/value: Presentation of the analytical methods which, according to author, can be very useful to evaluate and identify the heat treatment for blast furnaces cokes. The research pursued represents part of a larger project carried out within the framework of Department Extraction and Recycling of Metals, Czestochowa University of Technology.

  10. Prediksi Potensi Pencemaran Pengolahan Sampah dengan Metode Gasifikasi Fluidized Bed (Studi Kasus: TPA Benowo, Surabaya

    Directory of Open Access Journals (Sweden)

    Lailatun Nikmah

    2013-03-01

    Full Text Available Sistem pengelolaan sampah di TPA Benowo masih bersistem open dumping dan belum memperhatikan dampak pencemaran terhadap lingkungan. Kuantitas sampah yang masuk ke TPA sebesar 461.705,782 ton pada tahun 2012. Kuantitas sampah diperkirakan meningkat sebanding dengan pertumbuhan penduduk, sehingga dibutuhkan skenario pengolahan sampah yang ramah lingkungan. Skenario pengolahan sampah yang akan dikaji adalah gasifikasi  fluidized bed. Potensi pencemaran gasifikasi  fluidized bed akan dikaji menggunakan metode Life Cycle Assessment (LCA dengan software SimaPro versi 7.1. Satu ton sampah pada studi ini ditentukan sebagai satu fungsi unit. Data input Life Cycle Inventory (LCI meliputi jumlah sampah yang masuk ke reaktor gasifikasi dan energi yang dibutuhkan pada proses gasifikasi berdasarkan pendekatan efisiensi reaktor gasifikasi. Penentuan nilai Life Cycle Impact Assesment (LCIA meliputi Global Warming Potential (GWP dan asidifikasi menggunakan metode Environmental Product Declarations (EPD 2008. Besar dampak dinyatakan dalam faktor emisi yang ekivalen. Kesimpulan pada penelitian ini menunjukkan bahwa skenario pengolahan sampah dengan metode gasifikasi fluidized bed memberikan dampak GWP sebesar 1067,8 kg CO2/fu pada fase start-up dan 875 kg CO2/fu pada fase energy recovery serta asidifikasi sebesar 5,93 kg SO2/fu pada fase start-up dan 4,81 kg SO2/fu pada fase energy recovery.

  11. Shootin1

    DEFF Research Database (Denmark)

    Toriyama, Michinori; Shimada, Tadayuki; Kim, Ki Bum;

    2006-01-01

    novel protein, named shootin1, that became up-regulated during polarization of hippocampal neurons and began fluctuating accumulation among multiple neurites. Eventually, shootin1 accumulated asymmetrically in a single neurite, which led to axon induction for polarization. Disturbing the asymmetric...... organization of shootin1 by excess shootin1 disrupted polarization, whereas repressing shootin1 expression inhibited polarization. Overexpression and RNA interference data suggest that shootin1 is required for spatially localized phosphoinositide-3-kinase activity. Shootin1 was transported anterogradely to the...... growth cones and diffused back to the soma; inhibiting this transport prevented its asymmetric accumulation in neurons. We propose that shootin1 is involved in the generation of internal asymmetric signals required for neuronal polarization....

  12. ASC-1

    DEFF Research Database (Denmark)

    Jakimoski, Goce; Khajuria, Samant

    2011-01-01

    . Unfortunately, the use of a block cipher as a building block limits the performance of the authenticated encryption schemes to at most one message block per block cipher evaluation. In this paper, we propose the authenticated encryption scheme ASC-1 (Authenticating Stream Cipher One). Similarly to LEX, ASC-1...... uses leak extraction from diÆerent AES rounds to compute the key material that is XOR-ed with the message to compute the ciphertext. Unlike LEX, the ASC-1 operates in a CFB fashion to compute an authentication tag over the encrypted message. We argue that ASC-1 is secure by reducingits (IND-CCA , INT...

  13. Heteroepitaxy of CdTe(1 1 1)B on Si(1 1 1) : As

    Science.gov (United States)

    Schick, H.; Bensing, F.; Hilpert, U.; Richter, U.; Hansen, L.; Wagner, J.; Wagner, V.; Geurts, J.; Waag, A.; Landwehr, G.

    2000-06-01

    In order to improve the structural quality of CdTe/Si composite substrates, we have investigated the MBE growth mechanisms of CdTe(1 1 1) onto planar and vicinal arsenic-passivated Si(1 1 1) surfaces. The films were characterized by in situ RHEED, X-ray diffraction, Raman spectroscopy, photoluminescence, secondary electron microscopy, transmission electron microscopy and atomic force microscopy. Rocking curves had peaks narrower than 100 arcsec at a layer thickness of only 1-2 μm. BeTe buffer layers did not show a dominant effect, whereas the twin content decreased drastically when misoriented substrates were used. Efficient twin suppression can be obtained by realizing an interface step alignment between substrate and epitaxial CdTe film.

  14. Neurofibromatosis-1

    Science.gov (United States)

    ... of skin ( subcutaneous tissue) Nerves from the brain (cranial nerves) and spinal cord (spinal root nerves) Causes NF1 ... affect the appearance and put pressure on nearby nerves or organs Many soft tumors on the skin or deeper in ...

  15. 1/N

    International Nuclear Information System (INIS)

    There exist families of field theories with symmetry group SO(N) (or SU(N)) that become simpler as N becomes larger. More precisely, the solutions to these theories possess an expansion in powers of 1/N. This expansion is the subject of these lectures. The 1/N expansion can be used to analyze model field theories. The 1/N expansion is developed for phi4 theory and applied to two two-dimensional models with similar combinatoric structures, the Gross-Neveu model and the CP/sup N-1/ model. These models display (in the leading 1/N approximation) such interesting phenomena as asymptotic freedom, dynamical symmetry breaking, dimensional transmutation, and non-perturbative confinement. It is possible that the 1/N expansion, with N the number of colors, might fruitfully be applied to quantum chromodynamics. Unfortunately, it is not possible to make a decisive test of the approximation, because no one knows how to compute even the first term in the expansion in closed form. However, it is possible to argue that this first term, whatever its detailed form, has many properties that are also shared by the real world, and which are otherwise underived from field theory. These include the saturation of scattering amplitudes by an infinite number of narrow resonances, the essential feature of dual-resonance models

  16. POLX-1

    International Nuclear Information System (INIS)

    The capabilities of the POLX-1 code which was developed for the purpose of generating polynomial fits to neutron few-group cross sections as functions of soluble boron concentration, fuel temperature, moderator density and exposure in the reactor core are described. The effects of extracting removable burnable poison rods and the insertion of control rods are also parameterized as functions of the core conditions. Input data requirements and the format of the output file generated by POLX-1 are also described. 14 refs

  17. 1. Introduction

    OpenAIRE

    Olaniyi, Rasheed

    2013-01-01

    1.1: Background to the Study According to the Safer Cities Programme of UN-Habitat, crime does not occur spontaneously but it grows out of an unequal and exclusive society, and out of a lack of institutional and social control. African cities could be described as places of fear, where violence and crime rule. As Alan Mabin observed, social life and urban economies are often organised around the fear of violence and crime (Mabin, 2004). The criminal justice system, including the police, court...

  18. Danida1

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    1996-01-01

    At the request of Danish Ministry of Foreign Affairs, Department TSA.4, electrical testing of possibly damaged cables has been evaluated. This matter concerns three different types of cable, which are10 km 30(36) kV XLPE armoured submarine power cable, 1-phase15 km 30(36) kV XLPE armoured...... underground power cable, 1-phase20 km 10(12) kV XLPE armoured underground power cable, 3-phase.The possible damage of said cables took place during shipment from Denmark to Bangladesh....

  19. Pentacene on Au(111), Ag(111) and Cu(111): From physisorption to chemisorption

    Science.gov (United States)

    Lu, Meng-Chao; Wang, Rong-Bin; Yang, Ao; Duhm, Steffen

    2016-03-01

    We measured the electronic and the molecular surface structure of pentacene deposited on the (111)-surfaces of coinage metals by means of ultraviolet photoelectron spectroscopy (UPS) and low-energy electron diffraction (LEED). Pentacene is almost flat-lying in monolayers on all three substrates and highly ordered on Au(111) and on Cu(111). On Ag(111), however, weak chemisorption leads to almost disordered monolayers, both, at room temperature and at 78 K. On Cu(111) pentacene is strongly chemisorbed and the lowest unoccupied molecular orbital becomes observable in UPS by a charge transfer from the substrate. On Ag(111) and Cu(111) multilayers adopt a tilted orientation and a high degree of crystallinity. On Au(111), most likely, also in multilayers the molecular short and long axes are parallel to the substrate, leading to a distinctively different electronic structure than on Ag(111) and Cu(111). Overall, it could be demonstrated that the substrate not only determines the geometric and electronic characteristics of molecular monolayer films but also plays a crucial role for multilayer film growth.

  20. Pentacene on Au(111), Ag(111) and Cu(111): From physisorption to chemisorption

    International Nuclear Information System (INIS)

    We measured the electronic and the molecular surface structure of pentacene deposited on the (111)-surfaces of coinage metals by means of ultraviolet photoelectron spectroscopy (UPS) and low-energy electron diffraction (LEED). Pentacene is almost flat-lying in monolayers on all three substrates and highly ordered on Au(111) and on Cu(111). On Ag(111), however, weak chemisorption leads to almost disordered monolayers, both, at room temperature and at 78 K. On Cu(111) pentacene is strongly chemisorbed and the lowest unoccupied molecular orbital becomes observable in UPS by a charge transfer from the substrate. On Ag(111) and Cu(111) multilayers adopt a tilted orientation and a high degree of crystallinity. On Au(111), most likely, also in multilayers the molecular short and long axes are parallel to the substrate, leading to a distinctively different electronic structure than on Ag(111) and Cu(111). Overall, it could be demonstrated that the substrate not only determines the geometric and electronic characteristics of molecular monolayer films but also plays a crucial role for multilayer film growth. (paper)

  1. Pentacene on Au(111), Ag(111) and Cu(111): From physisorption to chemisorption.

    Science.gov (United States)

    Lu, Meng-Chao; Wang, Rong-Bin; Yang, Ao; Duhm, Steffen

    2016-03-01

    We measured the electronic and the molecular surface structure of pentacene deposited on the (111)-surfaces of coinage metals by means of ultraviolet photoelectron spectroscopy (UPS) and low-energy electron diffraction (LEED). Pentacene is almost flat-lying in monolayers on all three substrates and highly ordered on Au(111) and on Cu(111). On Ag(111), however, weak chemisorption leads to almost disordered monolayers, both, at room temperature and at 78 K. On Cu(111) pentacene is strongly chemisorbed and the lowest unoccupied molecular orbital becomes observable in UPS by a charge transfer from the substrate. On Ag(111) and Cu(111) multilayers adopt a tilted orientation and a high degree of crystallinity. On Au(111), most likely, also in multilayers the molecular short and long axes are parallel to the substrate, leading to a distinctively different electronic structure than on Ag(111) and Cu(111). Overall, it could be demonstrated that the substrate not only determines the geometric and electronic characteristics of molecular monolayer films but also plays a crucial role for multilayer film growth. PMID:26870881

  2. Dynamics Explorer-1 (DE-1)

    Science.gov (United States)

    Gordon, F.; Pashby, P.

    1991-01-01

    The Dynamics Explorer (DE) mission is designed to study the Earth's electromagnetic fields at varying heights up to 4 Earth radii. The DE-1 was launched on a Delta 3913 launch vehicle from the Western Test Range and was placed in a 561 x 23279 km orbit with a 90 degree inclination. The Deep Space Network (DSN) began to support this extended mission on February 1, 1985. Coverage consists of five passes per day that last for 45 minutes each. Information is given in tabular form for DSN support, frequency assignments, telemetry, command, and tracking mission responsibility.

  3. Mercury(1)

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    1.Mercury is the planet closest to the sun.It is thefastest moving planet.And it is the second smallestplanet in our solar system. 2.Mercury is very difficult to see.Its orbit isbetween us and the sun.So,we have to look toward thebright light of the sun to see it.The sunlight usuallyhides Mercury.When we can see it,it appears as a fuzzyball.

  4. Figures1

    OpenAIRE

    2014-01-01

    NB. Soulignons que cette carte, établie à partir de statistiques officielles, est en contradiction avec de nombreuses enquêtes locales.Source : Diop Salif, Rekacewicz Philippe, 2003, Atlas mondial de l’eau, Paris, Éditions Autrement.Figure 1. Part de la population urbaine ayant accès à l'eau potable en Afrique subsaharienne Source : Diop, Rekacewicz, 2003.Figure 2. Afrique subsaharienne : pénurie d'eau douce et stress hydrique en 1990 et 2025 (projection) Source : Diop, Rekacewicz, 2003.Fig...

  5. Wetlands; 1 : 1 000 000

    International Nuclear Information System (INIS)

    The most valuable swamps and other hydrophilic associations represent wetlands. In the years 1991 - 2000, 261 specialists carried out their inventory. Apart from these localities another 1,050 locally important wetlands were identified while more than 500 wetlands were identified geographically, i.e. without characterisation of flora and fauna, which prevented their categorisation. The source material used for mapping of wetlands was provided by the Centre for Wetland Mapping of the Slovak Union of Nature and Landscape Conservationists in Prievidza. Mapping of wetlands in Slovakia continues and its main aim is to: (1) cartographically process the yet not investigated territories, for instance, the districts of Humenne, Zlate Moravce, and other; (2) explore fauna and flora of more than 500 geographically identified wetlands; (3) update the state of biota of internationally and nationally important wetlands; (4) involve more specialists in inventory of wetlands. (authors)

  6. 26 CFR 1.7872-1-1.7872-4 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false 1.7872-1-1.7872-4 Section 1.7872-1-1.7872-4 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES General Actuarial Valuations §§ 1.7872-11.7872-4...

  7. 1-Benzylimidazolium hexafluorophosphate–1-benzylimidazole (1/1

    Directory of Open Access Journals (Sweden)

    Qing-Xiang Liu

    2008-02-01

    Full Text Available In the title compound, C10H11N2+·PF6−·C10H10N2, the H atom involved in protonation is disordered equally between the cation and the neutral molecule. The dihedral angle between the phenyl and imidazole rings is 82.6 (2°. In the crystal structure, there are head-to-tail π–π stacking interactions between imidazole rings; the interplanar separation is 3.295 (1 Å and the centroid–centroid separation is 3.448 (3 Å. In the centrosymmetric anion, two F atoms are disordered over two positions; the refined site-occupancy factors are 0.855 (11 and 0.145 (11.

  8. Methane dissociation on Pt(1 1 1), Ir(1 1 1) and PtIr(1 1 1) surface: A density functional theory study

    Energy Technology Data Exchange (ETDEWEB)

    Qi, Qiuhong; Wang, Xiujun, E-mail: xjwangcn@scut.edu.cn; Chen, Li; Li, Baitao

    2013-11-01

    A periodic density functional theory (DFT) was utilized to calculate the dissociation process of methane (CH{sub 4}) on Pt(1 1 1), Ir(1 1 1) and PtIr(1 1 1) surfaces. As compared to the adsorption energy, the most stable configurations of methane, methane dissociation species and co-adsorption of CH{sub x} (x = 0–3) with H were obtained. The kinetic results of the CH{sub 4} dissociation indicated that the dissociating of CH{sub 4} into CH{sub 3} and H is the rate-limiting step on the PtIr(1 1 1) and Ir(1 1 1) surfaces. CH was the most abundant species that was difficult to dehydrogenate into C and H. Particularly, the activation barrier for CH{sub 3} → CH{sub 2} + H and CH{sub 2} → CH + H on the Pt(1 1 1) surface is 3.5 and 1.4 times, respectively, higher than that on the PtIr(1 1 1) surface. According to the thermodynamics principles, the successive dehydrogenation of CH{sub 4} preferred to take place on the PtIr surface.

  9. CH4 dehydrogenation on Cu(1 1 1), Cu@Cu(1 1 1), Rh@Cu(1 1 1) and RhCu(1 1 1) surfaces: A comparison studies of catalytic activity

    International Nuclear Information System (INIS)

    Highlights: • Adsorbed Rh atom on Cu catalyst exhibits better catalytic activity for CH4 dehydrogenation. • The adsorbed Rh atom is the reaction active center for CH4 dehydrogenation. • The morphology of Cu substrate has negligible effect on CH4 dehydrogenation. - Abstract: In the CVD growth of graphene, the reaction barriers of the dehydrogenation for hydrocarbon molecules directly decide the graphene CVD growth temperature. In this study, density functional theory method has been employed to comparatively probe into CH4 dehydrogenation on four types of Cu(1 1 1) surface, including the flat Cu(1 1 1) surface (labeled as Cu(1 1 1)) and the Cu(1 1 1) surface with one surface Cu atom substituted by one Rh atom (labeled as RhCu(1 1 1)), as well as the Cu(1 1 1) surface with one Cu or Rh adatom (labeled as Cu@Cu(1 1 1) and Rh@Cu(1 1 1), respectively). Our results show that the highest barrier of the whole CH4 dehydrogenation process is remarkably reduced from 448.7 and 418.4 kJ mol−1 on the flat Cu(1 1 1) and Cu@Cu(1 1 1) surfaces to 258.9 kJ mol−1 on RhCu(1 1 1) surface, and to 180.0 kJ mol−1 on Rh@Cu(1 1 1) surface, indicating that the adsorbed or substituted Rh atom on Cu catalyst can exhibit better catalytic activity for CH4 complete dehydrogenation; meanwhile, since the differences for the highest barrier between Cu@Cu(1 1 1) and Cu(1 1 1) surfaces are smaller, the catalytic behaviors of Cu@Cu(1 1 1) surface are very close to the flat Cu(1 1 1) surface, suggesting that the morphology of Cu substrate does not obviously affect the dehydrogenation of CH4, which accords with the reported experimental observations. As a result, the adsorbed or substituted Rh atom on Cu catalyst exhibit a better catalytic activity for CH4 dehydrogenation compared to the pure Cu catalyst, especially on Rh-adsorbed Cu catalyst, we can conclude that the potential of synthesizing high-quality graphene with the help of Rh on Cu foils may be carried out at relatively low

  10. CH{sub 4} dehydrogenation on Cu(1 1 1), Cu@Cu(1 1 1), Rh@Cu(1 1 1) and RhCu(1 1 1) surfaces: A comparison studies of catalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Riguang; Duan, Tian [Key Laboratory of Coal Science and Technology of Ministry of Education and Shanxi Province, Taiyuan University of Technology, Taiyuan 030024, Shanxi (China); Ling, Lixia [Key Laboratory of Coal Science and Technology of Ministry of Education and Shanxi Province, Taiyuan University of Technology, Taiyuan 030024, Shanxi (China); Research Institute of Special Chemicals, Taiyuan University of Technology, Taiyuan 030024, Shanxi (China); Wang, Baojun, E-mail: wangbaojun@tyut.edu.cn [Key Laboratory of Coal Science and Technology of Ministry of Education and Shanxi Province, Taiyuan University of Technology, Taiyuan 030024, Shanxi (China)

    2015-06-30

    Highlights: • Adsorbed Rh atom on Cu catalyst exhibits better catalytic activity for CH{sub 4} dehydrogenation. • The adsorbed Rh atom is the reaction active center for CH{sub 4} dehydrogenation. • The morphology of Cu substrate has negligible effect on CH{sub 4} dehydrogenation. - Abstract: In the CVD growth of graphene, the reaction barriers of the dehydrogenation for hydrocarbon molecules directly decide the graphene CVD growth temperature. In this study, density functional theory method has been employed to comparatively probe into CH{sub 4} dehydrogenation on four types of Cu(1 1 1) surface, including the flat Cu(1 1 1) surface (labeled as Cu(1 1 1)) and the Cu(1 1 1) surface with one surface Cu atom substituted by one Rh atom (labeled as RhCu(1 1 1)), as well as the Cu(1 1 1) surface with one Cu or Rh adatom (labeled as Cu@Cu(1 1 1) and Rh@Cu(1 1 1), respectively). Our results show that the highest barrier of the whole CH{sub 4} dehydrogenation process is remarkably reduced from 448.7 and 418.4 kJ mol{sup −1} on the flat Cu(1 1 1) and Cu@Cu(1 1 1) surfaces to 258.9 kJ mol{sup −1} on RhCu(1 1 1) surface, and to 180.0 kJ mol{sup −1} on Rh@Cu(1 1 1) surface, indicating that the adsorbed or substituted Rh atom on Cu catalyst can exhibit better catalytic activity for CH{sub 4} complete dehydrogenation; meanwhile, since the differences for the highest barrier between Cu@Cu(1 1 1) and Cu(1 1 1) surfaces are smaller, the catalytic behaviors of Cu@Cu(1 1 1) surface are very close to the flat Cu(1 1 1) surface, suggesting that the morphology of Cu substrate does not obviously affect the dehydrogenation of CH{sub 4}, which accords with the reported experimental observations. As a result, the adsorbed or substituted Rh atom on Cu catalyst exhibit a better catalytic activity for CH{sub 4} dehydrogenation compared to the pure Cu catalyst, especially on Rh-adsorbed Cu catalyst, we can conclude that the potential of synthesizing high-quality graphene with the

  11. Theoretical study of NH3 decomposition on Pd-Cu (1 1 1) and Cu-Pd (1 1 1) surfaces: A comparison with clean Pd (1 1 1) and Cu (1 1 1)

    Science.gov (United States)

    Jiang, Zhao; Qin, Pei; Fang, Tao

    2016-05-01

    The adsorption and successive dehydrogenation mechanisms of NH3 on Pd-Cu (1 1 1) and Cu-Pd (1 1 1) surfaces (the Pd atoms substitution of the first and second layers of Cu (1 1 1) surfaces) have been systematically investigated by density functional theory (DFT) method with a periodic slab model. All possible adsorption configurations of relevant intermediates on Pd-Cu (1 1 1) and Cu-Pd (1 1 1) surfaces are identified. It is revealed that the adsorption configurations and corresponding adsorption energies of adsorbates are slightly changed on Pd-Cu (1 1 1) and Cu-Pd (1 1 1) surfaces. The adsorption energies of NHx(x = 0-3) species exhibit the following trend: NH3 energy path for the complete dehydrogenation of NH3 into adsorbed N and H is identified to explore the dehydrogenation mechanisms on different surfaces. The highest energy barrier and reaction energy on Pd-Cu (1 1 1) surface are greatly reduced to 1.56 and 0.99 eV, implying that the complete dehydrogenation of NH3 on Pd-Cu (1 1 1) surface is favorable both kinetically and thermodynamically, namely, the doped-Pd atoms in the first layer are the reaction active center. Compared to that on clean Pd (1 1 1) and Cu (1 1 1) surfaces, it is found that the synergistic effect exits in different layers of catalyst surfaces. The calculated results show that the layer-substituted Pd atoms on the surface of Cu catalysts exhibit a better catalytic activity for NH3 dehydrogenation compared to the clean Cu (1 1 1) surface.

  12. Main: SITE1SORPS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SITE1SORPS1 S000211 11-May-2006 (last modified) kehi Site 1 in the spinach (S.o.) r...ps1 promoter; S1F binding site; Nuclear genes encoding plastid ribosomal proteins are more highly expressed ... See S000215 (S1FSORPL21); S1 box=ATGGTA; Site 1; rps1; ribosomal protein; S1F; leaf; leaf-specific; repression; negative; spinach (Spinacia oleracea); TCATGGTAACAATT ...

  13. Surface relaxation of Pt(1 1 1) and Cu/Pt(1 1 1) revealed by DEPES

    Science.gov (United States)

    Miszczuk, A.; Morawski, I.; Kucharczyk, R.; Nowicki, M.

    2016-06-01

    In this paper, we report the results of surface relaxation investigations for a clean Pt(1 1 1) as well as Pt(1 1 1) covered with a pseudomorphic monolayer of Cu. The pseudomorphic (1 × 1) Cu overlayer on Pt(1 1 1) was formed upon continuous copper adsorption at the substrate temperature equal to 450 K. Considerations include both the experimental and theoretical studies employing directional elastic peak electron spectroscopy (DEPES), multiple scattering (MS) formalism, and density functional theory (DFT). A quantitative analysis of two-dimensional DEPES intensity distributions is presented and the contribution of consecutive subsurface Pt atomic layers to the measured signal is identified. The experimental DEPES distributions are compared with theoretical maps MS-simulated for a variable separation between the outermost atomic planes. For the clean Pt(1 1 1), the best fit is obtained assuming the outward relaxation of the surface layer by +0.7% with respect to the interplanar distance in the bulk, confirming the slight expansion of the Pt(1 1 1) surface. Similar analysis performed for the Cu/Pt(1 1 1) adsorption system indicates the inward shift of the pseudomorphic Cu overlayer by -6.9% with respect to the substrate lattice continuation sites. Such DEPES-determined surface relaxations of Pt(1 1 1) and Cu/Pt(1 1 1) agree with the values predicted by the corresponding DFT computations.

  14. PSA analysis focused on Mochovce safety measure evaluation from operational safety point of view

    International Nuclear Information System (INIS)

    Mochovce NPP consists of four reaktor units of WWER 440/V213 type and it is located in the south-middle part of Slovakia. At present units 1 and 2 are in operation. As these units represent the second generation of WWER reactor design, additional safety measures were implemented to enhance operational and nuclear safety according to the recommendations of international audits and operational experience from other simular units (such as Dukovany and Bohunice). These requirements result into a number of safety measures grouped according to their purpose to achieve recent international requirements on nuclear and operational safety. The paper presents the bases used for specification of safety measures including their grouping into comprehensive tasks covering different areas of safety goals as well as structural organization of project management including participating companies and work performance. Results are also given regarding the contribution of selected safety measures to reduction of total core damage frequency. (authors)

  15. Main: 1OM1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1OM1 トウモロコシ Corn Zea mays L. Casein Kinase Ii, Alpha Chain Name=Ack2; Zea Mays Mole...ELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENSRTRA corn_1OM1.jpg ...

  16. Main: 1FK1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1FK1 トウモロコシ Corn Zea mays L. Nonspecific Lipid-Transfer Protein Precursor Zea Mays ...RGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN corn_1FK1.jpg ...

  17. Main: L1DCPAL1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1DCPAL1 S000504 15-September-2006 (last modified) kehi L1 element, found in PAL1 promoter in ca ... rrot (Daucus ... carota), is a protoplastization (dilution) respons ... ACCC); see also S000492 (BOXL CORE of DC PAL1); L1 Daucus ... carota (carrot) ATTCACCTACCC ...

  18. 26 CFR 1.72-1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Introduction. 1.72-1 Section 1.72-1 Internal... TAXES (CONTINUED) Items Specifically Included in Gross Income § 1.72-1 Introduction. (a) General... law exceeds the consideration contributed (or deemed contributed) by the employee under §...

  19. Containment of 0 and 1 in 1(, )

    Indian Academy of Sciences (India)

    Mohsen Alimohammady

    2004-05-01

    Suppose 1(, ) is the space of all absolutely 1-summing operators between two Banach spaces and . We show that if has a copy of 0, then 1(, ) will have a copy of 0, and under some conditions if has a copy of 1 then 1(, ) would have a complemented copy of 1.

  20. 45 CFR 1216.1-1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Purpose. 1216.1-1 Section 1216.1-1 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE NONDISPLACEMENT OF EMPLOYED WORKERS AND NONIMPAIRMENT OF CONTRACTS FOR SERVICE § 1216.1-1 Purpose. This...

  1. 26 CFR 1.535-1 - Definition.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Definition. 1.535-1 Section 1.535-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.535-1 Definition. (a)...

  2. 26 CFR 1.936-1 - Elections.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Elections. 1.936-1 Section 1.936-1 Internal... TAXES Possessions of the United States § 1.936-1 Elections. (a) Making an election. A domestic corporation shall make an election under section 936(e), for any taxable year beginning after December...

  3. Composition and structure of chemically prepared GaAs(1 1 1)A and (1 1 1)B surfaces

    Science.gov (United States)

    Tereshchenko, O. E.; Alperovich, V. L.; Terekhov, A. S.

    2006-02-01

    The (1 1 1)A and (1 1 1)B surfaces of GaAs chemically treated in HCl-isopropanol solution (HCl-iPA) and annealed in vacuum were studied by means of X-ray photoelectron spectroscopy (XPS), low-energy electron diffraction (LEED) and electron energy loss spectroscopy (EELS). To avoid uncontrolled contamination, chemical treatment and sample transfer into UHV were performed under pure nitrogen atmosphere. The HCl-iPA treatment removes gallium and arsenic oxides, with about 0.5-3 ML of elemental arsenic being left on the surface, depending on the crystallographic orientation. With the increase of the annealing temperature, a sequence of reconstructions were identified by LEED: (1 × 1) and (2 × 2) on the (1 1 1)A surface and (1 × 1), (2 × 2), (1 × 1), (3 × 3), (√19 × √19) on the (1 1 1)B surface. These sequences of reconstructions correspond to the decrease of surface As concentration. The structural properties of chemically prepared GaAs(1 1 1) surfaces were found to be similar to those obtained by decapping of As-capped epitaxial layers.

  4. 1 CFR 21.1 - Drafting.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Drafting. 21.1 Section 21.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL, AND PROCESSING OF DOCUMENTS PREPARATION OF DOCUMENTS SUBJECT TO CODIFICATION General § 21.1 Drafting. (a) Each agency that prepares...

  5. 1 CFR 15.1 - Cooperation.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Cooperation. 15.1 Section 15.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL, AND PROCESSING OF DOCUMENTS SERVICES TO FEDERAL AGENCIES General § 15.1 Cooperation. The Director of the Federal...

  6. Reference: SITE1SORPS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SITE1SORPS1 Villain P, Clabault G, Mache R, Zhou DX S1F binding site is related to ...but different from the light-responsive GT-1 binding site and differentially represses the spinach rps1 prom

  7. Alpha-1 Antitrypsin Test

    Science.gov (United States)

    ... helpful? Also known as: Alpha 1 -antitrypsin; A1AT; AAT Formal name: Alpha 1 Antitrypsin; α1-antitrypsin Related ... know? How is it used? Alpha-1 antitrypsin (AAT) testing is used to help diagnose alpha-1 ...

  8. KINERJA KATALIS Ag/Al2O3 UNTUK REDUKSI NOx

    Directory of Open Access Journals (Sweden)

    Rakhman Sarwono

    2012-02-01

    Full Text Available NOx merupakan hasil samping dari suatu reaksi pembakaran. NOx merupakan gas yang beracun sangat berbahaya terhadap kesehatan manusia dan hewan bila terhirup pada waktu bernafas. Untuk mengurangi kadar NOx pada gas buang, banyak penelitian diarahkan pada reduksi NOx dengan katalis secara selektif dengan hidrokarbon dan oksigen berlebihan. Katalis yang digunakan adalah katalis alumina (Al2O3 yang didapat dari katalis komersial (AlO1-7 dan katalis hasil sintesa (ALOA. Katalis Ag/Al2O3 didapat dengan memasukkan logam Ag ke dalam alumina (Al2O3 dengan cara impregnasi dengan larutan perak nitrat. Katalis diuji aktifitasnya pada reaktor fixed bed yang diluarnya terdapat pemanas yang bisa diatur suhunya. Reaktan seperti gas NO, C2H4  dan oksigen dimasukkan kedalam reaktor dengan laju yang ditentukan. Hasil reaksi dianalisa dengan gas chromatography dan dicatat pada recorder, selanjutnya bisa ditentukan kuantitas dan prosentase konversinya. Katalis alumina  ALOA mempunyai kemampuan mereduksi NO dengan konversi  sekitar 40-45% gas NO menjadi N2. Loading logam perak (Ag kedalam Al2O3 sebesar 2-3% berat menambah daya reduksi NO menjadi sekitar 45-50% pada suhu 500oC. Pada umpan NO + C2H4  + O2  reaksi reduksi terjadi pada suhu 300oC, sedangkan pada umpan NO + C2H4   (tanpa oksigen reaksi reduksi baru terjadi pada suhu 450oC, dengan demikian adanya oksigen sangat berperan dalam proses reduksi NOx. Reaksi peruraian C2H4 menjadi COx berkebalikan dengan kinerja katalis pada proses reduksi NOx

  9. G18.95-1.1

    International Nuclear Information System (INIS)

    New radio continuum and spectral line observations of the Galactic radio source G18.95-1.1 are reported. The distance to G18.95-1.1 is 2 kpc as derived from HI-21 cm spectral line observations. These data also indicate an interaction with the interstellar medium. The radio continuum observations classify G18.95-1.1 as a composite supernova remnant

  10. Main: 1UD1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1UD1 大豆 Soybean Glycine max (L.) Merrill Glycinin G1 Precursor [Contains: Glycinin A1a Subunit ... Soybean Proglycinin Mutants C12g And C88s. J.Agric.Food ... Chem; V. 51 4633 2003 Glycinin, Soybean, Trimer SW ...

  11. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1970-01-01

    The reaction of dipotassium 2-nitroethylene-1,1-dithiolate (III) with α-halogeno aldehydes or ketones leads to derivatives of 3-nitro-thiophene-2-thiols. These reactions proceed by an acid catalyzed cyclization of the initially formed 1-(acylmethylthio)-2-nitroethylene-1-thiolates (IV). The infra...

  12. Reference: L1BOXATPDF1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1BOXATPDF1 Abe M, Takahashi T, Komeda Y Identification of a cis-regulatory element for L1 la...yer-specific gene expression, which is targeted by an L1-specific homeodomain protein Plant J 26: 487-494 (2001) PubMed: 11439135; ...

  13. Superconformal SU(1,1|n) mechanics

    CERN Document Server

    Galajinsky, Anton

    2016-01-01

    Recent years have seen an upsurge of interest in dynamical realizations of the superconformal group SU(1,1|2) in mechanics. Remarking that SU(1,1|2) is a particular member of a chain of supergroups SU(1,1|n) parametrized by an integer n, here we begin a systematic study of SU(1,1|n) multi-particle mechanics. A representation of the superconformal algebra su(1,1|n) is constructed on the phase space spanned by m copies of the (1,2n,2n-1) supermultiplet. We show that the dynamics is governed by two prepotentials V and F, and the Witten-Dijkgraaf-Verlinde-Verlinde equation for F shows up as a consequence of a more general fourth-order equation. All solutions to the latter in terms of root systems reveal decoupled models only. An extension of the dynamical content of the (1,2n,2n-1) supermultiplet by angular variables in a way similar to the SU(1,1|2) case is problematic.

  14. Ammonium 1-ammonioethane-1,1-diylbis(hydrogenphosphonate dihydrate

    Directory of Open Access Journals (Sweden)

    V. I. Pekhnyo

    2008-12-01

    Full Text Available The title compound, NH4+·C2H8NO6P2−·2H2O, was obtained by the reaction between 1-aminoethane-1,1-diyldiphosphonic acid and ammonium hydroxide (1:1 in an aqueous solution. The asymmetric unit contains one anion with two H atoms transferred from the phosphonic acid groups to the amino group of the anion and to an ammonia molecule, giving an ammonium cation. The structure displays N—H...O and O—H...O hydrogen bonding, which creates a three-dimensional network.

  15. Põhja-Korea lubas taas jätta tuumaplaanid / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2007-01-01

    Pekingis toimunud kuuepoolsete desarmeerimiskõneluste tulemusena on Põhja-Korea nõus andma ülevaate riigi tuumarajatistest ning alustama nende likvideerimist. 14. juulil suleti Yongbyoni tuumakeskuse reaktor. Lisa: Tuumavaidlus

  16. Adamkus : EU might be willing to negotiate on postponing Ignalina reactor closure

    Index Scriptorium Estoniae

    2008-01-01

    President Valdas Adamkus teatas võimalusest, et EL alustab arutelu Ignalina tuumaelektrijaama sulgemise edasilükkamisest. Uue jaama valmimise aeg pole teada ning praegune reaktor on tänu rootslaste abile turvaline

  17. SRAC calculation for TRR-1/M1 1st core

    International Nuclear Information System (INIS)

    The Thai Research Reactor 1/Modification 1 (TRR-1/M1) was modified from the Thai Research Reactor in order to reduce the enrichment of uranium content (U-235) fuel from 90 wt-% to LEU 8.5 and 20 wt-%. The modified reactor core was changed from rectangular core shape, plate type (MTR) to cylindrical core shape with rod type (UZrH). The purposes of operation are training, nuclear fundamental and application researches e.g. neutron radiography, neutron activation analysis etc. and medical ratio isotope production. The maximum operation power is 2.0 MW correspond to 4x1013 neutron flux density in the central irradiation hole. This report describes the calculation by using SRAC computer code for TRR-1/M1 at the beginning stage of operation. (author)

  18. Technetium (tin) ethane-1-hydroxy-1, 1-diphosphonate complexes

    International Nuclear Information System (INIS)

    The aim of this thesis is to establish the experimental conditions for the optimal preparation of the sup(99m)Tc(Sn)EHDP bone scanning agent. The pH and the concentrations of EHDP (ethane-1-hydroxy-1,1-disodium diphosphonate) and of Sn(II) may affect the yield and the biodistribution of the radiopharmacon. The investigation of the influence of these parameters is the subject of this investigation. (Auth.)

  19. 1-domination of knots

    OpenAIRE

    Boileau, Michel; Boyer, Steven; Rolfsen, Dale; Wang, Shicheng

    2015-01-01

    We say that a knot $k_1$ in the $3$-sphere {\\it $1$-dominates} another $k_2$ if there is a proper degree 1 map $E(k_1) \\to E(k_2)$ between their exteriors, and write $k_1 \\ge k_2$. When $k_1 \\ge k_2$ but $k_1 \

  20. XBZ1, XBJ1 Intelligent Transformer Substation

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    After conducting in-depth studies on and making improvements to the operational conditions of the current transformer substation, the advanced technology of the XBZ1 intelligent transformer substation and XBJ1 pre-installed transformer

  1. Multivariate COGARCH(1,1) processes

    OpenAIRE

    Stelzer, Robert

    2010-01-01

    Multivariate $\\operatorname {COGARCH}(1,1)$ processes are introduced as a continuous-time models for multidimensional heteroskedastic observations. Our model is driven by a single multivariate L\\'{e}vy process and the latent time-varying covariance matrix is directly specified as a stochastic process in the positive semidefinite matrices. After defining the $\\operatorname {COGARCH}(1,1)$ process, we analyze its probabilistic properties. We show a sufficient condition for the existence of a st...

  2. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1972-01-01

    A series of thieno[3,2-e]-3,4-dihydro-1,2,3-triazin-4-ones (V) and thieno[3,4-e]-3,4-dihydro-1,2,3-triazin-4-ones (VI) were prepared by diazotation of 3-aminothiophene-2-carboxamides (III) and 4-amino-thiophene-3-carboxamides (IV), respectively, both obtained by cyclization of 2-cyanoethylene-1,1...

  3. TRR-1/M1 reactor pool refurbishment

    International Nuclear Information System (INIS)

    The pool refurbishment of the TRR-1/M1 is intended to maintain the pool and irradiation facilities in the operable condition prior to the next decade before making decision whether the reactor will be shutdown and decommissioning or used for other purposes. What ever reason the TRR-1/M1 will serve as a training tool for scientists or engineers, and isotopes production or other analytical works for a period of time until the new research reactor will be established. (orig.)

  4. Katalytische Abluftreinigung : verfahrenstechnische Aufgaben und neue Lösungen

    OpenAIRE

    Eigenberger, Gerhart; Nieken, Ulrich

    1991-01-01

    Neue Verfahren der katalytischen Abluftreinigung mit im Reaktor integriertem regenerativem Wärmeaustausch erlauben die autotherme Abluftreinigung bis zu Schadstoffkonzentrationen entsprechend einer adiabaten Temperaturerhöhung von weniger als 20°C. Bei höheren Konzentrationen erlaubt ein Mittenabzug die nahezu vollständige Auskopplung der Verbrennungswärme auf dem höchsten im Reaktor vorliegenden Temperaturniveau. Infolge der Rückkopplung durch den integrierten Wärmeaustausch besitzt der Ablu...

  5. Kinetische Untersuchungen zur Methanol-Dampfreformierung am PdZn/ZnO-Katalysatorsystem

    OpenAIRE

    Kölbl, Andreas

    2004-01-01

    In dieser Arbeit wird eine neuartige Strömungsapparatur mit Mikrostrukturreaktor vorgestellt. Diese erlaubt katalytische Experimente in einem großen Druckbereich. Verschiedene Dosierungskonzepte zur Realisierung kleiner Reaktandenpartialdrücke im Reaktor werden diskutiert. Es wird gezeigt und experimentell verifiziert, dass durch die Teilung des generierten Eduktstroms und eine Teildosierung durch Kapillaren in den Reaktor im Vergleich zu klassischen Methoden wie der zusätzlichen Dosierung vo...

  6. Trockenharnstoff-SCR-System und Betriebsstrategie für Fahrzeuge mit Dieselmotor

    OpenAIRE

    Käfer, Sebastian

    2004-01-01

    Es wurde ein fahrzeugtaugliches SCR-Gesamtsystem auf der Basis von trockenem Harnstoff dargestellt, bei dem die Reduktionsmittelaufbereitung in einem elektrisch beheizten Reaktor erfolgt. Trockener Harnstoff bietet gegenüber der wässrigen Harnstofflösung eine Gewichtsersparnis von 67,5% und eine uneingeschränkte Wintertauglichkeit. Im externen Reaktor wird der Harnstoff unter stets optimalen Reaktionsbedingungen zersetzt. Der Harnstoff wird in Form von runden Pellets in einem Größenspektrum v...

  7. Reference: TEF1BOXATA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available TEF1BOXATA1 Regad F, Herve C, Marinx O, Bergounioux C, Tremousaygue D, Lescue B The tef1 box, a ... vation of plant genes that are highly expressed in cycling ... cells Mol. Gen. Genet. 248: 703-711 (1995) PubMed: ...

  8. Main: TEF1BOXATA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available TEF1BOXATA1 S000311 7-Sep-2000 (last modified) seki tef1 box found in the Arabidopsis (A.t.) EF- ... ctivation of plant genes that are overexpressed in cycling ... cells; Conserved in the promoters of genes for pro ...

  9. Current Status of TRR-1/M1

    Energy Technology Data Exchange (ETDEWEB)

    Sittichai, Chaiyut [Reactor Operation Division, Office of Atomic Energy for Peace, Bangkok (Thailand)

    2000-10-01

    In 1961, the first Thai Research Reactor, TRR-1, having power of 1 MW was established. It was located at Office of Atomic Energy for Peace (OAEP) in Bangkok. TRR-1 was completely commissioned in June 1962. Plate typed high-enriched uranium (HEU) and U{sub 3}O{sub 8}-Al were used as fuel. Light water used as moderator and coolant. During 1975-1977, TRR-1 was shut down for modification. The reactor core and control system were disassembled and replaced by TRIGA Mark III. It is a circular hexagonal core typed reactor designed by General Atomics Company (GA). Afterwards, TRR-1 was officially renamed to Thai Research Reactor 1/Modification 1 (TRR-1/M1). TRR-1/M1 is a multipurpose reactor with nominal power of 2 MW. This swimming pool typed reactor uses low-enriched uranium (LEU) as fuel and light water as coolant and moderator. To date, the reactor has been operated with core No.12 that released power 1135 MWD to serve the user. The reactor has been serving for various kinds of utilization, for example, to produce radioisotope, neutron beam experiments and reactor physics experiments. This report explains in detail regarding operational experience and current status of this reactor, for example, reactor operation and reactor utilization. (author)

  10. Current Status of TRR-1/M1

    International Nuclear Information System (INIS)

    In 1961, the first Thai Research Reactor, TRR-1, having power of 1 MW was established. It was located at Office of Atomic Energy for Peace (OAEP) in Bangkok. TRR-1 was completely commissioned in June 1962. Plate typed high-enriched uranium (HEU) and U3O8-Al were used as fuel. Light water used as moderator and coolant. During 1975-1977, TRR-1 was shut down for modification. The reactor core and control system were disassembled and replaced by TRIGA Mark III. It is a circular hexagonal core typed reactor designed by General Atomics Company (GA). Afterwards, TRR-1 was officially renamed to Thai Research Reactor 1/Modification 1 (TRR-1/M1). TRR-1/M1 is a multipurpose reactor with nominal power of 2 MW. This swimming pool typed reactor uses low-enriched uranium (LEU) as fuel and light water as coolant and moderator. To date, the reactor has been operated with core No.12 that released power 1135 MWD to serve the user. The reactor has been serving for various kinds of utilization, for example, to produce radioisotope, neutron beam experiments and reactor physics experiments. This report explains in detail regarding operational experience and current status of this reactor, for example, reactor operation and reactor utilization. (author)

  11. PD-1/PD-L1 inhibitors.

    Science.gov (United States)

    Sunshine, Joel; Taube, Janis M

    2015-08-01

    Tumors may adopt normal physiologic checkpoints for immunomodulation leading to an imbalance between tumor growth and host surveillance. Antibodies targeting the PD-1/PD-L1 checkpoint have shown dynamic and durable tumor regressions, suggesting a rebalancing of the host-tumor interaction. Nivolumab and pembrolizumab are the anti-PD-1 antibodies that are currently the furthest in clinical development, and anti-PD-L1 agents under investigation include MPDL3280A, MEDI4736, and BMS-936559. These agents have been used to treat advanced melanoma, non-small cell lung cancer, renal cell carcinoma, bladder cancer and Hodgkin lymphoma, amongst other tumor types. In this article, we review the updated response results for early clinical trials, note recent FDA actions regarding this class of agents, and summarize results across trials looking at PD-L1 status as a predictor of response to anti-PD-1/PD-L1. PMID:26047524

  12. Cuba vs H1N1 Influenza

    Directory of Open Access Journals (Sweden)

    Gail Reed

    2011-04-01

    Full Text Available El Comité Editorial de MediSur agradece a Gail Reed, editora de Medicc Review la autorización expresa, para reproducir el artículo titulado “Cuba vs H1N1 Influenza”. Este trabajo resume el esfuerzo realizado por todos los organismos en Cuba y en especial el Ministerio de Salud Pública en la lucha para disminuir los efectos de la influenza H1N1 en la población. El artículo original se puede encontrar en: Reed G. Faceoff: Cuba vs H1N1 Influenza. MEDICC Review. 2010; 12(1:6-12. Disponible en: http://www.medicc.org/mediccreview/index.php?issue=11

  13. Cuba vs H1N1 Influenza

    Directory of Open Access Journals (Sweden)

    Gail Reed

    2011-04-01

    Full Text Available El Comité Editorial de MediSur agradece a Gail Reed, editora de Medicc Review la autorización expresa, para reproducir el artículo titulado “Cuba vs H1N1 Influenza”. Este trabajo resume el esfuerzo realizado por todos los organismos en Cuba y en especial el Ministerio de Salud Pública en la lucha para disminuir los efectos de la influenza H1N1 en la población. El artículo original se puede encontrar en: Reed G. Faceoff: Cuba vs H1N1 Influenza. MEDICC Review. 2010; 12(1:6-12. Disponible en: http://www.medicc.org/mediccreview/index.php?issue=11

  14. Efek Durasi Pencahayaan Pada Sistem HRAR Untuk Menurunkan Kandungan Minyak Solar Dalam Air Limbah

    Directory of Open Access Journals (Sweden)

    Dian Puspitasari

    2014-09-01

    Full Text Available Kandungan minyak di dalam air limbah industri perminyakan umumnya bersifat toksik terhadap mikroorganisme dan mengganggu proses pengolahan secara biologis. Sistem HRAR diperkirakan dapat mengatasi hambatan tersebut melalui proses fotosintesis untuk menghasilkan oksigen yang dibutuhkan mikroorganisme dalam mendegradasi senyawa hidrokarbon. Penelitian ini bertujuan mengkaji pengaruh perpanjangan waktu pencahayaan pada kemampuan HRAR dalam menurunkan kandungan minyak di dalam limbah. Variabel yang digunakan pada penelitian ini adalah variasi durasi pencahayaan dan variasi penambahan volume minyak solar yang ditambahkan ke dalam reaktor. Variasi durasi pencahayaan yang digunakan adalah pencahayaan selama 12 jam dan pencahayaan selama 24 jam. Sedangkan penambahan volume minyak solar ke dalam masing-masing reaktor adalah sebesar 346 ppm, 519 ppm dan 692 ppm. Hasil yang didapatkan dari penelitian ini adalah durasi pencahayaan selama 12 jam memiliki efek yang lebih baik terhadap penurunan konsentrasi minyak dibandingkan pencahayaan selama 24 jam. Hal ini dapat terlihat dari baiknya pertumbuhan alga dan bakteri di dalam reaktor serta tingginya penurunan konsentrasi minyak solar di dalamnya. Penurunan konsentrasi minyak solar terbaik terdapat pada reaktor dengan penambahan minyak solar sebesar 346 ppm. Pada reaktor dengan durasi pencahayaan selama 12 jam terjadi penurunan konsentrasi minyak sebesar 78,4%. Sedangkan penurunan kandungan minyak solar pada reaktor dengan durasi pencahayaan selama 24 jam adalah sebesar 73,9%.

  15. Multivariate COGARCH(1,1) processes

    CERN Document Server

    Stelzer, Robert

    2010-01-01

    Multivariate $\\operatorname {COGARCH}(1,1)$ processes are introduced as a continuous-time models for multidimensional heteroskedastic observations. Our model is driven by a single multivariate L\\'{e}vy process and the latent time-varying covariance matrix is directly specified as a stochastic process in the positive semidefinite matrices. After defining the $\\operatorname {COGARCH}(1,1)$ process, we analyze its probabilistic properties. We show a sufficient condition for the existence of a stationary distribution for the stochastic covariance matrix process and present criteria ensuring the finiteness of moments. Under certain natural assumptions on the moments of the driving L\\'{e}vy process, explicit expressions for the first and second-order moments and (asymptotic) second-order stationarity of the covariance matrix process are obtained. Furthermore, we study the stationarity and second-order structure of the increments of the multivariate $\\operatorname {COGARCH}(1,1)$ process and their "squares".

  16. Breast Cancer Susceptibility Gene1 (BRCA1

    Directory of Open Access Journals (Sweden)

    Wasiksiri, S.

    2002-07-01

    Full Text Available Breast Cancer Susceptibility Gene1 (BRCA1 is a tumor suppressor gene for breast and ovarian cancers. The gene locates at chromosome 17q21 and encodes for 1863 amino acids protein. It is believed that BRCA1 protein is involved in many functions such as DNA repair, centrosome replication, cell cycle checkpoint and replication of other genes. More than 800 mutations have been found in the population with an increased risk of cancer incidence in their families. Germ-line mutation of BRCA1 accounts for 5-10 percent of all breast cancer cases. Epigenetic modifications also reduce the function of normal BRCA1 gene. Several methods are used for laboratory diagnosis of cancer-related mutations. The development of breast cancer in carriers at risk with BRCA1 mutations may be prevented by suitable prevention plans such as breast cancer screening, ovarian cancer screening, surgery and cancer chemotherapy.

  17. Anion adsorption and atomic friction on Au(1 1 1)

    International Nuclear Information System (INIS)

    Highlights: ► Electrochemical lateral force microscopy on Au(1 1 1) in sulphuric and perchloric acid. ► Lateral forces at the atomic scale are sensitive to the adsorption state of anions. ► Friction changes at lower potentials than expected from cyclic voltammograms. ► Friction increases with normal load when sliding on specifically adsorbed anions. ► A dramatic increase in friction occurs upon electrochemical oxidation of the surface. - Abstract: The influence of anion adsorption on friction forces in an electrochemical environment has been studied by means of lateral force microscopy on Au(1 1 1) surfaces. Sensitivity to atomic stick-slip motion allows to reveal sulphate adsorption in ordered layers under the sliding tip at potentials lower than expected from cyclic voltammetry for the open surface. No ordered adsorption is found in lateral force measurements for the weakly adsorbed perchlorate anions. Correspondingly, some increase in friction in the anion adsorption regime is observed for sulphate but none for perchlorate adsorption. Friction increases significantly at the onset of oxidation in both sulphuric and perchloric acid solutions.

  18. Development of an improved methodology for the determination of the neutron load of the pressure vessel steel of WWER-1000 type reactors. Final report; Entwicklung einer fortgeschrittenen Methodik zur Bestimmung der Neutronenbelastung des Druckbehaeltermaterials vom Reaktor des Typs WWER-1000. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Barz, H.U.; Boehmer, B.; Konheiser, J.; Stephan, I.

    1998-05-01

    The investigations, reported on here, are aimed at the theoretical and experimental determination of the neutron exposure of the VVER-1000 reactors Balakovo-3 and Rovno-3. The overall approach, partially developed and at least improved in the frame of this project, comprises the pure calculation part, the gamma spectrometric analysis of neutron activation detectors and the comparison of experimental and theoretical results using the spectrum adjustment procedure. The approach is not restricted to neutron embrittlement but can be applied to neutron fluence problems in general. (orig./GL) [Deutsch] In diesem Projekt wurden fuer die WWER-1000 Reaktoren Balakovo-3 und Rovno-3 die Parameter der Neutronenbelastung experimentell und theoretisch bestimmt. Der vorliegende Bericht beschreibt das methodische Vorgehen, welches aus dem reinen Berechnungsteil, der gammaspektrometrischen Analyse der Ativierungsdetektoren und dem Vergleich der gemessenen und berechneten Werte einschliesslich der Spektrumsjustierung besteht. Dieses Instrumentarium, welches allgemein bei der Bestimmung der Neutronenfluenz anwendbar ist, wurde im Projektzeitraum weiter verbessert. (orig./GL)

  19. Density functional study of hypophosphite adsorption on Ni (1 1 1) and Cu (1 1 1) surfaces

    International Nuclear Information System (INIS)

    Surface structures and electronic properties of hypophosphite, H2PO2-, molecularly adsorbed on Ni(1 1 1) and Cu(1 1 1) surfaces are investigated in this work by density functional theory at B3LYP/6-31++g(d, p) level. We employ a four-metal-atom cluster as the simplified model for the surface and have fully optimized the geometry and orientation of H2PO2- on the metal cluster. Six stable orientations have been discovered on both Ni (1 1 1) and Cu (1 1 1) surfaces. The most stable orientation of H2PO2- was found to have its two oxygen atoms interact the surface with two P-O bonds pointing downward. Results of the Mulliken population analysis showed that the back donation from 3d orbitals of the transition metal substrate to the unfilled 3d orbital of the phosphorus atom in H2PO2- and 4s orbital's acceptance of electron donation from one lone pair of the oxygen atom in H2PO2- play very important roles in the H2PO2- adsorption on the transition metals. The averaged electron configuration of Ni in Ni4 cluster is 4s0.634p0.023d9.35 and that of Cu in Cu4 cluster is 4s1.004p0.033d9.97. Because of this subtle difference of electron configuration, the adsorption energy is larger on the Ni surface than on the Cu surface. The amount of charge transfers due to above two donations is larger from H2PO2- to the Ni surface than to the Cu surface, leading to a more positively charged P atom in Ni nH2PO2- than in Cu nH2PO2-. These results indicate that the phosphorus atom in Ni nH2PO2- complex is easier to be attacked by a nucleophile such as OH- and subsequent oxidation of H2PO2- can take place more favorably on Ni substrate than on Cu substrate

  20. VANDAL user guide. V. 1.1

    International Nuclear Information System (INIS)

    This document forms Volume 1.1 of the VANDAL User Guide and is intended to provide all the information necessary to define and run a case study. Information is given on the data to be specified, on the structure of the input data files and on how to execute the system. There are three related volumes to this, they are: Volume 1.2 - Input and Execution Appendices; Volume 2.1 - Ouput and Error Messages; and Volume 2.2 - PRA Output Analysis. (author)

  1. Growth of monocrystalline Cu(1 1 1) films on MgO(1 1 1) by pulsed laser deposition

    Energy Technology Data Exchange (ETDEWEB)

    Aweke, F.; Antoni, F. [ICube, Université de Strasbourg-CNRS(UMR 7357), 23 rue du Loess, 67037 Strasbourg (France); Hulik, J. [ICube, Université de Strasbourg-CNRS(UMR 7357), 23 rue du Loess, 67037 Strasbourg (France); Comenius University in Bratislava, Faculty of Mathematics, Physics and Informatics, Department of Experimental Physics, Mlynská dolina F2, 842 48 Bratislava (Slovakia); Morvan, G. [LHyGeS – Laboratoire d’Hydrologie et de Géochimie de Strasbourg, Université de Strasbourg-CNRS-EOST, 1 rue Blessing, 67084 Strasbourg (France); Speisser, C. [ICube, Université de Strasbourg-CNRS(UMR 7357), 23 rue du Loess, 67037 Strasbourg (France); Veis, P. [Comenius University in Bratislava, Faculty of Mathematics, Physics and Informatics, Department of Experimental Physics, Mlynská dolina F2, 842 48 Bratislava (Slovakia); Le Normand, F., E-mail: francois.le-normand@unistra.fr [ICube, Université de Strasbourg-CNRS(UMR 7357), 23 rue du Loess, 67037 Strasbourg (France)

    2015-05-01

    Copper (Cu) films with a minimal thickness of 300 nm were grown on MgO(1 1 1) substrates in high vacuum by pulsed laser deposition (PLD) at various temperatures to achieve a single crystal Cu film with flat terraces without grain boundaries. We investigated the effect of the substrate temperature, the pulse repetition rate, the deposition time and the laser fluence. A temperature threshold is observed above which the growth mode is changed from a uniform flat mode to a three dimensional mode. A combined process involving a germination step at moderate temperature followed by a growth step at higher temperature yields a 450 nm almost continuous film.

  2. Ciencias 1. (Science 1). [Student's Workbook].

    Science.gov (United States)

    Raposo, Lucilia

    Ciencias 1 is the first in a series of science books designed for elementary Portuguese-speaking students. The book contains five sections divided into 43 lessons. The five sections are (1) Matter, (2) The Human Body, (3) Weather, (4) Solids, Liquids, and Gases, and (5) Living Things. Pictorial presentations and picture exercises are included for…

  3. Expect Surprises with 1-to-1 Laptops

    Science.gov (United States)

    Tusch, Erich G.

    2012-01-01

    In 2004, prior to the launch of their 1-to-1 laptop program, the superintendent expressed some anxiety about the prospect of radically changing teaching and learning by issuing a laptop computer to every student and teacher. Although the concept was exciting, it carried big risks and would take time and thorough planning to execute well. Even with…

  4. General Relativity in (1 + 1) Dimensions

    Science.gov (United States)

    Boozer, A. D.

    2008-01-01

    We describe a theory of gravity in (1 + 1) dimensions that can be thought of as a toy model of general relativity. The theory should be a useful pedagogical tool, because it is mathematically much simpler than general relativity but shares much of the same conceptual structure; in particular, it gives a simple illustration of how gravity arises…

  5. Reference: L1BOXATPDF1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1BOXATPDF1 He nriksson E , Olsson AS, Johanne sson H, Johansson H, Hanson J, E ngstrom P, Sode rman ... E . Home odomain le ucine ... zippe r class I ge ne s in Arabidopsis ... . E xpre ssion patte rns and phyloge ne tic re ... Plant Physio ... l. 139: 509-518. (2005) PubMe d: 16055682 ...

  6. Main: 1TE1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1TE1 小麦 Bread Wheat Triticum aestivum Xylanase Inhibitor Protein I Precursor. Name=Xipi; Triti ... anzanares, H.J.Gilbert, N.Juge, A.Roussel The Dual Nature ... Of The Wheat Xylanase Protein Inhibitor Xip-I: Str ...

  7. 27 CFR 1.1 - General.

    Science.gov (United States)

    2010-04-01

    ... OF DISTILLED SPIRITS AND WINE, BULK SALES AND BOTTLING OF DISTILLED SPIRITS Scope § 1.1 General. (a... regulations in this part also specify what uses of distilled spirits and wine are “nonindustrial,” as that...), contains the substantive requirements relative to bulk sales and bottling of distilled spirits under...

  8. *170290 PERILIPIN 1; PLIN1 [OMIM

    Lifescience Database Archive (English)

    Full Text Available FIELD NO 170290 FIELD TI 170290 PERILIPIN 1; PLIN1 ;;PLIN FIELD TX DESCRIPTION Perilipin is a ho ... l mice, but had normal body weight. They were much lean er and more muscular than controls, had 62% smaller ... duced adipose mass. The null animals had a greater lean ... body mass and increased metabolic rate but they al ...

  9. #309500 RENPENNING SYNDROME 1; RENS1 [OMIM

    Lifescience Database Archive (English)

    Full Text Available FIELD NO 309500 FIELD TI #309500 RENPENNING SYNDROME 1; RENS1 ;;MENTAL RETARDATION, X-LINKED, RE ... characteristic phenotype, including microcephaly, lean ... body habitus, short stature, long and narrow facie ... ying from mild to moderate severity, microcephaly, lean ness, and mild short stature. Most had language del ...

  10. 33 CFR 1.08-1 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... criminal penalty procedures under subpart 1.07 of this part: (1) 46 CFR 25.05 whistles or other sound producing devices; (2) 33 CFR part 175, subpart B and 46 CFR subpart 25.25, Personal Flotation Devices. (3... fire extinguishers; (9) 33 CFR part 159 marine sanitation devices; (10) 33 CFR part 175 subpart...

  11. Antiviral Prophylaxis and H1N1

    Centers for Disease Control (CDC) Podcasts

    2011-07-14

    Dr. Richard Pebody, a consultant epidemiologist at the Health Protection Agency in London, UK, discusses the use of antiviral post-exposure prophylaxis and pandemic H1N1.  Created: 7/14/2011 by National Center for Emerging Zoonotic and Infectious Diseases (NCEZID).   Date Released: 7/18/2011.

  12. CHARICE version 1.1 update.

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Jean-Paul

    2008-10-01

    CHARICE (CHARacteristics-based inverse analysis of Isentropic Compression Experiments) is a computer application, previously documented in SAND2007-4948, that analyzes velocity waveform data from ramp-wave experiments to determine a material's quasi-isentropic loading response in stress and density using an iterative characteristics-based approach. This short report documents only the changes in CHARICE release version 1.1 relative to release version 1.0, and is not intended to stand alone. CHARICE version 1.1 corrects an error in the algorithm of the method, fixes several bugs, improves robustness and performance, provides more useful error descriptions, and adds a number of minor features.

  13. Main: AMMORESVDCRNIA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMMORESVDCRNIA1 S000376 31-Jul-2001 (last modified) uchi Motif (VD) found in the Chlamydomonas (C.R.) Nia...1 gene promoter; Located between -33 and -8; Involved in Nia1 transcription activation

  14. Main: AMMORESIVDCRNIA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMMORESIVDCRNIA1 S000375 31-Jul-2001 (last modified) uchi Motif (IVD) found in the Chlamydomonas (C.R.) Nia...1 gene promoter; Located between -51 and -42; Involved in Nia1 transcription repress

  15. *609850 TBC1 DOMAIN FAMILY, MEMBER 1; TBC1D1 [OMIM

    Lifescience Database Archive (English)

    Full Text Available FIELD NO 609850 FIELD TI 609850 TBC1 DOMAIN FAMILY, MEMBER 1; TBC1D1 ;;KIAA1108 FIELD TX DESCRIP ... o obesity, see BMIQ7 (608410). ANIMAL MODEL In the lean ... Swiss Jim Lambert (SJL) strain of obesity-resistan ... .; Joost, H.-G.; Al-Hasani, H.: Tbc1d1 mutation in lean ... mouse strain confers lean ness and protects from di ...

  16. Main: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available IDRSZMFER 1 S000445 04-August-2006 (last modified) kehi IDRS (Iron-Dependent Regulatory Sequence) ... found in maize and Arabidopsis fer ritin genes (Fer 1); IDRS is responsible for transcr ... iptional repression of ZmFer 1 gene under low iron supply conditions; S=C/G; K=G ... of the AtAPX1 gene (Fourcroy et al., 2004); iron; fer ritin; APX1; AtFer 1; Fer ; Zea mays (maize); Arabido ...

  17. G1SST, 1km blended SST

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A daily, global Sea Surface Temperature (SST) data set is produced at 1-km (also known as ultra-high resolution) by the JPL ROMS (Regional Ocean Modeling System)...

  18. Conductors and Newforms for (1,1)

    Indian Academy of Sciences (India)

    Joshua Lansky; A Raghuram

    2004-11-01

    Let be a non-Archimedean local field whose residue characteristic is odd. In this paper we develop a theory of newforms for (1,1)(), building on previous work on $SL_2(F)$. This theory is analogous to the results of Casselman for $GL_2(F)$ and Jacquet, Piatetski-Shapiro, and Shalika for $GL_n(F)$. To a representation π of (1,1)(), we attach an integer () called the conductor of , which depends only on the -packet containing . A newform is a vector in which is essentially fixed by a congruence subgroup of level ()$. We show that our newforms are always test vectors for some standard Whittaker functionals, and, in doing so, we give various explicit formulae for newforms.

  19. Cytokine-like factor-1 (CLF-1)

    DEFF Research Database (Denmark)

    Larsen, Jakob Vejby; Kristensen, Anders Mejer; Pallesen, Lone Tjener; Bauer, Johannes; Vægter, Christian Bjerggaard; Nielsen, Morten Schallburg; Madsen, Peder; Petersen, Claus Munck

    2016-01-01

    -Crisponi or cold-induced sweating syndrome and have a high risk of early death. It is well known that CLC binds the CNTFRα and is a prerequisite for signalling through the gp130/LIFRβ heterodimer, whereas CLF-1 serves to promote the cellular release of CLC. However, the precise role of CLF-1 is unclarified...... establishes a link between the endocytic receptor sorLA and the tripartite CLC:CLF-1:CNTFRα complex, and allows sorLA to down-regulate the CNTFRα-pool in stimulated cells. Finally, sorLA may bind and concentrate the tripartite soluble CLC:CLF-1:CNTFRα complex on cell membranes and thus facilitate its...

  20. 7 CFR 301.1-1 - Definitions.

    Science.gov (United States)

    2010-01-01

    .... Interstate commerce. Trade, traffic, or other commerce (1) From one State into or through any other State or... interests of agriculture, irrigation, navigation, the natural resources of the United States, the...

  1. SPARK Version 1.1 user manual

    International Nuclear Information System (INIS)

    This manual describes the input required to use Version 1.1 of the SPARK computer code. SPARK 1.1 is a library of FORTRAN main programs and subprograms designed to calculate eddy currents on conducting surfaces where current flow is assumed zero in the direction normal to the surface. Surfaces are modeled with triangular and/or quadrilateral elements. Lorentz forces produced by the interaction of eddy currents with background magnetic fields can be output at element nodes in a form compatible with most structural analysis codes. In addition, magnetic fields due to eddy currents can be determined at points off the surface. Version 1.1 features eddy current streamline plotting with optional hidden-surface-removal graphics and topological enhancements that allow essentially any orientable surface to be modeled. SPARK also has extensive symmetry specification options. In order to make the manual as self-contained as possible, six appendices are included that present summaries of the symmetry options, topological options, coil options and code algorithms, with input and output examples. An edition of SPARK 1.1 is available on the Cray computers at the National Magnetic Fusion Energy Computer Center at Livermore, California. Another more generic edition is operational on the VAX computers at the Princeton Plasma Physics Laboratory and is available on magnetic tape by request. The generic edition requires either the GKS or PLOT10 graphics package and the IMSL or NAG mathematical package. Requests from outside the United States will be subject to applicable federal regulations regarding dissemination of computer programs. 22 refs

  2. SPARK Version 1. 1 user manual

    Energy Technology Data Exchange (ETDEWEB)

    Weissenburger, D.W.

    1988-01-01

    This manual describes the input required to use Version 1.1 of the SPARK computer code. SPARK 1.1 is a library of FORTRAN main programs and subprograms designed to calculate eddy currents on conducting surfaces where current flow is assumed zero in the direction normal to the surface. Surfaces are modeled with triangular and/or quadrilateral elements. Lorentz forces produced by the interaction of eddy currents with background magnetic fields can be output at element nodes in a form compatible with most structural analysis codes. In addition, magnetic fields due to eddy currents can be determined at points off the surface. Version 1.1 features eddy current streamline plotting with optional hidden-surface-removal graphics and topological enhancements that allow essentially any orientable surface to be modeled. SPARK also has extensive symmetry specification options. In order to make the manual as self-contained as possible, six appendices are included that present summaries of the symmetry options, topological options, coil options and code algorithms, with input and output examples. An edition of SPARK 1.1 is available on the Cray computers at the National Magnetic Fusion Energy Computer Center at Livermore, California. Another more generic edition is operational on the VAX computers at the Princeton Plasma Physics Laboratory and is available on magnetic tape by request. The generic edition requires either the GKS or PLOT10 graphics package and the IMSL or NAG mathematical package. Requests from outside the United States will be subject to applicable federal regulations regarding dissemination of computer programs. 22 refs.

  3. Curative establishments - spas; 1 : 1 500 000

    International Nuclear Information System (INIS)

    Slovakia has got an enormous developmental potential of spa and balneological activities if the number and abundance mineral and thermal springs is taken into account. The same is true of the climatological conditions, which are ideal for therapeutic purposes. This potential is not sufficiently exploited. There are 22 spas with 1,600 beds available in their facilities. Two beds in spa facilities correspond to 1,000 inhabitants in Slovakia compared to 10 beds in the European Union countries. (author)

  4. 1-Benzyl-1H-benzotriazole 3-oxide–1-hydroxy-1H-benzotriazole (1/1

    Directory of Open Access Journals (Sweden)

    P. Selvarathy Grace

    2012-08-01

    Full Text Available In the title compound, C6H5N3O·C13H11N3O, the benzotriazole ring system in the 1-benzyl-1H-benzotriazole 3-oxide (A molecule is close to being planar (r.m.s. deviation = 0.011 Å; its mean plane forms a dihedral angle of 67.56 (7° with that of the attached phenyl ring. The benzotriazole ring system in the 1-hydroxybenzotriazole (B molecule is also close to being planar (r.m.s. deviation = 0.010 Å. In the crystal, weak C—H...O and C—H...π interactions are present. The A and B molecules are linked by an O—H...N hydrogen bond.

  5. Main: ZDNAFORMINGATCAB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ZDNAFORMINGATCAB1 S000321 13-August-2005 (last modified) kehi Z-DNA-forming sequenc...t redundantly to induce Z-box containing promoters in white light; cab1; light; Z-DNA; leaf; shoot; HY5; COP1; LRE; Z-box; ZBF1; Z-box binding factor; Arabidopsis thaliana ATACGTGT ...

  6. Phosphanucleosides containing 1-hydroxymethylphospholane 1-oxide ring

    Czech Academy of Sciences Publication Activity Database

    Páv, Ondřej; Zborníková, Eva; Buděšínský, Miloš; Rosenberg, Ivan

    Praha : Institute of Organic Chemistry and Biochemistry AS CR, v. v. i, 2014 - (Hocek, M.), s. 344-345 ISBN 978-80-86241-50-0. - (Collection Symposium Series. 14). [Symposium on Chemistry of Nucleic Acid Components /16./. Český Krumlov (CZ), 08.06.2014-13.06.2014] R&D Projects: GA ČR GA13-26526S; GA ČR GA13-24880S; GA TA ČR TA03010598 Institutional support: RVO:61388963 Keywords : phosphanucleosides * 1-hydroxymethylphospholane 1-oxide ring * biological activity Subject RIV: CC - Organic Chemistry

  7. Byron Unit 1 Cycle 1 benchmark

    International Nuclear Information System (INIS)

    Commonwealth Edison Company (CECo) received NRC approval to perform neutronic analyses in support of its PWR reload design in 1983. To date these neutronic reload analyses have been performed only for the Zion units. In preparation for the first reload designs for the Byron reactors, CECo has embarked on a program to compare CECo's predictions to Byron Unit 1 Cycle 1 hot zero power startup physics measurements. Program results show good agreement between measured and predicted values for the following key neutronic parameters: boron endpoints, rod worths, isothermal temperature coefficients, and power distributions

  8. 1-Phenyl-3-(pyren-1-ylprop-2-en-1-one

    Directory of Open Access Journals (Sweden)

    Jiannian Yao

    2008-03-01

    Full Text Available The title compound, C25H16O, was prepared by the condensation reaction of pyrene-1-carbaldehyde and acetophenone in ethanol solution at room temperature. The phenyl ring forms a dihedral angle of 39.10 (11° with the pyrene ring system. In the crystal structure, adjacent pyrene ring systems are linked by aromatic π–π stacking interactions, with a perpendicular interplanar distance of 3.267 (6 Å and a centroid–centroid offset of 2.946 (7 Å.

  9. Sphingosine 1-Phosphate Receptor 1 (S1P1) Upregulation and Amelioration of Experimental Autoimmune Encephalomyelitis by an S1P1 Antagonist

    OpenAIRE

    Cahalan, Stuart M.; Gonzalez-Cabrera, Pedro J.; Nguyen, Nhan; Guerrero, Miguel; Cisar, Elizabeth A. George; Leaf, Nora B.; Brown, Steven J.; Roberts, Edward; Rosen, Hugh

    2013-01-01

    Sphingosine 1-phosphate receptor 1 (S1P1) is a G protein–coupled receptor that is critical for proper lymphocyte development and recirculation. Agonists to S1P1 are currently in use clinically for the treatment of multiple sclerosis, and these drugs may act on both S1P1 expressed on lymphocytes and S1P1 expressed within the central nervous system. Agonists to S1P1 and deficiency in S1P1 both cause lymphocyte sequestration in the lymph nodes. In the present study, we show that S1P1 antagonism ...

  10. Main: 1XQ1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available cs (Cesg) Center For Eukaryotic Structural Genomics X-Ray Structure Of Putative T...E; PS00061; ADH_SHORT; 1. X-Ray Diffraction, Resolution: 2.10 Angstrom, R-Factor: 0.255, R-Free: 0.316 Lengt

  11. 26 CFR 1.801-1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... than life. (b) Insurance companies. (1) Insurance companies include both stock and mutual companies, as well as mutual benefit insurance companies. A voluntary unincorporated association of employees formed... insurance company, whether the fund for such purpose is created wholly by membership dues or partly...

  12. 26 CFR 1.508-1 - Notices.

    Science.gov (United States)

    2010-04-01

    ... requirement of filing notice under section 508(a) will be exempt from taxation under section 501(c)(3) if it... subparagraph (2) of this paragraph No organization shall be exempt from taxation under section 501(a) by reason...) Filing of notice. (i) For purposes of subparagraph (1) of this paragraph, except as provided...

  13. Annual report 2002. 1.1.-21.1.2002

    International Nuclear Information System (INIS)

    In this Annual report of the Slovak Electric, plc (Slovenske elektrarne, a.s.) the results of operation in 2002 for the period from January 1 to January 21 are presented. It is unusual for a year to be considered as a matter of a few days, however, this is the case given the events at Slovak Electric, joint stock company which as of 21. 1. 2002 was dissolved and from which three new joint stock companies were established. Further proof of this is the annual report for 2002, which details the economic performance of the company during these 21 days, and the quantity of electricity and heat it generated and supplied to consumers. I am pleased to be able to state that this period of far-reaching changes during which the division of Slovak Electric, joint stock company into the new Slovak Electric, joint stock company, Slovak Electricity Transmission System, joint stock company and Heat Plant Kosice, joint stock company took place, did not cause any problems for Slovak consumers of electricity and heat. During the mentioned 21 January days of 2002, the sources of Slovak Electric generated 836,751 MWh of electricity, which represents 107 percent of the planned generation. The net profit for this period was 742,920 thousand crowns, the main influence being, of course, its short duration. As our economists have confirmed, the most important fact with a significant impact on net profit can be considered to be the amount of deferred taxes, which totalled 1,026,789 thou. Sk. With respect to the dissolution of the company, the company will apply 50 % tax depreciation from annual depreciation, which will, however, be reflected in the results of the newly established company - SE, a.s., as in the subsequent 344 day period its tax deductible depreciation will fall. It is clear that in the forthcoming period, in addition to this, many financial issues remain to be resolved by the management connected with the new form of the business, price, and management relationships within

  14. Main: ABADESI1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABADESI1 S000007 10-Feb-2000 (last modified) seki Responsive to ABA and desiccation; Motif I of ... s; Induced by ABA and osmotic stress in vegetative tissues ; Contains ACGT motif; transacting factor: TAF-1; r ...

  15. A1C test

    Science.gov (United States)

    HbA1C test; Glycated hemoglobin test; Glycosylated hemoglobin test; Hemoglobin glycosylated test; Glycohemoglobin test ... have recently eaten does not affect the A1C test, so you do not need to fast to ...

  16. Vitamin B1

    Science.gov (United States)

    ... Prize Alfred Nobel's Life and Work Teachers' Questionnaire Vitamin B1 - About The Chicken Farm educational game and ... the game window. Reading: "Christian Eijkman, Beriberi and Vitamin B1" - Who was Eijkman and why did he ...

  17. Reference: SRENTTTO1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SRENTTTO1 Takeda S, Sugimoto K, Otsuki H, Hirochika H A 13-bp cis-regulatory element in the LTR ... poson Tto1 is involved in responsiveness to tissue culture , wounding, methyl jasmonate and fungal elicitors P ...

  18. Interferon Alfacon-1 Injection

    Science.gov (United States)

    Interferon alfacon-1 is no longer available in the United States. If you are currently taking this ... switching to another treatment.Your doctor has ordered interferon alfacon-1 to help treat your hepatitis C ...

  19. BACE1 modulates gating of KCNQ1 (Kv7.1) and cardiac delayed rectifier KCNQ1/KCNE1 (IKs).

    Science.gov (United States)

    Agsten, Marianne; Hessler, Sabine; Lehnert, Sandra; Volk, Tilmann; Rittger, Andrea; Hartmann, Stephanie; Raab, Christian; Kim, Doo Yeon; Groemer, Teja W; Schwake, Michael; Alzheimer, Christian; Huth, Tobias

    2015-12-01

    KCNQ1 (Kv7.1) proteins form a homotetrameric channel, which produces a voltage-dependent K(+) current. Co-assembly of KCNQ1 with the auxiliary β-subunit KCNE1 strongly up-regulates this current. In cardiac myocytes, KCNQ1/E1 complexes are thought to give rise to the delayed rectifier current IKs, which contributes to cardiac action potential repolarization. We report here that the type I membrane protein BACE1 (β-site APP-cleaving enzyme 1), which is best known for its detrimental role in Alzheimer's disease, but is also, as reported here, present in cardiac myocytes, serves as a novel interaction partner of KCNQ1. Using HEK293T cells as heterologous expression system to study the electrophysiological effects of BACE1 and KCNE1 on KCNQ1 in different combinations, our main findings were the following: (1) BACE1 slowed the inactivation of KCNQ1 current producing an increased initial response to depolarizing voltage steps. (2) Activation kinetics of KCNQ1/E1 currents were significantly slowed in the presence of co-expressed BACE1. (3) BACE1 impaired reconstituted cardiac IKs when cardiac action potentials were used as voltage commands, but interestingly augmented the IKs of ATP-deprived cells, suggesting that the effect of BACE1 depends on the metabolic state of the cell. (4) The electrophysiological effects of BACE1 on KCNQ1 reported here were independent of its enzymatic activity, as they were preserved when the proteolytically inactive variant BACE1 D289N was co-transfected in lieu of BACE1 or when BACE1-expressing cells were treated with the BACE1-inhibiting compound C3. (5) Co-immunoprecipitation and fluorescence recovery after photobleaching (FRAP) supported our hypothesis that BACE1 modifies the biophysical properties of IKs by physically interacting with KCNQ1 in a β-subunit-like fashion. Strongly underscoring the functional significance of this interaction, we detected BACE1 in human iPSC-derived cardiomyocytes and murine cardiac tissue and observed

  20. Detection of outliers in BL(1,1,1,1 Models using Least Squares Method

    Directory of Open Access Journals (Sweden)

    Ibrahim Mohamed

    2006-07-01

    Full Text Available In the literature, various nonlinear time series data was shown to exist. As a result, studies on nonlinear models have been carried out. One of them is bilinear model. Further, there is a possibility that outliers may exist in the data. In this article, the possibility of an outlier appear in a special case of bilinear model, BL(1,1,1,1 is investigated. An outlier detection procedure is proposed.

  1. Just Perfect: Part 1

    Science.gov (United States)

    Scott, Paul

    2007-01-01

    This article is about a very small subset of the positive integers. The positive integer N is said to be "perfect" if it is the sum of all its divisors, including 1, but less that N itself. For example, N = 6 is perfect, because the (relevant) divisors are 1, 2 and 3, and 6 = 1 + 2 + 3. On the other hand, N = 12 has divisors 1, 2, 3, 4 and 6, but…

  2. Porcine SLITRK1

    DEFF Research Database (Denmark)

    Larsen, Knud Erik; Momeni, Jamal; Farajzadeh, Leila;

    2014-01-01

    The membrane protein SLITRK1 functions as a developmentally regulated stimulator of neurite outgrowth and variants in this gene have been implicated in Tourette syndrome. In the current study we have cloned and characterized the porcine SLITRK1 gene. The genomic organization of SLITRK1 lacks intr...

  3. Preparation of 1-bromoheptacosane

    International Nuclear Information System (INIS)

    Alkybromides are ones of the main organic precursors for fatty acids and alcohols labelling with Carbon 1-14. In this work the preparation of 1-bromoheptacosane by bromodescarboxylation of 1-octacosanoic acid is described. The synthesis yielded 80.5% of final product and more than 97% of chemical purity. Clean-up procedure modifications and spectral data bromoheptacosane are also reported

  4. Diabetes, Type 1

    OpenAIRE

    Riazi, Afsane; Bradley, Clare

    2007-01-01

    This chapter provides an overview of the role of psychological stress in Type 1 diabetes. Studies relating to stress and Type 1 diabetes onset and control, as well as the evidence relating to stress management training in people with Type 1 diabetes are discussed.

  5. Main: TAAAGSTKST1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available TAAAGSTKST1 S000387 20-Feb-2002 (last modified) uchi TAAAG motif found in promoter ...ecific gene expression; KST1 gene encodes a K+ influx channel of guard cells; See S000265; KST1; Dof; guard cell; Solanum tuberosum (potato) TAAAG ...

  6. Main: RSEPVGRP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available RSEPVGRP1 S000099 13-Feb-2001 (last modified) kehi RSE (root-specific element) of bean (P.v.) GRP1....8 gene; consensus sequence;See also S000288 and S000289; root; GRP1.8; bean (Phaseolus vulgaris) CAACTTTCATAT ...

  7. Main: GAREHVAMY1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available GAREHVAMY1 S000038 17-May-1998 (last modified) kehi GARE (gibberellic acid responsive element) of bar...ley (H.v.) alpha-amylase gene (Amy 1/6-4); GA3; gibberellic acid; GA; GA3; amylase; Amy1/6-4; GARE; barley (Hordeum vulgare) GGCCGATAACAAACTCCGGCC ...

  8. Main: AMMORESIIUDCRNIA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMMORESIIUDCRNIA1 S000374 31-Jul-2001 (last modified) uchi Motifs (IIU and IID) fou...nd in the Chlamydomonas (C.R.) Nia1 gene promoter; Involved in ammonium-response; Located between -231 and -...219 and also between -76 and -65; Involved in Nia1 transcription activation; W=T/A; nitrate reductase; ammonium response; Chlamydomonas reinhardtii GGWAGGGT ...

  9. Main: SRENTTTO1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SRENTTTO1 S000271 15-Oct-1999 (last modified) kehi Stress responsive element (SRE) in tobacco (N ... nsposon Tto1; Involved in responsiveness to tissue culture , wounding, methyl jasmonate and fungal elicitors; ... trotransposon; LTR; Tto1; wounding; stress; tissue culture ; methyl jasmonate; fungal elicitor; Box L; tobacco ...

  10. Reference: MYBCOREATCYCB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ranscription and identification of putative regulatory proteins. Plant Mol Biol. 50:111-127 (2002). PubMed: 12139003 ... ...MYBCOREATCYCB1 Planchais S, Perennes C, Glab N, Mironov V, Inze D, Bergounioux C. Characterizat...ion of cis-acting element involved in cell cycle phase-independent activation of Arath;CycB1;1 t

  11. Materials Science Research Rack-1 (MSRR-1)

    Science.gov (United States)

    2001-01-01

    This computer-generated image depicts the Materials Science Research Rack-1 (MSRR-1) being developed by NASA's Marshall Space Flight Center and the European Space Agency (ESA) for placement in the Destiny laboratory module aboard the International Space Station. The rack is part of the plarned Materials Science Research Facility (MSRF) and is expected to include two furnace module inserts, a Quench Module Insert (being developed by NASA's Marshall Space Flight Center) to study directional solidification in rapidly cooled alloys and a Diffusion Module Insert (being developed by the European Space Agency) to study crystal growth, and a transparent furnace (being developed by NASA's Space Product Development program). Multi-user equipment in the rack is being developed under the auspices of NASA's Office of Biological and Physical Research (OBPR) and ESA. Key elements are labeled in other images (0101754, 0101830, and TBD).

  12. Microhydropower Handbook, Volume 1, Part 1

    Energy Technology Data Exchange (ETDEWEB)

    McKinney, J.D.

    1983-01-01

    The purpose of the “Microhydropower Handbook, Volume 1, Part 1” is to provide a mechanically proficient lay person with sufficient information to evaluate microhydropower site potential, lay out a site, select and install equipment, and finally, operate and maintain the completed system. The actual construction details of the site are not included; rather, pointers are given as to what help an individual should expect from a construction contractor, and general guidelines on construction details are provided. In addition, information about obtaining financing and permits is provided. To help offset cost, the person performing the work, referred to as the “developer,” is encouraged to do as much of the work as possible. However, developers with major areas of uncertainty should consider professional assistance.

  13. The LIFE Model v1.1

    OpenAIRE

    P. Wheatley(University of Warwick, United Kingdom); Ayris, P.; R Davies; McLeod, R; Shenton, H.

    2007-01-01

    Extract: This document draws together feedback, discussion and review of the LIFE Model from a number of sources: 1. The LIFE and LIFE2 Project Teams, and the staff of their institutions 2. Feedback from review by independent economics expert 3. The LIFE Project Conference 4. Early adopters of the Life Model (particularly the Royal Danish Library, State Archives and the State and University Library, Denmark) The result is a revision of the LIFE Model which was first publ...

  14. Horizontally separated 1-in-1 crossing insertions

    Energy Technology Data Exchange (ETDEWEB)

    Syphers, M.J. [Fermi National Accelerator Lab., Batavia, IL (United States)

    1985-10-01

    Previous to this workshop, realistic lattices have been developed for vertically separated l-in-l (e.g., D.E. Johnson, A.A. Garren) and 2-in-1 (e.g., S. Heifets) magnets as well as for horizontally separated 2-in-l magnets (e.g., SSC RDS). Bringing together the widely separated ({approximately}60-70 cm) beams in a reasonable length of tunnel and keeping the dispersion zero at the interaction point has been difficult in the vertical l-in-l case. Most designs have required spacial 2-in-1 quadrupoles near the interaction point where the beams are separated by 15 cm or less. It is not clear that such magnets, as dictated by some of these lattice designs, can easily be built. The purpose of this exercise is to provide a crossing insertion for a realistic lattice which involves horizontally separated l-in-l magnets. The following horizontal crossing insertions, which incorporate the dispersion suppressors and phase trombones into the major arcs, need no special 2-in-1 magnets near the interaction point. The dispersion at the IP created by the horizontal crossing can be cancelled by the dispersion suppressor and one set of triplets.

  15. 1. Il software

    OpenAIRE

    Musilli, Giorgio

    2014-01-01

    1.1. Il sistema 1.1.1. Un quasi monopolio Windows è una famiglia di ambienti e sistemi operativi (con interfaccia grafica a finestre) prodotti dalla Microsoft Corporation. Il primo sistema Windows risale al novembre 1985, ma già in precedenza (agosto 1981 - giugno 1982) l'azienda di Redmond aveva avuto un grande successo commerciale con il sistema MS-DOS, ottenuto sviluppando il codice del sistema CPM-86 della Seattle Computer Product, soprattutto grazie alla decisione di IBM di inserirlo nei...

  16. The E1 proteins

    International Nuclear Information System (INIS)

    E1, an ATP-dependent DNA helicase, is the only enzyme encoded by papillomaviruses (PVs). It is essential for replication and amplification of the viral episome in the nucleus of infected cells. To do so, E1 assembles into a double-hexamer at the viral origin, unwinds DNA at the origin and ahead of the replication fork and interacts with cellular DNA replication factors. Biochemical and structural studies have revealed the assembly pathway of E1 at the origin and how the enzyme unwinds DNA using a spiral escalator mechanism. E1 is tightly regulated in vivo, in particular by post-translational modifications that restrict its accumulation in the nucleus. Here we review how different functional domains of E1 orchestrate viral DNA replication, with an emphasis on their interactions with substrate DNA, host DNA replication factors and modifying enzymes. These studies have made E1 one of the best characterized helicases and provided unique insights on how PVs usurp different host-cell machineries to replicate and amplify their genome in a tightly controlled manner. - Highlights: • The papillomavirus E1 helicase orchestrates replication of the viral DNA genome. • E1 assembles into a double-hexamer at the viral origin with the help of E2. • E1 interacts with cellular DNA replication factors. • E1 unwinds DNA using a spiral escalator mechanism. • Nuclear accumulation of E1 is regulated by post-translational modifications

  17. Melaminium nitrate–melamine–water (1/1/1

    Directory of Open Access Journals (Sweden)

    Farook Adam

    2010-11-01

    Full Text Available In the crystal structure of the title salt, C3H7N6+·NO3−·C3H6N6·H2O, the asymmetric unit consists of two neutral melamine (1,3,5-triazine-2,4,6-triamine molecules, two melaminium cations, two nitrate anions and two solvent water molecules. One of the nitrate anions is disordered over two sets of positions, with a refined occupancy ratio of 0.909 (3:0.091 (3. The cations and neutral molecules are approximately planar, with maximum deviations of 0.018 (2, 0.024 (2, 0.019 (2 and 0.007 (2 Å for each, respectively. In the crystal structure, melaminium cations and netural melamine molecules self-assemble via N—H...N hydrogen bonds to form a supramolecular hexagonal-shaped motif. In addition, the nitrate anions and water molecules are connected by N—H...O hydrogen bonds to form a three-dimensional network.

  18. Prokineticin1 and pregnancy.

    Science.gov (United States)

    Alfaidy, Nadia

    2016-06-01

    Prokineticin 1 (PROK1), also called EG-VEGF, is a peptide of 86 amino acids with multiple biological functions. PROK1 acts via two G-protein coupled receptors: PROKR1 PROKR2. PROK1 is highly expressed in the placenta. This article reports the expression and the role of PROK1 during normal and pathological pregnancies: (i) during early pregnancy, PROK1 exhibits a peak of placental expression shortly before the establishment of the feto-maternal circulation; (ii) its receptors, PROKR1 PROKR2 are highly expressed in human placenta; (iii) its expression is increased by hypoxia; (iv) PROK1 inhibits extravillous trophoblasts migration and invasion and increases their proliferation and survival; (v) PROK1 is also a pro-angiogenic placental factor that increases microvascular placental endothelial cells proliferation, migration, invasion, and permeability. Circulating PROK1 levels are five times higher in pregnant women during the first trimester compared to the second and third trimesters. Also, its serum levels are higher in patients with preeclampsia (PE) and in patients with isolated intra-uterine growth restriction (IUGR). In mice, maintaining high level of PROK1 beyond its normal period of production (>10.5dpc) reproduces symptoms of PE. To date, our results demonstrated that PROK1 is a central factor of human placentation with direct roles both in the control of trophoblast invasion and villous growth. Thus, a failure in the expression of PROK1 and/or its receptor during pregnancy may contribute to the development of PE and/or IUGR. Besides theses original findings, we also report a direct role of this factor in parturition. PMID:27172869

  19. Endothelin-1 and -2

    DEFF Research Database (Denmark)

    Compeer, Matthijs G; Suylen, Dennis P L; Hackeng, Tilman M; De Mey, Jo G R

    AIMS: Endothelin-1 (ET-1) and endothelin-2 (ET-2; Trp(6)Leu(7)ET-1) are expressed by different cell types, but are considered to display identical pharmacological properties on endothelin receptors. We studied agonist-dependent aspects of endothelin(A) (ET(A))-receptor function and the importance...... of amino acids 6 and 7 of ET-1 and ET-2 in this respect. MAIN METHODS: We used isolated rat mesenteric resistance arteries in wire myographs, in a setting that minimizes influences of endothelium and sensorimotor nerves, to study arterial smooth muscle ET(A)-receptor-mediated vasomotor responses, to...... ET-1, ET-2 and chimeras thereof (Trp(6)ET-1 and Leu(7)ET-1). KEY FINDINGS: ET-1 and ET-2 cause arterial contractions with comparable sensitivities and maximal responses. BQ123 (ET(A)-antagonist) reduces sensitivity to ET-1 more potently than that to ET-2 (pK(B): 7.1 ± 0.2 versus 5.6 ± 0.4). However...

  20. Thermochemistry of 1,1,3,3-tetramethylguanidine and 1,1,3,3-tetramethylguanidinium nitrate

    International Nuclear Information System (INIS)

    Graphical abstract: - Highlights: • The enthalpy of formation of 1,1,3,3-tetramethylguanidinium nitrate was determined by combustion calorimetry. • The cohesive energy of liquid 1,1,3,3-tetramethylguanidinium nitrate was evaluated. • The crystal structure of 1,1,3,3-tetramethylguanidinium nitrate was determined by single crystal X-ray diffraction. • ΔfHmo (l/g) of 1,1,3,3-tetramethylguanidine (tmg) were obtained by solution and Calvet calorimetry. • ΔfHmo (g) calculated by the W1-F12 procedure was in excellent agreement with the corresponding experimental value. - Abstract: Considerable efforts have recently been made to investigate how the structure of protic ionic liquids determines some of their most important properties for technological applications (e.g. low vapour pressure, conductivity). In contrast, the assessment of cohesive energies (which are also linked to those properties) based on thermodynamic results is still practically unexplored. This problem is addressed here for 1,1,3,3-tetramethylguanidinium nitrate, [Htmg][NO3], through a combination of experimental and computational chemistry results at the reference temperature of 298.15 K. The standard molar enthalpies of formation, ΔfHmo([Htmg][NO3],cr)=-(311.8±2.3)kJ·mol-1, and fusion, ΔfusHmo([Htmg][NO3])=16.2±3.8kJ·mol-1, of solid 1,1,3,3-tetramethylguanidinium nitrate (form I polymorph) were obtained by combustion and differential scanning calorimetry, respectively. From these results ΔfHmo([Htmg][NO3],l)=-(295.6±4.4)kJ·mol-1 could be derived. Also determined were the standard molar enthalpies of formation, ΔfHmo(tmg, l)=7.7±2.8kJ·mol-1, and vaporisation, ΔvapHmo(tmg,l)=50.0±1.2kJ·mol-1, of 1,1,3,3-tetramethylguanidine, by reaction solution and Calvet-drop microcalorimetry, respectively, leading to ΔfHmo(tmg,g)=57.7±3.0kJ·mol-1. This result is in excellent agreement with ΔfHmo(tmg,g)=58.4±4.0kJ·mol-1, obtained from the ab initio calculation of the standard molar

  1. 1-Methylpiperazine-1,4-diium dipicrate

    Directory of Open Access Journals (Sweden)

    Grzegorz Dutkiewicz

    2011-02-01

    Full Text Available In the crystal structure of the title compound [systematic name: 1-methylpiperazine-1,4-diium bis(2,4,6-trinitrophenolate], C5H14N22+·2C6H2N3O7−, the ionic components are connected by relatively strong N—H...O hydrogen bonds into centrosymmetric six-membered conglomerates, which comprise two dications and four anions. Besides Coulombic interactions, only weak C—H...O interactions and some stacking between picrates (separation between the planes of ca. 3.4 Å but only a small overlapping can be identified between these `building blocks' of the crystal structure. The piperazine ring adopts a chair conformation with the methyl substituent in the equatorial position. In the picrate anions, the twist angles of the nitro groups depend on their positions relative to the phenolate O atom: it is much smaller for the NO2 groups para to the C—O− group [15.23 (9and 3.92 (14°] than for the groups in the ortho positions [28.76 (13–39.84 (11°].

  2. Event generation with SHERPA 1.1

    Energy Technology Data Exchange (ETDEWEB)

    Gleisberg, T.; Hoche, Stefan.; Krauss, F.; Schoenherr, M.; Schumann, S.; Siegert, F.; Winter, J.

    2008-12-18

    In this paper the current release of the Monte Carlo event generator Sherpa, version 1.1, is presented. Sherpa is a general-purpose tool for the simulation of particle collisions at high-energy colliders. It contains a very flexible tree-level matrix-element generator for the calculation of hard scattering processes within the Standard Model and various new physics models. The emission of additional QCD partons off the initial and final states is described through a parton-shower model. To consistently combine multi-parton matrix elements with the QCD parton cascades the approach of Catani, Krauss, Kuhn and Webber is employed. A simple model of multiple interactions is used to account for underlying events in hadron-hadron collisions. The fragmentation of partons into primary hadrons is described using a phenomenological cluster-hadronization model. A comprehensive library for simulating tau-lepton and hadron decays is provided. Where available form-factor models and matrix elements are used, allowing for the inclusion of spin correlations; effects of virtual and real QED corrections are included using the approach of Yennie, Frautschi and Suura.

  3. ITER EDA Newsletter. Vol. 1, No. 1

    International Nuclear Information System (INIS)

    After the ITER Engineering Design Activities (EDA) Agreement and Protocol 1 had been signed by the four ITER parties on July 21, 1992 and had entered into force, the ITER Council suggested at its first meeting (Vienna, September 10-11, 1992) that the publication of the ITER Newsletter be continued during the EDA with assistance of the International Atomic Energy Agency. This suggestion was supported by the Agency and subsequently the ITER office in Vienna assumed its responsibilities for planning and executing activities related to the publication of the Newsletter. The ITER EDA Newsletter is planned to be a monthly publication aimed at disseminating broad information and understanding, including the description of the personal and institutional involvements in the ITER project in addition to technical facts about it. The responsibility for the Newsletter rests with the ITER council. In this first issue the signing of the ITER EDA Activities and Protocol 1 is reported. The EDA organizational structure is described. This issue also reports on the first ITER EDA council meeting, the opening of the ITER EDA NAKA Co-Centre, the first meeting of the ITER Technical Advisory Committee, activities of special working groups, an ITER Technical Meeting, as well as ''News in Brief'' and ''Coming Events''

  4. [NDM-1: the superbug?].

    Science.gov (United States)

    Pittalis, S; Ferarro, F; Puro, V

    2011-12-01

    A novel type of carbapenemase, New Delhi metallo beta-lactamase 1 (NDM 1), was first identified in 2008 in two Enterobacteriacea isolates, both recovered from a Swedish patient transferred from India. The emergence of NDM 1 is now reported from all continents, often in patients with a history of travel or hospitalization in the Indian subcontinent. The NDM 1 producing Gram-negative bacteria are mainly Enterobacteriaceae, which can cause colonization or fatal infections, with worrying antimicrobial susceptibility profiles: some isolates have developed resistance to practically all available antibiotics. Is the NDM-1 the super-bug? Are we in the post-antibiotic era? This review is a summary of currently available knowledge of NDM-1 that draws attention to future antimicrobial resistance scenarios. PMID:22212161

  5. Technology in L1

    DEFF Research Database (Denmark)

    Elf, Nikolaj Frydensbjerg; Hanghøj, Thorkild; Skaar, Håvard; Erixon, Per-Olof

    In recent decades, several Scandinavian research projects have had an explicit focus on how technology intervenes in L1 (or so-called Mother Tongue Education) practices in Swedish, Norwegian and Danish educational contexts, and how this may impact on understanding of the subject. There is currently...... no systematic overview of the documented possibilities and challenges related to the use of technology in L1. At the same time, there is terminological confusion in use of ‘technology’ and related concepts in L1. Finally, there is a general lack of critical reflection on the relation between...... technological developments, political rhetoric, and the development of L1 teaching and learning as a social practice related to specific contexts and actors. Thus, the paper attempts to answer three interrelated research questions: 1) what do we mean when we talk about ‘technology’ in L1?; 2) based on a...

  6. Technology in L1

    DEFF Research Database (Denmark)

    Elf, Nikolaj Frydensbjerg; Hanghøj, Thorkild; Skaar, Håvard;

    2015-01-01

    In recent decades, several Scandinavian research projects have had an explicit focus on how technology intervenes in L1 (or so-called Mother Tongue Education) practices in Swedish, Norwegian and Danish educational contexts, and how this may impact on understanding of the subject. There is currently...... no systematic overview of the documented possibilities and challenges related to the use of technology in L1. At the same time, there is terminological confusion in use of ‘technology’ and related concepts in L1. Finally, there is a general lack of critical reflection on the relation between...... technological developments, political rhetoric, and the development of L1 teaching and learning as a social practice related to specific contexts and actors. Thus, the paper attempts to answer three interrelated research questions: 1) what do we mean when we talk about ‘technology’ in L1?; 2) based on a...

  7. SINTEZA ( R )-1-AMINOINDANA

    OpenAIRE

    Prudič, Darja

    2014-01-01

    (R)-1-aminoindan je pomemben intermediat za sintezo zdravilne farmacevtske učinkovine rasagilina, (R)(+)-N-propargil-1-aminoindana, oz. njegove soli. Zdravila osnovana na navedeni učinkovini se uporabljajo za zdravljenje indikacij Parkinsonove bolezni, motenj spomina, demence tipa Alzheimerjeve bolezni, depresije in hiperaktivnega sindroma pri otrocih. Magistrska naloga temelji na razvoju učinkovite sinteze (R)-1-aminoindana in preveritvi ter potrditvi ustreznosti tega ključnega intermediata ...

  8. BAP1 and Cancer

    OpenAIRE

    Carbone, Michele; Yang, Haining; Pass, Harvey I.; Krausz, Thomas; Joseph R. Testa; Gaudino, Giovanni

    2013-01-01

    BAP1 is a deubiquitylase that is found associated with multi-protein complexes that regulate key cellular pathways, including the cell cycle, cellular differentiation, cell death, gluconeogenesis and the DNA damage response (DDR). Recent findings indicate that germline BAP1 mutations cause a novel cancer syndrome, characterized, at least in the affected families studied so far, by the onset at an early age of benign melanocytic skin tumours with mutated BAP1, and later in life by a high incid...

  9. TSS-1 Logo

    Science.gov (United States)

    1993-01-01

    The primary payload for the space Shuttle Mission STS-46, launched on July 31, 1992, was the Tethered Satellite System-1 (TSS-1). A cooperative development effort by the Italian Space Agency (ASI) and NASA, the TSS made capable the deployment and retrieval of a satellite which is attached by a wire tether from distances up to 100 km from the Orbiter. This is the logo or emblem designed to represent the TSS-1 payload.

  10. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  11. AC1 Wing

    OpenAIRE

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  12. What If w < -1 ?

    CERN Document Server

    McInnes, B

    2002-01-01

    The cosmological "equation of state parameter", w, is equal to -1 for a true cosmological constant, and is greater than -1 for quintessence. There is a widespread reluctance to consider the remaining possibility, w < -1, though in fact there is a variety of theoretical and observational evidence in favour of this range. We briefly discuss some of the objections to w < -1 and show that each of them can readily be circumvented. We also briefly consider what string theory has to say about this.

  13. SFR-1, Environmental impact

    International Nuclear Information System (INIS)

    SFR-1 is an underground disposal facility for low and intermediate level reactor waste. The present report considers the impact on the environment resulting from leakage of radionuclides from SFR-1. The radiation dose to a person in a hypothetical critical group has been estimated for two different situations: 1. the present day situation where the primary recipient is Oeregrundsgrepen with surroundings and 2. a situation when land uplift has altered the landscape to an inland area. The dominating dose pathways are for case 1. consumption of fish caught in Oeregrundsgrepen and for case 2. consumption of drinking water taken from a well drilled downstream the repository

  14. On 1/f Noise

    OpenAIRE

    Li, Ming; Zhao, Wei

    2012-01-01

    Due to the fact that 1/f noise gains the increasing interests in the field of biomedical signal processing and living systems, we present this introductive survey that may suffice to exhibit the elementary and the particularities of 1/f noise in comparison with conventional random functions. Three theorems are given for highlighting the particularities of 1/f noise. The first says that a random function with long-range dependence (LRD) is a 1/f noise. The secondindicates that a heavy-tailed r...

  15. Z physics at LEP 1. Vol. 1

    International Nuclear Information System (INIS)

    The contents of this final report from the Workshop on Z Physics at LEP can be divided into two parts. The first part, comprising Vols. 1 and 2, is a relatively concise but fairly complete handbook on the physics of e+e- annihilation near the Z peak (with normal LEP luminosity and unpolarized beams, appropriate for the first phase of LEP operation). The second part (Vol. 3) is devoted to a review of the existing Monte Carlo event generators for LEP physics. A special effort has been made to co-ordinate the different parts of this report, with the aim of achieving a systematic and balanced review of the subject, rather than having simply a collection of separate contributions. (orig.)

  16. Main: 1W1O [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1O トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...SSVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1O.jpg ...

  17. Main: 1W1Q [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1Q トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...SSVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1Q.jpg ...

  18. Main: 1W1S [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1S トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...SVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1S.jpg ...

  19. Main: 1W1R [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1R トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...LLFSSVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1R.jpg ...

  20. A Note on Indefinite Equation1/x+1/y+1/z +1/w+1/xyzw=0%关于不定方程1/x+1/y+1/z +1/w+1/xyzw=0的一点注记

    Institute of Scientific and Technical Information of China (English)

    管训贵

    2010-01-01

    利用初等方法研究了不定方程1/x+1/y+1/xyzw=1/z+1/w以及1/x+1/y+1/z=1/w+1/xyzw的正整数解问题,分别给出了它们的全部正整数解的公式:(x,y,z,w)=(n+k,n(n+k)-d/k,n2(n+k)2-n(n+k)d-k/kd,n)其中n,k,d为正整数,满足d|n2(n+k)2-k),d<n(n+k)-k,k|(n2-d) ;以及 (x,y,z,w)=(n+k,n(n+k)+d/k,n2(n+k)2+n(n+k)d-k/kd,n),其中n,k,d为正整数,满足 d|(n2(n+k)2-k) ,d<n2(n+k)2-k,k|(n2+d).

  1. Moschos' 1. Idyl

    DEFF Research Database (Denmark)

    Nielsen, Thomas Heine

    2009-01-01

    genudgivelse med indledning af Simon meislings oversættelse fra 1824 af Moschos' 1. idyl, Den bortløbne eros. Udgivelsesdato: 2009......genudgivelse med indledning af Simon meislings oversættelse fra 1824 af Moschos' 1. idyl, Den bortløbne eros. Udgivelsesdato: 2009...

  2. The No.1 Priority

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    At the beginning of each year, the Central Committee of theCommunist Party of China and the State Council jointly release thefirst document of the year, dubbed the No. 1 Document. The issuediscussed in the No. 1 Document is, of course, the most important to

  3. The No.1 Priority

    Institute of Scientific and Technical Information of China (English)

    YU SHUJUN

    2010-01-01

    @@ At the beginning of each year, the Central Committee of the Communist Party of China and the State Council jointly release the first document of the year, dubbed the No.1 Document. The issue discussed in the No.1 Document is, of course, the most important to the current economic and social development of the country.

  4. BYG-1. Lavt boligbyggeri

    DEFF Research Database (Denmark)

    Andersen, Birte Møller

    2010-01-01

    Teoretisk indlæring i myndighedskrav, lokalplankrav og BR-krav til 1½ etages énfamiliehuse. Skitsering, udformning, bygningsdesign og projektering. Projektorienteret gruppearbejde. 15% forelæsninger 85% dialogbaseret projektvejledning Semester: 1. Omfang: 15% af 15 ects Klasse str: 30-65...

  5. Excavation of LSS1

    CERN Multimedia

    1972-01-01

    Excavation of the long straight-section LSS1 by an Alpine boring machine. View of the connection chamber, in the background, the roofs of the enlarged sections (8.5 m and 6 m). On the right, the access tunnel to PP1.

  6. Diabetes Type 1

    Science.gov (United States)

    Diabetes means your blood glucose, or blood sugar, levels are too high. With type 1 diabetes, your pancreas does not make insulin. Insulin is ... kidneys, nerves, and gums and teeth. Type 1 diabetes happens most often in children and young adults ...

  7. Farmers’ No.1 Concern

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Rural residents anticipate the impact of the No.1Document on China’s countryside in 2010 Liu Limin, a farmer living in Lanxian County, Shanxi Province, knows theins and outs of the No. 1 Document.From memory, Liu can recite major

  8. Final report Isafruit wp 1.1 Isafruit deliverable 1.1.7

    NARCIS (Netherlands)

    Groot, M.J.; Benninga, J.; Hennen, W.H.G.J.

    2007-01-01

    The aim of Work Package 1.1 EUFCON of Isafruit is to conduct a thorough analysis of European Fruit Consumption in order to identify and understand major consumption trends and consumption patterns of European Fruit Consumption. Additionally, the information obtained in this work package (WP) will pr

  9. ATG16L1

    DEFF Research Database (Denmark)

    Salem, Mohammad; Ammitzboell, Mette; Nys, Kris;

    2015-01-01

    Genetic variations in the autophagic pathway influence genetic predispositions to Crohn disease. Autophagy, the major lysosomal pathway for degrading and recycling cytoplasmic material, constitutes an important homeostatic cellular process. Of interest, single-nucleotide polymorphisms in ATG16L1...... importance of ATG16L1 and its genetic variant (T300A) within the elementary biological processes linked to Crohn disease....

  10. Reference: ZDNAFORMINGATCAB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ed modulation of Z-box containing promoters by photoreceptors and downstream regulato...ZDNAFORMINGATCAB1 Yadav V, Kundu S, Chattopadhyay D, Negi P, Wei N, Deng XW, Chattopadhyay S Light regulat...ry components, COP1 and HY5, in Arabidopsis Plant J. 31: 741-753 (2002) PubMed: 12220265; ...

  11. Bisphosphonic compounds. Pt. 1

    International Nuclear Information System (INIS)

    Tetrakis(1-methylethyl) (methylene-13C)bisphosphonate was obtained from 13C-methyliodide via the Michaelis-Arbuzov reaction with tris(1-methylethyl)phosphite followed by condensation with chlorophosphonic acid bis(1-methylethyl)ester. Tetrakis(1-methyl-ethyl) (methylene-14C)bisphosphonate was prepared from 14C-dibromomethane via the Michaelis-Arbuzov reaction with excess of tris(1-methylethyl)phosphite. Both of these labelled tetraesters were chlorinated with NaOCl, hydrolysed with HCl and neutralized with NaOH similarly. The overall yield of 13C-clodronate, (dichloromethylene-13C)bisphosphonic acid disodium salt tetrahydrate, was 71% with 99.5% isotopic and 99.8% chemical purity. The overall radiochemical yield of 14C-clodronate was 9.8%. (author)

  12. Influenza Stigma during the 2009 H1N1 Pandemic

    OpenAIRE

    Earnshaw, Valerie A.; Quinn, Diane M.

    2013-01-01

    The current study examines the extent to which H1N1 was stigmatized at the height of the 2009 H1N1 pandemic in the U.S. and explores the role that H1N1 stigma played in people’s desire for physical distance from others with H1N1. H1N1 was the most stigmatized disease, with participants endorsing greater prejudice towards people with H1N1 than people with cancer or HIV/AIDS. Further, H1N1 stigma partially mediated the relationship between participants’ perceptions that H1N1 was threatening and...

  13. Density functional theory study of SO2-adsorbed Ni(1 1 1) and hydroxylated NiO(1 1 1) surface

    Science.gov (United States)

    Wei, Xin; Dong, Chaofang; Chen, Zhanghua; Xiao, Kui; Li, Xiaogang

    2015-11-01

    Spin polarized, DFT + U periodic calculation is used as an effective way to model the adsorption process of SO2 on hydroxylated NiO(1 1 1) surface. The adsorption of atomic O and O2 on the clean Ni(1 1 1) surface is calculated to investigate the forming process of passive film. The molecular and dissociated adsorptions of H2O on NiO(1 1 1) surface are evaluated to construct defect-free hydroxylated NiO(1 1 1) surface. The adsorption of SO2 and atomic O on clean Ni(1 1 1) surface is also investigated to compare with the adsorption capacity between passive film and substrate. With respect to the single adsorption process of SO2 on defect-free hydroxylated NiO(1 1 1) surface, the effects of O vacancy of surface and atomic O closed to the surface are investigated. The calculation results show that there is no chemical adsorption of SO2 on the defect-free hydroxylated NiO(1 1 1) surface with or without atomic O. Either single SO2 or SO2 with atomic O prefer adsorbing on the hydroxylated NiO(1 1 1) surface with O vacancies. The adsorption behavior is strengthened with the increase of percentage of surface O vacancy. The existence of atomic O leads to the production of SO3 on the hydroxylated NiO(1 1 1) surface and strengthens the adsorption capacity of SO2. Furthermore, the results also reveal the relationship between the charge transfer and the adsorption energy of SO2 and atomic O on the hydroxylated NiO(1 1 1) surface and clean Ni(1 1 1) surface. We inferred that broken passive film susceptibility to corrosion compare with substrate when surface O vacancies aggregate and its concentration large enough.

  14. Linac 1, inner structure

    CERN Multimedia

    1968-01-01

    This photo shows the inner structure of Linac 1. As injector to the PS, and later to the Booster, Linac 1 accelerated protons to 50 MeV, but it has also accelerated heavier ions. Fitted with a 520 keV RFQ pre-injector (instead of the original Cockcroft-Walton generator), it delivered protons and heavy ions to LEAR, from 1982 to 1992. After 33 years of faithful service, Linac 1 was dismantled in 1992 to make room for Linac 3 (Pb ions).

  15. Gym1 Hammerfest AS

    OpenAIRE

    Bloch, Tara Helen

    2014-01-01

    Jeg har i denne oppgaven tatt for meg treningssentret Gym1 Hammerfest AS, og deres arbeid med å være et kvalitetssenter med et mangfold av tilbud. Oppgaven er skrevet i samarbeid med virksomheten. Formålet med oppgaven har vært å finne ut hvordan Gym1 kan vedlikeholde sin store kundemasse, samt hvordan bedriften kan maksimere sin verdiskapning fra eksisterende medlemmer. Derfor har følgende problemstilling har blitt utformet, som grunnlag for oppgaven: Hvordan kan Gym1 Hammerfest oppret...

  16. Niobium ore OKA-1

    International Nuclear Information System (INIS)

    A 287-kg sample of a niobium ore, OKA-1, from Oka, Quebec, was prepared as a compositional reference material. OKA-1 was ground to minus 74 μm, blended in one lot, tested for homogeneity by X-ray fluorescence and chemical methods and bottled in 200-g units. In a 'free-choice' round-robin analytical program, 22 laboratories contributed results for niobium in each of two bottles of OKA-1. A statistical analysis of the data gave a recommended value of 0.37 +- 0.01% for niobium

  17. Spacelab Life Sciences-1

    Science.gov (United States)

    Dalton, Bonnie P.; Jahns, Gary; Meylor, John; Hawes, Nikki; Fast, Tom N.; Zarow, Greg

    1995-01-01

    This report provides an historical overview of the Spacelab Life Sciences-1 (SLS-1) mission along with the resultant biomaintenance data and investigators' findings. Only the nonhuman elements, developed by Ames Research Center (ARC) researchers, are addressed herein. The STS-40 flight of SLS-1, in June 1991, was the first spacelab flown after 'return to orbit', it was also the first spacelab mission specifically designated as a Life Sciences Spacelab. The experiments performed provided baseline data for both hardware and rodents used in succeeding missions.

  18. Open Praxis, volumen 1 issue 1

    Directory of Open Access Journals (Sweden)

    Editor Open Praxis

    2007-01-01

    Full Text Available Table of Contents - A Study on the Importance of Fostering Trust in a Distance Learning Community Sónia Sousa, David Lamas & Brian Hudson (1-10 - Teacher Upgrading through Distance Education in a South African Context C. G. Kruger & Prof. E. J. Spamer (11-19 - An Investigation into Delivery of On-Line Courses within an Early Childhood Teacher Education Distance Programme in New Zealand Susan E. Smart (20-29 - Transnational Online Project Management Curriculum Model for Engineering Students Enrique Benimeli Bofarull, Anke Muendler, Peter Haber (30-39 - China Rural Distance Education and Construction of the New Countryside Li Fanghong & Zeng Yichun (40-46 - E-Learning in Japan: Steam Locomotive on Shinkansen Ali E. Ozkul, Ph.D. & Kumiko Aoki, Ph.D.  (47-55 - Widening Access to Higher Education: Open and Distance Learning in Higher Education Setting in Indonesia Paulina Pannen (56-65 - Research and Development of a Costing Toolkit for Distance, Flexible and ICT-Based Education for Teacher Development in Africa Frank R J Banks (66-75 - Fostering E-Learning in Medical Education: The Eurovacc Team Experience Guilherme Andrade Marson, Nathalie Debard, Jean-Pierre Kraehenbuhl, Pascal Py, Yan Cornneille, Laurent Richard, Alain Meystre (76-86 - Program Upgrading Teachers in Education Irene Hardy de Gómez (87-95 - ICT based learning strategies for Educating nomads Yogesh Kulkarni & Dr. Madhav Gaikwad (96-102 - Information and Communication Technology and Distance Education in Brazil Marta de Campos Maia & Fernando de Souza Meirelles (103-112 - ICDE’s interview with Susan D’Antoni, UNESCO International Institute for Educational Planning (IIEP (113-117 - ICDE Task Force Open Educational Resources – Inquiry Results (118-125 - 22nd ICDE – World Conference on Distance Education: Facts and figures (126-131

  19. Contaminant Candidate List 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — CCL 1 is a list of contaminants that are currently not subject to any proposed or promulgated national primary drinking water regulations, that are known or...

  20. Mark 1 Test Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Mark I Test Facility is a state-of-the-art space environment simulation test chamber for full-scale space systems testing. A $1.5M dollar upgrade in fiscal year...

  1. A1C Test

    Science.gov (United States)

    ... to minimize the complications caused by chronically elevated glucose levels, such as progressive damage to body organs like the kidneys, eyes, cardiovascular system, and nerves. The A1c test result ...

  2. Probability 1/e

    Science.gov (United States)

    Koo, Reginald; Jones, Martin L.

    2011-01-01

    Quite a number of interesting problems in probability feature an event with probability equal to 1/e. This article discusses three such problems and attempts to explain why this probability occurs with such frequency.

  3. Type 1 diabetes

    DEFF Research Database (Denmark)

    Green, Anders; Kyvik, Kirsten Ohm

    2001-01-01

    Prediction of Type 1 diabetes at individual level is relevant for any possible intervention before clinical disease develops. Currently available markers of Type 1 diabetes include genetic specificities and immune markers, in addition to a positive family history. This chapter reviews the measures...... and methods of importance in predicting Type 1 diabetes. Based on numerical examples it is demonstrated that available markers have a low level of performance, even when combined. Even so, combined marker information may allow for the identification of the large majority of the general population who...... is at very low disease risk. The impact at population level of predicting Type 1 diabetes varies between societies because the performance of markers depends on levels of disease risk and distribution of markers within a population. The incorporation of the influence of non-genetic etiological factors may...

  4. Reference: POLASIG1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available POLASIG1 Loke JC, Stahlberg EA, Strenski DG, Haas BJ, Wood PC, Li QQ. Compilation of mRNA polyad ... enylation signals in Arabidopsis revealed a new ... signal element and potential secondary structures. ...

  5. IML-1 Logo

    Science.gov (United States)

    1989-01-01

    The primary payload for Space Shuttle Mission STS-42, launched January 22, 1992, was the International Microgravity Laboratory-1 (IML-1), a pressurized manned Spacelab module. The goal of IML-1 was to explore in depth the complex effects of weightlessness of living organisms and materials processing. Around-the-clock research was performed on the human nervous system's adaptation to low gravity and effects of microgravity on other life forms such as shrimp eggs, lentil seedlings, fruit fly eggs, and bacteria. Materials processing experiments were also conducted, including crystal growth from a variety of substances such as enzymes, mercury iodide and a virus. More than 200 scientists from 16 countries participated in the investigations. This is the logo or emblem that was designed to represent the IML-1 payload.

  6. Main: SUREAHVISO1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SUREAHVISO1 S000441 28-Jan-2004 (last modified) kehi SURE-a; Sugar -responsive element found in b ... SUSIBA2 (WRKY transcription factor) binding site; sugar ; SURE; patatin; WRKY; isoamylase; SUSIBA; Hordeum ...

  7. Reference: SUREAHVISO1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SUREAHVISO1 Sun C, Palmqvist S, Olsson H, Boren M, Ahlandsberg S, Jansson C. A novel WRKY transc ... ription factor, SUSIBA2, participates in sugar ... signaling in barley by binding to the sugar -respon ...

  8. Reference: WBOXHVISO1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available WBOXHVISO1 Sun C, Palmqvist S, Olsson H, Boren M, Ahlandsberg S, Jansson C. A novel WRKY transcr ... iption factor, SUSIBA2, participates in sugar ... signaling in barley by binding to the sugar -respon ...

  9. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

  10. Main: ACGTROOT1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ssion; Gene: synthetic; perfect palindromic sequence (PA) containing G-box-related sequence; transacting fac...ACGTROOT1 S000016 31-Jul-2001 (last modified) uchi ACGT motif related to root expre

  11. Reference: TAAAGSTKST1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available TAAAGSTKST1 Plesch G, Ehrhardt T, Mueller-Roeber B Involvement of TAAAG elements suggests a role ... for Dof transcription factors in guard ... cell-specific gene expression Plant J 28: 455-464 ...

  12. COMPASS RICH-1

    International Nuclear Information System (INIS)

    RICH-1 is one of the key detectors of the COMPASS experiment at CERN. It is a large acceptance gaseous RICH, designed to perform π/κ separation up to 60 GeV/c. All RICH-1 components are built, most of them have been commissioned during year 2000 COMPASS technical run and the detector will be completed during Spring 2001. We give a description of the detector and report about various technological achievements required by this challenging project

  13. Revisiting HIV-1 uncoating

    OpenAIRE

    Arhel Nathalie

    2010-01-01

    Abstract HIV uncoating is defined as the loss of viral capsid that occurs within the cytoplasm of infected cells before entry of the viral genome into the nucleus. It is an obligatory step of HIV-1 early infection and accompanies the transition between reverse transcription complexes (RTCs), in which reverse transcription occurs, and pre-integration complexes (PICs), which are competent to integrate into the host genome. The study of the nature and timing of HIV-1 uncoating has been paved wit...

  14. aflatoxina b1

    Directory of Open Access Journals (Sweden)

    A. Valdivia

    2004-01-01

    Full Text Available Con el objetivo de probar que la suplementación dietética de ácido elágico (AE o N-Acetilcisteína (NAC en pollos de engorda, atenúa los efectos de una intoxicación aguda por la aflatoxina B1 (AFB1, se intoxicaron con AFB1 pura, tres grupos de diez pollos cada uno (3.0 mb/kg pc, IP. Otros tres grupos recibieron solamente el vehículo (aceite de maíz 2.0 ml/kg pc, IP. Cuatro días antes se administró un alimento testigo, o bien, la misma dieta adicionada con AE (2.5 g/kg o NAC (200 mg/kg pc/6 h. A las 24 horas de la administración de AFB1, se cuantificaron las concentraciones hepáticas de glutatión (GSH, de actividad enzimática específica de la transferasa de glutatión (GST, alanina aminotransferasa, aspartato aminotransferasa y de proteínas hepáticas totales. Los resultados mostraron que NAC atenúa el impacto negativo de la AFB1 sobre el crecimiento corporal y al igual que AE, incrementa la GST y revierte parcialmente los efectos de AFB1 sobre GSH, lo cual sugiere que ambas sustancias pudieran conferir un efecto protector de las aves

  15. Wozu AT1-Rezeptorantagonisten?

    Directory of Open Access Journals (Sweden)

    Berent R

    2000-01-01

    Full Text Available ACE-Hemmer sind nun seit fast 20 Jahren im klinischen Einsatz. Ihre Effektivität in der Behandlung der arteriellen Hypertonie, der Herzinsuffizienz und bei nephrologischen Erkrankungen wurde durch eine große Zahl an randomisierten, prospektiven Studien belegt. Zusätzlich ist das Nebenwirkungsprofil (inklusive seltener Nebenwirkungen dieser Substanzklasse durch die langjährige Anwendung gut dokumentiert. Unter einer AT1-Rezeptorantagonistentherapie konnte bislang eindeutig gezeigt werden, daß das Auftreten von Nebenwirkungen, im speziellen des Reizhustens, deutlich seltener ist und im Placebobereich liegt, was die Compliance der Patienten sicherlich erhöht. Klinisch finden sich allerdings kaum Unterschiede in der Hämodynamik bei der Einnahme von ACE-Hemmern oder AT1-Rezeptorantagonisten. AT1-Rezeptorantagonisten blockieren sicherlich effektiver die AT1-rezeptorvermittelte Vasokonstriktion, währenddessen sich die ACE-Hemmerwirkung aus einer partiellen Abnahme der Angiotensin-II-Bildung und der Akkumulation von Bradykinin zusammensetzt. Aufgrund der derzeitigen Datenlage kann der AT1-Rezeptorantagonist nicht als Alternative zum ACE-Hemmer empfohlen werden, außer ein Absetzen des ACE-Hemmers ist wegen Nebenwirkungen notwendig. Auch die Kombinationstherapie, AT1-Rezeptorantagonist plus ACE-Hemmer, stellt zum jetzigen Zeitpunkt noch keine etablierte Therapie dar.

  16. 26 CFR 1.50-1 - Restoration of credit.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Restoration of credit. 1.50-1 Section 1.50-1... Computing Credit for Investment in Certain Depreciable Property § 1.50-1 Restoration of credit. (a) In general. Section 49(a) (relating to termination of credit) does not apply to property— (1)...

  17. 26 CFR 1.23-1 - Residential energy credit.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Residential energy credit. 1.23-1 Section 1.23-1... Rates During A Taxable Year § 1.23-1 Residential energy credit. (a) General rule. Section 23 or former section 44C provides a residential energy credit against the tax imposed by chapter 1 of the...

  18. Main: 1E1F [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1F トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...QRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1F.jpg ...

  19. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  20. Epitaxial growth of Nd2Hf2O7(1 1 1) thin films on Ge(1 1 1) substrates by pulsed laser deposition

    International Nuclear Information System (INIS)

    Nd2Hf2O7 (NHO) thin films have been epitaxially grown by pulsed laser deposition (PLD) on Ge(1 1 1) substrates. In situ reflection high-energy electron diffraction (RHEED) evolution of the (1 1 1)-oriented NHO during the deposition has been investigated and shows that the epilayer has a twin-free character with type-B stacking. Interfacial structure of NHO/Ge has been examined by high-resolution transmission electron microscopy (HRTEM). The results indicate a highly crystalline film with a very thin interface, and the orientation relationship between NHO and Ge can be denoted as (1 1 1)NHO//(1 1 1)Ge and [1-bar 10]NHO//[11-bar 10]Ge. Finally, twin-free epitaxial growth of NHO with type-B orientation displays temperature dependence and the type-B epitaxy is favored at high temperature.

  1. TRUPACT-1 implementation plan

    Energy Technology Data Exchange (ETDEWEB)

    Hurley, J.D.; Tappen, J.J. (Westinghouse Electric Corp., Albuquerque, NM (United States). Joint Integration Office); Christensen, D.S. (USDOE Joint Integration Office, Albuquerque, NM (United States)) (eds.)

    1985-09-01

    TRUPACT-1, the TRansUranic PACkage Transporter is a packaging designed to transport defense contact handled transuranic (CH-TRU) waste from generating and interim TRU waste storage facilities to the Waste Isolation Pilot Plant (WIPP). Prior to fabrication and procurement of a full fleet, an initial design (TRUPACT-1) will be introduced to the defense TRU waste complex through use in an operational prototype fleet which will consist of Units 1, 2, and 3. In an effort to provide a relatively smooth introduction of the TRUPACT-1, the TRUPACT Technical Team (TTT) has developed the following implementation plan. The plan provides detailed information on user handling opportunities, schedules, equipment, responsibilities, reporting and data collection activities to be performed. The intent of this document is to provide users of the TRUPACT-1 with a guidance document, complete with references, that will allow the smooth introduction of this new transportation system by providing the information necessary for collecting operational, performance and cost data. These data will be used in modeling and full fleet design and procurement activities. In addition, these data will help fine tune procedures in the inspection and maintenance document and the operational document. Additional objectives of this plan are to aid in the establishment of site operational, inspection and maintenance procedures as well as training of site operators and briefing state and local officials.

  2. Sunflower trypsin inhibitor-1.

    Science.gov (United States)

    Korsinczky, Michael L J; Schirra, Horst Joachim; Craik, David J

    2004-10-01

    SFTI-1 is a bicyclic 14 amino acid peptide that was originally isolated from the seeds of the sunflower Helianthus annuus. It is a potent inhibitor of trypsin, with a sub-nanomolar K(i) value and is homologous to the active site region of the well-known family of serine protease inhibitors known as the Bowman-Birk trypsin inhibitors. It has a cyclic backbone that is cross-braced by a single disulfide bridge and a network of hydrogen bonds that result in a well-defined structure. SFTI-1 is amenable to chemical synthesis, allowing for the creation of synthetic variants. Alterations to the structure such as linearising the backbone or removing the disulfide bridge do not reduce the potency of SFTI-1 significantly, and minimising the peptide to as few as nine residues results in only a small decrease in reactivity. The creation of linear variants of SFTI-1 also provides a tool for investigating putative linear precursor peptides. The mechanism of biosynthesis of SFTI-1 is not yet known but it seems likely that it is a gene-coded product that has arisen from a precursor protein that may be evolutionarily related to classic Bowman-Birk inhibitors. PMID:15544530

  3. Preparation of 1,1'-dinitro-3,3'-azo-1,2,4-triazole. [1,1'-dinitro-3,3'-azo-1,2,4-triazole

    Science.gov (United States)

    Lee, K.Y.

    1985-03-05

    A new high density composition of matter, 1,1'-dinitro-3,3'-azo-1,2,4-triazole, has been synthesized using inexpensive, commonly available compounds. This compound has been found to be an explosive, and its use as a propellant is anticipated. 1 fig., 1 tab.

  4. ATLAS-1 Logo

    Science.gov (United States)

    1990-01-01

    The primary payload for the Space Shuttle mission STS-45, launched March 24, 1992, was the Atmospheric Laboratory for Applications and Science-1 (ATLAS-1)which was mounted on nondeployable Spacelab pallets in the orbiter cargo bay. Eight countries, th U.S., France, Germany, Belgium, United Kingdom, Switzerland, The Netherlands, and Japan, provided 12 instruments designed to perform 14 investigations in four fields. Atmospheric science instruments/investigations: Atmospheric Lyman-Alpha Emissions (ALAE); Atmospheric Trace Molecule Spectroscopy (ATMOS); Grille Spectrometer (GRILLE); Imaging Spectrometric Observatory (ISO); Millimeter-Wave Atmospheric Sounder (MAS). Solar Science: Active Cavity Radiometer Irradiance Monitor (ACRIM); Measurement of the Solar Constant (SOLCON); Solar Spectrum from 180 to 3,200 Nanometers (SOLSPEC); Solar Ultraviolet Spectral Irradiance Monitor (SUSIM). Space Plasma Physics: Atmospheric Emissions Photometric Imaging (AEPI); Space Experiments with Particle Accelerators (SEPAC). Ultraviolet astronomy: Far Ultraviolet Space Telescope (FAUST). This is the logo or emblem that was designed to represent the ATLAS-1 payload.

  5. ASTRO-1 Logo

    Science.gov (United States)

    1989-01-01

    The primary payload for Space Shuttle Mission STS-35, launched December 2, 1990, was the ASTRO-1 Observatory. Designed for round the clock observation of the celestial sphere in ultraviolet and X-ray astronomy, ASTRO-1 featured a collection of four telescopes: the Hopkins Ultraviolet Telescope (HUT); the Wisconsin Ultraviolet Photo- Polarimeter Experiment (WUPPE); the Ultraviolet Imaging Telescope (UIT); and the Broad Band X-ray Telescope (BBXRT). Ultraviolet telescopes mounted on Spacelab elements in cargo bay were to be operated in shifts by flight crew. Loss of both data display units (used for pointing telescopes and operating experiments) during mission impacted crew-aiming procedures and forced ground teams at Marshall Space Flight Center to aim ultraviolet telescopes with fine-tuning by flight crew. BBXRT, also mounted in cargo bay, was directed from outset by ground-based operators at Goddard Space Flight Center. This is the logo or emblem that was designed to represent the ASTRO-1 payload.

  6. Diabetes mellitus type 1

    OpenAIRE

    Tøraasen, Lisa Vangen; Al-Sultan, Zainab

    2014-01-01

    Hvert år blir rundt 600 nordmenn diagnostisert med sykdommen diabetes type 1, og Norge er et av landene i verden med størst andel av barnediabetes. I dag er det 15 000- 20 000 personer i Norge som har diabetes type 1, og antall barn som får diabetes har fordoblet seg de siste 30 årene (Diabetesforbundet, 2014). Problemstillingen vår gikk ut på hvordan sykepleiere kan veilede og undervise ungdom med nyoppdaget diabetes type på sykehus. Ut i fra litteraturstudiet har vi arbeidet oss frem for å ...

  7. Green syntheses, v.1

    CERN Document Server

    Tundo, Pietro

    2014-01-01

    Introduction to the Green Syntheses SeriesPietro Tundo and John AndraosApplication of Material Efficiency Metrics to Assess Reaction Greenness-Illustrative Case Studies from Organic SynthesesJohn AndraosReaction 1: Synthesis of 3-Benzyl-5-Methyleneoxazolidin-2-one from N-Benzylprop-2-yn-1-Amine and CO2Qing-Wen Song and Liang-Nian HeReaction 2: Synthesis of the 5-Membered Cyclic Carbonates from Epoxides and CO2Qing-Wen Song, Liang-Nian HePart I: Green Methods for the Epoxidation of

  8. Aggressive HIV-1?

    OpenAIRE

    van der Hoek Lia; de Ronde Anthony; Berkhout Ben

    2005-01-01

    Abstract New York City health officials announced on February 11, 2005 that a patient rapidly developed full-blown AIDS shortly after being diagnosed with a rare, drug-resistant strain of HIV-1. The New York City Department of Health issued an alert to all hospitals and doctors and a press conference was held to announce the emergence of an aggressive HIV-1 strain that may be difficult to treat and that appears to trigger rapid progression to AIDS. Is the panic justified?

  9. Microelectronic systems 1 checkbook

    CERN Document Server

    Vears, R E

    2013-01-01

    Microelectronic Systems 1 Checkbook provides coverage of the Business and Technician Education Council level 1 unit in Microelectronic Systems. However, it can be regarded as a basic textbook in microelectronic systems for a much wider range of studies. Each topic considered in the text is presented in a way that assumes the reader has little prior knowledge of electronics. The aim of the book is to provide an introduction to the concept of systems, to differentiate analogue and digital systems, and to describe the nature of microprocessor-controlled systems. An introduction to programming is

  10. CYP7B1

    DEFF Research Database (Denmark)

    Roos, P; Svenstrup, K; Danielsen, E R;

    2014-01-01

    UNLABELLED: The SPG5A subtype of Hereditary Spastic Paraplegia (HSP) is a rare autosomal recessive neurodegenerative disorder caused by mutations in the CYP7B1 gene, which encodes a steroid cytochrome P450 7α-hydroxylase. This enzyme provides the primary metabolic route for neurosteroids. Clinica......UNLABELLED: The SPG5A subtype of Hereditary Spastic Paraplegia (HSP) is a rare autosomal recessive neurodegenerative disorder caused by mutations in the CYP7B1 gene, which encodes a steroid cytochrome P450 7α-hydroxylase. This enzyme provides the primary metabolic route for neurosteroids...

  11. ROCSAT-1 telecommunication experiments

    Science.gov (United States)

    Chang, J. F.; Taur, R. R.; Chu, T. H.; Li, H. S.; Su, Y. T.; Kiang, Y. W.; Su, S. L.; Shih, M. P.; Lin, H. D.; Chung, C. D.

    This paper addresses a telecommunication payload project approved by the R.O.C. NSPO's ROCSAT-1 space program. This project will enable several innovative experiments via the low-earth-orbit satellite ROCSAT-1, including multipath fading channel characterization, ionospheric scintillation measurement, real-time voice communications, and CDMA data communications. A unified L/S-band transponder payload is proposed for conducting these experiments in an efficient way. The results of these experiments would provide the evolving mobile communication communities with fruitful information.

  12. Fessenheim 1, 1989

    International Nuclear Information System (INIS)

    10 years after the preservice inspection in 1979, French legislation required the Fessenheim 1 900 MW reactor unit to undergo specific inspections necessitating a long-duration shut-down. EDF, the French Electricity Board, decided to take advantage of the shut-down to make major improvements to safety, fire detection and fire-fighting systems. Fessenheim 1 was shut down on April 7th 1989 and reconnected to the grid on October 14th in the same year. The overall operation was brought to a successful conclusion. This paper reviews the objectives and preparatives for the operation, describes the key phases and summarizes the main benefits

  13. 26 CFR 1.85-1 - Unemployment compensation.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Unemployment compensation. 1.85-1 Section 1.85-1...) INCOME TAXES (CONTINUED) Items Specifically Included in Gross Income § 1.85-1 Unemployment compensation... unemployment compensation (as defined in paragraph (b)(1) of this section) paid in taxable years...

  14. 26 CFR 1.1201-1 - Alternative tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Alternative tax. 1.1201-1 Section 1.1201-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Wash Sales of Stock Or Securities § 1.1201-1 Alternative tax. (a) Corporations—(1)...

  15. 26 CFR 1.74-1 - Prizes and awards.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Prizes and awards. 1.74-1 Section 1.74-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Items Specifically Included in Gross Income § 1.74-1 Prizes and awards. (a) Inclusion in gross income. (1) Section...

  16. 2009 H1N1 Flu Vaccine Facts

    Science.gov (United States)

    ... page please turn Javascript on. Feature: Flu 2009 H1N1 Flu Vaccine Facts Past Issues / Fall 2009 Table ... of the H1N1 flu vaccine. 1 The 2009 H1N1 flu vaccine is safe and well tested. Clinical ...

  17. Main: O2F1BE2S1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available O2F1BE2S1 S000162 17-May-1998 (last modified) kehi opaque-2 recognition site F1 in Bertholle...quences of be2S1 promoter; F1 is hybrid C/G box; O2; opaque-2; be2S1; F1; seed; Brazil nut tree (Bertholletia excelsa); TCCACGTCGA ...

  18. 26 CFR 1.815-1 - Taxable years affected.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Taxable years affected. 1.815-1 Section 1.815-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Distributions to Shareholders § 1.815-1 Taxable years affected. Sections 1.815-2 through...

  19. 26 CFR 1.148-1A - Definitions and elections.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Definitions and elections. 1.148-1A Section 1.148-1A Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX....148-1A Definitions and elections. (a) . For guidance see § 1.148-1. (b) Certain...

  20. 26 CFR 1.381(c)(5)-1 - Inventories.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Inventories. 1.381(c)(5)-1 Section 1.381(c)(5)-1...) INCOME TAXES Insolvency Reorganizations § 1.381(c)(5)-1 Inventories. (a) Carryover requirement—(1... which inventories are received by the acquiring corporation (as defined in § 1.381(a)-1(b)(2))...

  1. Synthesis of Pandamarilactone-1

    OpenAIRE

    Seah, Kang Yee; Macnaughton, Sarah J.; Dallimore, Jonathan W. P.; Robertson, Jeremy

    2014-01-01

    The first total synthesis of pandamarilactone-1, an alkaloid of Pandanus amaryllifolius, is reported. The nine-step synthesis features furan oxidation with singlet oxygen and then spiro-N,O-acetalization and elimination to generate the natural product and further Pandanus alkaloids, pandamarilactonines A–D.

  2. IDEA papers no. 1

    International Nuclear Information System (INIS)

    The Information network on the Economic Development in Aquitaine (IDEA) aims to collect and spread the environmental information concerning the Aquitaine, in order to implement an observatory of the regional environment and of the sustainable development. The IDEA paper no. 1 provides information such as, meeting, Internet addresses and programs, for the month of April 2002. (A.L.B.)

  3. 3.1 Introduction

    Science.gov (United States)

    Kramer, H.-M.

    This document is part of Subvolume A 'Fundamentals and Data in Radiobiology, Radiation Biophysics, Dosimetry and Medical Radiological Protection' of Volume 7 'Medical Radiological Physics' of Landolt-Börnstein - Group VIII 'Advanced Materials and Technologies'. It contains the Section '3.1 Introduction' of the Chapter '3 Dosimetry in Diagnostic Radiology and Radiotherapy'.

  4. 2.1 Introduction

    Science.gov (United States)

    Bernhardt, J. H.; Kasch, K.-U.; Kaul, A.

    This document is part of Subvolume A 'Fundamentals and Data in Radiobiology, Radiation Biophysics, Dosimetry and Medical Radiological Protection' of Volume 7 'Medical Radiological Physics' of Landolt-Börnstein - Group VIII 'Advanced Materials and Technologies'. It contains the Section '2.1 Introduction' of the Chapter '2 Radiation and Biological Effects'.

  5. 5.1 Introduction

    Science.gov (United States)

    Almén, A.; Valentin, J.

    This document is part of Subvolume A 'Fundamentals and Data in Radiobiology, Radiation Biophysics, Dosimetry and Medical Radiological Protection' of Volume 7 'Medical Radiological Physics' of Landolt-Börnstein - Group VIII 'Advanced Materials and Technologies'. It contains the Section '5.1 Introduction' of the Chapter '5 Medical Radiological Protection' with the contents:

  6. 4.1 Introduction

    Science.gov (United States)

    Noßke, D.; Mattsson, S.; Johansson, L.

    This document is part of Subvolume A 'Fundamentals and Data in Radiobiology, Radiation Biophysics, Dosimetry and Medical Radiological Protection' of Volume 7 'Medical Radiological Physics' of Landolt-Börnstein - Group VIII 'Advanced Materials and Technologies'. It contains the Section '4.1 Introduction' of the Chapter '4 Dosimetry in Nuclear Medicine Diagnosis and Therapy' with the contents:

  7. Main: AMYBOX1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMYBOX1 S000020 17-May-1998 (last modified) kehi amylase box; Conserved sequence found in 5'-ups ... tream region of alpha-amylase gene of rice, wheat , barley; amylase; seed; barley (Hordeum vulgare); ... rice (Oryza sativa); wheat ... (Triticum aestivum) TAACARA ...

  8. Reference: CACTFTPPCA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CACTFTPPCA1 Gowik U, Burscheidt J, Akyildiz M, Schlue U, Koczor M, Streubel M, Westhoff P. cis-R ... ents for mesophyll-specific gene expression in the C4 ... plant Flaveria trinervia, the promoter of the C4 ... p ...

  9. Synthesis de 1-dotriacotanol

    International Nuclear Information System (INIS)

    In order to prepare isotopic labeled long chain aliphatic primary alcohol's, the synthesis overall yielding and chemical purity of 1-dotriacotanol were 41% and 98%, respectively. This procedure is very useful for carbon-14 and tritium labeling at Beta position of saturated fatty alcohol's

  10. IUPHAR Review 1

    DEFF Research Database (Denmark)

    Harmar, Anthony J; Fahrenkrug, Jan; Gozes, Illana;

    2012-01-01

    in the control of circadian rhythms, learning and memory, anxiety and responses to stress and brain injury. Recent genetic studies also implicate the VPAC(2) receptor in susceptibility to schizophrenia and the PAC(1) receptor in post-traumatic stress disorder. In the periphery, VIP and PACAP play important roles...

  11. Type 1 Diabetes Facts

    Science.gov (United States)

    ... levels 6 T1D is associated with an estimated loss of life-expectancy of up to 13 years 7 Warning ... urination Drowsiness or lethargy Increased appetite Sudden weight ... it’s difficult. It’s upsetting. It’s life threatening. It never goes away. But at the ...

  12. Reference: RSEPVGRP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ter, domain A of the 35S promoter and the 35S^2 promoter. Transgenic Res 4:388-396 (1995) PubMed: 7581519; ... ...RSEPVGRP1 Elmayan T, Tepfer M Evaluation in tobacco of the organ specificity and strength of the rol D promo

  13. Sampler bias -- Phase 1

    International Nuclear Information System (INIS)

    This documents Phase 1 determinations on sampler induced bias for four sampler types used in tank characterization. Each sampler, grab sampler or bottle-on-a-string, auger sampler, sludge sampler and universal sampler, is briefly discussed and their physical limits noted. Phase 2 of this document will define additional testing and analysis to further define Sampler Bias

  14. A Distributed Tier-1

    DEFF Research Database (Denmark)

    Fischer, Lars; Grønager, Michael; Kleist, Josva;

    2008-01-01

    organization but instead is a meta-center built of resources under the control of a number of different national organizations. We present some technical implications of these aspects as well as the high-level design of this distributed Tier-1. The focus will be on computing services, storage and monitoring....

  15. SL-1 recovery experience

    International Nuclear Information System (INIS)

    A pinhole camera was used to establish the spatial distribution of the radioactivity in the SL-1 reactor after the January 3, 1961 accident. The difficulties of photographing the top of the reactor are described. A shielded box was used in cutting in order to obtain access to the reactor. A shielded cherry picker and other equipment shielding improvisations are described. 12 figures

  16. Code A1 Revised

    CERN Multimedia

    SC Secretariat

    2004-01-01

    Please note that the revised safety code A1 entitled 'MEDICAL CODE' is available on the web at the following url: https://edms.cern.ch/document/335476/last_released Paper copies can also be obtained from the SC Secretariat, e-mail : sc.secretariat@cern.ch SC Secretariat

  17. Editorial 9 (1

    Directory of Open Access Journals (Sweden)

    Jana Dlouhá

    2014-05-01

    [1] A further issue which will be comprised of regional sustainability case studies (working title "Social learning processes for regional sustainable development", see here is still under preparation. Shorter examples of regional development highlighting the roles of its actors are welcome to be included in non-research sections or into the related database.

  18. county_1m

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — This is a raster grid dataset (1-Meter Resolution) of the ground points derived from the acquired LiDAR. The Light Detection and Ranging (LiDAR) DEM dataset is a...

  19. Intersection I-1

    CERN Multimedia

    1971-01-01

    Intersection I-1 of the ISR in August 1971 showing the 90 degree large acceptance spectrometer of the Saclay-Strasbourg Collaboration which is studying the momentum spectra of electrons at large angles. On the left of the crossing region can be seen the track used by the CERN-Bucharest-Cracow-Tata Collaboration to bring nuclear emulsions into the ISR.

  20. Improving surface smoothness and photoluminescence of CdTe(1 1 1)A on Si(1 1 1) substrates grown by molecular beam epitaxy using Mn atoms

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Jyh-Shyang, E-mail: jswang@cycu.edu.tw [Department of Physics, Chung Yuan Christian University, Chung-Li 32023, Taiwan (China); Center for Nano-Technology, Chung Yuan Christian University, Chung-Li 32023, Taiwan (China); Tsai, Yu-Hsuan; Chen, Chang-Wei; Dai, Zi-Yuan; Tong, Shih-Chang [Department of Physics, Chung Yuan Christian University, Chung-Li 32023, Taiwan (China); Yang, Chu-Shou [Graduate Institute of Electro-Optical Engineering, Tatung University, Taipei 10452, Taiwan (China); Wu, Chih-Hung [Institute of Nuclear Energy Research, Longtan 32546, Taiwan (China); Yuan, Chi-Tsu; Shen, Ji-Lin [Department of Physics, Chung Yuan Christian University, Chung-Li 32023, Taiwan (China); Center for Nano-Technology, Chung Yuan Christian University, Chung-Li 32023, Taiwan (China)

    2014-04-01

    Highlights: • CdTe(1 1 1)A epilayers were grown on Si(1 1 1) substrates by molecular beam epitaxy. • We report an enhanced growth using Mn atoms. • The significant improvements in surface quality and optical properties were found. - Abstract: This work demonstrates an improvement of the molecular beam epitaxial growth of CdTe(1 1 1)A epilayer on Si(1 1 1) substrates using Mn atoms. The reflection high-energy electron diffraction patterns show that the involvement of some Mn atoms in the growth of CdTe(1 1 1)A is even more effective than the use of a buffer layer with a smooth surface for forming good CdTe(1 1 1)A epilayers. 10 K Photoluminescence spectra show that the incorporation of only 2% Mn significantly reduced the intensity of defect-related emissions and considerably increased the integral intensity of exciton-related emissions by a large factor of about 400.

  1. Crystalline 1H-1,2,3-triazol-5-ylidenes

    Energy Technology Data Exchange (ETDEWEB)

    Bertrand, Guy; Gulsado-Barrios, Gregorio; Bouffard, Jean; Donnadieu, Bruno

    2016-08-02

    The present invention provides novel and stable crystalline 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of making 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of using 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes in catalytic reactions.

  2. Protein: MPB1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPB1 Related chemokines CCL3 G0S19-1, MIP1A, SCYA3 C-C motif chemokine 3 G0/G1 switch regulatory ... ein 19-1, Macrophage inflammatory protein 1-alpha, PAT ... 464.1, SIS-beta, Small-inducible cytokine A3, Tons ...

  3. Synthesis of novel (1-alkanoyloxy-4-alkanoylaminobutylidene)-1,1-bisphosphonic acid derivatives

    OpenAIRE

    Vepsäläinen Jouko J; Turhanen Petri A

    2006-01-01

    Abstract A novel strategy for the synthesis of (1-alkanoyloxy-4-alkanoylaminobutylidene)-1,1-bisphosphonic acid derivatives (1a-d) via (1-hydroxy-4-alkanoylaminobutylidene)-1,1-bisphosphonic acid derivatives (2a-d), starting from alendronate has been developed with reasonable 51–77% overall yields. Intermediate products, (1-hydroxy-4-alkanoylaminobutylidene)-1,1-bisphosphonic acid derivatives (2a-d), were prepared in water with reasonable to high yields (52–94%).

  4. Synthesis of novel (1-alkanoyloxy-4-alkanoylaminobutylidene-1,1-bisphosphonic acid derivatives

    Directory of Open Access Journals (Sweden)

    Vepsäläinen Jouko J

    2006-02-01

    Full Text Available Abstract A novel strategy for the synthesis of (1-alkanoyloxy-4-alkanoylaminobutylidene-1,1-bisphosphonic acid derivatives (1a-d via (1-hydroxy-4-alkanoylaminobutylidene-1,1-bisphosphonic acid derivatives (2a-d, starting from alendronate has been developed with reasonable 51–77% overall yields. Intermediate products, (1-hydroxy-4-alkanoylaminobutylidene-1,1-bisphosphonic acid derivatives (2a-d, were prepared in water with reasonable to high yields (52–94%.

  5. 26 CFR 1.812-1 - Taxable years affected.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES Gain and Loss from Operations § 1.812-1 Taxable years affected. Sections 1.812-2 through 1... Internal Revenue Code of 1954, as amended by the Life Insurance Company Income Tax Act of 1959 (73...

  6. NZMATH 1.0

    CERN Document Server

    Tanaka, Satoru; Nakamula, Ken; Matsui, Tetsushi; Uchiyama, Shigenori

    2010-01-01

    This is an announcement of the first official release ver.1.0 of a Python system NZMATH for number theory. We overview all functions in NZMATH 1.0, show main properties after former report on NZMATH 0.5.0, and describe new features for stable development. The most important point of the release is that we can now treat number fields. The second big change is that new type of polynomial programs are provided. Elliptic curve primality proving and its related programs are also available, where we partly use a library outside NZMATH as an advantage of writing the system only by Python. On method of development, a new feature is that NZMATH is registered on SourceForge as an open source project to keep continuous development of the project. This is a unique attempt among existing systems for number theory.

  7. Ferrocene-1-carbaldehyde thiosemicarbazone

    Directory of Open Access Journals (Sweden)

    M. R. Vikneswaran

    2010-06-01

    Full Text Available The asymmetric unit of the title compound, [Fe(C5H5(C7H8N3S], consists of two crystallographically independent molecules, A and B. The cyclopentadienyl (Cp rings in both molecules adopt an eclipsed conformation and are parallel to each other, forming dihedral angles of 2.5 (3 and 1.1 (3°, respectively. The mean plane of the semicarbazone group is coplanar with the attached Cp ring in molecule A, whereas it is twisted away in molecule B. In the crystal structure, intermolecular N—H...S hydrogen bonds link the molecules into two-dimensional planes parallel to the ab plane. The structure is further consolidated by C—H...π interactions.

  8. AAU-BOT1

    DEFF Research Database (Denmark)

    Svendsen, Mads Sølver; Helbo, Jan; Hansen, Michael Rygaard;

    2009-01-01

    This paper describes the development of the humanoid robot AAU-BOT1. The purpose of the robot is to investigate human-like walking and in this connection, test prosthetic limbs. AAU-BOT1 has been designed with modularity in mind making it possible to replace, e.g. the lower leg to test transfemoral...... Systems at Aalborg University and supported by the Department of Health Sciences and Technology (HST). To further reduce the cost, the robot uses off-the-shelf hardware which also reduced the time from idea to practical implementation. The result is a low-cost humanoid robot fully assembled and equipped...... or transtibial prosthesis or orthosis. Recorded motion data from a male test person, along with approximated inertial and mass properties, were used to determine necessary joint torques in human walking which was used as design parameters for the robot. The robot has 19 degrees of freedom (DoF), 17...

  9. Summary: after LS1

    International Nuclear Information System (INIS)

    After LS1 the energy will be about 6.5 TeV. The physics potential of LHC is determined by the integrated luminosity useful for the experiments and not only by the peak luminosity. The integrated luminosity is determined by the peak luminosity, the luminosity decay and the efficiency of operation (availability). In this session two of these parameters are addressed, the peak luminosity and the availability. In this paper peak luminosity is discussed through the performance potential of the injectors and through the global performance reach of LHC after LS1. LHC availability is tackled through the issues of the reliability of the magnet powering and of the beam system and of the occurrence of quenches

  10. Evaluation report no.1

    International Nuclear Information System (INIS)

    This document, which is the first evaluation report from the French National Evaluation Commission about research on radioactive waste management, was sent to the French Government on June 30, 1995. The Commission was created in January 1994 and started its investigations on April 1994. The evaluation concerns the three axes of the 91-1381 law from December 30, 1991 (1 - separation-transmutation and minimization of wastes, 2 - underground disposal, 3 - choices for conditioning, storage and disposal). The document has been written after hearing of the principal French research organisms. The report focusses on the necessity for a scientific and technical coordination between all the organisms concerned, for a consistent and open analysis of all research topics. This implies a compatibility between schedules and specifications, and with the 15 years allowed by the law. (J.S.). 15 figs., 14 tabs., 4 annexes., 1 glossary

  11. Physics. Module 1. Mechanics

    OpenAIRE

    Бовтрук, Алла Георгіївна; Мєняйлов, Сергій Миколайович; Максимов, Сергій Леонідович; Поліщук, Аркадій Петрович

    2009-01-01

    Ukraine’s joining Bologna process requires creating new books in physics (in English in particular). The book is developed for all forms of studying physics on the Credit-based Modular System basis in higher school. «Physics. Module 1. Mechanics» presents Newtonian mechanics and Special theory of relativity. It contains eight Study Units which include theoretical information, test questions, sample problems, laboratory works and individual home tasks. It is designed for students of engi...

  12. Euroconstruction Report 1

    OpenAIRE

    Gunnigan, Louis; ORR, TREVOR

    1998-01-01

    This report was prepared on behalf of the Construction Industry Federation as Ireland’s initial contribution to the Leonardo da Vinci Project: Euroconstruction. The report is divided into 3 sections. Section 1 concentrates on the recent and likely future changes in the structure of the Irish construction market and the impact of these changes on project management and project financing. The recent growth of the industry is documented and predictions for the future of the industry in Ire...

  13. Muons in UA1

    International Nuclear Information System (INIS)

    In the years 1987-1989 the experiment ('UA1'), which is described in this thesis, has focused on measurements with muons. These particles can be considered as a part of the 'fingerprint' of interesting reactions. In the practice of 'UA1', recognizing this 'fingerprint' represents a puzzle because many (often more than hundred particles are produced in a collision between a proton and an anti-proton. In the experiment the properties (charge, energy, direction) of these particles are measured and subsequently the events are reconstructed. This results in several event samples corresponding to specific production mechanisms. The first part (ch. 1-5) of this thesis deals with the muon trigger of the UA1 experiment. This is a computer system that, directly after a measurement, reconstructs an event and checks for the presence of muons. If no muon is found the event is not considered anymore. In the other cases, the event is kept and written to magnetic tape. These tapes are for further analysis. The necessity of a trigger follows from the fact that per second more than 250.000 interactions occur and only about 10 can be saved on tape. For this reason a trigger system is of critical importance: all events not written to tape are lost. In ch. 2 the experiment and in ch. 4 the ideas and constraints of the trigger are explained. Ch. 4 discusses the construction and functioning of the muon trigger and ch. 5 presents the performance. The second part of this thesis (ch.'s 6 and 7) contain the physics analysis results from data collected with muon trigger. These results are explicitly obtained from events containing two muons. The theory is briefly reviewed and a discussion is given of the data and the way the selections are done. Finally the J/Ψ and Γ samples and the cross sections of b-quark production are given. (author). 57 refs.; 60 figs.; 8 tabs

  14. UOA1: Hardware Manual

    Energy Technology Data Exchange (ETDEWEB)

    Wolfers, G.; Sanchez, E.

    2012-07-01

    The UOA1 is a versatile printed circuit board which can be configured to accommodate up to four analogue signal channels of either electrical to optical or optical to electrical converters. A charge-balance voltage to frequency technique is used for the conversion. The board can be adapted to different electrical input or output range and the full scale frequency can be adjusted to provide the best accuracy-to bandwidth compromise for each application. (Author)

  15. Chapter 1: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2009-01-18

    The Office of Energy Efficiency and Renewable Energy (EERE) develops–and encourages consumers and business to adopt–technologies that improve energy efficiency and increase the use of renewable energy. This report describes analysis undertaken by EERE to better understand the extent to which the technologies and market improvements funded by its FY 2004 Budget Request1 will make energy more affordable, cleaner, and more reliable.

  16. Protein expression of CYP1A1, CYP1B1, ALDH1A1, and ALDH2 in young patients with oral squamous cell carcinoma.

    Science.gov (United States)

    Kaminagakura, E; Caris, A; Coutinho-Camillo, C; Soares, F A; Takahama-Júnior, A; Kowalski, L P

    2016-06-01

    The purpose of this study was to evaluate the expression of the enzymes involved in the biotransformation of tobacco and alcohol. A study group of 41 young patients (≤40 years old) with oral squamous cell carcinoma (OSCC) was compared to 59 control subjects (≥50 years old) with tumours of similar clinical stages and topographies. The immunohistochemical expression of CYP1A1, CYP1B1, ALDH1A1, and ALDH2 was evaluated using the tissue microarray technique. There was a predominance of males, smokers, and alcohol drinkers in both groups. Most tumours were located in the tongue (43.9% vs. 50.8%), were well-differentiated (63.4% vs. 56.6%), and were in clinical stages III or IV (80.5% vs. 78.0%). No difference was observed in the expression of CYP1A1, ALDH1A1, or ALDH2 between the two groups. CYP1A1 and ALDH2 protein expression had no influence on the prognosis. The immunoexpression of CYP1B1 was significantly higher in the control group than in the young group (Pexpression improved relapse-free survival in young patients. These results suggest a lower risk of recurrence with increased metabolism of carcinogens by CYP1B1. Further studies involving other genes and proteins are necessary to complement the results of this research. PMID:26944893

  17. Indico 1.0

    Science.gov (United States)

    Gonzalez Lopez, J. B.; Avilés, A.; Baron, T.; Ferreira, P.; Kolobara, B.; Pugh, M. A.; Resco, A.; Trzaskoma, J. P.

    2014-06-01

    Indico has evolved into the main event organization software, room booking tool and collaboration hub for CERN. The growth in its usage has only accelerated during the past 9 years, and today Indico holds more that 215,000 events and 1,100,000 files. The growth was also substantial in terms of functionalities and improvements. In the last year alone, Indico has matured considerably in 3 key areas: enhanced usability, optimized performance and additional features, especially those related to meeting collaboration. Along the course of 2012, much activity has centred around consolidating all this effort and investment into "version 1.0", recently released in 2013.Version 1.0 brings along new features, such as the Microsoft Exchange calendar synchronization for participants, many new and clean interfaces (badges and poster generation, list of contributions, abstracts, etc) and so forth. But most importantly, it brings a message: Indico is now stable, consolidated and mature after more than 10 years of non-stop development. This message is addressed not only to CERN users but also to the many organisations, in or outside HEP, which have already installed the software, and to others who might soon join this community. In this document, we describe the current state of the art of Indico, and how it was built. This does not mean that the Indico software is complete, far from it! We have plenty of new ideas and projects that we are working on and which we have shared during CHEP 2013.

  18. Indico 1.0

    CERN Document Server

    Lopez, J B Gonzalez; Baron, T; Ferreira, P; Kolobara, B; Pugh, M A; Resco, A; Trzaskoma, J P

    2014-01-01

    Indico has evolved into the main event organization software, room booking tool and collaboration hub for CERN. The growth in its usage has only accelerated during the past 9 years, and today Indico holds more that 215,000 events and 1,100,000 files. The growth was also substantial in terms of functionalities and improvements. In the last year alone, Indico has matured considerably in 3 key areas: enhanced usability, optimized performance and additional features, especially those related to meeting collaboration. Along the course of 2012, much activity has centred around consolidating all this effort and investment into 'version 1.0', recently released in 2013.Version 1.0 brings along new features, such as the Microsoft Exchange calendar synchronization for participants, many new and clean interfaces (badges and poster generation, list of contributions, abstracts, etc) and so forth. But most importantly, it brings a message: Indico is now stable, consolidated and mature after more than 10 years of non-stop de...

  19. AMF 1 Site Science

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Mark Alan [Rutgers Univ., New Brunswick, NJ (United States)

    2016-08-18

    This report documents progress on DOE Grant# DE-FG02-08ER64531 funded by the Department of Energy’s Atmospheric Systems Research (ASR) program covering the period between its inception in 2008 and its conclusion in 2014. The Atmospheric Radiation Measurement (ARM) Program’s Mobile Facility #1 (AMF#1) is a collection of state-of-the art atmospheric sensing systems including remote and in situ instrumentation designed to characterize the atmospheric column above and in the immediate vicinity of the deployment location. The grant discussed in this report funded the activities of the AMF#1 Site Scientist Team. Broad responsibilities of this team included examining new deployment sites and recommending instrument deployment configurations; data quality control during the early stages of deployments and for certain instruments through the course of the deployment; scientific outreach in the host country or location (particularly international deployments); scientific research oriented toward basic questions about cloud physics and radiation transfer in the deployment region; and training of Ph.D. students to conduct future research relevant to the Atmospheric Systems Research (ASR) program.

  20. Point 1 Updates

    CERN Multimedia

    Inigo-Golfin, J.

    The ATLAS experimental area is located in Point 1, just across the main CERN entrance, in the commune of Meyrin. There people are ever so busy to finish the different infrastructures for ATLAS. Not only has Civil Engineering finished the construction of the USA15 technical cavern, but the excavation of the main UX15 cavern has resumed below the machine tunnel, after a brief halt to allow the construction of the UJ-caverns for the power converters of the LHC machine. The excavation work should end in August 2002. The UX15 hand-over to ATLAS is expected in April 2003. On the surface civil engineering is starting to complete the last two surface buildings (SDX1 and SH1), once the services (cooling pipes, ventilation ducts and the largest item, the lift modules and its lift of course) in the shaft PX15 have been completed. But the civil engineering is not all. A lot more is under way. The site installation of the steel structures in the caverns is to begin in Autumn, along with all the cooling pipes, airconditi...

  1. Intestinal and Hepatic Niemann-Pick C1-Like 1

    OpenAIRE

    Sung-Woo Park

    2013-01-01

    Polytopic transmembrane protein, Niemann-Pick C1-Like 1 (NPC1L1) is localized at the apical membrane of enterocytes and the canalicular membrane of hepatocytes. It mediates intestinal cholesterol absorption and prevents extensive loss of cholesterol by transporting biliary cholesterol into hepatocytes. NPC1L1 is a molecular target of ezetimibe, an agent for hypercholesterolemia. Recently, NPC1L1 inhibition has been shown to prevent metabolic disorders such as fatty liver disease, obesity, dia...

  2. 26 CFR 1.51-1 - Amount of credit.

    Science.gov (United States)

    2010-04-01

    ... of the assistance unit (within the meaning of 45 CFR 205.40(a)(1)) that the individual is a member of... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Amount of credit. 1.51-1 Section 1.51-1 Internal... Credit for Expenses of Work Incentive Programs § 1.51-1 Amount of credit. (a) Determination of...

  3. 26 CFR 1.168(i)-1 - General asset accounts.

    Science.gov (United States)

    2010-04-01

    ... effect prior to June 17, 2004 (§ 1.168(i)-1(b)(1) as contained in 26 CFR part 1 edition revised as of... section 446(e) apply. However, if a taxpayer adopted a method of accounting for general asset account... February 27, 2004 (§ 1.168(i)-1 as contained in 26 CFR part 1 edition revised as of April 1, 2003)....

  4. Universal graphs at $\\aleph_{\\omega_1+1}$

    OpenAIRE

    Davis, Jacob

    2016-01-01

    Starting from a supercompact cardinal we build a model in which $2^{\\aleph_{\\omega_1}}=2^{\\aleph_{\\omega_1+1}}=\\aleph_{\\omega_1+3}$ but there is a jointly universal family of size $\\aleph_{\\omega_1+2}$ of graphs on $\\aleph_{\\omega_1+1}$. The same technique will work for any uncountable cardinal in place of $\\omega_1$.

  5. Sequential Seasonal H1N1 Influenza Virus Infections Protect Ferrets against Novel 2009 H1N1 Influenza Virus

    OpenAIRE

    Carter, Donald M.; Bloom, Chalise E.; Nascimento, Eduardo J. M.; Marques, Ernesto T.A.; Craigo, Jodi K.; Cherry, Joshua L.; Lipman, David J.; Ross, Ted M.

    2013-01-01

    Individuals 60 years old also had preexisting antibodies to novel H1N1. These observations are puzzling because the seasonal H1N1 viruses circulating during the last 60 years were not antigenically similar to novel H1N1. We therefore hypothesized that a sequence of exposures to antigenically different seasonal H1N1 viruses can elicit an antibody response that protects against novel 2009 H1N1. Ferrets were preinfected with seasonal H1N1 viruses and assessed for cross-reactive antibodies to nov...

  6. 26 CFR 1.471-1 - Need for inventories.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 6 2010-04-01 2010-04-01 false Need for inventories. 1.471-1 Section 1.471-1...) INCOME TAXES Inventories § 1.471-1 Need for inventories. In order to reflect taxable income correctly, inventories at the beginning and end of each taxable year are necessary in every case in which the...

  7. 26 CFR 1.305-1 - Stock dividends.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Stock dividends. 1.305-1 Section 1.305-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Effects on Recipients § 1.305-1 Stock dividends. (a) In general. Under section 305, a distribution made by a corporation to...

  8. 26 CFR 1.1464-1 - Refunds or credits.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Refunds or credits. 1.1464-1 Section 1.1464-1...) INCOME TAXES Application of Withholding Provisions § 1.1464-1 Refunds or credits. (a) In general. The refund or credit under chapter 65 of the Code of an overpayment of tax which has actually been...

  9. 26 CFR 1.7701(l)-1 - Conduit financing arrangements.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Conduit financing arrangements. 1.7701(l)-1 Section 1.7701(l)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES General Actuarial Valuations § 1.7701(l)-1 Conduit...

  10. 26 CFR 1.164-1 - Deduction for taxes.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Deduction for taxes. 1.164-1 Section 1.164-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.164-1 Deduction...

  11. 26 CFR 1.282-1.300 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false 1.282-1.300 Section 1.282-1.300 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Terminal Railroad Corporations and Their Shareholders §§ 1.282-1.300...

  12. 26 CFR 1.536-1 - Short taxable years.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Short taxable years. 1.536-1 Section 1.536-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.536-1 Short...

  13. 26 CFR 1.531-1 - Imposition of tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Imposition of tax. 1.531-1 Section 1.531-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.531-1 Imposition...

  14. Sintesis Molibdenum Oksida Berpenyangga Silika sebagai Katalis pada Reaksi Oksidasi Etanol Menjadi Asetaldehida

    Directory of Open Access Journals (Sweden)

    Achyar Rasyidi

    2015-06-01

    Full Text Available Oksidasi etanol membentuk asetaldehida dengan menggunakan katalis molibdenum oksida berpenyangga silika oksida telah dilakukan. Preparasi katalis dilakukan dengan metode impregnasi dengan rasio Mo : Si 1 : 1, 3 : 1, 6 : 1, 9 : 1. Karakterisasi katalis dilakukan menggunakan X-Ray Difractometer (XRD. Hasil identifikasi menunjukkan bahwa komponen katalis yang telah dibuat mengandung kristal MoO3 dan SiO2. Uji kinerja katalis dilakukan terhadap reaksi oksidasi etanol menjadi asetaldehida. Reaksi oksidasi dilangsungkan dalam reaktor pipa lurus berunggun tetap yang beroperasi pada suhu 200oC, 225oC, 250oC, 275oC, 300oC, 325oC, dan 350oC pada tekanan atmosfir. Hasil uji kinerja menunjukkan bahwa konversi tertinggi diperoleh sebesar 91,99% pada temperatur 350oC menggunakan katalis dengan rasio Mo : Si = 9 : 1. Selektivitas tertinggi diperoleh sebesar 89,10% pada temperatur 200oC dengan rasio Mo : Si = 9 : 1. Yield tertinggi diperoleh sebesar 74,80% pada temperatur 350oC pada katalis dengan rasio Mo : Si = 9 : 1.

  15. Main: AS1LIKECSHPRA [PLACE

    Lifescience Database Archive (English)

    Full Text Available AS1LIKECSHPRA S000260 14-Oct-1999 (last modified) kehi as-1-like motif found in cucumber ... (C.s.) ... YTOSITECSHPRA); cytokinin; as-1; as-1 TGACG motif; cucumber ... (Cucumis sativus) AAATGACGAAAATGC ...

  16. The 2009 H1N1 Pandemic Influenza in Korea

    OpenAIRE

    Kim, Jae Yeol

    2016-01-01

    In late March of 2009, an outbreak of influenza in Mexico, was eventually identified as H1N1 influenza A. In June 2009, the World Health Organization raised a pandemic alert to the highest level. More than 214 countries have reported confirmed cases of pandemic H1N1 influenza A. In Korea, the first case of pandemic influenza A/H1N1 infection was reported on May 2, 2009. Between May 2009 and August 2010, 750,000 cases of pandemic influenza A/H1N1 were confirmed by laboratory test. The H1N1-rel...

  17. Characterisation of polymers, 1

    CERN Document Server

    Crompton, Roy

    2008-01-01

    This essential guide to Polymer Characterisation is a complete compendium of methodologies that have evolved for the determination of the chemical composition of polymers. This 478-page book gives an up-to-date and thorough exposition of the state-of-the-art theories and availability of instrumentation needed to effect chemical and physical analysis of polymers. This is supported by approximately 1200 references. Volume 1 covers the methodology used for the determination of metals, non-metals and organic functional groups in polymers, and for the determination of the ratio in which different m

  18. Nuflood, Version 1.x

    Energy Technology Data Exchange (ETDEWEB)

    2016-07-29

    NUFLOOD Version 1.x is a surface-water hydrodynamic package designed for the simulation of overland flow of fluids. It consists of various routines to address a wide range of applications (e.g., rainfall-runoff, tsunami, storm surge) and real time, interactive visualization tools. NUFLOOD has been designed for general-purpose computers and workstations containing multi-core processors and/or graphics processing units. The software is easy to use and extensible, constructed in mind for instructors, students, and practicing engineers. NUFLOOD is intended to assist the water resource community in planning against water-related natural disasters.

  19. Nonlocal N=1 Supersymmetry

    CERN Document Server

    Kimura, Tetsuji; Noumi, Toshifumi; Yamaguchi, Masahide

    2016-01-01

    We construct $\\mathcal{N}=1$ supersymmetric nonlocal theories in four dimension. We discuss higher derivative extensions of chiral and vector superfields, and write down generic forms of K\\"ahler potential and superpotential up to quadratic order. We derive the condition in which an auxiliary field remains non-dynamical, and the dynamical scalars and fermions are free from the ghost degrees of freedom. We also investigate the nonlocal effects on the supersymmetry breaking and find that supertrace (mass) formula is significantly modified even at the tree level.

  20. Diabetes Mellitus Type 1

    OpenAIRE

    Trydal, Kari

    2015-01-01

    Hvert år får rundt 300 barn og 600 voksne diabetes mellitus type 1, og til sammen har rundt 28 000 personer denne sykdommen i Norge i dag. Det er en kronisk metabolsk sykdom, med en absolutt insulinmangel. Gjennom litteratur og forskning er det vist, at for å forebygge senkomplikasjoner, trenger pasienten informasjon, undervisning og praktisk veiledning når det gjelder medisinering, kosthold og fysisk aktivitet, og motivering til å mestre sykdommen. I praksis vil sykepleier spille en aktiv ro...

  1. Chandrayaan-1: Science goals

    Indian Academy of Sciences (India)

    N Bhandari

    2005-12-01

    The primary objectives of the Chandrayaan-1 mission are simultaneous chemical,mineralogical and topographic mapping of the lunar surface at high spatial resolution.These data should enable us to understand compositional variation of major elements,which in turn,should lead to a better understanding of the stratigraphic relationships between various litho units occurring on the lunar surface.The major element distribution will be determined using an X-ray fluorescence spectrometer (LEX),sensitive in the energy range of 1 –10 keV where Mg,Al,Si,Ca and Fe give their K lines.A solar X-ray monitor (SXM)to measure the energy spectrum of solar X-rays,which are responsible for the fluorescent X-rays,is included.Radioactive elements like Th will be measured by its 238.6 keV line using a low energy gamma-ray spectrometer (HEX)operating in the 20 –250 keV region.The mineral composition will be determined by a hyper-spectral imaging spectrometer (HySI)sensitive in the 400 –920 nm range.The wavelength range is further extended to 2600 nm where some spectral features of the abundant lunar minerals and water occur,by using a near-infrared spectrometer (SIR-2),similar to that used on the Smart-1 mission,in collaboration with ESA.A terrain mapping camera (TMC)in the panchromatic band will provide a three-dimensional map of the lunar surface with a spatial resolution of about 5 m.Aided by a laser altimeter (LLRI) to determine the altitude of the lunar craft,to correct for spatial coverage by various instruments, TMC should enable us to prepare an elevation map with an accuracy of about 10 m. Four additional instruments under international collaboration are being considered.These are: a Miniature Imaging Radar Instrument (mini-SAR),Sub Atomic Re flecting Analyser (SARA), the Moon Mineral Mapper (M3)and a Radiation Monitor (RADOM).Apart from these scientific payloads,certain technology experiments have been proposed,which may include an impactor which will be released to

  2. Technetium. Suppl. Vol. 1

    International Nuclear Information System (INIS)

    Volume 1 of the Gmelin-Handbook 'Technetium' describes the interesting story of its discovery, its separation in small quantities from natural minerals and in big quantities from radioactive waste solution together with all necessary analytical aspects. The up-to-date listing of the properties of the isotopes and isomers will help their identification as well as the description of the uses of 99Tc and sup(99m)Tc not only demonstrates the present state of knowledge but also may affect new studies. The volume is completed by chapters on recoil chemistry, its biological effects and the general properties of the atoms and the ion. (orig./RB)

  3. ISR Intersection 1

    CERN Multimedia

    1974-01-01

    The experimental apparatus used at intersection 1 by the CERN-Bologna Collaboration (experiment R105). It consists of two almost identical magnetic spectrometers centered at 90 degrees on opposite sides of the intersection region. In each spectrometer one can see magnetostrictive wire spark chambers, a magnet, more chambers and various hodoscopes of scintillation counters. Gas Cerenkov counters (almost invisible in the picture) are located in the gap of each magnet. On the left hand side, a matrix of 119 lead glass Cerenkov counters is located behind some concrete and iron shielding.

  4. Mosaic neurofibromatosis type 1.

    Science.gov (United States)

    Liang, Christine; Schaffer, Julie V

    2008-01-01

    A 24-year-old man presented with numerous lentigines and multiple cafe-au-lait macules on both sides of the face, neck, and trunk as well as on the proximal area of the upper extremities and in the axillae. The pigmented lesions had a Blaschko-linear distribution on the upper trunk and were limited to the left side of the abdomen, with a sharp demarcation at the midline. Multiple, cutaneous neurofibromas were found on the trunk, and ophthalmologic examination showed a Lisch nodule in the left iris. The clinical findings and their widespread but segmental distribution were consistent with a diagnosis of mosaic neurofibromatosis type 1. PMID:18627742

  5. Viability Assessment Volume 1

    International Nuclear Information System (INIS)

    Since May 1996, under its draft Civilian Radioactive Waste Management Program Plan (DOE 1996), DOE has been carrying out a 5-year program of work to support the decision in 2001 by the Secretary of Energy on whether or not to recommend the site to the President. Part of this program was to address major unresolved technical issues and to complete an assessment of the viability of the Yucca Mountain site by 1998. Affirming the DOE plans, Congress directed DOE in the 1997 Energy and Water Development Appropriations Act to provide a viability assessment of the Yucca Mountain site to Congress and the President. This Viability Assessment (VA) document is the DOE report to Congress and the President. They are expected to use the VA to make an informed decision about program direction and funding. Drawing on 15 years of scientific investigation and design work at Yucca Mountain, the VA summarizes a large technical basis of field investigations, laboratory tests, models, analyses, and engineering, described in cited references. The VA identifies the major uncertainties relevant to the technical defensibility of DOE analyses and designs, the DOE approach to managing these uncertainties, and the status of work toward the site recommendation and LA. The VA also identifies DOE plans for the remaining work, and the estimated costs of completing an LA and constructing and operating a repository. The attention to uncertainties is important because DOE must evaluate how the repository will perform during the next 10,000 years or longer. Uncertainties exist because of variability in the natural (geologic and hydrologic) systems at Yucca Mountain and because of imperfect scientific understanding of the natural processes that might affect the repository system. This is Volume 1 and it covers, Introduction and Site Characteristics, includes a high-level summary of the results of the VA and some additional background information. (The overview is bound separately.) Section 1 of Volume

  6. Frameworks in CS1

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak; Caspersen, Michael Edelgaard

    2002-01-01

    used to introduce the principles of object-oriented frameworks to students at the introductory programming level. Our framework, while simple, introduces central abstractions such as inversion of control, event-driven programming, and variability points/hot-spots. This has provided a good starting......In this paper we argue that introducing object-oriented frameworks as subject already in the CS1 curriculum is important if we are to train the programmers of tomorrow to become just as much software reusers as software producers. We present a simple, graphical, framework that we have successfully...

  7. Frameworks in CS1

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak; Caspersen, Michael Edelgaard

    2002-01-01

    In this paper we argue that introducing object-oriented frameworks as subject already in the CS1 curriculum is important if we are to train the programmers of tomorrow to become just as much software reusers as software producers. We present a simple, graphical, framework that we have successfully...... used to introduce the principles of object-oriented frameworks to students at the introductory programming level. Our framework, while simple, introduces central abstractions such as inversion of control, event-driven programming, and variability points/hot-spots. This has provided a good starting...

  8. R806 (part 1)

    CERN Multimedia

    1976-01-01

    R806 was designed by the BNL-CERN-Syracuse-Yale Collaboration (Bill Willis spokesman) to study large transverse momentum phenomena, and installed in intersection 8 of the ISR. The main detectors were Lithium foil transition radiation detectors to identify electrons and liquid argon calorimeters to measure the energy of the electrons and photons (among the first such calorimeters to be used in an experiment). In part 1 there were two modules, top and bottom of the horizontal beam pipe; the black vertical pipe contains the cryogenics (LN2 and Lar) and is connected to the two modules with the horizontal piping.

  9. Annexe 1. Figures

    OpenAIRE

    2014-01-01

    Figure 1. — Carte générale de Colombie Figure 2. — Le Nouveau Royaume de Grenade Figure 3. — Nouvelle Grenade — Région centre Figure 4. — Nouvelle Grenade — Région nord Figure 5. — Nouvelle Grenade — Région sud-ouest Figure 6. — Schéma-organigramme des relations établies entre les institutions chargées de l’implantation de la foi dans le Nouveau Monde, (tiré de Enrique Düssel, Historia de la Iglesia en América Latina, Bogotá, Universidad Santo Tomás, 1984, p. 89)....

  10. Brownian Brownian Motion-1

    OpenAIRE

    Chernov, N.; Dolgopyat, D.

    2008-01-01

    A classical model of Brownian motion consists of a heavy molecule submerged into a gas of light atoms in a closed container. In this work we study a 2D version of this model, where the molecule is a heavy disk of mass M and the gas is represented by just one point particle of mass m = 1, which interacts with the disk and the walls of the container via elastic collisions. Chaotic behavior of the particles is ensured by convex (scattering) walls of the container. We prove that the position and ...

  11. VENESAT-1 Successfully Launched

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ Venezuelan first satellite VENESAT-1 (or Simon Bolivar) was sent to space from the Xichang Satellite Launch Center(XSLC) at 0:53 (Beijing time) on October 30 atop a LM-3B launch vehicle. About 12 minutes later, the satellite entered the preset GTO orbit at the altitude of 36,000km. After four maneuvers, the satellite was normally positioned at 78 degrees west longitude at 15:39 (Beijing time) on November 9,beaming the majority of Latin America and part of the Caribbean region.

  12. Main: ALF1NTPARC [PLACE

    Lifescience Database Archive (English)

    Full Text Available ALF1NTPARC S000238 11-Oct-1999 (last modified) kehi ALF-1 (as-1-like sequence bindi...ng factor) binding site found in tobacco (N.t.) parC gene; Found in auxin-responsive regions; as-1-like sequences in parA, par...B and parC bind with ASF-1, ALF-2, and ALF-1, respectively; See S000190 (ABFOS); as-1; ALF-1; par; auxin; tobacco (Nicotiana tabacum); TTACGCAAGCAATGACA ...

  13. Protein: FBB1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBB1 CNC family transcription factors NFE2L1 HBZ17, NRF1, TCF11 NFE2L1 Nuclear factor... erythroid 2-related factor 1 Locus control region-factor 1, Nuclear factor, erythroid derived 2, like 1, Transcription factor... 11, Transcription factor HBZ17, Transcription factor LCR-F1 9606 Homo sapiens Q14494 4779 4779 Q14494 ...

  14. Pandemic (H1N1) 2009 and Seasonal Influenza A (H1N1) Co-infection, New Zealand, 2009

    OpenAIRE

    Peacey, Matthew; Hall, Richard J.; Sonnberg, Stephanie; Ducatez, Mariette; Paine, Shevaun; Nicol, Mackenzie; Jacqui C Ralston; Bandaranayake, Don; Hope, Virginia; Webby, Richard J.; Huang, Sue

    2010-01-01

    Co-infection with seasonal influenza A (H1N1) and pandemic (H1N1) 2009 could result in reassortant viruses that may acquire new characteristics of transmission, virulence, and oseltamivir susceptibility. Results from oseltamivir-sensitivity testing on viral culture suggested the possibility of co-infections with oseltamivir-resistant (seasonal A [H1N1]) and -susceptible (pandemic [H1N1] 2009) viruses.

  15. Preparation Methods of the Important Intermediate of 1,1,1,3,3,3-Hexafluoropropane——1,1,1,3,3,3-Hexachloropropane%1,1,1,3,3,3-六氟丙烷的重要中间体——1,1,1,3,3,3-六氯丙烷的调聚制备方法

    Institute of Scientific and Technical Information of China (English)

    金文斌; 刘毓林

    2011-01-01

    The batch telomerization preparation methods and continuous telomerization preparation methods of the important intermediate of 1,1,1,3,3,3-hexafluoropropane—1,1,1,3,3,3-hexachloropropane(HCC-230) is reviewed.The advantages and disadvantages are recommended.%主要阐述了1,1,1,3,3,3-六氟丙烷的重要中间体1,1,1,3,3,3-六氯丙烷的间歇调聚和连续调聚制备方法,并比较了两者的优缺点。

  16. Protein: FBB1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBB1 Signaling molecules in Keap1-Nrf2 sensor NFE2L1 HBZ17, NRF1, TCF11 Nuclear factor erythroid ... 2-related factor 1 Locus control region -factor 1, Nuclear factor, erythroid derived 2, lik ...

  17. Main: GLUTEBP1OS [PLACE

    Lifescience Database Archive (English)

    Full Text Available GLUTEBP1OS S000048 17-May-1998 (last modified) kehi Glutelin BP-1; Binding site in ...the promoter region of glutelin Gt3 gene family of nuclear factor (PB-1); PB-1 is observed only in nuclear e...xtract of developing seeds; glutelin; nuclear factor; seed; endosperm; BP-1; PB-1; rice (Oryza sativa) AAGCAACACACAAC ...

  18. Investigations on Collectin Liver 1

    DEFF Research Database (Denmark)

    Axelgaard, Esben; Jensen, Lisbeth; Dyrlund, Thomas Franck;

    2013-01-01

    Collectins are pattern recognition molecules of the innate immune system showing binding to carbohydrate structures on microorganisms in a calcium-dependent manner. Recently, three novel collectins, collectin liver 1 (CL-L1), collectin kidney 1 (CL-K1 and CL-11), and collectin placenta 1 (CL-P1),...

  19. The INFN Tier-1

    International Nuclear Information System (INIS)

    INFN-CNAF is the central computing facility of INFN: it is the Italian Tier-1 for the experiments at LHC, but also one of the main Italian computing facilities for several other experiments such as BABAR, CDF, SuperB, Virgo, Argo, AMS, Pamela, MAGIC, Auger etc. Currently there is an installed CPU capacity of 100,000 HS06, a net disk capacity of 9 PB and an equivalent amount of tape storage (these figures are going to be increased in the first half of 2012 respectively to 125,000 HS06, 12 PB and 18 PB). More than 80,000 computing jobs are executed daily on the farm, managed by LSF, accessing the storage, managed by GPFS, with an aggregate bandwidth up to several GB/s. The access to the storage system from the farm is direct through the file protocol. The interconnection of the computing resources and the data storage is based on 10 Gbps technology. The disk-servers and the storage systems are connected through a Storage Area Network allowing a complete flexibility and easiness of management; dedicated disk-servers are connected, also via the SAN, to the tape library. The INFN Tier-1 is connected to the other centers via 3×10 Gbps links (to be upgraded at the end of 2012), including the LHCOPN and to the LHCONE. In this paper we show the main results of our center after 2 full years of run of LHC.

  20. (E-1-Phenylethanone semicarbazone

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2009-08-01

    Full Text Available In the title compound, C9H11N3O, the benzene ring is disordered over two positions with refined occupancies of 0.922 (5 and 0.078 (5. The program PLATON [Spek (2009. Acta Cryst. D65, 148–155] recommends the solution in the space group C2/m with a = 7.3050 (3, b = 6.6745 (2, c = 18.3853 (6 Å and β = 96.986 (2°. However, the large number of non-extinct reflections needed to be ignored if C2/m is chosen suggested that the space group is incorrect, even though the R values are lower than that for P21/c. The semicarbazone group is essentially planar, with a maximum deviation of 0.046 (1 Å for one of the N atoms. The mean plane of the semicarbazone group forms dihedral angles of 33.61 (8 and 39.1 (9° with the benzene ring of the major and minor components, respectively. In the crystal structure, molecules are linked by intermolecular N—H...O hydrogen bonds into extended chains along the c axis. The crystal structure is further stabilized by weak intermolucular C—H...π interactions.

  1. ATLAS Point 1 Construction

    CERN Multimedia

    Inigo-Golfin, J

    After 3 years of work in point 1, a number of surface buildings have already been completed and handed over to CERN (the control, the gas and the cooling and ventilation buildings) and, probably more appealing to the public, 60,000 m3 of earth have already been excavated from underground. At present, the technical cavern USA15 and its access shaft are almost finished, leaving only the main cavern and the liaison galleries to be completed in the coming year and a half. The main cavern has been excavated down to the radiation limit and its walls and vault will presently be concreted (see below the picture of the section of the vault with the impressive shell of 1.2 m thickness). The excavation of the bench (27 vertical metres to go yet!) will proceed from August, when some additional civil engineering work in the LHC tunnel will be undertaken. Needless to say many different services are necessary around the detector, both for its installation and future operation for physics. To that end much of the heavy...

  2. Tow Tank #1

    Science.gov (United States)

    1930-01-01

    Digging the channel for the Tow Tank. In the late 1920s, the NACA decided to investigate the aero/hydro dynamics of floats for seaplanes. A Hydrodynamics Branch was established in 1929 and special towing basin was authorized in March of that same year. Starr Truscott (the first head of the new division) described the tank in NACA TR 470: 'The N.A.C.A. tank is of the Froude type; that is, the model which is being tested is towed through still water at successive constant speeds from a carriage spanning the tank. At each constant speed the towing pull is measured, the trim and the rise, or change of draft, are recorded and, if the model is being towed at a fixed trim, the moment required to hold it there is measured and recorded.' 'The reinforced concrete basin containing the water has the following dimensions: (1) Length on water, extreme, 2,020 feet; (2) Normal width of water surface, 24 feet; (3) Normal depth of water, 12 feet; (4) Length of 12 foot depth, 1,980 feet.' The tank was dedicated on May 27, 1931. In 1936 the tank was extended to a total length of 2,960 feet. In 1959 the facility was turned over to the U.S. Navy.Published in NACA TR No. 470, 'The N.A.C.A. Tank: A High-Speed Towing Basin for Testing Models of Seaplane Floats,' by Starr Truscott, 1933.

  3. Endothelin-1 and antiangiogenesis.

    Science.gov (United States)

    Lankhorst, Stephanie; Jan Danser, A H; van den Meiracker, Anton H

    2016-02-01

    Antiangiogenesis, targeting vascular endothelial growth factor (VEGF), has become a well-established treatment for patients with cancer. This treatment is associated with nitric oxide (NO) suppression and a dose-dependent activation of the endothelin system, resulting in preeclampsia-like features, particularly hypertension and renal injury. Studies in endothelium NO synthase (eNOS)-deficient mice and pharmacological treatment with endothelin receptor blockers and sildenafil indicate that an activated endothelin system, rather than NO suppression, mediates the side effects of angiogenesis inhibitors. Activation of the endothelin system is also observed in preeclamptic women, where it is related to the increased placental production of sFlt-1, the soluble form of the VEGF receptor-1. This receptor binds VEGF, thereby having the same consequences as antiangiogenic treatment with VEGF inhibitors. The side effects of antiangiogenic treatment in patients with cancer may be dose limiting, thereby impairing its therapeutic potential. In addition, because endothelin exerts proangiogenic effects, investigation of the effects of endothelin receptor blockade in patients with cancer treated with angiogenesis inhibitors is warranted. PMID:26511523

  4. UA1 prototype detector

    CERN Multimedia

    1980-01-01

    Prototype of UA1 central detector inside a plexi tube. The UA1 central detector was crucial to understanding the complex topology of proton-antiproton events. It played a most important role in identifying a handful of Ws and Zs among billions of collisions. The detector was a 6-chamber cylindrical assembly 5.8 m long and 2.3 m in diameter, the largest imaging drift chamber of its day. It recorded the tracks of charged particles curving in a 0.7 Tesla magnetic field, measuring their momentum, the sign of their electric charge and their rate of energy loss (dE/dx). Atoms in the argon-ethane gas mixture filling the chambers were ionised by the passage of charged particles. The electrons which were released drifted along an electric field shaped by field wires and were collected on sense wires. The geometrical arrangement of the 17000 field wires and 6125 sense wires allowed a spectacular 3-D interactive display of reconstructed physics events to be produced.

  5. ON THE DIOPHANTINE EQUATION (an - 1)((a + 1)n - 1) =x2%关于Diophantine方程(an-1)((a+1)n-1)=x2

    Institute of Scientific and Technical Information of China (English)

    梁明

    2012-01-01

    In this article, the positive integer solution (n, x) of the exponential diophantine equation (αn - 1)((α + l)n-1) = x2 is discussed. Using elementary number theory methods, we prove that, if a = 2 or 3(mod 4), then the equation has no integer solution.%本文研究了指数Diophantine方程(an-1)((a+1)n-1)=x2的正整数解(n,x),其中a是大于1的正整数.运用初等数论方法证明了:当a≡2或3(mod 4)时,该方程无解.

  6. Cytochrome P450 (CYP) and glutathione S-transferases (GST) polymorphisms (CYP1A1, CYP1B1, GSTM1, GSTP1 and GSTT1) and urinary levels of 1-hydroxypyrene in Turkish coke oven workers

    OpenAIRE

    Ahmet Oguz Ada; Meltem Yilmazer; Sinan Suzen; Canan Demiroglu; Ali Eba Demirbag; Sibel Efe; Yavuz Alemdar; Sema Burgaz; Mumtaz Iscan

    2007-01-01

    Genetic polymorphisms of xenobiotic metabolizing enzymes have been associated with cancer risk. We evaluated the influences of genetic polymorphisms of polycyclic aromatic hydrocarbon (PAH) metabolizing enzymes on urinary 1-hydroxypyrene (1-OHP) excretion in Turkish coke oven workers. Urinary 1-OHP was analyzed by HPLC after enzymatic hydrolysis. Lymphocyte DNA was used for PCR-based genotyping of cytochrome P450 (CYP) polymorphisms (CYP1A1 and CYP1B1) and glutathione S-transferases (GST) pol...

  7. Cytochrome P450 (CYP and glutathione S-transferases (GST polymorphisms (CYP1A1, CYP1B1, GSTM1, GSTP1 and GSTT1 and urinary levels of 1-hydroxypyrene in Turkish coke oven workers

    Directory of Open Access Journals (Sweden)

    Ahmet Oguz Ada

    2007-01-01

    Full Text Available Genetic polymorphisms of xenobiotic metabolizing enzymes have been associated with cancer risk. We evaluated the influences of genetic polymorphisms of polycyclic aromatic hydrocarbon (PAH metabolizing enzymes on urinary 1-hydroxypyrene (1-OHP excretion in Turkish coke oven workers. Urinary 1-OHP was analyzed by HPLC after enzymatic hydrolysis. Lymphocyte DNA was used for PCR-based genotyping of cytochrome P450 (CYP polymorphisms (CYP1A1 and CYP1B1 and glutathione S-transferases (GST polymorphisms (GSTM1, GSTT1 and GSTP1. The mean urinary 1-OHP levels of coke oven workers were significantly higher than that of controls. No significant difference was detected in the mean urinary 1-OHP levels of smokers and non-smokers either for coke oven workers or controls. Genetic polymorphisms of the CYPs and GSTs studied had no significant influence on 1-OHP excretion in coke oven workers, but in the control group the urinary 1-OHP levels of individuals carrying the GSTT1- genotype were significantly higher than those of individuals carrying GSTT1+ genotype. The duration of occupational exposure and metabolic genotype for GSTT1 were the significant predictors of urinary 1-OHP levels. The control individuals carrying combined GSTM1-/GSTT1- genotypes also had significantly higher levels of urinary 1-OHP than those of individuals carrying GSTM1+/GSTTI+, GSTM1-/GSTT1+, and GSTM1+/GSTT1- genotypes. These results indicate that urinary 1-OHP is a sensitive indicator of recent human exposure to PAHs and that genetic polymorphism of GSTT1 may also to some extent reflect the interindividual variation in susceptibility to PAHs only at low PAH exposure.

  8. 26 CFR 1.9002-1 - Purpose, applicability, and definitions.

    Science.gov (United States)

    2010-04-01

    ... applicable provisions of the Act and §§ 1.9002-1 to 1.9002-8, inclusive, shall apply. (b) Eligibility to... regulations thereunder. (c) Definitions. For purposes of the Act and §§ 1.9002-1 to 1.9002-8, inclusive: (1... of his trade or business, of real property or tangible personal property, and (b) Held in a...

  9. Selenium adsorption at different coverages on Fe(1 0 0) and Fe(1 1 1): A DFT study

    International Nuclear Information System (INIS)

    Graphical abstract: - Highlights: • Selenium is adsorbed in a distorted bridge on the (1 1 1) surface. • In the case of (1 0 0) surface is adsorbed in a 4-fold hollow site. • The magnetic moment decrease 50% on the Fe(1 0v0) surface after Se adsorption. • Fe–Se bonds are formed at the expense of the metallic bond. • Se–Se bonds are detected only in the (1 0 0) surface at 1 ML. - Abstract: Se adsorption on Fe(1 0 0) and (1 1 1) surfaces is examined using the density functional theory (DFT). Selenium is adsorbed in a distorted bridge on the (1 1 1) surface while in the (1 0 0) surface it prefers a 4-fold hollow site, with energies of −10.36 and −5.25 eV, respectively. Se adsorption results in surface reconstruction. There is some contraction in the case of the (1 0 0) plane for 1/4 and 1/2 ML coverage and some relaxation at 1 ML (4.5%). Contraction increases to 15% for the (1 1 1) plane at ¼ ML. At a higher coverage, there is a non-regular movement of surface metal atoms, and there is almost no change at 1 ML. The magnetic moment for surface Fe atoms decreases with coverage. The most important changes are in the (1 0 0) plane, followed by the (1 1 0) and then the (1 1 1) planes with a reduction of 52%, 24% and 7% respectively. The density of states presents a contribution of Se states at −5.0 and −13.1 eV, when stabilized after adsorption. The Fe–Fe bond weakening is higher in the (1 0 0) plane. Fe–Se bonds are formed at the expense of the metallic bond

  10. Type 1 autoimmune pancreatitis

    Directory of Open Access Journals (Sweden)

    Zen Yoh

    2011-12-01

    Full Text Available Abstract Before the concept of autoimmune pancreatitis (AIP was established, this form of pancreatitis had been recognized as lymphoplasmacytic sclerosing pancreatitis or non-alcoholic duct destructive chronic pancreatitis based on unique histological features. With the discovery in 2001 that serum IgG4 concentrations are specifically elevated in AIP patients, this emerging entity has been more widely accepted. Classical cases of AIP are now called type 1 as another distinct subtype (type 2 AIP has been identified. Type 1 AIP, which accounts for 2% of chronic pancreatitis cases, predominantly affects adult males. Patients usually present with obstructive jaundice due to enlargement of the pancreatic head or thickening of the lower bile duct wall. Pancreatic cancer is the leading differential diagnosis for which serological, imaging, and histological examinations need to be considered. Serologically, an elevated level of IgG4 is the most sensitive and specific finding. Imaging features include irregular narrowing of the pancreatic duct, diffuse or focal enlargement of the pancreas, a peri-pancreatic capsule-like rim, and enhancement at the late phase of contrast-enhanced images. Biopsy or surgical specimens show diffuse lymphoplasmacytic infiltration containing many IgG4+ plasma cells, storiform fibrosis, and obliterative phlebitis. A dramatic response to steroid therapy is another characteristic, and serological or radiological effects are normally identified within the first 2 or 3 weeks. Type 1 AIP is estimated as a pancreatic manifestation of systemic IgG4-related disease based on the fact that synchronous or metachronous lesions can develop in multiple organs (e.g. bile duct, salivary/lacrimal glands, retroperitoneum, artery, lung, and kidney and those lesions are histologically identical irrespective of the organ of origin. Several potential autoantigens have been identified so far. A Th2-dominant immune reaction and the activation of

  11. Tokai-1 decommissioning project

    International Nuclear Information System (INIS)

    Tokai-1 (GCR, Gas Cooled Reactor) nuclear power plant of JAPC (the Japan Atomic Power Company) started commercial operation in 1966 as the first commercial nuclear power plant in Japan. The unit had helped introduction and establishment of the construction and operation technologies regarding nuclear power plant at early stage in Japan by its construction and operating experiences. However, The Japan Atomic Power Company (JAPC), the operator and owner of Tokai-1, decided to cease its operation permanently because of a fulfillment of its mission and economical reason. The unit was finally shut down in March 1998 after about 32 year operation. It took about three years for removal of all spent fuels from the site, and then decommissioning started in 2001. JAPC, always on the forefront of the nation's nuclear power generation, is now grappling Japan's first decommissioning of a commercial nuclear power plant, striving to establish effective, advanced decommissioning. The decommissioning for Tokai-1 was scheduled as 20 years project. At the beginning, the reactor was started to be in a static condition ('safe storage period'). While the reactor had been safely stored, the phased decommissioning works started from non-radioactive or low radioactive equipment toward high radioactive equipment. First five years of the project, JAPC concentrated to drain and clean spent fuel cartridge cooling pond and to remove conventional equipments such as turbine, feed water pump and fuel charge machine as planed and budgeted. From 2006, the project came into a new phase. JAPC has been trying to remove four Steam Raising Units (SRUs). The SRUs are huge component (750ton, φ6.3m, H24.7m) of the Gas Cooling Reactor (GCR) and inside of the SRUs are radioactively contaminated. Major concerns are workers safety and minimizing contamination areas during SRU removal. Therefore, JAPC is developing and introducing Jack-down method and remote control multi-functional dismantling system. This

  12. 1. part: strong interactions 1: heavy ions; 1. partie: interactions fortes 1: ions lourds

    Energy Technology Data Exchange (ETDEWEB)

    Suire, Ch

    2007-07-01

    This article is an introduction to the study of the quark-gluon plasma obtained through heavy ion collisions at ultra-relativistic range. In such collisions the energy density can exceed about 1 GeV/fm{sup 3} which implies that matter no longer exists as separate hadrons but rather as their fundamental constituents: quarks and gluons. The experimental difficulty lies in the fact that both the lifetime and size of the system are very limited. The signatures of the quark gluon plasma are of 3 types according to the parameters on which they are based: -) the change in the equation of state of the matter, -) the chiral symmetry, and -) the properties of the medium.

  13. The H1 detector

    International Nuclear Information System (INIS)

    The H1 detector presently operating at the HERA e-p collider is described. A general overview of the detector is given with particular emphasis on the calorimeters, the main element of which is a liquid Argon calorimeter enclosed within a large radius solenoid. Calorimetry in the proton direction, close to the beam-pipe is provided by a copper-silicon pad hadronic calorimeter. In the electron direction a lead-scintillator electromagnetic calorimeter closes the solid angle between the rear part of the liquid Argon calorimeter and the beam-pipe. An iron limited streamer tube tail catcher using the return yoke of the solenoid as absorber completes the calorimetry of the detector. The hardware triggers derived from the calorimeters are also described and some performance details of the calorimeters are given

  14. PMOD 1. 42

    Energy Technology Data Exchange (ETDEWEB)

    Braun, R.L.; Burnham, A.K. (Lawrence Livermore National Lab., CA (United States))

    1991-06-01

    PMOD-Version 1.4 is a copyrighted computer program for simulating oil generation, cracking, and other chemical reactions occuring during the pyrolysis of petroleum source rocks oaver a specified history of temperature and either depth or hydrostatic pressure. The chemical reaction mechanism is defined by the user and, within limits, can be as simple or complex as desired. The model also simulates compaction of the source rock and expulsion of a liquid water phase and a liquid hydrocarbon phase. The expulsion is done by either a simple, constant-fluid-density model or by a more rigorous model using a modified Redlich-Kwong-Soave eqauation of state. The latter model also calculates overpressuring. An auxiliary program, PLOTPMOD, permits graphical display and hardcopy of the results, as well as preperation of ASCII-file subsets of the results for use with a spreadsheet or other graphics program.

  15. Vieillardiixanthone B1

    OpenAIRE

    Boonnak, Nawong; Chantrapromma, Suchada; Fun, Hoong-Kun; Karalai, Chatchanok

    2010-01-01

    The title compound [systematic name: 1,5-dihydr­oxy-3,6-dimeth­oxy-4-(2-methyl­but-3-en-2-yl)-9H-xanthen-9-one], C20H20O6, is a xanthone, which was isolated from the roots of Cratoxylum formosum ssp. pruniflorum. The three rings in the mol­ecule are approximately coplanar, with an r.m.s. deviation of 0.0372 (2) Å for the plane through the 14 non-H atoms. The O atoms of the two hydr­oxy substituents also lie close to this plane with deviations of 0.0669 (2) and 0.1122 (2) Å, respectively. The ...

  16. Overview of EHN1

    CERN Multimedia

    1982-01-01

    The beams enter from the bottom of the photo. Starting from left (Jura side)three experiments lay upstream of the European Hybrid Spectrometer (EHS), NA20, NA25 (with a small HOlographic Bubble Chamber, HOBC) and NA24. The EHS houses NA21, NA22 and NA23 with the Rapid Cycling Bubble Chamber RCBC, NA26, NA27 with the HOlographic LExan Bubble Chamber, HOLEBC. Along the beam line most at the right (H8) lays the NA3 setup, while downstream one sees the assembly of the GAMS detector (blue) of the CERN/USSR experiment NA12. At the centre run the beam H2/E2 for the FRAMM experiments NA1 (now completed), NA7 and NA29, and the beam H6 for NA30 and NA11.

  17. Volume 6, Issue 1

    Directory of Open Access Journals (Sweden)

    Karen Nelson

    2015-03-01

    Full Text Available The International Journal of the First Year in Higher Education (Int J FYHE explores the transition experience of the first year student but this issue, Volume 6 Issue 1, has several unique characteristics. As a publication, it has a significant transition feature of its own: This issue is the last under this title and the current journal is to undergo a transformation, re-emerging with a new title and look in time for the inaugural STARS Conference in Melbourne, Australia in July 2015.   These are exciting times, not only for our editorial team, but also for prospective authors as the new journal will broaden the current First Year focus to that of enhancing students’ tertiary experiences across their entire learning journey in all its multiplicity and complexity.

  18. D-Dimond1

    CERN Document Server

    Iliakis, D C

    2006-01-01

    At the present thesis a prototype antenna is studied. In chapter 1 the antenna's geometry is selected with the supervisor's assistance and its geometrical and dimensional characteristics are outlined. In chapter 2 an extensive theoretical analysis is carried out and the final mathematical formulas of the antenna's radiation pattern are extracted. In chapter 3 a computational study - simulation is carried out utilizing the computer program RICHWIRE which is capable of dividing the antenna in many segments. The study's results illustrate the variations of the most important antenna's characteristic quantities as a function of the number of segments. Finally, a study of the antenna's behavior as a function of the frequency follows at the range from 900 to 1300 [MHz]. In chapter 4 the antenna's behavior as a function of frequency is studied at a more extensive range, approximately from 200 to 2850 [MHz]. In chapter 5 an improvement of the antenna's characteristics is attempted by modifying its geometrical shape u...

  19. Type 1 narcolepsy

    DEFF Research Database (Denmark)

    Degn, Matilda; Kornum, Birgitte Rahbek

    2015-01-01

    Type 1 narcolepsy is a sleep disorder characterized by excessive daytime sleepiness with unintentional sleep attacks and cataplexy. The disorder is caused by a loss of hypocretinergic neurons in the brain. The specific loss of these neurons in narcolepsy is thought to result from an autoimmune...... attack, and this is supported by evidence of both environmental and genetic factors pointing toward an involvement of the immune system. However, definitive proof of an autoimmune etiology is still missing. Several different immune-mediated disorders targeting neurons are known, and many of these are...... believed to be caused by autoreactive CD8(+) T cells. In this paper, we review the current knowledge on CD8(+) T cell-mediated neuronal damage on the basis of our understanding of other autoimmune disorders and experimental studies. We identify major histocompatibility complex class I presentation of...

  20. Petroleum resources assessment 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-01

    This report consists of two articles. (1) Petroleum resources assessment of the Okinawa Trough: The hydrocarbon potential has been evaluated for the Tertiary strata in the northwestern margin of the Okinawa Trough on the basis of the pale-ontological, petrological, geochemical data from two wells (Nikkan 8-9 and JDZ 7-3), and geophysical data. (2) Petroliferous basin analysis in Jinju area (2): Petroleum geological studies such as stratigraphy, sedimentology, petrology and organic geochemistry were carried out in the Gyeongsang Supergroup, Junju area. Based on lithofacies and rock color, the sequence can be divided into seven formations which can be organized into two groups (Sindong Group: Nagdong, Hasandong and Jinju formations in ascending order; Hayang Group: Chilgog, Silla Conglomerate, Haman and Jindong formations). (author). 57 refs.

  1. UA1 central detector

    CERN Multimedia

    The UA1 central detector was crucial to understanding the complex topology of proton-antiproton events. It played a most important role in identifying a handful of Ws and Zs among billions of collisions. The detector was a 6-chamber cylindrical assembly 5.8 m long and 2.3 m in diameter, the largest imaging drift chamber of its day. It recorded the tracks of charged particles curving in a 0.7 Tesla magnetic field, measuring their momentum, the sign of their electric charge and their rate of energy loss (dE/dx). Atoms in the argon-ethane gas mixture filling the chambers were ionised by the passage of charged particles. The electrons which were released drifted along an electric field shaped by field wires and were collected on sense wires. The geometrical arrangement of the 17000 field wires and 6125 sense wires allowed a spectacular 3-D interactive display of reconstructed physics events to be produced.

  2. 26 CFR 1.1202-1 - Deduction for capital gains.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Deduction for capital gains. 1.1202-1 Section 1... (CONTINUED) INCOME TAXES Wash Sales of Stock Or Securities § 1.1202-1 Deduction for capital gains. (a) In computing gross income, adjusted gross income, taxable income, capital gain net income (net capital gain...

  3. 26 CFR 1.1211-1 - Limitation on capital losses.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Limitation on capital losses. 1.1211-1 Section 1... (CONTINUED) INCOME TAXES Treatment of Capital Losses § 1.1211-1 Limitation on capital losses. (a... equal to the sum of: (i) Losses sustained during the taxable year from sales or exchanges of...

  4. 26 CFR 1.846-1 - Application of discount factors.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Application of discount factors. 1.846-1 Section... (CONTINUED) INCOME TAXES Other Insurance Companies § 1.846-1 Application of discount factors. (a) In general—(1) Rules. A separate series of discount factors are computed for, and applied, to...

  5. 26 CFR 1.642(e)-1 - Depreciation and depletion.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Depreciation and depletion. 1.642(e)-1 Section 1... (CONTINUED) INCOME TAXES Estates, Trusts, and Beneficiaries § 1.642(e)-1 Depreciation and depletion. An estate or trust is allowed the deductions for depreciation and depletion, but only to the extent...

  6. 37 CFR 1.331-1.334 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false 1.331-1.334 Section 1.331-1.334 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Arbitration Awards §§...

  7. 26 CFR 1.664-1 - Charitable remainder trusts.

    Science.gov (United States)

    2010-04-01

    ..., 2007, are contained in § 1.664-1(c) as in effect prior to June 24, 2008. (See 26 CFR part 1, § 1.664-1... administration of a charitable remainder trust, and rules governing the taxation of the trust and its... applicable local law or authorized by the provisions of the governing instrument, the requirement to pay...

  8. 26 CFR 1.501(a)-1 - Exemption from taxation.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Exemption from taxation. 1.501(a)-1 Section 1.501... (CONTINUED) INCOME TAXES (CONTINUED) Exempt Organizations § 1.501(a)-1 Exemption from taxation. (a) In... law or regulations or for other good cause, an organization that has been determined by...

  9. 26 CFR 1.926(a)-1 - Distributions to shareholders.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Distributions to shareholders. 1.926(a)-1... to shareholders. (a) Treatment of distributions. . For guidance, see § 1.926(a)-1T(a). (b) Order of distribution—(1) In general—(i) Distributions by a FSC received by a shareholder in a taxable year of...

  10. 26 CFR 1.280B-1 - Demolition of structures.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Demolition of structures. 1.280B-1 Section 1... (CONTINUED) INCOME TAXES Items Not Deductible § 1.280B-1 Demolition of structures. (a) In general. Section 280B provides that, in the case of the demolition of any structure, no deduction otherwise...

  11. Revisiting HIV-1 uncoating

    Directory of Open Access Journals (Sweden)

    Arhel Nathalie

    2010-11-01

    Full Text Available Abstract HIV uncoating is defined as the loss of viral capsid that occurs within the cytoplasm of infected cells before entry of the viral genome into the nucleus. It is an obligatory step of HIV-1 early infection and accompanies the transition between reverse transcription complexes (RTCs, in which reverse transcription occurs, and pre-integration complexes (PICs, which are competent to integrate into the host genome. The study of the nature and timing of HIV-1 uncoating has been paved with difficulties, particularly as a result of the vulnerability of the capsid assembly to experimental manipulation. Nevertheless, recent studies of capsid structure, retroviral restriction and mechanisms of nuclear import, as well as the recent expansion of technical advances in genome-wide studies and cell imagery approaches, have substantially changed our understanding of HIV uncoating. Although early work suggested that uncoating occurs immediately following viral entry in the cell, thus attributing a trivial role for the capsid in infected cells, recent data suggest that uncoating occurs several hours later and that capsid has an all-important role in the cell that it infects: for transport towards the nucleus, reverse transcription and nuclear import. Knowing that uncoating occurs at a later stage suggests that the viral capsid interacts extensively with the cytoskeleton and other cytoplasmic components during its transport to the nucleus, which leads to a considerable reassessment of our efforts to identify potential therapeutic targets for HIV therapy. This review discusses our current understanding of HIV uncoating, the functional interplay between infectivity and timely uncoating, as well as exposing the appropriate methods to study uncoating and addressing the many questions that remain unanswered.

  12. Revisiting HIV-1 uncoating.

    Science.gov (United States)

    Arhel, Nathalie

    2010-01-01

    HIV uncoating is defined as the loss of viral capsid that occurs within the cytoplasm of infected cells before entry of the viral genome into the nucleus. It is an obligatory step of HIV-1 early infection and accompanies the transition between reverse transcription complexes (RTCs), in which reverse transcription occurs, and pre-integration complexes (PICs), which are competent to integrate into the host genome. The study of the nature and timing of HIV-1 uncoating has been paved with difficulties, particularly as a result of the vulnerability of the capsid assembly to experimental manipulation. Nevertheless, recent studies of capsid structure, retroviral restriction and mechanisms of nuclear import, as well as the recent expansion of technical advances in genome-wide studies and cell imagery approaches, have substantially changed our understanding of HIV uncoating. Although early work suggested that uncoating occurs immediately following viral entry in the cell, thus attributing a trivial role for the capsid in infected cells, recent data suggest that uncoating occurs several hours later and that capsid has an all-important role in the cell that it infects: for transport towards the nucleus, reverse transcription and nuclear import. Knowing that uncoating occurs at a later stage suggests that the viral capsid interacts extensively with the cytoskeleton and other cytoplasmic components during its transport to the nucleus, which leads to a considerable reassessment of our efforts to identify potential therapeutic targets for HIV therapy. This review discusses our current understanding of HIV uncoating, the functional interplay between infectivity and timely uncoating, as well as exposing the appropriate methods to study uncoating and addressing the many questions that remain unanswered. PMID:21083892

  13. Experimental Conditions: SE18_S1_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available liver and brain by Orbitrap MS and automated search engine Lipid Search SE18_S1 Mouse liver SE18_S1_M1 34.1...phy. SE18_MS1 Preparation of lipid extract and ESI negative detection by LC-MS analysis SE18_DS1 Identification of phospholipids with Lipid Search default ...

  14. Regional gene expression of LOX-1, VCAM-1, and ICAM-1 in aorta of HIV-1 transgenic rats

    DEFF Research Database (Denmark)

    Hag, Anne Mette Fisker; Kristoffersen, Ulrik Sloth; Pedersen, Sune Folke;

    2009-01-01

    endpoints, studies in animal models could be attractive alternatives. METHODOLOGY/PRINCIPAL FINDINGS: We evaluated gene expression of lectin-like oxidized-low-density-lipoprotein receptor-1 (LOX-1), vascular cell adhesion molecule-1 (VCAM-1), and intercellular adhesion molecule-1 (ICAM-1) in HIV-1......-infection per se may cause atherosclerosis. This transgenic rat model may be a very promising model for further studies of the pathophysiology behind HIV-associated cardiovascular disease....

  15. 1918 pandemic H1N1 DNA vaccine protects ferrets against 2007 H1N1 virus infection

    DEFF Research Database (Denmark)

    Bragstad, Karoline; Martel, Cyril Jean-Marie; Aasted, Bent; Nielsen, Lars Peter; Fomsgaard, Anders

    of the H1N1 pandemic virus from 1918 induce protection in ferrets against infection with a H1N1 (A/New Caledonia/20/99(H1N1)) virus which was included in the conventional vaccine for the 2006-2007 season. The viruses are separated by a time interval of 89 years and differ by 21.2% in the HA1 protein...

  16. Study on characteristic differences of wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5 + 1Dy10 gene

    International Nuclear Information System (INIS)

    Use wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5 + 1Dy10 gene, characteristics differences have been studied. The two-year results showed that the statistical differences in seed quality parameters, farinogram parameters, extensigram parameters, botany characters and main agricultural characters between 1Ax1 and 1Ax2* were not significant. We considered that 08K860 and 08K871 are similar in hereditary background, 1Ax1 and 1Ax2* have identical contribute on quality. Breeder should attach to 1Ax1 and 1Ax2* identically on wheat breeding. (authors)

  17. Intestinal and Hepatic Niemann-Pick C1-Like 1

    Directory of Open Access Journals (Sweden)

    Sung-Woo Park

    2013-08-01

    Full Text Available Polytopic transmembrane protein, Niemann-Pick C1-Like 1 (NPC1L1 is localized at the apical membrane of enterocytes and the canalicular membrane of hepatocytes. It mediates intestinal cholesterol absorption and prevents extensive loss of cholesterol by transporting biliary cholesterol into hepatocytes. NPC1L1 is a molecular target of ezetimibe, an agent for hypercholesterolemia. Recently, NPC1L1 inhibition has been shown to prevent metabolic disorders such as fatty liver disease, obesity, diabetes, and atherosclerosis. In this review, the identification and characterization of NPC1L1, NPC1L1-dependent cholesterol transport, the relationship with pathogenesis of metabolic disease and its newly introduced function for virus entry are discussed.

  18. 26 CFR 1.811-1 - Taxable years affected.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES Gain and Loss from Operations § 1.811-1 Taxable years affected. Section 1.811-2, except as... 1954, as amended by the Life Insurance Company Income Tax Act of 1959 (73 Stat. 112)....

  19. 1 Ft. x 1 Ft. Supersonic Wind Tunnel, Bldg. 37

    Data.gov (United States)

    Federal Laboratory Consortium — The 1- by 1-Foot Supersonic Wind Tunnel (1x), located in the Engine Research Building, is one of the most active test facilities at the Glenn Research Center. Used...

  20. M32 +/- 1

    Science.gov (United States)

    Lauer, Tod R.; Faber, S. M.; Ajhar, Edward A.; Grillmair, Carl J.; Scowen, Paul A.

    1998-11-01

    Multicolor HST WFPC2 images are used to study the central structure of the three Local Group galaxies M31, M32, and M33. PSF deconvolution and modeling of image aliasing are required to recover accurate brightness profiles within r Crane at 1700 Å. WFPC2 images now show that this source is resolved, with r_1/2 ~ 0.2 pc. It dominates the nucleus at 3000 Å, and its spectral energy distribution is consistent with late B-early A stars. This probable nuclear star cluster may consist of young stars and be an older version of the central cluster of hot stars that now sits at the center of the Milky Way, or it may consist of heavier stars built up from collisions in a possible cold disk of stars orbiting P2. Aspects of its formation remain highly problematic. In M32, new images show that the central cusp continues to rise into the HST limit with slope gamma ~ 0.5 and the central density rho_0 > 10^7 M_⊙ pc^-3. The V-I and U-V color profiles are essentially flat, and there is no sign of an inner disk, dust, or any other structure. This total lack of features seems at variance with a nominal stellar collision time of 2 x 10^10 yr, which implies that a significant fraction of the light in the central pixel should come from blue stragglers. This discrepancy is eased but not completely removed if the stellar population is young (2 x 10^9 yr). The stubborn normalcy of M32 at tiny radii may be emerging as an important puzzle. In M33, the nucleus has an extremely steep gamma = 1.49 power-law profile for 0.05" 2 x 10^6 M_⊙ pc^-3, and the implied central relaxation time is only ~3 x 10^6 yr, indicating that the nucleus is highly relaxed. The accompanying short collision time of 7 x 10^9 yr predicts a central blue straggler component that is quantitatively consistent with the strong V-I and B-R color gradients seen with HST and from the ground. When combined with the Galaxy, the nuclei of the Local Group show surprisingly similar radial density profiles but divide into two

  1. 26 CFR 1.864-1 - Meaning of sale, etc.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Meaning of sale, etc. 1.864-1 Section 1.864-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED..., etc. For purposes of §§ 1.861 through 1.864-7, the word “sale” includes “exchange”; the word...

  2. Transmission electron microscope study of the topotactic reaction of (0 0 1), (0 1 1) and (1 1 1) Ag films and Te

    Energy Technology Data Exchange (ETDEWEB)

    Safran, G.; Geszti, O.; Radnoczi, G

    2003-09-01

    The formation, structure and morphology of silver telluride was investigated in the reaction of (0 0 1), (0 1 1) and (1 1 1) single crystalline Ag films with vacuum deposited Te. Silver films 30-40 nm in thickness were deposited by thermal evaporation onto water- and chlorine-treated NaCl. Onto this silver 1-40 nm of tellurium were deposited at 100 and 200 deg. C. The Ag-Te reaction occurred during Te deposition. Accordingly, formation of the compound phase was investigated from the nucleation stage through complete tellurization on either side of the polymorphic phase transformation temperature (T{sub c}=150 deg. C). Transmission electron microscope and selected area electron diffraction showed that monoclinic silver telluride (Ag{sub 2}Te) of different morphology and texture was always formed. The orientation of silver and monoclinic phase upon differently oriented monocrystalline Ag films and at deposition temperatures around T{sub c} is discussed.

  3. Main: ASF1NTPARA [PLACE

    Lifescience Database Archive (English)

    Full Text Available ASF1NTPARA S000240 11-Oct-1999 (last modified) kehi ASF-1 (as-1 binding nuclear fac...tor) binding site found in tobacco (N.t.) parA gene; Found in auxin-responsive regions; as-1-like sequences in parA, parB and par...C bind with ASF-1, ALF-2, and ALF-1, respectively; See S000190 (ABFOS), S000238 (ALF1NTPAR...C), S000239 (ALF2NTPARB); as-1; ASF-1; par; auxin; tobacco (Nicotiana tabacum); TTACGCAAGCAATGACAT ...

  4. SUT1 suppresses sec14-1 through upregulation of CSR1 in Saccharomyces cerevisiae.

    Science.gov (United States)

    Régnacq, Matthieu; Ferreira, Thierry; Puard, Julien; Bergès, Thierry

    2002-11-01

    SUT1 constitutive expression in aerobiosis suppressed the ts phenotype of the sec14-1 mutation, restored growth of the sec14-null mutant and corrected the translocation defect of the vacuolar carboxypeptidase Y. Therefore SUT1 was shown to be a novel potent sec14-1 suppressor. Further, the hypoxic gene CSR1 (YLR380W), a Sec14 homolog, was upregulated upon SUT1 constitutive expression. In addition, SUT1 effects on both sec14-1 suppression and on free sterol composition were abolished in a csr1-null background, showing that this gene acts downstream of SUT1. PMID:12435498

  5. UNCORRELATED TWO-MODE SU(1,1) COHERENT STATES

    Institute of Scientific and Technical Information of China (English)

    侯丽珍; 曾高坚

    2001-01-01

    We have constructed a new kind of two-mode bosonic realization of SU(1,1) Lie algebra, on the basis of which the SU(1,1) generalized coherent states in the two-mode Fock space are derived. These two-mode SU(1,1) coherent states,which are called uncorrelated two-mode SU(1,1) coherent states, include three special cases. For these states, we study the mean photon number distribution and their non-classical properties, which are photon anti-bunching, violations of Cauchy-Schwarz inequality and two-mode squeezing.

  6. Cytogenetic damage in Turkish coke oven workers exposed to polycyclic aromatic hydrocarbons: Association with CYP1A1, CYP1B1, EPHX1, GSTM1, GSTT1, and GSTP1 gene polymorphisms.

    Science.gov (United States)

    Ada, Ahmet Oguz; Demiroglu, Canan; Yilmazer, Meltem; Suzen, Halit Sinan; Demirbag, Ali Eba; Efe, Sibel; Alemdar, Yilmaz; Iscan, Mumtaz; Burgaz, Sema

    2013-09-01

    The aim of this study was to determine the frequencies of chromosomal aberrations (CA) and cytochalasin-blocked micronuclei (CBMN) in peripheral blood lymphocytes from Turkish coke oven workers and the influence of CYP1A1, CYP1B1, EPHX1, GSTM1, GSTT1, and GSTP1 gene polymorphisms on these biomarkers. Cytogenetic analysis showed that occupational exposure significantly increased the CA and CBMN frequencies. Gene polymorphisms, on the other hand, did not affect CA or CBMN in either exposed or control subjects. However, due to the limited sample size, our findings need to be verified in future studies with a larger sample. PMID:24084344

  7. YY1 positively regulates human UBIAD1 expression

    Energy Technology Data Exchange (ETDEWEB)

    Funahashi, Nobuaki, E-mail: nfunahashi@ri.ncgm.go.jp [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Department of Metabolic Disorder, Diabetes Research Center, Research Institute, National Center for Global Health and Medicine, Tokyo (Japan); Hirota, Yoshihisa [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Faculty of Pharmaceutical Sciences, Suzuka University of Medical Science, Suzuka (Japan); Nakagawa, Kimie; Sawada, Natumi; Watanabe, Masato [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Suhara, Yoshitomo [Department of Bioscience and Engineering, Shibaura Institute of Technology, Saitama (Japan); Okano, Toshio [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan)

    2015-05-01

    Vitamin K is involved in bone formation and blood coagulation. Natural vitamin K compounds are composed of the plant form phylloquinone (vitamin K{sub 1}) and a series of bacterial menaquionones (MK-n; vitamin K{sub 2}). Menadione (vitamin K{sub 3}) is an artificial vitamin K compound. MK-4 contains 4-isoprenyl as a side group in the 2-methyl-1,4-naphthoquinone common structure and has various bioactivities. UbiA prenyltransferase domain containing 1 (UBIAD1 or TERE1) is the menaquinone-4 biosynthetic enzyme. UBIAD1 transcript expression significantly decreases in patients with prostate carcinoma and overexpressing UBIAD1 inhibits proliferation of a tumour cell line. UBIAD1 mRNA expression is ubiquitous in mouse tissues, and higher UBIAD1 mRNA expression levels are detected in the brain, heart, kidneys and pancreas. Several functions of UBIAD1 have been reported; however, regulation of the human UBIAD1 gene has not been elucidated. Here we report cloning and characterisation of the human UBIAD1 promoter. A 5′ rapid amplification of cDNA ends analysis revealed that the main transcriptional start site was 306 nucleotides upstream of the translation initiation codon. Deletion and mutation analyses revealed the functional importance of the YY1 consensus motif. Electrophoretic gel mobility shift and chromatin immunoprecipitation assays demonstrated that YY1 binds the UBIAD1 promoter in vitro and in vivo. In addition, YY1 small interfering RNA decreased endogenous UBIAD1 mRNA expression and UBIAD1 conversion activity. These results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter. - Highlights: • We cloned the human UBIAD1 promoter. • The functional importance of the YY1 motif was identified in the UBIAD1 promoter. • YY1 binds the UBIAD1 promoter in vitro and in vivo. • Knockdown of YY1 significantly decreased UBIAD1 expression. • YY1 up-regulates UBIAD1 conversion activity through the UBIAD1

  8. YY1 positively regulates human UBIAD1 expression

    International Nuclear Information System (INIS)

    Vitamin K is involved in bone formation and blood coagulation. Natural vitamin K compounds are composed of the plant form phylloquinone (vitamin K1) and a series of bacterial menaquionones (MK-n; vitamin K2). Menadione (vitamin K3) is an artificial vitamin K compound. MK-4 contains 4-isoprenyl as a side group in the 2-methyl-1,4-naphthoquinone common structure and has various bioactivities. UbiA prenyltransferase domain containing 1 (UBIAD1 or TERE1) is the menaquinone-4 biosynthetic enzyme. UBIAD1 transcript expression significantly decreases in patients with prostate carcinoma and overexpressing UBIAD1 inhibits proliferation of a tumour cell line. UBIAD1 mRNA expression is ubiquitous in mouse tissues, and higher UBIAD1 mRNA expression levels are detected in the brain, heart, kidneys and pancreas. Several functions of UBIAD1 have been reported; however, regulation of the human UBIAD1 gene has not been elucidated. Here we report cloning and characterisation of the human UBIAD1 promoter. A 5′ rapid amplification of cDNA ends analysis revealed that the main transcriptional start site was 306 nucleotides upstream of the translation initiation codon. Deletion and mutation analyses revealed the functional importance of the YY1 consensus motif. Electrophoretic gel mobility shift and chromatin immunoprecipitation assays demonstrated that YY1 binds the UBIAD1 promoter in vitro and in vivo. In addition, YY1 small interfering RNA decreased endogenous UBIAD1 mRNA expression and UBIAD1 conversion activity. These results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter. - Highlights: • We cloned the human UBIAD1 promoter. • The functional importance of the YY1 motif was identified in the UBIAD1 promoter. • YY1 binds the UBIAD1 promoter in vitro and in vivo. • Knockdown of YY1 significantly decreased UBIAD1 expression. • YY1 up-regulates UBIAD1 conversion activity through the UBIAD1 promoter

  9. Synthesis and characterization of arsenate antimonic acid AAAc(1 : 1)

    Institute of Scientific and Technical Information of China (English)

    WANG Xue-wen; CHEN Qi-yuan; YIN Zhou-lan; ZHANG Ping-min; WANG Yu-wen

    2005-01-01

    The AAAc(1 : 1) was synthesized in water by As2O3 and Sb2O3 with molar ratio of 1 : 1: AAAc(1 : 1)was characterized by Raman, IR, TG/DTG, DSC, XPS and XRD. The results show that there are four peaks to vsof As-OH, As-O-Sb, Sb-OH and Sb-O-Sb in Raman spectra of AAAc(1 : 1) at 100 - 1 000 cm-1. The solution of AAAc(1 : 1) was also titrated with KOH solution. The titration results show that AAAc(1 : 1) is a hexabasic acid with dissociation constants of k1 = 3.62 × 10-2 , k2 = 3.05 × 10-3 , k3 = 6. 43 × 10-6 , k4 = 9. 78 × 10-8 ,k5 = 1.32 × 10-11 , k6 =3.87 × 10-12. AAAc(1 : 1) has a good solubility and stability in water, its solid obtained by free volatilizing water from its solution under air at ambient temperature is amorphous. Chemical and thermal analyture of AsO ( OH )2-OH-Sb ( OH )4-O-Sb ( OH )4-OH-AsO ( OH )2 or As ( OH )3-O-Sb(OH)4-O-Sb(OH)4-O-As(OH)3 (isomerism) through experimental determination and geometry optimization.

  10. Main: GT1CONSENSUS [PLACE

    Lifescience Database Archive (English)

    Full Text Available m of GT-1 may be achieved through direct interaction between TFIIA and GT-1; Binding of GT-1-like factors to the PR-1a promoter influ...ences the level of SA-inducible gene expression; GT-1; light; TATA; TFIIA; TBP; HR;

  11. Main: P1BS [PLACE

    Lifescience Database Archive (English)

    Full Text Available P1BS S000459 27-March-2004 (last modified) kehi PHR1-binding sequence found in the upstream regi ... ons of phosphate ... starvation responsive genes from several plant spe ... cies; phr1 (phosphate ... starvation response 1) gene codes for PHR1 protein ...

  12. Protein: MPB1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPB1 FROUNT c hemokine network CC R2 C MKBR2 CC R2 C -C ... c hemokine rec eptor type 2 Monoc yte c hemoattra c tant protein 1 rec eptor 9606 Homo sapiens P41597 1231 1KAD, 1KP1 1231 ...

  13. Main: AGL1ATCONSENSUS [PLACE

    Lifescience Database Archive (English)

    Full Text Available AGL1ATCONSENSUS S000338 16-May-2001 (last modified) uchi Binding consensus sequence... of Arabidopsis (A.t.) AGL1 (AGAMOUS-like 1); AGL1 contains MADS domain; See S000339; AGL20 is a MADS domain...ing several MADS-genes underlie development of vegetative structures; MADS; AGL1; AGAMOUS; AGL20; floral ind

  14. Palladium(0)-catalyzed cross-coupling of 1,1-diboronates with vinyl bromides and 1,1-dibromoalkenes.

    Science.gov (United States)

    Li, Huan; Zhang, Zhikun; Shangguan, Xianghang; Huang, Shan; Chen, Jun; Zhang, Yan; Wang, Jianbo

    2014-10-27

    Palladium-catalyzed cross-coupling reactions of 1,1-diboronates with vinyl bromides and dibromoalkenes were found to afford 1,4-dienes and allenes, respectively. These reactions utilize the high reactivities of both 1,1-diboronates and allylboron intermediates generated in the initial coupling. PMID:25213194

  15. Les graphes (-1)-critiques

    CERN Document Server

    Belkhechine, Houmem; Elayech, Mohamed Baka

    2010-01-01

    Given a (directed) graph G=(V,A), a subset X of V is an interval of G provided that for any a, b\\in X and x\\in V-X, (a,x)\\in A if and only if (b,x)\\in A and (x,a)\\in A if and only if (x,b)\\in A. For example, \\emptyset, \\{x\\} (x \\in V) and V are intervals of G, called trivial intervals. A graph, all the intervals of which are trivial, is indecomposable; otherwise, it is decomposable. A vertex x of an indecomposable graph is critical if G-x is decomposable. In 1993, J.H. Schmerl and W.T. Trotter characterized the indecomposable graphs, all the vertices of which are critical, called critical graphs. In this article, we characterize the indecomposable graphs which admit a single non critical vertex, that we call (-1)-critical graphs.} This gives an answer to a question asked by Y. Boudabbous and P. Ille in a recent article studying the critical vertices in an indecomposable graph.

  16. B1 Aerogels

    DEFF Research Database (Denmark)

    Duer, Karsten; Svendsen, Sv Aa Højgaard

    1996-01-01

    , engineering and architectural basis which will support the appropriate use of aerogels in windows, solar collectors and passive solar applications, with the aim of saving or producing thermal energy for use in buildings".This objective is in very good agreement with the general scope of task 18 but where Task...... properties of aerogel as a material for window applications3. Construction of an aerogel DGU and measurement of key performance parameters. The goal for the aerogel DGU was to reach a Total Solar Energy Transmittance above 0.75 and a U-value below 0.5 W/m²K. These are values that can not be simultaneously......The report summarizes the work that has been carried out within the project "B1 AEROGELS" as a part of the IEA SH&CP Task 18 "Advanced Glazing and Associated Materials For Solar And Building Applications".By providing at the same time thermal insulation and transparency the silica aerogel is a very...

  17. ATLAS Data Challenge 1

    CERN Document Server

    DC1 TaskForce

    2003-01-01

    The ATLAS Collaboration at CERN is preparing for the data taking and analysis at LHC that will start in 2007. Therefore, in 2002 a series of Data Challenges (DC's) was started whose goals are the validation of the Computing Model, of the complete software suite, of the data model, and to ensure the correctness of the technical choices to be made. A major feature of the first Data Challenge (DC1) was the preparation and the deployment of the software required for the production of large event samples for the High Level Trigger and Physics communities, and the production of those large data samples as a worldwide distributed activity. It should be noted that it was not an option to "run everything at CERN" even if we had wanted to; the resources were not available at CERN to carry out the production on a reasonable time-scale. We were therefore faced with the great challenge of organising and then carrying out this large-scale production at a significant number of sites around the world. However, the benefits o...

  18. Quenches after LS1

    International Nuclear Information System (INIS)

    In this paper I will give an overview of the different types of quenches that occur in the LHC, followed by an estimate of the number of quenches that we can expect after LS1. Beam-induced quenches and false triggering of the QPS will be the main cause of those quenches that cause a beam dump. Possibly in total up to 10-20 per year. After consolidation of the 13 kA joints, the approach for the BLM settings can be less conservative than in 2010-2012 in order to maximize beam time. This will cause some quenches but, anyhow, a beam.induced quench is not more risky than a quench provoked by false triggering. It is not easy to predict the number of BLM triggered beam dumps, needed to avoid magnet quenches, because it is not sure how to scale beam losses and UFO's from 3.5 TeV to 6.5 TeV, and it is not sure if the thresholds at 3.5 TeV are correct. Quench events will be much more massive (ex: RB quench at 6 kA → 2 MJ, RB quench at 11 kA → 6-20 MJ), and as a result cryo recuperation much longer. There will also be more ramp induced quenches after a FPA in other circuits due to higher ramp rates and smaller temperature margins (mutual coupling)

  19. Structural, electronic properties and stability of the (1 x 1) PbTiO3 (1 1 1) polar surfaces by first-principles calculations

    International Nuclear Information System (INIS)

    Under GGA, the structural, electronic properties and stabilities of four different (1 x 1) terminations of cubic PbTiO3 (1 1 1) surface, the directly cleaved (1 1 1)-Ti and (1 1 1)-PbO3 terminations and the constructed (1 1 1)-TiO and (1 1 1)-PbO2 ones, have been systematically studied by using projector-augmented wave method implemented in VASP. For (1 1 1)-Ti and (1 1 1)-PbO3 terminations, Ti-O bonds between the outermost two layers are enhanced after relaxation, while those between the second and the third layers are weakened. In addition, a contraction of O-O distance in surface PbO3 layer is also found for (1 1 1)-PbO3 termination. Moreover, electronic structures of both (1 1 1)-Ti and (1 1 1)-PbO2 terminations are significantly influenced by structure relaxations, and the effects of the surface on the DOS are dominantly on the Ti layers, especially the CB. For a constructed (1 1 1)-TiO termination, the relaxation results show both Ti-O bonds between the outermost two layers and those between the second PbO3 layer and the third Ti layers are enhanced. For a constructed (1 1 1)-PbO2 termination, Ti-O bonds between the outermost two layers are also enhanced as in the (1 1 1)-TiO termination, however, inequivalent Ti-O bonds between the second layer Ti atom and the third layer O atoms are found, with two bonds expanding and the other one contracting. Results of electronic structure calculations show these two constructed terminations are all insulating and changes of DOS originate dominantly from modifications of surface compositions. Furthermore, it is found that for all four different (1 1 1) terminations, the movements of the cation and/or anion on the outermost layer along the surface normal direction after relaxation all result in a reduction of the space electric field. In O and Pb external environments, it is predicted that (1 1 1)-PbO2 termination is the most stable one in O- and Pb-rich environments, however, the (1 1 1)-Ti termination is stable one in O

  20. Taz1, Rap1 and Rif1 act both interdependently and independently to maintain telomeres

    OpenAIRE

    Miller, Kyle M.; Ferreira, Miguel Godinho; Cooper, Julia Promisel

    2005-01-01

    Telomere protection and maintenance are accomplished through the coordinated actions of telomere-specific DNA binding proteins and their interacting partners. The fission yeast ortholog of human TRF1/2, Taz1, binds telomeric DNA and regulates numerous aspects of telomere function. Here, we ask which aspects of Taz1 function are mediated through its interacting proteins, Rap1 and Rif1. We demonstrate that rap1+ deletion phenocopies some, but not all, aspects of taz1Δ telomere dysfunction, whil...

  1. EGR-1 regulates Ho-1 expression induced by cigarette smoke

    International Nuclear Information System (INIS)

    As an anti-oxidant molecule, heme oxygenase-1 (HO-1) has been implicated in the protection of lung injury by cigarette smoke (CS). The mechanisms regulating its expression have not been defined. In this report, the role of early growth response 1 (EGR-1) in the regulation of Ho-1 expression was investigated. In C57BL/6 mice with CS exposure, HO-1 was greatly increased in bronchial epithelial cells and alveolar inflammatory cells. In primary cultured mouse lung fibroblasts and RAW264.7 cells exposed to cigarette smoke water extract (CSE), an increase in HO-1 protein level was detected. In addition, CSE induced HO-1 expression was decreased in Egr-1 deficient mouse embryo fibroblasts (Egr-1-/- MEFs). Nuclear localization of EGR-1 was examined in mouse lung fibroblasts after exposure to CSE. Luciferase reporter activity assays showed that the enhancer region of the Ho-1 gene containing a proposed EGR-1 binding site was responsible for the induction of HO-1. A higher increase of alveolar mean linear intercept (Lm) was observed in lung tissues, and a larger increase in the number of total cells and monocytes/macrophages from bronchial alveolar lavage fluid was found in CS-exposed mice by loss of function of EGR-1 treatment. In summary, the present data demonstrate that EGR-1 plays a critical role in HO-1 production induced by CS.

  2. Effects of human SAMHD1 polymorphisms on HIV-1 susceptibility

    International Nuclear Information System (INIS)

    SAMHD1 is a human restriction factor that prevents efficient infection of macrophages, dendritic cells and resting CD4+ T cells by HIV-1. Here we explored the antiviral activity and biochemical properties of human SAMHD1 polymorphisms. Our studies focused on human SAMHD1 polymorphisms that were previously identified as evolving under positive selection for rapid amino acid replacement during primate speciation. The different human SAMHD1 polymorphisms were tested for their ability to block HIV-1, HIV-2 and equine infectious anemia virus (EIAV). All studied SAMHD1 variants block HIV-1, HIV-2 and EIAV infection when compared to wild type. We found that these variants did not lose their ability to oligomerize or to bind RNA. Furthermore, all tested variants were susceptible to degradation by Vpx, and localized to the nuclear compartment. We tested the ability of human SAMHD1 polymorphisms to decrease the dNTP cellular levels. In agreement, none of the different SAMHD1 variants lost their ability to reduce cellular levels of dNTPs. Finally, we found that none of the tested human SAMHD1 polymorphisms affected the ability of the protein to block LINE-1 retrotransposition. - Highlights: • Human SAMHD1 single-nucleotide polymorphisms block HIV-1 and HIV-2 infection. • SAMHD1 polymorphisms do not affect its ability to block LINE-1 retrotransposition. • SAMHD1 polymorphisms decrease the cellular levels of dNTPs

  3. Effects of human SAMHD1 polymorphisms on HIV-1 susceptibility

    Energy Technology Data Exchange (ETDEWEB)

    White, Tommy E.; Brandariz-Nuñez, Alberto; Valle-Casuso, Jose Carlos [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, 1301 Morris Park – Price Center 501, New York, NY 10461 (United States); Knowlton, Caitlin; Kim, Baek [Department of Microbiology and Immunology, University of Rochester School of Medicine and Dentistry, Rochester, NY 14642 (United States); Sawyer, Sara L. [Department of Molecular Biosciences, University of Texas at Austin, Austin, TX 78712 (United States); Diaz-Griffero, Felipe, E-mail: Felipe.Diaz-Griffero@einstein.yu.edu [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, 1301 Morris Park – Price Center 501, New York, NY 10461 (United States)

    2014-07-15

    SAMHD1 is a human restriction factor that prevents efficient infection of macrophages, dendritic cells and resting CD4+ T cells by HIV-1. Here we explored the antiviral activity and biochemical properties of human SAMHD1 polymorphisms. Our studies focused on human SAMHD1 polymorphisms that were previously identified as evolving under positive selection for rapid amino acid replacement during primate speciation. The different human SAMHD1 polymorphisms were tested for their ability to block HIV-1, HIV-2 and equine infectious anemia virus (EIAV). All studied SAMHD1 variants block HIV-1, HIV-2 and EIAV infection when compared to wild type. We found that these variants did not lose their ability to oligomerize or to bind RNA. Furthermore, all tested variants were susceptible to degradation by Vpx, and localized to the nuclear compartment. We tested the ability of human SAMHD1 polymorphisms to decrease the dNTP cellular levels. In agreement, none of the different SAMHD1 variants lost their ability to reduce cellular levels of dNTPs. Finally, we found that none of the tested human SAMHD1 polymorphisms affected the ability of the protein to block LINE-1 retrotransposition. - Highlights: • Human SAMHD1 single-nucleotide polymorphisms block HIV-1 and HIV-2 infection. • SAMHD1 polymorphisms do not affect its ability to block LINE-1 retrotransposition. • SAMHD1 polymorphisms decrease the cellular levels of dNTPs.

  4. Proinsulin Shares a Motif with Interleukin-1α (IL-1α) and Induces Inflammatory Cytokine via Interleukin-1 Receptor 1*

    Science.gov (United States)

    Lee, Siyoung; Kim, Eunsom; Jhun, Hyunjhung; Hong, Jaewoo; Kwak, Areum; Jo, Seunghyun; Bae, Suyoung; Lee, Jongho; Kim, Busun; Lee, Jungmin; Youn, Sulah; Kim, Somi; Kim, Miyeon; Kim, Hyunwoo; Lee, Youngmin; Choi, Dong-Ki; Kim, Yong-Sung; Kim, Soohyun

    2016-01-01

    Although it has been established that diabetes increases susceptibility to infections, the role of insulin (INS) in the immune response is unknown. Here, we investigated the immunological function of INS. Proinsulin dimer (pINSd) was a potent immune stimulus that induced inflammatory cytokines, but mature INS was unable to induce an immune response. An affinity-purified rabbit polyclonal antibody raised against mature IL-1α recognized IL-1α and pINS but failed to detect mature INS and IL-1β. Analysis of the pINS sequence revealed the existence of an INS/IL-1α motif in the C-peptide of pINS. Surprisingly, the INS/IL-1α motif was recognized by monoclonal antibody raised against IL-1α. Deleting the INS/IL-1α motif in pINSd and IL-1α changed their activities. To investigate the pINSd receptor, the reconstitution of IL-1 receptor 1 (IL-1R1) in Wish cells restored pINSd activity that was reversed by an IL-1R antagonist. These data suggested that pINSd needs IL-1R1 for inflammatory cytokine induction. Mouse embryo fibroblast cells of IL-1R1-deficient mice further confirmed that pINSd promotes immune responses through IL-1R1. PMID:27226621

  5. Proinsulin Shares a Motif with Interleukin-1α (IL-1α) and Induces Inflammatory Cytokine via Interleukin-1 Receptor 1.

    Science.gov (United States)

    Lee, Siyoung; Kim, Eunsom; Jhun, Hyunjhung; Hong, Jaewoo; Kwak, Areum; Jo, Seunghyun; Bae, Suyoung; Lee, Jongho; Kim, Busun; Lee, Jungmin; Youn, Sulah; Kim, Somi; Kim, Miyeon; Kim, Hyunwoo; Lee, Youngmin; Choi, Dong-Ki; Kim, Yong-Sung; Kim, Soohyun

    2016-07-01

    Although it has been established that diabetes increases susceptibility to infections, the role of insulin (INS) in the immune response is unknown. Here, we investigated the immunological function of INS. Proinsulin dimer (pINSd) was a potent immune stimulus that induced inflammatory cytokines, but mature INS was unable to induce an immune response. An affinity-purified rabbit polyclonal antibody raised against mature IL-1α recognized IL-1α and pINS but failed to detect mature INS and IL-1β. Analysis of the pINS sequence revealed the existence of an INS/IL-1α motif in the C-peptide of pINS. Surprisingly, the INS/IL-1α motif was recognized by monoclonal antibody raised against IL-1α. Deleting the INS/IL-1α motif in pINSd and IL-1α changed their activities. To investigate the pINSd receptor, the reconstitution of IL-1 receptor 1 (IL-1R1) in Wish cells restored pINSd activity that was reversed by an IL-1R antagonist. These data suggested that pINSd needs IL-1R1 for inflammatory cytokine induction. Mouse embryo fibroblast cells of IL-1R1-deficient mice further confirmed that pINSd promotes immune responses through IL-1R1. PMID:27226621

  6. YY1 positively regulates human UBIAD1 expression.

    Science.gov (United States)

    Funahashi, Nobuaki; Hirota, Yoshihisa; Nakagawa, Kimie; Sawada, Natumi; Watanabe, Masato; Suhara, Yoshitomo; Okano, Toshio

    2015-05-01

    Vitamin K is involved in bone formation and blood coagulation. Natural vitamin K compounds are composed of the plant form phylloquinone (vitamin K1) and a series of bacterial menaquionones (MK-n; vitamin K2). Menadione (vitamin K3) is an artificial vitamin K compound. MK-4 contains 4-isoprenyl as a side group in the 2-methyl-1,4-naphthoquinone common structure and has various bioactivities. UbiA prenyltransferase domain containing 1 (UBIAD1 or TERE1) is the menaquinone-4 biosynthetic enzyme. UBIAD1 transcript expression significantly decreases in patients with prostate carcinoma and overexpressing UBIAD1 inhibits proliferation of a tumour cell line. UBIAD1 mRNA expression is ubiquitous in mouse tissues, and higher UBIAD1 mRNA expression levels are detected in the brain, heart, kidneys and pancreas. Several functions of UBIAD1 have been reported; however, regulation of the human UBIAD1 gene has not been elucidated. Here we report cloning and characterisation of the human UBIAD1 promoter. A 5' rapid amplification of cDNA ends analysis revealed that the main transcriptional start site was 306 nucleotides upstream of the translation initiation codon. Deletion and mutation analyses revealed the functional importance of the YY1 consensus motif. Electrophoretic gel mobility shift and chromatin immunoprecipitation assays demonstrated that YY1 binds the UBIAD1 promoter in vitro and in vivo. In addition, YY1 small interfering RNA decreased endogenous UBIAD1 mRNA expression and UBIAD1 conversion activity. These results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter. PMID:25772619

  7. Existence of seven human IL-1R1 promoters

    Directory of Open Access Journals (Sweden)

    Qiming Li

    2010-02-01

    Full Text Available Qiming Li, Hao Zhang, Qun Chen, Ning QuanDepartment of Oral Biology, Ohio State University, Columbus, OH, USAAbstract: Previous studies have reported the existence of three promoters for the human type I interleukin-1 receptor (hIL-1R1 gene. These promoters were discovered by identifying discrete transcription start sites (TSS from limited human cell lines. In this study, we examined the TSSs of hIL-1R1 mRNA from 24 different tissues and identified several novel TSSs in hIL-1R1 that suggest the existence of seven hIL-1R1 promoters: three of them are the same as those reported previously and four are putative novel promoters. Using a promoter-reporter assay, we show here that these promoters can drive the transcription of the reporter gene. In addition, these promoters exhibit cell type specific expression patterns and they can be regulated by enhancer elements in a cell type specific manner. Only one of the promoters was found to be sensitive to the stimulation by glucocorticoids. Similar to our recent report on murine IL-1R1, two of the hIL-1R1 promoters appear to be the dominant promoters, one of which was published previously and the other is identified in the present study. We also found an internal promoter that drives the expression of IL-1R1 after the conventional translation start codon, suggesting that a truncated hIL-1R1 may be expressed by this promoter. These results provide additional information regarding the transcription of hIL-1R1.Keywords: type1 interleukin receptor, human IL-1R1 promoters, transcription start sites, reporter gene, stress hormones, acute phase proteins

  8. USML-1 Glovebox experiments

    Science.gov (United States)

    Naumann, Robert J.

    1995-01-01

    This report covers the development of and results from three experiments that were flown in the Materials Science Glovebox on USML-1: Marangoni convection in Closed Containers (MCCC), Double Float Zone (DFZ), and Fiber Pulling in Microgravity (FPM). The Glovebox provided a convenient, low cost method for doing simple 'try and see' experiments that could test new concepts or elucidate microgravity phenomena. Since the Glovebox provided essentially one (or possibly two levels of confinement, many of the stringent verification and test requirements on the experiment apparatus could be relaxed and a streamlined test and verification plan for flight qualification could be implemented. Furthermore, the experiments were contained in their own carrying cases whose external configurations could be identified early in the integration sequence for stowage considerations while delivery of the actual experiment apparatus could be postponed until only a few months before flight. This minimized the time fluids must be contained and reduced the possibility of corrosive reactions that could ruin the experiment. In many respects, this exercise was as much about developing a simpler, cheaper way of doing crew-assisted science as it was about the actual scientific accomplishments of the individual experiments. The Marangoni Convection in Closed Containers experiment was designed to study the effects of a void space in a simulated Bridgman crystal growth configuration and to determine if surface tension driven convective flows that may result from thermal gradients along any free surfaces could affect the solidification process. The Fiber Pulling in Microgravity experiment sought to separate the role of gravity drainage from capillarity effects in the break-up of slender cylindrical liquid columns. The Stability of a Double Float Zone experiment explored the feasibility of a quasi-containerless process in which a solidifying material is suspended by two liquid bridges of its own melt.

  9. BOOK REVIEW: Physics 1

    Science.gov (United States)

    Sang, David; Gibbs, Keith; Hutchings, Robert

    2000-09-01

    Physics 1 is an attractive book designed to cover the whole of the AS physics course and has been endorsed by OCR for its Advanced AS and A2 specifications. Built on books from the Cambridge Modular Sciences series, it provides a clearly presented path through each of the three sections: Foundation Physics, Electrons and Photons, and Wave Properties. Each chapter has clearly stated objectives and is peppered with self-assessment questions, the answers to all of which are at the back of the book. Additional questions are given at the end of each chapter. There is an excellent use of colour, summary boxes and diagrams, but relatively few photographs. At the back of the book is a useful section on uncertainties and a glossary. The key feature of this book is its accessibility to students coming from a double-award science background. A great deal of thought has gone into lessening the trauma of the transition to Advanced Level and the results are impressive. Some of the main areas of concern for many students are the mathematical sections. These areas are not rushed, especially in the foundation physics, where there are plenty of worked examples. It is assumed, also, that students will not necessarily be confident with graphs so lots of examples are given. Diagrams of the type of practical equipment students are likely to encounter add another dimension to the book. It is good to see the use of light gates and motion sensors in addition to the more traditional ticker-timers for the calculations of speed and acceleration. Accessibility is the strength of this book. The use of colour and space, as well as the content, make it enjoyable to use and to read for any student embarking on the new AS courses. Helen Reynolds

  10. Main: ARR1AT [PLACE

    Lifescience Database Archive (English)

    Full Text Available ARR1AT S000454 27-March-2004 (last modified) kehi ARR1-binding element found in Arabidopsis; AR...oglobin-2 (NSHB) gene (Ross et al., 2004); ARR1; Response regulator; Arabidopsis thaliana NGATT ...

  11. Protein: MPA1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA1 TLR signaling molecules Mavs Ips1, Visa Mitochondrial antiviral-signaling protein CARD adap ... ta, Interferon beta promoter stimulator protein 1, Virus -induced-signaling adapter 10090 Mus musculus 22860 ...

  12. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  13. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    International Nuclear Information System (INIS)

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  14. Verification of rod safety via confidence intervals for a binomial proportion

    International Nuclear Information System (INIS)

    The probabilistic safety assessed to a set of N fuel rods assembled in one core of a nuclear power reactor is commonly modelled by Σ i≤N X i, where X 1, ..., X N are independent Bernoulli random variables (rv) with individual probability p i = P (X i = 1) that the ith rod shows no failure during one cycle. This is the probability of the event that the ith rod will not exceed the failure limit during one cycle. The safety standard presently set by the German Reaktor-Sicherheitskommission (Reactor Safety Commission) requires that the expected number of unfailed rods in the core during one cycle is at least N - 1, i.e., E(Σ i≤N X i) = Σ i≤N p i ≥ N - 1, whereby a confidence level of 0.95 for the verification of this condition is demanded. In this paper, we provide an approach, based on the Clopper-Pearson confidence interval for the proportion p of a binomial B(n, p) distribution, how to verify this condition with a confidence level of at least 0.95. We extend our approach to the case, where the set of N fuel rods is arranged in strata, possibly due to different design in each stratum

  15. Cyclin D1, Id1 and EMT in breast cancer

    Directory of Open Access Journals (Sweden)

    Lehn Sophie

    2011-09-01

    Full Text Available Abstract Background Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1 gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT. Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Methods Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. Results The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1low/ID1high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1low/ID1high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. Conclusions These results indicate that increased migration of MDA-MB-231 cells following

  16. The gold and oxygen (3 x 1) structures on W(1 1 2)

    Energy Technology Data Exchange (ETDEWEB)

    Losovyj, Ya.B. [Louisiana State University, CAMD, 6980 Jefferson Highway, 70806 Baton Rouge, LA (United States); Department of Physics and Astronomy and the Nebraska Center for Materials and Nanoscience, 116 Brace Laboratory, P.O. Box 880111, University of Nebraska, Lincoln, NE 68588 (United States)], E-mail: ylosovyj@lsu.edu; Ketsman, Ihor [Department of Physics and Astronomy and the Nebraska Center for Materials and Nanoscience, 116 Brace Laboratory, P.O. Box 880111, University of Nebraska, Lincoln, NE 68588 (United States); Lozova, N.; Scott, John [Louisiana State University, CAMD, 6980 Jefferson Highway, 70806 Baton Rouge, LA (United States); Dowben, P.A. [Department of Physics and Astronomy and the Nebraska Center for Materials and Nanoscience, 116 Brace Laboratory, P.O. Box 880111, University of Nebraska, Lincoln, NE 68588 (United States); Yakovkin, I.N. [Institute of Physics of National Academy of Sciences of Ukraine, Prospect Nauki 46, Kiev 03028 (Ukraine); Zuber, S.M. [Institute of Experimental Physics, University of Wroclaw, pl. M. Borna 9, Wroclaw (Poland)

    2008-05-15

    The adsorption of two very different adsorbates, gold and oxygen, induce the formation of a (3 x 1) surface structure on both W(1 1 2) and Mo(1 1 2). In spite of similar adsorbate unit cells, the surface electronic structure, derived from photoemission, exhibits pronounced differences for the two adsorbates. Indeed, both experiment and simulations indicate substantial changes in electronic structures of (1 x 1) and (3 x 1) gold overlayers supported by highly anisotropic (1 1 2) plane. We speculate that (3 x 1) is a favored periodicity in the atomic rearrangement of the (1 1 2) surfaces of molybdenum and tungsten due in part as a result of the initial state band structure of these surfaces.

  17. Transcriptional Auto-Regulation of RUNX1 P1 Promoter.

    Directory of Open Access Journals (Sweden)

    Milka Martinez

    Full Text Available RUNX1 a member of the family of runt related transcription factors (RUNX, is essential for hematopoiesis. The expression of RUNX1 gene is controlled by two promoters; the distal P1 promoter and the proximal P2 promoter. Several isoforms of RUNX1 mRNA are generated through the use of both promoters and alternative splicing. These isoforms not only differs in their temporal expression pattern but also exhibit differences in tissue specificity. The RUNX1 isoforms derived from P2 are expressed in a variety of tissues, but expression of P1-derived isoform is restricted to cells of hematopoietic lineage. However, the control of hematopoietic-cell specific expression is poorly understood. Here we report regulation of P1-derived RUNX1 mRNA by RUNX1 protein. In silico analysis of P1 promoter revealed presence of two evolutionary conserved RUNX motifs, 0.6kb upstream of the transcription start site, and three RUNX motifs within 170bp of the 5'UTR. Transcriptional contribution of these RUNX motifs was studied in myeloid and T-cells. RUNX1 genomic fragment containing all sites show very low basal activity in both cell types. Mutation or deletion of RUNX motifs in the UTR enhances basal activity of the RUNX1 promoter. Chromatin immunoprecipitation revealed that RUNX1 protein is recruited to these sites. Overexpression of RUNX1 in non-hematopoietic cells results in a dose dependent activation of the RUNX1 P1 promoter. We also demonstrate that RUNX1 protein regulates transcription of endogenous RUNX1 mRNA in T-cell. Finally we show that SCL transcription factor is recruited to regions containing RUNX motifs in the promoter and the UTR and regulates activity of the RUNX1 P1 promoter in vitro. Thus, multiple lines of evidence show that RUNX1 protein regulates its own gene transcription.

  18. Gromov-Witten Theory of P^1xP^1xP^1

    OpenAIRE

    Karp, Dagan; Ranganathan, Dhruv

    2012-01-01

    We use elementary geometric techniques to exhibit an explicit equivalence between certain sectors of the Gromov-Witten theories of blowups of P^1xP^1xP^1 and P^3. In particular, we prove that the all genus, virtual dimension zero Gromov-Witten theory of the blowup of P^3 at points coincides with that of the blowup at points of P^1xP^1xP^1, for non-exceptional classes. We observe a toric symmetry of the Gromov-Witten theory of P^1xP^1xP^1 analogous and intimately related to Cremona symmetry of...

  19. Genetic variation of GSTM1, GSTT1 and GSTP1 genes in a South Indian population.

    OpenAIRE

    Vettriselvi, V.; Vijayalakshmi, K.; Solomon Fd, Paul; Venkatachalam, P

    2009-01-01

    Biomarkers of individual susceptibility: field studies. Biomarker: GSTM1, GSTT1 and GSTP1 polymorphisms. Effect studied: DNA damageTissue/biological material/sample size: blood. Method of analysis: GSTM1 and GSTT1 genotypes were determined by PCR and GSTP1 by PCR-RFLPStudy design: cross-sectional studyStudy size: 255 healthy random volunteersImpact on outcome (including dose-response): The GSTM1 and GSTT1 null genotype frequencies were found to be 22.4% and 17.6% respectively. The GSTP1 all...

  20. 26 CFR 1.543-1 - Personal holding company income.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Personal holding company income. 1.543-1 Section 1.543-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX.... Although the O Corporation particularly desired the services of A for an entertainment program it...

  1. 26 CFR 1.7702B-1 - Consumer protection provisions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Consumer protection provisions. 1.7702B-1 Section 1.7702B-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME... policies, unintentional lapse, disclosure, prohibitions against post-claims underwriting, minimum...

  2. 26 CFR 1.809-1 - Taxable years affected.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES Gain and Loss from Operations § 1.809-1 Taxable years affected. Sections 1.809 through 1.809... Internal Revenue Code of 1954, as amended by the Life Insurance Company Income Tax Act of 1959 (73...

  3. 26 CFR 1.7703-1 - Determination of marital status.

    Science.gov (United States)

    2010-04-01

    ... Section 1.7703-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES General Actuarial Valuations § 1.7703-1 Determination of marital status... income of A for the short taxable year ending with the date of his death is determined without regard...

  4. 41 CFR 109-1.5108-1 - Equipment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Equipment. 109-1.5108-1...-Personal Property Management Standards and Practices § 109-1.5108-1 Equipment. An individual property record will be developed and maintained for each item of equipment....

  5. 26 CFR 1.215-1 - Periodic alimony, etc., payments.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Periodic alimony, etc., payments. 1.215-1 Section 1.215-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME..., etc., payments. (a) A deduction is allowable under section 215 with respect to periodic payments...

  6. Symmetric Peripheral Gangrene Associated with H1N1 Infection

    OpenAIRE

    Kaulgud, Ram S.; Kamath, Vasantha; Patil, Vijayalaxmi; Desai, Sagar

    2013-01-01

    More and more cases of H1N1 influenza are being detected in India and so also the variety of complications this virus can cause. Here, we report a case of symmetric peripheral gangrene following H1N1 infection.

  7. TAS1R1 - Wikipedia, the free encyclopedia [Gene Wiki

    Lifescience Database Archive (English)

    Full Text Available TAS1R1 - Wikipedia, the free encyclopediaTAS1R1From Wikipedia, the free encyclopediaJump to:navi ... "The metabolic clearance rate of corticosterone in lean ... and obese male Zucker rats". Metabolism: clinical ...

  8. Main: 1H1Y [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H1Y イネ Rice Oryza sativa L. D-Ribulose-5-Phosphate ... 3-Epimerase Oryza Sativa Molecule: D-Ribul ... ose-5-Phosphate ... 3-Epimerase; Chain: A, B; Engineered: Yes Isomeras ... e 5.1.3.1 (D-Ribulose-5-Phosphate ... 3-Epimerase) S.Jelakovic, G.E.Schulz S.Jelakovic, ...

  9. Main: 1H1Z [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H1Z イネ Rice Oryza sativa L. D-Ribulose-5-Phosphate ... 3-Epimerase Oryza Sativa Molecule: D-Ribul ... ose-5-Phosphate ... 3-Epimerase; Chain: A, B; Engineered: Yes Isomeras ... e 5.1.3.1 (D-Ribulose-5-Phosphate ... 3-Epimerase) S.Jelakovic, G.E.Schulz S.Jelakovic, ...

  10. Programmed cell death 1 ligand 1 expression in osteosarcoma

    OpenAIRE

    Shen, Jacson K.; Cote, Gregory M.; Choy, Edwin; Yang, Pei; Harmon, David; Schwab, Joseph; Nielsen, G. Petur; Chebib, Ivan; Ferrone, Soldano; Wang, Xinhui; Wang, Yangyang; Mankin, Henry; Francis J. Hornicek; Duan, Zhenfeng

    2014-01-01

    Programmed cell death 1 ligand 1 (PD-L1, B7H1) is a cell-surface protein that suppresses the cytotoxic CD8+ T cell-mediated immune response. PD-L1 expression and its clinical relevance in sarcomas are not well understood. Therefore, we sought to measure RNA expression levels for PD-L1 in 38 clinically annotated osteosarcoma tumor samples, and aimed to determine if PD-L1 expression correlates with clinical features and tumor-infiltrating T-lymphocytes (TILs). Quantitative real-time RT-PCR for ...

  11. First principle calculations of nitric oxide on metallic Pt (1 1 1) and Pt (1 0 0), and bimetallic Au/Pt (1 1 1) and Au/Pt (1 0 0) surfaces

    International Nuclear Information System (INIS)

    Highlights: • The chemisorption of NO on Pt (1 1 1), Pt (1 0 0), Au/Pt (1 1 1) and Au/Pt (1 0 0) has been investigated. • The adsorptive position of NO on metal surface has been discussed. • The interaction between NO and metal surface is mainly NO 5σ/2π* and metal d-bands. • Different compositions and facets can produce varied catalytic effects. - Abstract: The chemisorption of NO on pure Pt (1 1 1) and Pt (1 0 0), bimetallic Au/Pt (1 1 1) and Au/Pt (1 0 0) surfaces has been investigated using the pseudo-potential plane-wave method within the generalized-gradient approximation density functional theory (GGA + DFT). The results show that different surfaces have various effects on the adsorption of NO. NO tends to be adsorbed on site coordinated with more Pt atoms, and the substitution number of the top-layer Pt by Au atoms affect the d-band center and adsorption energy. The local density of states of various surfaces are calculated. With the increasing atomic number of surface Au, the d-band center moves away from the Fermi level, and the adsorption energies decrease. The further electronic states analysis reveals that the interaction between NO and metal surfaces is mainly via the hybridization of NO 5σ/2π* orbitals and metal d-bands. And when the top-layer concentrations of Au are equal, Au/Pt (1 0 0) exhibits better catalytic toward NO adsorption than Au/Pt (1 1 1). It indicates that different compositions and facets can produce varied catalytic effects

  12. 26 CFR 1.1402(c)-1 - Trade or business.

    Science.gov (United States)

    2010-04-01

    ...)-7, inclusive, the term “trade or business”, for the purpose of the tax on self-employment income... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Trade or business. 1.1402(c)-1 Section 1.1402(c... (CONTINUED) INCOME TAXES Tax on Self-Employment Income § 1.1402(c)-1 Trade or business. In order for...

  13. Interleukin-1 antagonism in type 1 diabetes of recent onset

    DEFF Research Database (Denmark)

    Moran, Antoinette; Bundy, Brian; Becker, Dorothy J;

    2013-01-01

    Innate immunity contributes to the pathogenesis of autoimmune diseases, such as type 1 diabetes, but until now no randomised, controlled trials of blockade of the key innate immune mediator interleukin-1 have been done. We aimed to assess whether canakinumab, a human monoclonal anti-interleukin-1...... antibody, or anakinra, a human interleukin-1 receptor antagonist, improved β-cell function in recent-onset type 1 diabetes....

  14. Thyrocyte-interleukin-1 interactions

    DEFF Research Database (Denmark)

    Rasmussen, A K; Bendtzen, K; Feldt-Rasmussen, U

    2000-01-01

    characterized by massive infiltration of lymphoid cells. The interleukin-1 (IL-1) family of molecules is together with other cytokines an integral component of the complex intercellular communication required to mount and control an immune response. IL-1alpha/beta in moderate and high concentrations reversibly...... inhibit thyroid cell function, while IL-1beta in low concentrations stimulates thyroid cell function. The biphasic, non-cytotoxic and reversible influence of IL-1 supports a role of IL-1 in the physiological regulation of thyroid cell function. IL-1 stimulates the guanylate mediated pathways and inhibits...... the adenylate cyclase mediated pathways. All IL-1 effects are counteracted by IL-1 receptor antagonist indicating that the effects are exerted through activation of specific IL-1 receptors on thyrocytes. Furthermore, IL-1 induces or enhances expression of a number of immunologically active molecules...

  15. PINK1 positively regulates IL-1β-mediated signaling through Tollip and IRAK1 modulation

    Directory of Open Access Journals (Sweden)

    Lee Hyun Jung

    2012-12-01

    Full Text Available Abstract Background Parkinson disease (PD is characterized by a slow, progressive degeneration of dopaminergic neurons in the substantianigra. The cause of neuronal loss in PD is not well understood, but several genetic loci, including PTEN-induced putative kinase 1 (PINK1, have been linked to early-onset autosomal recessive forms of familial PD. Neuroinflammation greatly contributes to PD neuronal degeneration and pathogenesis. IL-1 is one of the principal cytokines that regulates various immune and inflammatory responses via the activation of the transcription factors NF-κB and activating protein-1. Despite the close relationship between PD and neuroinflammation, the functional roles of PD-linked genes during inflammatory processes remain poorly understood. Methods To explore the functional roles of PINK1 in response to IL-1β stimulation, HEK293 cells, mouse embryonic fibroblasts derived from PINK1-null (PINK1−/− and control (PINK1+/+ mice, and 293 IL-1RI cells stably expressing type 1 IL-1 receptor were used. Immunoprecipitation and western blot analysis were performed to detect protein–protein interaction and protein ubiquitination. To confirm the effect of PINK1 on NF-κB activation, NF-κB-dependent firefly luciferase reporter assay was conducted. Results PINK1 specifically binds two components of the IL-1-mediated signaling cascade, Toll-interacting protein (Tollip and IL-1 receptor-associated kinase 1 (IRAK1. The association of PINK1 with Tollip, a negative regulator of IL-1β signaling, increases upon IL-1β stimulation, which then facilitates the dissociation of Tollip from IRAK1 as well as the assembly of the IRAK1–TNF receptor-associated factor 6 (TRAF6 complex. PINK1 also enhances Lys63-linked polyubiquitination of IRAK1, an essential modification of recruitment of NF-κB essential modulator and subsequent IκB kinase activation, and increases formation of the intermediate signalosome including IRAK1, TRAF6, and

  16. Nucleation and growth of epitaxial ZrB 2(0 0 0 1) on Si(1 1 1)

    Science.gov (United States)

    Hu, C.-W.; Chizmeshya, A. V. G.; Tolle, J.; Kouvetakis, J.; Tsong, I. S. T.

    2004-07-01

    The growth behavior of epitaxial ZrB 2(0 0 0 1) films on Si(1 1 1) via the thermal decomposition of the unimolecular precursor Zr(BH 4) 4 was studied in situ using low-energy electron diffraction and low-energy electron microscopy, and ex situ using cross-sectional transmission electron microscopy and atomic force microscopy. Under appropriate kinetic conditions, epitaxy was achieved in spite of the very large lattice mismatch between ZrB 2(0 0 0 1) and Si(1 1 1). Our study followed the growth from the initial nucleation stage to the final epitaxial film at various growth temperatures. At 900°C, the growth of ZrB 2(0 0 0 1) proceeded by the nucleation of two-dimensional islands. These islands eventually coalesced to form a smooth film with an RMS roughness of 0.9 nm. The interface between ZrB 2(0 0 0 1) and Si(1 1 1) was modeled theoretically and the most favorable interface consisted of the ZrB 2(0 0 0 1) growing on a Si(1 1 1)-(√3×√3)B surface with the Zr-layer nearest to the interface and the B-layer on the top surface.

  17. DBR1 siRNA inhibition of HIV-1 replication

    Directory of Open Access Journals (Sweden)

    Naidu Yathi

    2005-10-01

    Full Text Available Abstract Background HIV-1 and all retroviruses are related to retroelements of simpler organisms such as the yeast Ty elements. Recent work has suggested that the yeast retroelement Ty1 replicates via an unexpected RNA lariat intermediate in cDNA synthesis. The putative genomic RNA lariat intermediate is formed by a 2'-5' phosphodiester bond, like that found in pre-mRNA intron lariats and it facilitates the minus-strand template switch during cDNA synthesis. We hypothesized that HIV-1 might also form a genomic RNA lariat and therefore that siRNA-mediated inhibition of expression of the human RNA lariat de-branching enzyme (DBR1 expression would specifically inhibit HIV-1 replication. Results We designed three short interfering RNA (siRNA molecules targeting DBR1, which were capable of reducing DBR1 mRNA expression by 80% and did not significantly affect cell viability. We assessed HIV-1 replication in the presence of DBR1 siRNA and found that DBR1 knockdown led to decreases in viral cDNA and protein production. These effects could be reversed by cotransfection of a DBR1 cDNA indicating that the inhibition of HIV-1 replication was a specific effect of DBR1 underexpression. Conclusion These data suggest that DBR1 function may be needed to debranch a putative HIV-1 genomic RNA lariat prior to completion of reverse transcription.

  18. (E-1-(Naphthalen-1-yl-3-(1-phenyl-1H-pyrazol-4-ylprop-2-en-1-one

    Directory of Open Access Journals (Sweden)

    Khalid A. Alamry

    2011-10-01

    Full Text Available In the title molecule, C22H16N2O, the phenyl ring is twisted slightly with respect to the plane of the central pyrazole ring [dihedral angle = 14.8 (2°]; the central ring is connected to the naphthyl ring through a —CH=CH—C(=O— fragment, whose C=C double bond has an E configuration. The pyrazole ring and naphthalene ring system are twisted by 46.3 (1°. Weak intermolecular C—H...O hydrogen bonds link the molecules, forming supramolecular chains running along the a axis. The crystal studied was a non-merohedral twin with a component ratio of 0.544 (2:0.456 (2.

  19. Pin1 liberates the human immunodeficiency virus type-1 (HIV-1): Must we stop it?

    Science.gov (United States)

    Hou, Hai; Wang, Jing-Zhang; Liu, Bao-Guo; Zhang, Ting

    2015-07-01

    Acquired immune deficiency syndrome (AIDS) is mainly caused by the human immunodeficiency virus type-1 (HIV-1). To our knowledge, this is the first review focusing on the vital role of Pin1 in the infection of HIV-1 and the development of AIDS. We and others have demonstrated that Pin1, the only known cis-to-trans isomerase recognizing the pThr/pSer-Pro motifs in proteins, plays striking roles in several human diseases. Interestingly, recent evidence gradually indicates that Pin1 regulates several key steps of the life cycle of HIV-1, including the uncoating of the HIV-1 core, the reverse transcription of the RNA genome of HIV-1, and the integration of the HIV-1 cDNA into human chromosomes. Whereas inhibiting Pin1 suppresses all of these key steps and attenuates the replication of HIV-1, at the same time different PIN1 gene variants are correlated with the susceptibility to HIV-1 infection. Furthermore, Pin1 potentially promotes HIV-1 infection by activating multiple oncogenes and inactivating multiple tumor suppressors, extending the life span of HIV-infected cells. These descriptions suggest Pin1 as a promising therapeutic target for the prevention of HIV-1 and highlight the possibility of blocking the development of AIDS by Pin1 inhibitors. PMID:25913034

  20. KLF1 stabilizes GATA-1 and TAL1 occupancy in the human β-globin locus.

    Science.gov (United States)

    Kang, Yujin; Kim, Yea Woon; Yun, Jangmi; Shin, Jongo; Kim, AeRi

    2015-03-01

    KLF1 is an erythroid specific transcription factor that binds to regulatory regions of erythroid genes. Binding sites of KLF1 are often found near binding sites of GATA-1 and TAL1. In the β-globin locus, KLF1 is required for forming active chromatin structure, although its role is unclear. To explore the role of KLF1 in transcribing the human γ-globin genes, we stably reduced the expression of KLF1 in erythroid K562 cells, compromising its association in the β-globin locus. The γ-globin transcription was reduced with disappearance of active chromatin structure of the locus in the KLF1 knockdown cells. Interestingly, GATA-1 and TAL1 binding was reduced in the β-globin locus, even though their expressions were not affected by KLF1 knockdown. The KLF1-dependent GATA-1 and TAL1 binding was observed in the adult locus transcribing the β-globin gene and in several erythroid genes, where GATA-1 occupancy is independent from TAL1. These results indicate that KLF1 plays a role in facilitating and/or stabilizing GATA-1 and TAL1 occupancy in the erythroid genes, contributing to the generation of active chromatin structure such as histone acetylation and chromatin looping. PMID:25528728

  1. LASP-1: a nuclear hub for the UHRF1-DNMT1-G9a-Snail1 complex.

    Science.gov (United States)

    Duvall-Noelle, N; Karwandyar, A; Richmond, A; Raman, D

    2016-03-01

    Nuclear LASP-1 (LIM and SH3 protein-1) has a direct correlation with overall survival of breast cancer patients. In this study, immunohistochemical analysis of a human breast TMA showed that LASP-1 is absent in normal human breast epithelium but the expression increases with malignancy and is highly nuclear in aggressive breast cancer. We investigated whether the chemokines and growth factors present in the tumor microenvironment could trigger nuclear translocation of LASP-1.Treatment of human breast cancer cells with CXCL12, EGF and HRG, and HMEC-CXCR2 cells with CXCL8 facilitated nuclear shuttling of LASP-1. Data from the biochemical analysis of the nuclear and cytosolic fractions further confirmed the nuclear translocation of LASP-1 upon chemokine and growth factor treatment. CXCL12-dependent nuclear import of LASP-1 could be blocked by CXCR4 antagonist, AMD-3100. Knock down of LASP-1 resulted in alterations in gene expression leading to an increased level of cell-junction and extracellular matrix proteins and an altered cytokine secretory profile. Three-dimensional cultures of human breast cancer cells on Matrigel revealed an altered colony growth, morphology and arborization pattern in LASP-1 knockdown cells. Functional analysis of the LASP-1 knockdown cells revealed increased adhesion to collagen IV and decreased invasion through the Matrigel. Proteomic analysis of immunoprecipitates of LASP-1 and subsequent validation approaches revealed that LASP-1 associated with the epigenetic machinery especially UHRF1, DNMT1, G9a and the transcription factor Snail1. Interestingly, LASP-1 associated with UHRF1, G9a, Snail1 and di- and tri-methylated histoneH3 in a CXCL12-dependent manner based on immunoprecipitation and proximity ligation assays. LASP-1 also directly bound to Snail1 which may stabilize Snail1. Thus, nuclear LASP-1 appears to functionally serve as a hub for the epigenetic machinery. PMID:25982273

  2. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1).

    Science.gov (United States)

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. PMID:25088042

  3. Synthesis of Some New Derivatives of 1,3-Dichloro-1,1,3,3-tetraphenyldisilazane

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The reactive properties of 1,3-dichloro-1,1,3,3-tetraphenyldisilazane (DCTPS) with water, methanol, phenylamine and lithium salt of hexamethylcyclotrisilazane (D3NLi) were investigated, and four new derivatives were obtained.

  4. On the transmutation of Am in a fast lead-cooled system

    Indian Academy of Sciences (India)

    B P Kochurov; V N Konev; A Yu Kwaretzkheli

    2007-02-01

    Characteristics of the equilibrium fuel cycle for the core or a blanket of ADS having the structure of the core of a fast lead-cooled reactor of type BREST (Russian abbreviation for `Bystryy Reaktor so Svintsovym Teplonositelem') in a mode of americium transmutation are calculated. Americium loading was taken 5% of heavy atoms. Keeping the average multiplication factor the same as in a standard equilibrium cycle, reactivity swing over 1 year's microcycle is about 1%, that demands partial fuel reloading with a periodicity of about one month. For one year of operation, 61 kg of americium is destroyed, and due to increased 238Pu content, americium is mainly converted to fission products. Thus in a system of 1 GWt (thermal), 87 kg of americium can be transmuted yearly. The estimate of the reactivity void effect has shown that it increases to 0.6% almost linearly with the void fraction increasing up to 25% and reaches its maximum of 0.7% at a void fraction of about 50%. Application of similar strategy for ADS with a sub-criticality level ≈ 0.96–0.98 can essentially relax safety problems related to positive void effects.

  5. Study of hypercharge exchange processes 0-1/2+→1- 1/2+

    International Nuclear Information System (INIS)

    In this work we present a formalism for the reconstruction of the transitivity amplitudes governing the processes of the type 0-1/2+→1-1/2+. The formalism uses the information contained in the decay angular correlations and takes into account the existence of mixed spin configurations in the final state 0-1/2+→(0↓, 1-)1/2+ (Author) 10 refs

  6. A Set of Novel Monoclonal Antibodies Against Swine-Origin Pandemic H1N1 Differentiate Swine H1N1 and Human Seasonal H1N1

    Science.gov (United States)

    In April 2009, a novel H1N1 influenza virus (S-OIV) emerged in North America and caused the first influenza pandemic of the 21st century. The new pandemic strain is a triple reassortant influenza virus of swine origin containing genes from avian, swine and human influenza viruses. It is genetically ...

  7. AAS 227: Day 1

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    The mission was featured on the front pages of 450 newspapers worldwide on every single continent (including Antartica!)New Horizons reached the Moon in9 HOURSafter launch (compared to the ~3 days it took the Apollo missions)The mission controllers were aiming for a 100km window of space all the way from EarthThere was a window of ~400seconds which the probe had to arrive within the probe arrived90 seconds early! Putting tardy astronomers everywhere to shame.Charon was the only satellite of Pluto known at the time of the mission proposalThe canyon found on Charon is not only bigger than the Grand Canyon but bigger than Mariner Valley on Mars which is already4000 km (2500 mi) long and reaches depths of up to 7 km (4 mi)!Charons surface. Tectonic feature runs about 1500 km, around 10 km deep. Eat it, Mars. #aas227 pic.twitter.com/blewwJaXEn Danny Barringer (@HeavyFe_H) January 5, 2016The mountains ringing the Sputnik Planum (aka the heart of Pluto) are over 4km high and are snow capped with methane icePlutos mountain ranges. Means surface nitrogen layer is thin, probably water ice according to @AlanStern. #aas227 pic.twitter.com/0yyHZvpBOE Danny Barringer (@HeavyFe_H) January 5, 2016Plutos atmosphere has a dozendistincthaze layers but how they arecreated is a mystery#aas227 hazes on Pluto wow pic.twitter.com/VPx99ZhPj1 Lisa StorrieLombardi (@lisajsl) January 5, 2016Alan also spoke about the future of New Horizons there is a new mission proposal for a fly by of a Kuiper Belt object 2014MU69 in Jan 2019 which should give us a better understanding of this icy frontier at the edge ofthe Solar System. As a parting gift Alan playedthemost gorgeously detailed fly over video of Plutos surface that had all in the room melting into their flip flops. Its safe to say that the whole room is now Pluto-curious and wondering whether a change of discipline is in order!Press Conference: Black Holes and Exoplanets (by Susanna Kohler)This morning marked the first press conference of the meeting

  8. 1-Benzyl-2-phenyl-1H-benzimidazole–4,4′-(cyclohexane-1,1-diyldiphenol (1/1

    Directory of Open Access Journals (Sweden)

    Chunhua Ge

    2011-07-01

    Full Text Available The asymmetric unit of the title co-crystal, C20H16N2·C18H20O2, contains one molecule of 4,4′-(cyclohexane-1,1-diyldiphenol (in which the cyclohexane ring adopts a chair conformation and one molecule of 1-benzyl-2-phenyl-1H-benzimidazole, which are paired through an O—H...N hydrogen bond. These pairs are further linked by intermolecular O—H...O hydrogen bonds into chains along [010]. Weak intermolecular C—H...O and C—H...π interactions further consolidate the crystal packing. The dihedral angles between the pendant phenyl rings and the benzimidazole ring are 86.9 (2 and 43.1 (2°.

  9. Tetraaqua{1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole}sulfatocobalt(II dihydrate

    Directory of Open Access Journals (Sweden)

    Yu-xian Li

    2011-08-01

    Full Text Available In the title complex, [Co(SO4(C9H8N6(H2O4]·2H2O, the CoII ion is six-coordinated by one N atom from a 1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole ligand, one O atom from a monodentate sulfate ligand and four water molecules in a slightly distorted octahedral geometry. The sulfate ligand is rotationally disordered over two sets of sites with refined occupancies of 0.662 (15 and 0.338 (15. In the crystal, complex molecules and solvent water molecules are linked through intermolecular O—H...O and O—H...N hydrogen bonds into a three-dimensional network.

  10. Global behavior of the difference equation xn+1=(xn-l+1)/(1+a0xn+a1xn-1+...+alxn-l+xn-l+1)

    International Nuclear Information System (INIS)

    In this paper, we find the asymptotic behavior of solutions of the third order difference equation xn+1=(xn-2)/(1+pxn+qxn-1+xn-2) ,n=0,1,2,... for all admissible non-negative values of the parameters p, q where the initial conditions x-2, x-1, x0 are positive. We show that the solutions do not exhibit a periodic attitude for all parameters of the above mentioned difference equation. It is worth to mention that this difference equation was an open problem introduced by Kulenovic and Ladas. Note that we also generalize and extend the above mentioned equation and we investigate the same arguments as the third difference equation for the zero equilibrium point of the higher case

  11. Regional gene expression of LOX-1, VCAM-1, and ICAM-1 in aorta of HIV-1 transgenic rats.

    Directory of Open Access Journals (Sweden)

    Anne Mette Fisker Hag

    Full Text Available BACKGROUND: Increased prevalence of atherosclerotic cardiovascular disease in HIV-infected patients has been observed. The cause of this accelerated atherosclerosis is a matter of controversy. As clinical studies are complicated by a multiplicity of risk-factors and a low incidence of hard endpoints, studies in animal models could be attractive alternatives. METHODOLOGY/PRINCIPAL FINDINGS: We evaluated gene expression of lectin-like oxidized-low-density-lipoprotein receptor-1 (LOX-1, vascular cell adhesion molecule-1 (VCAM-1, and intercellular adhesion molecule-1 (ICAM-1 in HIV-1 transgenic (HIV-1Tg rats; these genes are all thought to play important roles in early atherogenesis. Furthermore, the plasma level of sICAM-1 was measured. We found that gene expressions of LOX-1 and VCAM-1 were higher in the aortic arch of HIV-1Tg rats compared to controls. Also, the level of sICAM-1 was elevated in the HIV-1Tg rats compared to controls, but the ICAM-1 gene expression profile did not show any differences between the groups. CONCLUSIONS/SIGNIFICANCE: HIV-1Tg rats have gene expression patterns indicating endothelial dysfunction and accelerated atherosclerosis in aorta, suggesting that HIV-infection per se may cause atherosclerosis. This transgenic rat model may be a very promising model for further studies of the pathophysiology behind HIV-associated cardiovascular disease.

  12. Mosaic type-1 NF1 microdeletions as a cause of both generalized and segmental neurofibromatosis type-1 (NF1).

    Science.gov (United States)

    Messiaen, Ludwine; Vogt, Julia; Bengesser, Kathrin; Fu, Chuanhua; Mikhail, Fady; Serra, Eduard; Garcia-Linares, Carles; Cooper, David N; Lazaro, Conxi; Kehrer-Sawatzki, Hildegard

    2011-02-01

    Mosaicism is an important feature of type-1 neurofibromatosis (NF1) on account of its impact upon both clinical manifestations and transmission risk. Using FISH and MLPA to screen 3500 NF1 patients, we identified 146 individuals harboring gross NF1 deletions, 14 of whom (9.6%) displayed somatic mosaicism. The high rate of mosaicism in patients with NF1 deletions supports the postulated idea of a direct relationship between the high new mutation rate in this cancer predisposition syndrome and the frequency of mosaicism. Seven of the 14 mosaic NF1 deletions were type-2, whereas four were putatively type-1, and three were atypical. Two of the four probable type-1 deletions were confirmed as such by breakpoint-spanning PCR or SNP analysis. Both deletions were associated with a generalized manifestation of NF1. Independently, we identified a third patient with a mosaic type-1 NF1 deletion who exhibited segmental NF1. Together, these three cases constitute the first proven mosaic type-1 deletions so far reported. In two of these three mosaic type-1 deletions, the breakpoints were located within PRS1 and PRS2, previously identified as hotspots for nonallelic homologous recombination (NAHR) during meiosis. Hence, NAHR within PRS1 and PRS2 is not confined to meiosis but may also occur during postzygotic mitotic cell cycles. PMID:21280148

  13. Telomere Protection by TPP1 Is Mediated by POT1a and POT1b ▿

    OpenAIRE

    Kibe, Tatsuya; Osawa, Gail A.; Keegan, Catherine E.; de Lange, Titia

    2009-01-01

    Mammalian telomeres are protected by the shelterin complex, which contains single-stranded telomeric DNA binding proteins (POT1a and POT1b in rodents, POT1 in other mammals). Mouse POT1a prevents the activation of the ATR kinase and contributes to the repression of the nonhomologous end-joining pathway (NHEJ) at newly replicated telomeres. POT1b represses unscheduled resection of the 5′-ended telomeric DNA strand, resulting in long 3′ overhangs in POT1b KO cells. Both POT1 proteins bind TPP1,...

  14. Pandemic H1N1 influenza infections in 2009

    Directory of Open Access Journals (Sweden)

    Mustafa Hacımustafaoğlu

    2010-05-01

    Full Text Available In early spring 2009 an outbreak of H1N1 influenza A virus infection was detected in Mexico, spreaded quickly, and on June 11 2009, World Health Organization raised its pandemic level to phase 6. This novel H1N1 pandemic influenza A virus represented a quadruple reassortment of swine, human and avian influenza virus strains. This pandemic 2009 H1N1 influenza A viruses in different regions of the world were found to be antigenically homogenous. Transmission features, incubation period and clinical findings wee similar with the seasonal influenza viruses, although the gastrointestinal manifestations were more common. Young children (<5years and some special risk groups are at increased risk for infection complications and mortality. The recommended test for diagnosis is real-time PCR. Pandemic 2009 H1N1 influenza A strains are sensitive to neuraminidase inhibitors (oseltamivir, zanamivir and resistant to amantadine and rimantadine. Oseltamivir and zanamivir are used for prophlaxis and therapy of infection. However, vaccination against pandemic 2009 H1N1 influenza A should be the main target for individual and population based prevention. Monovalent pandemic 2009 H1N1 influenza A vaccines are available in this (recent influenza season. According to CDC, the next (2010-2011 influenza season trivalent vaccines will coverage the pandemic 2009 H1N1 influenza A vaccine. (Turk Arch Ped 2010; 45: 80th Year: 31-6

  15. Niemann-Pick C1-Like 1 (NPC1L1) Protein in Intestinal and Hepatic Cholesterol Transport

    Science.gov (United States)

    Jia, Lin; Betters, Jenna L.; Yu, Liqing

    2014-01-01

    Increased blood cholesterol is an independent risk factor for atherosclerotic cardiovascular disease. Cholesterol homeostasis in the body is controlled mainly by endogenous synthesis, intestinal absorption, and hepatic excretion. Niemann-Pick C1-Like 1 (NPC1L1) is a polytopic transmembrane protein localized at the apical membrane of enterocytes and the canalicular membrane of hepatocytes. It functions as a sterol transporter to mediate intestinal cholesterol absorption and counterbalances hepatobiliary cholesterol excretion. NPC1L1 is the molecular target of ezetimibe, a potent cholesterol absorption inhibitor that is widely used in treating hypercholesterolemia. Recent findings suggest that NPC1L1 deficiency or ezetimibe treatment also prevents diet-induced hepatic steatosis and obesity in addition to reducing blood cholesterol. Future studies should focus on molecular mechanisms underlying NPC1L1-dependent cholesterol transport and elucidation of how a cholesterol transporter modulates the pathogenesis of metabolic diseases. PMID:20809793

  16. The mappings of degree 1

    Directory of Open Access Journals (Sweden)

    2006-01-01

    Full Text Available The maps of the form f( x = ∑ i=1 n a i ⋅x⋅ b i , called 1-degree maps, are introduced and investigated. For noncommutative algebras and modules over them 1-degree maps give an analogy of linear maps and differentials. Under some conditions on the algebra &#x1d49c; , contractibility of the group of 1-degree isomorphisms is proved for the module l 2 ( &#x1d49c; . It is shown that these conditions are fulfilled for the algebra of linear maps of a finite-dimensional linear space. The notion of 1-degree map gives a possibility to define a nonlinear Fredholm map of l 2 ( &#x1d49c; and a Fredholm manifold modelled by l 2 ( &#x1d49c; . 1-degree maps are also applied to some problems of Markov chains.

  17. Sigma-1 receptor agonists directly inhibit Nav1.2/1.4 channels.

    Directory of Open Access Journals (Sweden)

    Xiao-Fei Gao

    Full Text Available (+-SKF 10047 (N-allyl-normetazocine is a prototypic and specific sigma-1 receptor agonist that has been used extensively to study the function of sigma-1 receptors. (+-SKF 10047 inhibits K(+, Na(+ and Ca2+ channels via sigma-1 receptor activation. We found that (+-SKF 10047 inhibited Na(V1.2 and Na(V1.4 channels independently of sigma-1 receptor activation. (+-SKF 10047 equally inhibited Na(V1.2/1.4 channel currents in HEK293T cells with abundant sigma-1 receptor expression and in COS-7 cells, which barely express sigma-1 receptors. The sigma-1 receptor antagonists BD 1063,BD 1047 and NE-100 did not block the inhibitory effects of (+-SKF-10047. Blocking of the PKA, PKC and G-protein pathways did not affect (+-SKF 10047 inhibition of Na(V1.2 channel currents. The sigma-1 receptor agonists Dextromethorphan (DM and 1,3-di-o-tolyl-guanidine (DTG also inhibited Na(V1.2 currents through a sigma-1 receptor-independent pathway. The (+-SKF 10047 inhibition of Na(V1.2 currents was use- and frequency-dependent. Point mutations demonstrated the importance of Phe(1764 and Tyr(1771 in the IV-segment 6 domain of the Na(V1.2 channel and Phe(1579 in the Na(V1.4 channel for (+-SKF 10047 inhibition. In conclusion, our results suggest that sigma-1 receptor agonists directly inhibit Na(V1.2/1.4 channels and that these interactions should be given special attention for future sigma-1 receptor function studies.

  18. Kinetic mixing effect in the 3 -3 -1 -1 model

    Science.gov (United States)

    Dong, P. V.; Si, D. T.

    2016-06-01

    We show that the mixing effect of the neutral gauge bosons in the 3 -3 -1 -1 model comes from two sources. The first one is due to the 3 -3 -1 -1 gauge symmetry breaking as usual, whereas the second one results from the kinetic mixing between the gauge bosons of U (1 )X and U (1 )N groups, which are used to determine the electric charge and baryon minus lepton numbers, respectively. Such mixings modify the ρ -parameter and the known couplings of Z with fermions. The constraints that arise from flavor-changing neutral currents due to the gauge boson mixings and nonuniversal fermion generations are also given.

  19. Integrating 3D CAD data for manufacturing and fabrication the core model of reactor TRIGA PUSPATI

    International Nuclear Information System (INIS)

    This paper describe the intrigue integration of digital 3 Dimensional Computer Aided Design (3D CAD) data manipulation for the Core Model fabrication of REAKTOR TRIGA PUSPATI and ready for mass manufacturing. 3 Dimensional CAD data from Computer Aided Design program will be used as an interpreter in the fabrication of this project. The Core Model of REAKTOR TRIGA PUSPATI will be fabricated with the aid of 3D CAD drawings and digital files. The components will be segregated and divided into 2 categories namely Conventional d Rapid Fabrication. (Author)

  20. Mosaic type-1 NF1 microdeletions as a cause of both generalized and segmental neurofibromatosis type-1 (NF1)

    OpenAIRE

    Messiaen, Ludwine M; Vogt, Julia; Bengesser, Kathrin; Fu, Chuanhua; Mikhail, Fady; Serra, Eduard; Garcia-Linares, Carles; Cooper, David N.; Lázaro, Conxi; Kehrer-Sawatzki, Hildegard

    2011-01-01

    Abstract Mosaicism is an important feature of type-1 neurofibromatosis (NF1) on account of its impact upon both clinical manifestations and transmission risk. Using FISH and MLPA to screen 3500 NF1 patients, we identified 146 individuals harbouring gross NF1 deletions, 14 of whom (9.6%) displayed somatic mosaicism. The high rate of mosaicism in patients with NF1 deletions supports the postulated idea of a direct relationship between the high new mutation rate in this cancer predisp...

  1. Sulfation of fulvestrant by human liver cytosols and recombinant SULT1A1 and SULT1E1

    Directory of Open Access Journals (Sweden)

    Edavana VK

    2011-11-01

    Full Text Available Vineetha Koroth Edavana1, Xinfeng Yu1, Ishwori B Dhakal1, Suzanne Williams1, Baitang Ning2, Ian T Cook3, David Caldwell1, Charles N Falany3, Susan Kadlubar11Division of Medical Genetics, College of Medicine, University of Arkansas for Medical Sciences, Little Rock, AR, USA; 2Division of Personalized Nutrition and Medicine, National Center for Toxicological Research, Food and Drug Administration, Jefferson, AR, USA; 3Department of Pharmacology, University of Alabama, Birmingham, AL, USAAbstract: Fulvestrant (Faslodex™ is a pure antiestrogen that is approved to treat hormone receptor-positive metastatic breast cancer in postmenopausal women. Previous studies have demonstrated that fulvestrant metabolism in humans involves cytochromes P450 and UDP-glucuronosyltransferases (UGTs. To date, fulvestrant sulfation has not been characterized. This study examined fulvestrant sulfation with nine recombinant sulfotransferases and found that only SULT1A1 and SULT1E1 displayed catalytic activity toward this substrate, with Km of 4.2 ± 0.99 and 0.2 ± 0.16 µM, respectively. In vitro assays of 104 human liver cytosols revealed marked individual variability that was highly correlated with β-naphthol sulfation (SULT1A1 diagnostic substrate; r = 0.98, P < 0.0001, but not with 17ß-estradiol sulfation (SULT1E1 diagnostic substrate; r = 0.16, P = 0.10. Fulvestrant sulfation was correlated with both SULT1A1*1/2 genotype (P value = 0.023 and copy number (P < 0.0001. These studies suggest that factors influencing SULT1A1/1E1 tissue expression and/or enzymatic activity could influence the efficacy of fulvestrant therapy.Keywords: fulvestrant, sulfotransferase, genotype, copy number

  2. 2016 SPD: Day 1

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors note: This week were in Boulder, Colorado at the 47th meeting of the AAS Solar Physics Division (SPD). Follow along to catch some of the latest news from the field of solar physics!The 2016 SPD meeting was launched this morning from the University of Colorado Boulder campus. Two of the hot topics at this years meeting include celebration of the recent move of the National Solar Observatorys headquarters to Boulder, and discussion of the future Daniel K. Inouye Solar Telescope (DKIST, formerly the Advanced Technology Solar Telescope, ATST). DKIST, planned for a 2019 completion in Hawaii, is the next big telescope on the horizon for solar physics.Todays press conference had an interesting focus: instruments providing new high-energy observations of the Sun. Representatives from four different instruments were here to talk about some of the latest X-ray solar observations.GRIPSThe GRIPS payload flew at 130,000 ft over Antarctica on a giant balloon in January 2016. [NASA/Albert Shih]First up, Albert Shih (NASA Goddard) described the Gamma-Ray Imager/Polarimeter for Solar flares, or GRIPS. GRIPS is a balloon-borne instrument designed to detect X-rays and gamma rays emitted during solar flares. Up to tens of a percent of the energy in solar flares is emitted in the form of accelerated particles, but the physics behind this process is not well understood. GRIPS observes where the highest-energy particles are accelerated, in an effort to learn more about the process.GRIPS was launched on 19 January, 2016 and flew for roughly 12 days gathering ~1 million seconds of data! The logistics of this instruments flight are especially interesting, since it was launched from Antarctica and carried by a balloon at a whopping elevation of 130,000 ft (to get high enough that the atmosphere doesnt absorb all the photons GRIPS is trying to observe). Though the data from the mission has been retrieved, the bulk of the hardware remains where it landed at the end of January. It must

  3. KAP1 regulates type I interferon/STAT1-mediated IRF-1 gene expression

    International Nuclear Information System (INIS)

    Signal transducers and activators of transcription (STATs) mediate cell proliferation, differentiation, and survival in immune responses, hematopoiesis, neurogenesis, and other biological processes. Recently, we showed that KAP1 is a novel STAT-binding partner that regulates STAT3-mediated transactivation. KAP1 is a universal co-repressor protein for the KRAB zinc finger protein superfamily of transcriptional repressors. In this study, we found KAP1-dependent repression of interferon (IFN)/STAT1-mediated signaling. We also demonstrated that endogenous KAP1 associates with endogenous STAT1 in vivo. Importantly, a small-interfering RNA-mediated reduction in KAP1 expression enhanced IFN-induced STAT1-dependent IRF-1 gene expression. These results indicate that KAP1 may act as an endogenous regulator of the IFN/STAT1 signaling pathway

  4. 40 CFR 180.450 - Beta-(4-Chlorophenoxy)-alpha-(1,1-dimethylethyl)-1H-1,2,4-triazole-1-ethanol; tolerances for...

    Science.gov (United States)

    2010-07-01

    ...-dimethylethyl)-1H-1,2,4-triazole-1-ethanol; tolerances for residues. 180.450 Section 180.450 Protection of...-dimethylethyl)-1H-1,2,4-triazole-1-ethanol; tolerances for residues. (a) General. Tolerances are established for...-ethanol (triadimenol) and its butanediol metabolite,...

  5. Blocking S1P interaction with S1P1 receptor by a novel competitive S1P1-selective antagonist inhibits angiogenesis

    International Nuclear Information System (INIS)

    Highlights: ► The effect of a newly developed S1P1-selective antagonist on angiogenic responses. ► S1P1 is a critical component of VEGF-related angiogenic responses. ► S1P1-selective antagonist showed in vitro activity to inhibit angiogenesis. ► S1P1-selective antagonist showed in vivo activity to inhibit angiogenesis. ► The efficacy of S1P1-selective antagonist for anti-cancer therapies. -- Abstract: Sphingosine 1-phosphate receptor type 1 (S1P1) was shown to be essential for vascular maturation during embryonic development and it has been demonstrated that substantial crosstalk exists between S1P1 and other pro-angiogenic growth factors, such as vascular endothelial growth factor (VEGF) and basic fibroblast growth factor. We developed a novel S1P1-selective antagonist, TASP0277308, which is structurally unrelated to S1P as well as previously described S1P1 antagonists. TASP0277308 inhibited S1P- as well as VEGF-induced cellular responses, including migration and proliferation of human umbilical vein endothelial cells. Furthermore, TASP0277308 effectively blocked a VEGF-induced tube formation in vitro and significantly suppressed tumor cell-induced angiogenesis in vivo. These findings revealed that S1P1 is a critical component of VEGF-related angiogenic responses and also provide evidence for the efficacy of TASP0277308 for anti-cancer therapies.

  6. Ire1 Has Distinct Catalytic Mechanisms for XBP1/HAC1 Splicing and RIDD

    Directory of Open Access Journals (Sweden)

    Arvin B. Tam

    2014-11-01

    Full Text Available An evolutionarily conserved unfolded protein response (UPR component, IRE1, cleaves XBP1/HAC1 introns in order to generate spliced mRNAs that are translated into potent transcription factors. IRE1 also cleaves endoplasmic-reticulum-associated RNAs leading to their decay, an activity termed regulated IRE1-dependent decay (RIDD; however, the mechanism by which IRE1 differentiates intron cleavage from RIDD is not well understood. Using in vitro experiments, we found that IRE1 has two different modes of action: XBP1/HAC1 is cleaved by IRE1 subunits acting cooperatively within IRE1 oligomers, whereas a single subunit of IRE1 performs RIDD without cooperativity. Furthermore, these distinct activities can be separated by complementation of catalytically inactive IRE1 RNase and mutations at oligomerization interfaces. Using an IRE1 RNase inhibitor, STF-083010, selective inhibition of XBP1 splicing indicates that XBP1 promotes cell survival, whereas RIDD leads to cell death, revealing modulation of IRE1 activities as a drug-development strategy.

  7. SAMHD1 controls cell cycle status, apoptosis and HIV-1 infection in monocytic THP-1 cells.

    Science.gov (United States)

    Bonifati, Serena; Daly, Michele B; St Gelais, Corine; Kim, Sun Hee; Hollenbaugh, Joseph A; Shepard, Caitlin; Kennedy, Edward M; Kim, Dong-Hyun; Schinazi, Raymond F; Kim, Baek; Wu, Li

    2016-08-01

    SAMHD1 limits HIV-1 infection in non-dividing myeloid cells by decreasing intracellular dNTP pools. HIV-1 restriction by SAMHD1 in these cells likely prevents activation of antiviral immune responses and modulates viral pathogenesis, thus highlighting a critical role of SAMHD1 in HIV-1 physiopathology. Here, we explored the function of SAMHD1 in regulating cell proliferation, cell cycle progression and apoptosis in monocytic THP-1 cells. Using the CRISPR/Cas9 technology, we generated THP-1 cells with stable SAMHD1 knockout. We found that silencing of SAMHD1 in cycling cells stimulates cell proliferation, redistributes cell cycle population in the G1/G0 phase and reduces apoptosis. These alterations correlated with increased dNTP levels and more efficient HIV-1 infection in dividing SAMHD1 knockout cells relative to control. Our results suggest that SAMHD1, through its dNTPase activity, affects cell proliferation, cell cycle distribution and apoptosis, and emphasize a key role of SAMHD1 in the interplay between cell cycle regulation and HIV-1 infection. PMID:27183329

  8. Underground storage tank 291-D1U1: Closure plan

    Energy Technology Data Exchange (ETDEWEB)

    Mancieri, S.; Giuntoli, N.

    1993-09-01

    The 291-D1U1 tank system was installed in 1983 on the north side of Building 291. It supplies diesel fuel to the Building 291 emergency generator and air compressor. The emergency generator and air compressor are located southwest and southeast, respectively, of the tank (see Appendix B, Figure 2). The tank system consists of a single-walled, 2,000- gallon, fiberglass tank and a fuel pump system, fill pipe, vent pipe, electrical conduit, and fuel supply and return piping. The area to be excavated is paved with asphalt and concrete. It is not known whether a concrete anchor pad is associated with this tank. Additionally, this closure plan assumes that the diesel tank is below the fill pad. The emergency generator and air compressor for Building 291 and its associated UST, 291-D1U1, are currently in use. The generator and air compressor will be supplied by a temporary above-ground fuel tank prior to the removal of 291-D1U1. An above-ground fuel tank will be installed as a permanent replacement for 291-D1U1. The system was registered with the State Water Resources Control Board on June 27, 1984, as 291-41D and has subsequently been renamed 291-D1U1. Figure 1 (see Appendix B) shows the location of the 291-D1U1 tank system in relation to the Lawrence Livermore National Laboratory (LLNL). Figure 2 (see Appendix B) shows the 291-D1U1 tank system in relation to Building 291. Figure 3 (see Appendix B) shows a plan view of the 291-D1U1 tank system.

  9. Effect of APE1 T2197G (Asp148Glu) polymorphism on APE1, XRCC1, PARP1 and OGG1 expression in patients with colorectal cancer.

    Science.gov (United States)

    Santos, Juliana C; Funck, Alexandre; Silva-Fernandes, Isabelle J L; Rabenhorst, Silvia H B; Martinez, Carlos A R; Ribeiro, Marcelo L

    2014-01-01

    It has been hypothesized that genetic variation in base excision repair (BER) might modify colorectal adenoma risk. Thus, we evaluated the influence of APE1 T2197G (Asp148Glu) polymorphism on APE1, XRCC1, PARP1 and OGG1 expression in normal and tumor samples from patients with colorectal cancer. The results indicate a downregulation of OGG1 and an upregulation of XRCC1 expression in tumor tissue. Regarding the anatomical location of APE1, OGG1 and PARP-1, a decrease in gene expression was observed among patients with cancer in the rectum. In patients with or without some degree of tumor invasion, a significant downregulation in OGG1 was observed in tumor tissue. Interestingly, when taking into account the tumor stage, patients with more advanced grades (III and IV) showed a significant repression for APE1, OGG1 and PARP-1. XRCC1 expression levels were significantly enhanced in tumor samples and were correlated with all clinical and histopathological data. Concerning the polymorphism T2197G, GG genotype carriers exhibited a significantly reduced expression of genes of the BER repair system (APE1, XRCC1 and PARP1). In summary, our data show that patients with colorectal cancer present expression changes in several BER genes, suggesting a role for APE1, XRCC1, PARP1 and OGG1 and APE1 polymorphism in colorectal carcinogenesis. PMID:25268610

  10. Effect of APE1 T2197G (Asp148Glu Polymorphism on APE1, XRCC1, PARP1 and OGG1 Expression in Patients with Colorectal Cancer

    Directory of Open Access Journals (Sweden)

    Juliana C. Santos

    2014-09-01

    Full Text Available It has been hypothesized that genetic variation in base excision repair (BER might modify colorectal adenoma risk. Thus, we evaluated the influence of APE1 T2197G (Asp148Glu polymorphism on APE1, XRCC1, PARP1 and OGG1 expression in normal and tumor samples from patients with colorectal cancer. The results indicate a downregulation of OGG1 and an upregulation of XRCC1 expression in tumor tissue. Regarding the anatomical location of APE1, OGG1 and PARP-1, a decrease in gene expression was observed among patients with cancer in the rectum. In patients with or without some degree of tumor invasion, a significant downregulation in OGG1 was observed in tumor tissue. Interestingly, when taking into account the tumor stage, patients with more advanced grades (III and IV showed a significant repression for APE1, OGG1 and PARP-1. XRCC1 expression levels were significantly enhanced in tumor samples and were correlated with all clinical and histopathological data. Concerning the polymorphism T2197G, GG genotype carriers exhibited a significantly reduced expression of genes of the BER repair system (APE1, XRCC1 and PARP1. In summary, our data show that patients with colorectal cancer present expression changes in several BER genes, suggesting a role for APE1, XRCC1, PARP1 and OGG1 and APE1 polymorphism in colorectal carcinogenesis.

  11. Metamorphosis of NPP A1, V1, V2

    International Nuclear Information System (INIS)

    In this book the history of construction, commissioning and exploitation of NPP A1, NPP V1 and NPP V2 in Jaslovske Bohunice is presented on documentary photos. Vicinity around of these NPPs is presented, too

  12. ERF1 -- Enhanced River Reach File 1.2

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — U.S. Environmental Protection Agency's River Reach File 1 (RF1)to ensure the hydrologic integrity of the digital reach traces and to quantify the mean water time of...

  13. 26 CFR 1.50A-1 - Determination of amount.

    Science.gov (United States)

    2010-04-01

    ... such spouse, for example, from an electing small business corporation, as defined in section 1371(b... § 1.1563-1(b)(2)(ii)(c), an electing small business corporation shall be treated as an excluded...

  14. General Unitary SU(1,1) TFD Formulation

    OpenAIRE

    Abdalla, M. C. B.; Gadelha, A. L.

    2003-01-01

    In this work we discuss a generalization for the thermal Bogoliubov transformation in the context of a hermitian general SU(1,1) transformation generator. The TFD tilde conjugation rules are redefined using an appropriated Tomita-Takesaki modular operator.

  15. General Unitary SU(1,1) TFD Formulation

    CERN Document Server

    Abdalla, Maria Christina B

    2004-01-01

    In this work we discuss a generalization for the thermal Bogoliubov transformation in the context of a hermitian general SU(1,1) transformation generator. The TFD tilde conjugation rules are redefined using an appropriated Tomita-Takesaki modular operator.

  16. 2016 Mission Operations Working Group: Earth Observing-1 (EO-1)

    Science.gov (United States)

    Frye, Stuart

    2016-01-01

    EO-1 Mission Status for the Constellation Mission Operations Working Group to discuss the EO-1 flight systems, mission enhancements, debris avoidance maneuver, orbital information, 5-year outlook, and new ground stations.

  17. WA-circumflex(n - 1 modul n - 1)(1) Miura transformation: Analysis and applications

    International Nuclear Information System (INIS)

    We introduce the concept of conformal spin gradation of the untwisted affine Lie superalgebra A-circumflex(n -1 modul n - 1)(1) to study the WA-circumflex(n - 1 modul n - 1)(1) Miura transformation. We show that the essential of A-circumflex(n - 1 modul n - 1)(1) may be read from the conformal spin gradation of the canonical vector basis of the SL(n modul n) vector representation space V2n and a spectral parameter μ. We give the generic formula of their conformal spin weights. Then, we set up the fundamentals of a manifestly N = 2 U(1) Lax formalism leading to a manifestly N = 2 WA-circumflex(n - 1 modul n - 1)(1) Miura transformation. Its explicit form is obtained and is shown to have a similar structure as in the N = 0 case. Both N = 0 WA-circumflex(n - 1)(1) and N = 2 WA-circumflex(n - 1 modul n - 1)(1) Miura transformations involve (n - 1) N = 0 and N = 2 conserved currents with integer conformal spins. The leading cases are discussed. Using the U(1) charge of the N = 2 algebra, we develop also a new method of constructing N = 2 superfield realizations of the N = 2 higher spin supercurrents. Among other results, we find that in general there are three series of (n - 1) higher conformal spin N = 2 supercurrents. The usual N = 2 super W currents are the only hermitian ones. At the n = 3 level, we find a new Feigin Fuchs type extension of the conformal spin one N = 2 supercurrent. Such a feature, which has no analogue at the n = 2 level, is also present for n>3. Finally, we give the N = 2 superfield formulation of the N = 2 Boussinesq equation and its generalization involving complex N = 2 supercurrents. (author). 27 refs

  18. Johnston Atoll Site 1A-P 1/23/2006 1-2M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Johnston Atoll, site 1AP 16 46.909N, 169 27.757W, between 1 and 2 meters along a permanent transect.

  19. Johnston Atoll Site 1A-P 1/23/2006 0-1M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Johnston Atoll, site 1AP 16 46.909N, 169 27.757W, between 0 and 1 meters along a permanent transect.

  20. Interleukin 1 is a radioprotector

    International Nuclear Information System (INIS)

    Pretreatment with recombinant interleukin 1 (IL 1) protects mice in a dose-dependent manner from lethal effects of ionizing radiation. Two thousand units of IL 1, given i.p. 20 hr before irradiation, protect 88% of C57B1/6 mice from an LD100/17 radiation dose (dose of radiation that kills 100% mice in 17 days), and 1000 U of IL 1 protect 100% of DBA/1 mice from an LD50/30 dose. This finding provides the first evidence that a cytokine, IL 1, which acts as a differentiation- and maturation-inducing agent for a variety of cells, also can serve as a signal that initiates radioprotective events in vivo. Because many of the exogenous immunomodulators that have been shown to be radioprotective also induce endogenous IL 1 production, our observation suggests that IL 1 may mediate their radioprotective effects

  1. TRAC-BD1/MOD1 user's guideline

    International Nuclear Information System (INIS)

    Code assessment studies and specific code applications have provided insight into the effective use of the TRAC-BWR series of codes. This document reports the experience gained from the studies and serves to assist the user in the effective application of the TRAC-BD1/MOD1 computer code. This document stresses the user's perspective relative to approprite use of the TRAC-BD1/MOD1 code and is considered an adjunct to other documentation provided with the code

  2. Germline Mutation of INI1/SMARCB1 in Familial Schwannomatosis

    OpenAIRE

    Hulsebos, Theo J. M.; Plomp, Astrid S.; Wolterman, Ruud A.; Robanus-Maandag, Els C.; Baas, Frank; Wesseling, Pieter

    2007-01-01

    Patients with schwannomatosis develop multiple schwannomas but no vestibular schwannomas diagnostic of neurofibromatosis type 2. We report an inactivating germline mutation in exon 1 of the tumor-suppressor gene INI1 in a father and daughter who both had schwannomatosis. Inactivation of the wild-type INI1 allele, by a second mutation in exon 5 or by clear loss, was found in two of four investigated schwannomas from these patients. All four schwannomas displayed complete loss of nuclear INI1 p...

  3. Synthesis of fluorinated agonist of sphingosine-1-phosphate receptor 1.

    Science.gov (United States)

    Aliouane, Lucie; Chao, Sovy; Brizuela, Leyre; Pfund, Emmanuel; Cuvillier, Olivier; Jean, Ludovic; Renard, Pierre-Yves; Lequeux, Thierry

    2014-09-01

    The bioactive metabolite sphingosine-1-phosphate (S1P), a product of sphingosine kinases (SphKs), mediates diverse biological processes such as cell differentiation, proliferation, survival and angiogenesis. A fluorinated analogue of S1P receptor agonist has been synthesized by utilizing a ring opening reaction of oxacycles by a lithiated difluoromethylphosphonate anion as the key reaction. In vitro activity of this S1P analogue is also reported. PMID:25047939

  4. Palladium-catalyzed 1,1-difunctionalization of ethylene.

    Science.gov (United States)

    Saini, Vaneet; Sigman, Matthew S

    2012-07-18

    The 1,1-difunctionalization of ethylene, with aryl/vinyl/heteroaryl transmetalating agents and vinyl electrophiles, is reported. The reaction is high-yielding under a low pressure of ethylene, and regioselectivity is generally high for the 1,1-disubstituted product. The process is highlighted by the use of heteroaromatic cross-coupling reagents, which have not been competent reaction partners in previously reported efforts. PMID:22765909

  5. Palladium-Catalyzed 1,1-Difunctionalization of Ethylene

    OpenAIRE

    Saini, Vaneet; Sigman, Matthew S.

    2012-01-01

    The 1,1 difunctionalization of ethylene, with aryl/vinyl/heteroaryl transmetallating agents and vinyl electrophiles is reported. The reaction is high-yielding under low pressure of ethylene and regioselectivity is generally high for the 1,1-disubstituted product. The process is highlighted by the use of heteroaromatic cross-coupling reagents, which have not been competent reaction partners in previously reported efforts.

  6. Suppression of CYP1A1 expression by naringenin in murine Hepa-1c1c7 cells.

    Science.gov (United States)

    Kim, Ji Young; Han, Eun Hee; Shin, Dong Weon; Jeong, Tae Cheon; Lee, Eung Seok; Woo, Eun-Rhan; Jeong, Hye Gwang

    2004-08-01

    Naringenin, dietary flavonoid, is antioxidant constituents of many citrus fruits. In the present study, we investigated the effect of naringenin on 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD)-inducible CYP1A1 gene expression in mouse hepatoma Hepa-1c1c7 cells. Naringenin alone did not affect CYP1A1-specific 7-ethoxyresorufin O-deethylase (EROD) activity. In contrast, the TCDD-inducible EROD activities were markedly reduced upon concomitant treatment with TCDD and naringenin in a dose dependent manner. TCDD-induced CYP1A1 mRNA level was also markedly suppressed by naringenin. A transient transfection assay using dioxin-response element (DRE)-linked luciferase and electrophoretic mobility shift assay revealed that naringenin reduced transformation of the aryl hydrocarbons receptor(AhR) to a form capable of specifically binding to the DRE sequence in the promoter of the CYP1A1 gene. These results suggest the down regulation of the CYP1A1 gene expression by either naringenin in Hepa-1c1c7 cells might be antagonism of the DRE binding potential of nuclear AhR. PMID:15460448

  7. Suppression of CYP1A1 expression by 4-nonylphenol in murine Hepa-1c1c7 cells.

    Science.gov (United States)

    Jeong, H G; Kim, J Y; Choi, C Y; You, H J; Hahm, K

    2001-04-10

    This study investigated the effects that 4-nonylphenol (NP) has on CYP1A1 expression in Hepa-1c1c7 cell cultures. NP alone did not affect CYP1A1-specific 7-ethoxyresorufin-O-deethylase (EROD) activity. In contrast, the 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD)-inducible EROD activities were markedly reduced upon concomitant treatment with TCDD and NP in a dose-dependent manner. Treatment with tamoxifen, an anti-estrogen that acts through the estrogen receptor, did not affect the suppressive effects that NP has on TCDD-inducible EROD activity. The TCDD-inducible CYP1A1 mRNA levels were markedly suppressed upon concomitant treatment with TCDD and NP that is consistent with their effects on EROD activity. A transient transfection assay using dioxin-response element (DRE)-linked luciferase and an electrophoretic mobility shift assay revealed that NP reduced the transformation of the aryl hydrocarbon (Ah) receptor to a form capable of binding specifically to the DRE sequence of the CYP1A1 gene promoter. These results suggest that the down-regulation of CYP1A1 gene expression by NP in Hepa-1c1c7 cells might be an antagonism of the DRE-binding potential of the nuclear Ah receptor, but is not mediated through the estradiol receptor. PMID:11248424

  8. Human kidney anion exchanger 1 interacts with adaptor-related protein complex 1 {mu}1A (AP-1 mu1A)

    Energy Technology Data Exchange (ETDEWEB)

    Sawasdee, Nunghathai; Junking, Mutita [Division of Medical Molecular Biology and BIOTEC-Medical Biotechnology Unit, Department of Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Ngaojanlar, Piengpaga [Division of Medical Molecular Biology and BIOTEC-Medical Biotechnology Unit, Department of Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Department of Immunology and Graduate Program in Immunology, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Sukomon, Nattakan; Ungsupravate, Duangporn [Division of Medical Molecular Biology and BIOTEC-Medical Biotechnology Unit, Department of Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Limjindaporn, Thawornchai [Division of Medical Molecular Biology and BIOTEC-Medical Biotechnology Unit, Department of Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Department of Anatomy, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Akkarapatumwong, Varaporn [Institute of Molecular Biosciences, Mahidol University at Salaya Campus, Nakorn Pathom 73170 (Thailand); Noisakran, Sansanee [Division of Medical Molecular Biology and BIOTEC-Medical Biotechnology Unit, Department of Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Yenchitsomanus, Pa-thai, E-mail: grpye@mahidol.ac.th [Division of Medical Molecular Biology and BIOTEC-Medical Biotechnology Unit, Department of Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand)

    2010-10-08

    Research highlights: {yields} Trafficking defect of kAE1 is a cause of dRTA but trafficking pathway of kAE1 has not been clearly described. {yields} Adaptor-related protein complex 1 {mu}1A (AP-1 mu1A) was firstly reported to interact with kAE1. {yields} The interacting site for AP-1 mu1A on Ct-kAE1 was found to be Y904DEV907, a subset of YXXO motif. {yields} AP-1 mu1A knockdown showed a marked reduction of kAE1 on the cell membrane and its accumulation in endoplasmic reticulum. {yields} AP-1 mu1A has a critical role in kAE1 trafficking to the plasma membrane. -- Abstract: Kidney anion exchanger 1 (kAE1) mediates chloride (Cl{sup -}) and bicarbonate (HCO{sub 3}{sup -}) exchange at the basolateral membrane of kidney {alpha}-intercalated cells. Impaired trafficking of kAE1 leads to defect of the Cl{sup -}/HCO{sub 3}{sup -} exchange at the basolateral membrane and failure of proton (H{sup +}) secretion at the apical membrane, causing a kidney disease - distal renal tubular acidosis (dRTA). To gain a better insight into kAE1 trafficking, we searched for proteins physically interacting with the C-terminal region of kAE1 (Ct-kAE1), which contains motifs crucial for intracellular trafficking, by a yeast two-hybrid (Y2H) system. An adaptor-related protein complex 1 {mu}1A (AP-1 mu1A) subunit was found to interact with Ct-kAE1. The interaction between either Ct-kAE1 or full-length kAE1 and AP-1 mu1A were confirmed in human embryonic kidney (HEK) 293T by co-immunoprecipitation, affinity co-purification, co-localization, yellow fluorescent protein (YFP)-based protein fragment complementation assay (PCA) and GST pull-down assay. The interacting site for AP-1 mu1A on Ct-kAE1 was found to be Y904DEV907, a subset of YXXO motif. Interestingly, suppression of endogenous AP-1 mu1A in HEK 293T by small interfering RNA (siRNA) decreased membrane localization of kAE1 and increased its intracellular accumulation, suggesting for the first time that AP-1 mu1A is involved in the kAE1

  9. Human kidney anion exchanger 1 interacts with adaptor-related protein complex 1 μ1A (AP-1 mu1A)

    International Nuclear Information System (INIS)

    Research highlights: → Trafficking defect of kAE1 is a cause of dRTA but trafficking pathway of kAE1 has not been clearly described. → Adaptor-related protein complex 1 μ1A (AP-1 mu1A) was firstly reported to interact with kAE1. → The interacting site for AP-1 mu1A on Ct-kAE1 was found to be Y904DEV907, a subset of YXXO motif. → AP-1 mu1A knockdown showed a marked reduction of kAE1 on the cell membrane and its accumulation in endoplasmic reticulum. → AP-1 mu1A has a critical role in kAE1 trafficking to the plasma membrane. -- Abstract: Kidney anion exchanger 1 (kAE1) mediates chloride (Cl-) and bicarbonate (HCO3-) exchange at the basolateral membrane of kidney α-intercalated cells. Impaired trafficking of kAE1 leads to defect of the Cl-/HCO3- exchange at the basolateral membrane and failure of proton (H+) secretion at the apical membrane, causing a kidney disease - distal renal tubular acidosis (dRTA). To gain a better insight into kAE1 trafficking, we searched for proteins physically interacting with the C-terminal region of kAE1 (Ct-kAE1), which contains motifs crucial for intracellular trafficking, by a yeast two-hybrid (Y2H) system. An adaptor-related protein complex 1 μ1A (AP-1 mu1A) subunit was found to interact with Ct-kAE1. The interaction between either Ct-kAE1 or full-length kAE1 and AP-1 mu1A were confirmed in human embryonic kidney (HEK) 293T by co-immunoprecipitation, affinity co-purification, co-localization, yellow fluorescent protein (YFP)-based protein fragment complementation assay (PCA) and GST pull-down assay. The interacting site for AP-1 mu1A on Ct-kAE1 was found to be Y904DEV907, a subset of YXXO motif. Interestingly, suppression of endogenous AP-1 mu1A in HEK 293T by small interfering RNA (siRNA) decreased membrane localization of kAE1 and increased its intracellular accumulation, suggesting for the first time that AP-1 mu1A is involved in the kAE1 trafficking of kidney α-intercalated cells.

  10. Investigation of InSb(1 1 0) and InSb(1 1 1) surfaces by means of target current (VLEED) spectroscopy and LEED

    International Nuclear Information System (INIS)

    In this paper, we present experimental results of target current (TCS) and LEED investigation of well-oriented InSb(1 1 0) and InSb(1 1 1)-A and InSb(1 1 1)-B crystals. TCS results are interpreted in terms of very low electron diffraction (VLEED) and empty band signatures. To examine to which extent the TCS spectra reflect the bulk or surface electronic properties of InSb(1 1 0), thin layers of indium have been evaporated and the corresponding spectrum changes have been investigated.

  11. Uncertainty analysis for containment response of U.S. EPR TM reactor to large break loss-of-coolant accidents

    International Nuclear Information System (INIS)

    This paper presents an uncertainty analysis applying the GOTHIC containment analysis code to simulate the first 24-hours following a large-break loss-of-coolant accident (LBLOCA) in AREVA's U.S. EPR TM plant. The uncertainty method is modeled after a study performed by the Gesellschaft fur Anlagen und Reaktorsicherheit (GRS) using data from the Heifidampf-Reaktor (HDR) Test T31.5. The analysis method incorporates an assessment of phenomenological importance, identifying the dominant contributors that influence the principle analysis metric, containment pressure. As with the GRS approach, this study employs non-parametric statistics. This analysis illustrates U.S. EPR containment response sensitivity to realistic variation in a set of important model parameters influencing containment conditions during LBLOCA. In considering a set of model uncertainty parameters, a number of GOTHIC variation calculations were performed (59 calculations) to effect a best estimate plus uncertainty result at 95/95 coverage/confidence level for the key metric, containment pressure. The results of the importance analysis showed condensation phenomena on the surface of the containment structures to be important during the passive cooling period, which occurred prior to the start of HL (hot leg) injection of SI (safety injection). In this study, hot leg injection was assumed to initiate at 1.5 hours. Condensation phenomena faded in importance after 1.5 hours due to the hot leg injection of SI suppressing steaming. Structure conduction, especially, the physical properties of concrete, retained importance throughout the transient. (authors)

  12. KONVERSI KATALITIK MINYAK SAWIT UNTUK MENGHASILKAN BIOFUEL MENGGUNAKAN SILIKA ALUMINA DAN HZSM-5 SINTESIS

    Directory of Open Access Journals (Sweden)

    Nurjannah Nurjannah

    2012-02-01

    Full Text Available Terbatasnya sumber energi fosil menyebabkan perlunya pengembangan energi terbarukan yang berasal dari alam dan dapat diperbaharui. Penggunaan bahan bakar minyak bumi, baik dari penggunaan berupa alat transportasi maupun dari penggunaan oleh industri sangat mencemari lingkungan karena tingkat polusi yang ditimbulkan sangat tinggi sehingga perlu mencari bahan bakar alternatif pengganti bahan bakar gasoline, solar, dan kerosene dari minyak nabati. Penelitian dilakukan dalam dua tahapan yaitu sintesa katalis dan proses katalitik cracking. Silika alumina disintesa menggunakan metode Latourette dan HZSM-5 disintesa menggunakan metode Plank. Hasil sintesa dikarakterisasi dengan Penyerapan Spektroskopi Atomis (AAS menunjukkan bahwa silika alumina dan HZSM-5 mempunyai Si/Al 198 dan 243. Luas permukaan  silika alumina dan HZSM-5 diperoleh dari analisa Brunauer Emmet Teller (BET yaitu 149,91-213,35 m2.g-1 dan ukuran pori rata-rata adalah 13oA. Perengkahan katalitik dilakukan dalam suatu mikroreaktor fixed bed pada temperatur 350-500°C dan laju alir gas N2 100-160 ml.min-1 selama 120 min. Hasil perengkahan dianalisa dengan metode gas kromatografi. Hasil yang diperoleh untuk katalis HZSM-5 fraksi gasoline dengan yield tertinggi 28,87%, kerosene 16,70%, dan diesel 12,20%  pada suhu reaktor 4500C dan laju gas N2 100 ml/menit.

  13. Pengaruh Aerasi dan Sumber Nutrien terhadap Kemampuan Alga Filum Chlorophyta dalam Menyerap Karbon (Carbon Sink untuk Mengurangi Emisi CO2 di Kawasan Perkotaan

    Directory of Open Access Journals (Sweden)

    Lancur Setoaji

    2013-09-01

    Full Text Available Penelitian terkait mitigasi pemanasan global, khususnya dalam penyerapan karbon dioksida (CO2, menjadi fokus utama di kalangan ilmuwan dunia. Secara alamiah, karbon dioksida dapat diserap oleh tumbuhan hijau, laut, karbonasi batuan kapur, dan alga. Pigmen hijau dalam alga atau klorofil dapat menyerap karbon dioksida dalam proses fotosintesis. Alga memiliki pertumbuhan yang sangat cepat sehingga cocok digunakan sebagai carbon sink. Penelitian terkait carbon sink ini bertujuan untuk menentukan kemampuan rata-rata serapan CO2 oleh alga di kawasan perkotaan dan menentukan pengaruh aerasi dan variasi sumber N terhadap pertumbuhan dan perkembangan alga. Penelitian ini dilakukan dalam skala laboratorium menggunakan reaktor dengan proses batch. Sampel alga yang digunakan didapatkan dari hasil pengembangbiakan yang bersumber dari perairan di kawasan perkotaan. Penelitian ini menggunakan dua variabel uji, yaitu aerasi dan sumber nutrien. Jumlah karbon dioksida yang diserap didapatkan dari perbandingan stoikiometri pada reaksi fotosintesis.  Berdasarkan perbandingan stoikiometri tersebut diketahui bahwa 1 gram sel alga yang terbentuk sebanding dengan 1,92 gram CO2 yang diserap. Dari hasil penelitian, alga dengan penambahan pupuk urea dapat menyerap 4,87 mg CO2/hari dalam kondisi tanpa aerasi atau 3,84 mg CO2/hari dengan aerasi. Sedangkan alga dengan penambahan pupuk NPK dapat menyerap 3,61 mg CO2/hari dalam kondisi tanpa aerasi atau 3,01 mg CO2/hari dengan aerasi.

  14. Suppression of Exogenous Gene Expression by Spermidine/Spermine N1-Acetyltransferase 1 (SSAT1) Cotransfection*

    OpenAIRE

    Lee, Seung Bum; Park, Jong Hwan; Woster, Patrick M.; CASERO, ROBERT A.; Park, Myung Hee

    2010-01-01

    Spermidine/spermine N1-acetyltransferase 1 (SSAT1), which catalyzes the N1-acetylation of spermidine and spermine to form acetyl derivatives, is a rate-limiting enzyme in polyamine catabolism. We now report a novel activity of transiently transfected SSAT1 in suppressing the exogenous expression of other proteins, i.e. green fluorescent protein (GFP) or GFP-eIF5A. Spermidine/spermine N1-acetyltransferase 2 (SSAT2) or inactive SSAT1 mutant enzymes (R101A or R101K) were without effect. The loss...

  15. Association of CYP1A1 and GSTM1 Polymorphisms With Oral Cancer Susceptibility

    OpenAIRE

    Liu, Haitao; Jia, Jinlin; Mao, Xuemei; Lin, Zhiyong

    2015-01-01

    Abstract Our meta-analysis was aimed to evaluate the association of CYP1A1 and glutathione-S-transferase M1 (GSTM1) polymorphisms with oral cancer susceptibility. The related articles were searched in PubMed, Embase, and CNKI databases. Fifty eligible studies were included in our meta-analysis. Odds ratios (ORs) with 95% confidence intervals (CIs) were used to evaluate the relationship of CYP1A1 (rs4646903 and rs1048943) and GSTM1 polymorphisms with oral cancer risk. A random-effects model or...

  16. ADD1/SREBP1c activates the PGC1-alpha promoter in brown adipocytes

    DEFF Research Database (Denmark)

    Hao, Qin; Hansen, Jacob B; Petersen, Rasmus K;

    2010-01-01

    Cold adaptation elicits a paradoxical simultaneous induction of fatty acid synthesis and beta-oxidation in brown adipose tissue. We show here that cold exposure coordinately induced liver X receptor alpha (LXRalpha), adipocyte determination and differentiation-dependent factor 1 (ADD1)/sterol...... regulatory element-binding protein-1c (SREBP1c) and peroxisome proliferator-activated receptor gamma coactivator-1alpha (PGC1alpha) in brown and inguinal white adipose tissues, but not in epididymal white adipose tissue. Using in vitro models of white and brown adipocytes we demonstrate that beta...... regulator of PGC1alpha expression in brown adipose tissue....

  17. Phosphorylation sites of Arabidopsis MAP Kinase Substrate 1 (MKS1)

    DEFF Research Database (Denmark)

    Caspersen, M.B.; Qiu, J.-L.; Zhang, X.; Andreasson, E.; Naested, H.; Mundy, J.; Svensson, Birte

    2007-01-01

    The Arabidopsis MAP kinase 4 (MPK4) substrate MKS1 was expressed in Escherichia coli and purified, full-length, 6x histidine (His)-tagged MKS1 was phosphorylated in vitro by hemagglutinin (HA)-tagged MPK4 immuno-precipitated from plants. MKS1 phosphorylation was initially verified by electrophore...

  18. DSS1/Sem1, a Multifunctional and Intrinsically Disordered Protein

    DEFF Research Database (Denmark)

    Kragelund, Birthe B; Schenstrøm, Signe M; Rebula, Caio A;

    2016-01-01

    DSS1/Sem1 is a versatile intrinsically disordered protein. Besides being a bona fide subunit of the 26S proteasome, DSS1 associates with other protein complexes, including BRCA2-RPA, involved in homologous recombination; the Csn12-Thp3 complex, involved in RNA splicing; the integrator, involved in...

  19. 26 CFR 1.832-1 - Gross income.

    Science.gov (United States)

    2010-04-01

    ... such, home office remittances and receipts, and special deposits, are ignored. Gain or loss from agency... include (1) life insurance reserves as defined in section 803(b) and § 1.803-1 pertaining to the life... section 831 and not qualifying as a life insurance company under section 801, and (2) liability for...

  20. IDC Use Case Model Survey Version 1.1.

    Energy Technology Data Exchange (ETDEWEB)

    Harris, James Mark [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Carr, Dorthe B. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)

    2015-02-01

    This document contains the brief descriptions for the actors and use cases contained in the IDC Use Case Model. REVISIONS Version Date Author/Team Revision Description Authorized by V1.0 12/2014 SNL IDC Reengineering Project Team Initial delivery M. Harris V1.1 2/2015 SNL IDC Reengineering Project Team Iteration I2 Review Comments M. Harris