WorldWideScience

Sample records for basf-industriekernkraftwerk reaktor 1

  1. ANALISIS INVENTORI REAKTOR DAYA EKSPERIMENTAL JENIS REAKTOR GAS TEMPERATUR TINGGI

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2016-06-01

    Full Text Available ABSTRAK ANALISIS INVENTORI REAKTOR DAYA EKSPERIMENTAL JENIS REAKTOR GAS TEMPERATUR TINGGI. Berkaitan dengan rencana Badan Tenaga Nuklir Nasional (BATAN untuk mengoperasikan reaktor eksperimental jenis Reaktor Gas Temperatur Tinggi (RGTT, maka diperlukan analisis keselamatan terhadap reaktor terutama yang berkaitan dengan issue lingkungan. Analisis sebaran radionuklida dari reaktor ke lingkungan pada kondisi operasi normal atau abnormal diawali dengan estimasi sumber radionuklida di teras reaktor (inventori teras berdasarkan pada tipe, daya, dan operasi reaktor. Tujuan penelitian adalah melakukan analisis inventori teras untuk disain Reaktor Daya Eksperimental (RDE jenis reaktor gas temperature tinggi berdaya 10 MWt, 20 MWt dan 30 MWt. Analisis dilakukan menggunakan program ORIGEN2 berbasis pustaka penampang lintang pada temperatur tinggi. Perhitungan diawali dengan membuat modifikasi beberapa parameter pustaka tampang lintang berdasarkan temperatur rata-rata teras sebesar 5700 °C dan dilanjutkan dengan melakukan perhitungan inventori reaktor untuk reaktor RDE berdaya 10 MWt. Parameter utama reaktor RDE 10 MWt yang digunakan dalam perhitungan sama dengan parameter utama reaktor HTR-10. Setelah inventori reaktor RDE 10 MWt diperoleh, dilakukan perbandingan dengan hasil dari peneliti terdahulu. Berdasarkan kesesuaian hasil yang didapat dilakukan desain untuk reaktor RDE 20MWEt dan 30 MWt untuk memperoleh parameter utama reaktor tersebut berupa jumlah bahan bakar pebble bed di teras reaktor, tinggi dan diameter teras. Berdasarkan pareameter utama teras dilakukan perhitungan inventori teras RDE 20 MWt dan 30 MWt dengan metode yang sama dengan metode perhitungan pada RDE 10 MWt. Hasil yang diperoleh adalah inventori terbesar untuk reaktor RDE 10 MWt, 20 MWt dan 30 MWt secara berurutan untuk kelompok Kr adalah sekitar 1,00E+15 Bq, 1,20E+16 Bq, 1,70E+16 Bq untuk kelompok I sebesar 6,50E+16 Bq, 1,20E+17 Bq, 1,60E+17 Bq dan untuk

  2. Aspek Proteksi Radiasi Pada Peningkatan Daya Reaktor Triga 2000

    OpenAIRE

    Oetami, Rini Heroe; Wiryosimin, S; Kurnia, E; Sofyan, S; Arifin, Z

    2002-01-01

    ASPEK PROTEKSI RADIASI FADA PENLNGKATAN DAYA REAKTOR TRIGA 2000. Reaktor TRIGA Mark II Bandung telah ditingkatkan dayanya dari 1 MW menjadi 2 MW dan saat ini namanya menjadi reaktor TRIGA 2000. Pekerjaan peningkatan daya meliputi tahap kegiatan pembongkaran, pemasangan dan uji nuklir yang memberikan risiko bahaya radiasi eksterna maupun interna. Bahaya radiasi dapat memberikan efek deterministik dan stokastik pada jaringan tubuh. Untuk mencegah efek deterministik dan menurunkan peluang terjad...

  3. DESAIN KONSEPTUAL PERISAI RADIASI REAKTOR RRI-50

    Directory of Open Access Journals (Sweden)

    Amir Hamzah

    2015-06-01

    Full Text Available ABSTRAK DESAIN KONSEPTUAL PERISAI RADIASI REAKTOR RRI-50. Salah satu parameter yang harus dipenuhi dalam mendesain reaktor nuklir adalah desain perisai radiasi yang dapat menjamin keamanan dan keselamatan radiasi bagi pekerja dan masyarakat sekitar. Pada penelitian ini dilakukan desain perisai radiasi RRI-50 dengan elemen bakar berjenis U9Mo-Al berkerapatan tinggi dengan tipe pelat sebanyak 21 buah dan berdimensi seperti elemen bakar RSG-GAS tapi panjang aktifnya 70 cm. Konfigurasi teras terdiri dari 16 elemen bakar dan 4 elemen kendali serta 5 posisi iradiasi sehingga membentuk matriks 5 x 5. Tujuan dari penelitian ini adalah mendesain perisai radiasi dan menentukan distribusi laju dosis di daerah kerja dan di lingkungan reaktor RRI-50. Tahapan awal penelitian adalah perhitungan kuat sumber dan inventori bahan radioaktif teras reaktor dengan mensimulasikan operasi 50 MW selama 20 hari tiap siklus menggunakan program ORGEN2.1. Berdasarkan kuat sumber tersebut dan model yang dibuat menggunakan program VisEd, maka dilakukan analisis penentuan parameter perisai radiasi secara iteratif menggunakan program MCNPX. Pada tahap akhir, dilakukan analisis distribusi laju dosis di seluruh ruang di dalam dan di luar gedung reaktor juga menggunakan program MCNPX. Hasil yang diperoleh menunjukkan bahwa ketinggian permukaan air adalah 1000 cm dan kombinasi 90 cm beton berat dan 60 cm beton biasa dapat digunakan sebagai perisai biologi. Desain perisai tersebut mereduksi laju dosis menjadi 0,05 µSv/jam di Balai Operasi sementara di Balai Eksperimen dan di luar gedung reaktor menjadi 4,2 µSv/jam dan 0,03 µSv/jam pada saat reaktor beroperasi. Hasil penelitian juga menunjukkan pemasagan perisai tambahan setebal 280 cm berjarak 300 cm di depan tabung berkas neutron radial yang terbuka mereduksi laju dosis gamma dan neutron menjadi 3,3 µSv/jam dan 3,1x10-11 µSv/jam. Hasil-hasil penelitian ini menunjukkan bahwa desain perisai radiasi yang dibuat membuat reaktor

  4. OPTIMASI DESAIN TERMOHIDROLIKA TERAS DAN SISTEM PENDINGIN REAKTOR RISET INOVATIF DAYA TINGGI

    Directory of Open Access Journals (Sweden)

    Endiah Puji Hastuti

    2015-10-01

    Full Text Available ABSTRAK OPTIMASI DESAIN TERMOHIDROLIKA TERAS DAN SISTEM PENDINGIN REAKTOR RISET INOVATIF DAYA TINGGI. Implementasi reaktor inovasi telah diterapkan pada berbagai reaktor riset baru yang saat ini sedang dibangun.  Pada saat ini BATAN sedang merancang desain konseptual reaktor riset daya tinggi yang telah masuk pada tahap optimasi desain. Spesifikasi desain konseptual reaktor riset inovatif adalah reaktor tipe kolam berpendingin air dan reflektor D2O. Teras reaktor memiliki kisi 5x5 dengan 16 bahan bakar dan 4 batang kendali. Teras reaktor berada di dalam tabung berisi D2O yang berfungsi sebagai posisi iradiasi. Daya reaktor 50 MW didesain untuk membangkitkan fluks neutron termal sebesar 5x1014 n/cm2s. Teras reaktor berbentuk kompak dan menggunakan bahan bakar U9Mo-Al dengan tingkat muat uranium 7-9 gU/cm3. Desain termohidrolika yang mencakup pemodelan, perhitungan dan analisis kecukupan pendingin dibuat sinergi dengan desain fisika teras agar keselamatan reaktor terjamin. Makalah ini bertujuan menyampaikan hasil analisis perhitungan termohidrolika teras dan sistem reaktor riset inovatif pada kondisi tunak. Analisis dilakukan menggunakan program perhitungan yang telah tervalidasi, masing-masing adalah Caudvap, PARET-ANL, Fluent dan ChemCad 6.4.1. Hasil perhitungan menunjukkan bahwa pembangkitan panas yang tinggi dapat dipindahkan tanpa menyebabkan pendidihan dengan menerapkan desain teras reaktor bertekanan, di samping itu desain awal komponen utama sistem pembuangan panas yang terintegrasi telah dilakukan, sehingga konseptual desain termohidrolika RRI-50 dapat diselesaikan. Kata kunci : reaktor riset inovatif, Caudvap, PARET-ANL, Fluent, ChemCad 6.4.1.   ABSTRACT THERMALHYDRAULIC DESIGN AND COOLING SYSTEM OPTIMIZATION OF THE HIGH POWER INOVATIVE RESEARCH REACTOR. Reactor innovation has been implemented in a variety of new research reactors that currently are being built. At this time BATAN is designing a conceptual design of the high power

  5. Theoretical investigations on the determination of cavitation-free primary flow after compacting the reactor FRG-1; Theoretische Untersuchungen zur Bestimmung des kavitationsfreien Primaerdurchsatzes nach Kernkompaktierung des Reaktors FRG-1

    Energy Technology Data Exchange (ETDEWEB)

    Pihowicz, W. [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Zentralabteilung Forschungsreaktoren

    1997-12-31

    Basing on an extensive analysis of the influence of compacting the FRG-1 reactor core upon the change in flow, heat exchange, as well as cavitation behavior of the primary circuit the underlying principles of the determination procedure for a cavitations-free primary flow have been developed theoretically. It was found that the problem has to be treated in a complex manner, i.e. considering the coupled flow, temperature, as well as cavitation fields, and that for a successful solution of the problem it is absolutely necessary to simultaneously induce an optimized fixation of the main primary coolant pump. (orig.) [Deutsch] Auf der Basis einer umfangreichen Analyse des Einflusses einer Kernkompaktierung des Reaktors FRG-1 auf die Aenderung der Stroemungs-, Waermeaustausch- und Kavitationsverhaeltnisse im Reaktorkuehlkreislauf wurden theoretische Grundlagen der Vorgehensweise zur Bestimmung des kavitationsfreien Primaerdurchsatzes entwickelt. Es wurde nachgewiesen, dass das Problem komplex, d.h. unter Beruecksichtigung der gegenseitigen Kopplung von Stroemungs-, Temperatur- und Kavitationsfeldern betrachtet werden muss und, dass es zur erfolgreichen Loesung der Aufgabe noch unbedingt erforderlich ist, parallel eine optimale Festlegung der Hauptprimaerumwaelzpumpe herbeizufuehren. (orig.)

  6. DESAIN KONSEPTUAL TERAS REAKTOR RISET INOVATIF BERBAHAN BAKAR URANIUM MOLIBDENUM DARI ASPEK NEUTRONIK

    Directory of Open Access Journals (Sweden)

    Tukiran Surbakti

    2015-03-01

    Full Text Available Manfaat yang luas dari penggunaan reaktor riset membuat banyak negara membangun reaktor riset baru. Kecenderungan saat ini adalah reaktor tipe reaktor serbaguna (MPR dengan teras yang kompak untuk mendapatkan fluks neutron yang tinggi dengan daya yang relatif sedang atau rendah. Reaktor riset yang ada di Indonesia yang paling muda usianya sudah berumur 25 tahun. Oleh karena itu diperlukan desain reaktor riset baru sebagai alternatif, disebut reaktor riset inovatif (RRI, kelak pengganti reaktor riset yang sudah ada. Tujuan dari riset ini mendapatkan konfigurasi teras setimbang reaktor riset yang optimal dengan kriteria memiliki fluks neutron termal minimum sebesar 2,5x1014 n/cm2 s pada daya 20 MW (minimum, memiliki panjang operasi satu siklus lebih dari 40 hari dan penggunaan bahan bakar yang paling efisien. Desain neutronik dilakukan untuk bahan bakar baru U-9Mo-Al dengan kerapatan bervariasi dan jenis reflektor yang bervariasi. Desain dilakukan dengan paket program WIMSD-5B dan BATAN-FUEL. Hasil desain konseptual menyajikan 4 konfigurasi teras yaitu 5×5, 5×7, 6×5 dan 6×6. Hasil optimasi menunjukkan bahwa teras setimbang reaktor RRI dengan konfigurasi 5×5, tingkat muat 235U sebesar 450 g, reflektor berilium, fluks neutron termal maksimum di daerah reflektor sebesar 3,33×1014 neutron cm-2s-1 dan panjang siklus 57 hari merupakan desain teras reaktor riset inovatif yang paling optimal. Kata kunci: desain konseptual, bahan bakar uranium-molibdenum,berilium, D2O, WIMS, BATAN-FUEL   The multipurpose of research reactor utilization make many countries build the new research reactor. Trend of this reactor for this moment is multipurpose reactor type with a compact core to get high neutron flux at the low or medium level of power. The research newest reactor in Indonesia right now is already 25 year old. Therefore, it is needed to design a new research reactor, called innovative research reactor (IRR and then as an alternative to replace the old

  7. DESAIN TERAS ALTERNATIF UNTUK REAKTOR RISET INOVATIF (RRI DARI ASPEK NEUTRONIK

    Directory of Open Access Journals (Sweden)

    Iman Kuntoro

    2015-03-01

    Full Text Available Berdasarkan dokumen kriteria pengguna dan fungsi utamanya, Reaktor Riset Inovatif (RRI dipersyaratkan dapat menghasilkan fluks neutron termal maksimum 1×1015 neutron cm-2s-1. Hal ini diperlukan agar reaktor RRI dapat digunakan untuk target yang membutuhkan fluks neutron tinggi. Dalam penelitian sebelumnya diperoleh bahwa desain reaktor RRI tidak mungkin menghasilkan fluks neutron tersebut jika menggunakan bahan bakar seperti yang digunakan reaktor RSG-GAS. Hal ini diduga karena dimensinya terlalu besar, mengingat fluks neutron berbanding terbalik dengan volume teras. Tujuan penelitaian ini adalah untuk mendapatkan desain teras alternatif reaktor RRI yang memenuhi persyaratan fluks neutron termal tersebut. Alternatif bahan bakar yang dipilih adalah yang dipakai di reaktor JMTR (Japan Material Testing Reactor yang berdimensi lebih kecil dibanding reaktor RSG-GAS. Disamping itu tinggi aktif teras divariasi 70 cm dan 75 cm. Desain teras dilakukan dengan perangkat analaitik WIMS-D5B, Batan-FUEL dan Batan-3DIFF. Teras alternatif menggunakan konsep konfigurasi teras kompak 5×5 dengan 4 elemen kendali jenis follower. Berdasarkan hasil perhitungan ada 3 (tiga teras alternatif yang dapat memenuhi persyaratan tersebut, termasuk teras menggunakan bahan bakar reaktor RSG-GAS dengan menambah tinggi aktifnya menjadi 70 cm dari 60 cm. Dengan menganalisis seluruh aspek, keselamatan serta efisiensi dan efektivitas reaktor, maka teras alternatif dengan bahan bakar tipe JMTR dengan tinggi aktif 70 cm merupakan teras alternatif yang terbaik. Kata kunci: neutronik, teras kompak, reaktor riset inovatif, fluks neutron termal tinggi   Based on its User Requirement Document and main function, RRI shall be able to provide a maximum thermal neutron flux of 1×1015 neutron cm-2s-1. The reason is that the RRI reactor can serve targets requiring a high neutron flux. From the previous results it was obtained that RRI design using fuel of RSG-GAS type was not possible to

  8. Fire modeling of the Heiss Dampf Reaktor containment

    Energy Technology Data Exchange (ETDEWEB)

    Nicolette, V.F. [Sandia National Labs., Albuquerque, NM (United States); Yang, K.T. [Notre Dame Univ., IN (United States)

    1995-09-01

    This report summarizes Sandia National Laboratories` participation in the fire modeling activities for the German Heiss Dampf Reaktor (HDR) containment building, under the sponsorship of the United States Nuclear Regulatory Commission. The purpose of this report is twofold: (1) to summarize Sandia`s participation in the HDR fire modeling efforts and (2) to summarize the results of the international fire modeling community involved in modeling the HDR fire tests. Additional comments, on the state of fire modeling and trends in the international fire modeling community are also included. It is noted that, although the trend internationally in fire modeling is toward the development of the more complex fire field models, each type of fire model has something to contribute to the understanding of fires in nuclear power plants.

  9. ANALISIS KESELAMATAN TERMOHIDROLIK BULK SHIELDING REAKTOR KARTINI

    Directory of Open Access Journals (Sweden)

    Azizul Khakim

    2015-10-01

    Full Text Available ABSTRAK ANALISIS KESELAMATAN TERMOHIDROLIK BULK SHIELDING REAKTOR KARTINI. Bulk shielding merupakan fasilitas yang terintegrasi dengan reaktor Kartini yang berfungsi sebagai penyimpanan sementara bahan bakar bekas. Fasilitas ini merupakan fasilitas yang termasuk dalam struktur, sistem dan komponen (SSK yang penting bagi keselamatan. Salah satu fungsi keselamatan dari sistem penanganan dan penyimpanan bahan bakar adalah mencegah kecelakaan kekritisan yang tak terkendali dan membatasi naiknya temperatur bahan bakar. Analisis keselamatan paling kurang harus mencakup analisis keselamatan dari sisi neutronik dan termo hidrolik Bulk shielding. Analisis termo hidrolik ditujukan untuk memastikan perpindahan panas dan proses pendinginan bahan bakar bekas berjalan baik dan tidak terjadi akumulasi panas yang mengancam integritas bahan bakar. Code tervalidasi PARET/ANL digunakan untuk analisis pendinginan dengan mode konveksi alam. Hasil perhitungan menunjukkan bahwa mode pendinginan konvekasi alam cukup memadai dalam mendinginkan panas sisa tanpa mengakibatkan kenaikan temperatur bahan bakar yang signifikan. Kata kunci: Bulk shielding, bahan bakar bekas, konveksi alam, PARET.   ABSTRACT THERMAL HYDRAULIC SAFETY ANALYSIS OF BULK SHIELDING KARTINI REACTOR. Bulk shielding is an integrated facility to Kartini reactor which is used for temporary spent fuels storage. The facility is one of the structures, systems and components (SSCs important to safety. Among the safety functions of fuel handling and storage are to prevent any uncontrolable criticality accidents and to limit the fuel temperature increase. Safety analyses should, at least, cover neutronic and thermal hydraulic calculations of the bulk shielding. Thermal hydraulic analyses were intended to ensure that heat removal and the process of the spent fuels cooling takes place adequately and no heat accumulation that challenges the fuel integrity. Validated code, PARET/ANL was used for analysing the

  10. ANALISIS POLA MANAJEMEN BAHAN BAKAR DESAIN TERAS REAKTOR RISET TIPE MTR

    Directory of Open Access Journals (Sweden)

    Lily Suparlina

    2015-03-01

    Full Text Available Parameter neutronik dibutuhkan dalam mendesain teras reaktor riset. Reaktor riset jenis MTR (Material Testing Reactor sangat diminati karena dapat digunakan baik untuk riset dan juga produksi radio isotop. Reaktor riset yang ada saat ini sudah tua sehingga dibutuhkan desain reaktor yang mempunyai teras kompak. Desain teras reaktor riset yang sudah ada saat ini belum cukup memadai untuk memenuhi persyaratan di dalam UCD yang telah ditetapkan yaitu fluks neutron termal di teras 1x1015 n/cm2s, oleh karena itu perlu dibuat desain teras reaktor baru sebagai alternatif yang kompak dan dapat menghasilkan fluks neutron tinggi. Telah dilakukan perhitungan dan analisis terhadap manajemen bahan bakar desain teras kompak dengan konfigurasi teras 5x5, berbahan bakar U9Mo-Al dan tinggi teras aktif 70 cm. Tujuan dari riset ini untuk memperoleh fluks neutron di teras memenuhi kebutuhan seperti yang telah ditetapkan di UCD dengan panjang siklus operasi minimum 20 hari pada daya 50 MW. Perhitungan dilakukan dengan menggunakan paket program komputer WIMSD-5B untuk menggenerasi tampang lintang makroskopik bahan bakar dan Batan-FUEL untuk memperoleh nilai parameter neutronik serta Batan-3DIFF untuk perhitungan nilai reaktivitas batang kendali. Perhitungan parameter neutronik teras reaktor riset ini dilakukan untuk bahan bakar U-9Mo-Al dengan tingkat muat bervariasi dan 2 macam pola pergantian bahan bakar yaitu teras segar dan teras setimbang. Hasil analisis menunjukkan bahwa pada teras segar, tingkat muat 235U sebesar 360 gram, 390 gram dan 450 gram memenuhi kriteria keselamatan dan kriteria penerimaan di UCD dengan nilai fluks neutron termal di teras lebih dari 1x1015 n/cm2s dan panjang siklus >20 hari, sedangkan pada teras setimbang panjang siklus dapat terpenuhi hanya untuk tingkat muat 450 gram. Kata kunci: desain teras reaktor, bahan bakar UMo, pola bahan bakar, WIMS, BATAN-FUEL   Research reactor core design needs neutronics parameter calculation use computer

  11. ANALISIS SEBARAN RADIONUKLIDA PADA KONDISI NORMAL UNTUK REAKTOR AEC 1000 MW

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2015-03-01

    Full Text Available Telah dilakukan analisis sebaran radionuklida pada reaktor daya Atomic Energy Agency (AEC 3568 MWTh, setara dengan 1000 Mwe untuk kondisi operasi normal. Analisis dilakukan untuk dua reaktor yang terpisah sejauh 500 m dan sudut 90o satu dengan yang lain. Langkah awal dalam melakukan analisis adalah menentukan suku sumber reaktor menggunakan program komputer ORIGEN2 dan EMERALD NORMAL. ORIGEN2 digunakan untuk menentukan inventori radionuklida yang terdapat di reaktor. Selanjutnya dengan dengan menggunakan program EMERALD NORMAL dihitung suku sumber yang sampai ke cerobong reaktor. Untuk menganalisis dosis yang diterima penduduk dilakukan dengan menggunakan program PC-CREAM. Perhitungan dilakukan untuk satu dan dua PLTN di calon tapak PLTN. Hasil yang diperoleh adalah sebaran radionuklida terbesar untuk satu PLTN pada jarak 1 km dan kearah zona 9 (191,25o dan untuk dua PLTN pada jarak 1 km dan kearah zona 10 (213,75o. Radionuklida yang sampai ke penduduk melalui dua alur yaitu alur makanan dan hirupan. Untuk alur makanan berasal dari radionuklida I-131, dan terbesar melalui alur produk susu sebesar 53,40 % untuk satu maupun dua PLTN . Untuk alur hirupan ranionuklida pemberi kontribusi paparan terbesar berasal dari Kr-85m sebesar 53,80 %. Dosis total terbesar yang diterima penduduk terdapat pada jarak 1 Km untuk bayi yaitu sebesar 4,10 μSi dan 11,26 μSi untuk satu dan dua PLTN. Hasil ini sangat kecil dibandingkan dengan batas dosis yang diijinkan oleh badan pengawas (BAPETEN untuk penduduk yaitu sebesar 1 mSi. Kata Kunci : Reaktor daya, komputer code, radionuklida, alur makanan, hirupan   Analysis for radionuclide dispersion for the Atomic Energy Agency (AEC 3568 MWth Power Reactor, equal to the 1000 MWe at normal condition has been done. Analysis was done for two piles that is separated by 500 m distance and angle of 90o one to other. Initial pace in doing the analysis is to determine reactors source term using ORIGEN2 and EMERALD NORMAL

  12. REAKTOR INNOVATIVE MOLTEN SALT (IMSR DENGAN SISTEM KESELAMATAN PASIF MENYELURUH

    Directory of Open Access Journals (Sweden)

    Andang Widiharto

    2015-04-01

    Full Text Available Pengembangan Teknologi Reaktor Nuklir pada masa mendatang mengarah pada peningkatan aspek keselamatan, peningkatan pendayagunaan bahan bakar, reduksi limbah radioaktif, ketahanan terhadap proliferasi bahan-bakar nuklir dan peningkatan aspek ekonomi. reaktor Innovative Molten Salt (IMSR adalah reaktor nuklir yang menggunakan bahan bakar cair berupa garam lebur fluoride (7LiF-ThF4-UF4-MaFx. Reaktor IMSR didesain sebagai reaktor pembiak termal, yaitu membiakkan U-233 dari Th-232. Hal ini untuk menjawab permasalahan sustainabilitas ketersedian sumber daya bahan bakar nuklir dan reduksi limbah radioaktif. Dalam aspek keselamatan, desain reaktor IMSR memiliki sifat inherent safe, yaitu koefisien umpan balik daya yang negatif serta memiliki fitur-fitur keselamatan pasif. Fitur-fitur keselamatan pasif terdiri dari sistem shutdown pasif, sistem pendinginan pasif pasca shutdown serta sistem pendinginan pasif untuk produk fisi. Kecelakaan yang berpotensi terjadi pada IMSR, yaitu kecelakaan kehilangan aliran bahan bakar, kecelakaan kehilangan aliran pendingin, kecelakaan kehilangan kemampuan pengambilan kalor serta kecelakaan kerusakan integritas sistem reaktor, dapat ditangani sepenuhnya secara pasif hingga mencapai kondisi shutdown selamat. Kata kunci: keselamatan pasif, inherent safe, IMSR   The next Nuclear Reactor Technology developments are directed to the increasing of the aspects of safety, fuel utility, radioactive waste reduction, proliferation retention and economy. Innovative Molten Salt Reactor (IMSR is a nuclear reactor design that uses fluoride molten salt (7LiF-ThF4-UF4-MaFx. IMSR is designed as a thermal breeder reactor, i.e. to produce U-233 from Th-232. This is the answer of natural nuclear fuel sustainability and radioactive waste problems. In term of safety aspect, IMSR design has inherent safe characteristics, i.e. negative power feedback coefficient, and passive safety features. The passive safety features are passive shutdown

  13. Studi Pemasangan Damping Reaktor untuk Mengatasi Feroresonansi pada Incoming 20 kV GIS Tandes

    Directory of Open Access Journals (Sweden)

    Satria Seventino Simamora

    2015-12-01

    Full Text Available Pada studi ini, dilakukan simulasi pemasangan damping reaktor sebagai salah satu teknik mitigasi feroresonansi dengan menggunakan ATP Draw. Damping reaktor sebagai teknik mitigasi feroresonansi menggunakan elemen resistor yang dipasang di sisi primer transformer. Hasil dari simulasi pemasangan damping reaktor yang diperoleh berupa respon arus dan respon tegangan yang berubah terhadap waktu yang menunjukkan apakah feroresonansi dapat diredam atau tidak. Dari hasil simulasi pemasangan damping reaktor pada studi ini diperoleh bahwa feroresonansi dapat diredam dengan pemasangan nilai damping yang tepat. Sehingga dalam studi ini akan dibahas mengenai sejauh mana keefektifan dari pemasangan damping untuk meredam feroresonansi.

  14. ANALISIS PENGENDALIAN DAYA REAKTOR PCMSR DENGAN LAJU ALIR PENDINGIN

    Directory of Open Access Journals (Sweden)

    Iqbal Syafin Noha

    2015-03-01

    Full Text Available Passive Compact Molten Salt Reactor (PCMSR merupakan pengembangan dari Molten Salt Reactor (MSR yang memiliki karakter berbeda dengan lima reaktor generasi IV lainnya, yaitu menggunakan bahan bakar leburan garam. Pada reaktor MSR, garam lebur tidak digunakan sebagai pendingin tetapi digunakan sebagai medium pembawa bahan bakar. Dengan fase bahan bakar yang berupa garam lebur LiF-BeF2-ThF4-UF4, maka dapat dilakukan pengendalian daya dengan mengatur laju aliran bahan bakar dan pendingin. Tujuan penelitian ini adalah untuk mengetahui pengaruh perubahan laju alir pendingin terhadap daya reaktor PCMSR. Analisis dilakukan dengan empat jenis masukan untuk perubahan laju alir pendingin, yaitu masukan step, ramp, eksponensial, dan sinusoidal. Untuk masukan step, laju alir pendingin dibuat berubah secara mendadak. Selanjutnya untuk masukan ramp dan eksponensal, perubahan laju alir masing-masing dibuat perlahan secara linear dan mengikuti fungsi eksponensial. Kemudian untuk masukan sinusoidal, laju alir berubah naik turun secara periodik dengan memvariasikan frekuensi dari perubahan laju alir tersebut. Hasil penelitian menunjukkan bahwa penurunan laju alir pendingin sebesar 50% dari laju pendingin sebelumnya, menyebabkan daya pada reaktor PCMSR turun sebesar 63% dari daya sebelumnya. Jika terjadi fluktuasi laju aliran pendingin, maka semakin cepat perubahan tersebut, maka respon daya yang diberikan semakin kecil. Pada frekuensi yang sangat cepat, daya reaktor menjadi konstan dan cenderung tidak memiliki respon terhadap laju aliran. Hal ini merupakan salah satu aspek keselamatan reaktor, karena reaktor tidak merespon perubahan yang terlalu cepat. Kemampuan reaktor mengatur daya menyesuaikan laju aliran pendingin merupakan aspek keselamatan lainnya. Kata kunci : PCMSR, pengendalian daya, laju alir pendingin, uji respon   Passive Compact Molten Salt Reactor (PCMSR is the development of Molten Salt Reactor (MSR which has different character from other five

  15. PENGARUH GEMPA PATAHAN LEMBANG TERHADAP FLEKSIBILITAS PIPA DAN KEGAGALAN NOZEL PERALATAN SISTEM PENDINGIN PRIMER REAKTOR TRIGA 2000 BANDUNG

    Directory of Open Access Journals (Sweden)

    H.P. Raharjo

    2012-02-01

    Full Text Available Gempa bumi di suatu instalasi nuklir dapat menyebabkan terjadinya kerusakan sistem peralatan karena adanya perubahan fleksibilitas pipa akibat beban berlebih pada sistem perpipaannya. Beban dari sistem perpipaan dapat membebani nozel peralatan seperti pompa, penukar panas, dll. Apabila beban tersebut terlalu besar dan melebihi beban yang diizinkan akan mengakibatkan kegagalan nozel peralatan. Penelitian ini menganalisis besarnya beban-beban yang terjadi di semua nozel  sistem pendingin primer Reaktor TRIGA 2000 Bandung. Analisis dilakukan dengan bantuan perangkat lunak Caesar II yang berbasis metode elemen hingga (finite element method. Acuan analisis yang digunakan adalah code ASME B31.1 yang mengatur tentang perancangan sistem perpipaan untuk sistem pembangkit daya (Power Piping. Hasil analisis menunjukkan bahwa gaya yang terjadi pada nozel masukan pompa arah aksial (FZ melebihi batas yang diijinkan. Oleh karena itu perlu dilakukan modifikasi terhadap jalur perpipaan sistem pendingin tersebut agar nozel tidak menerima gaya yang berlebih. Penyangga pipa titik(node 22 di jalur PriOut dilepas dan/atau dipindahkan pada nozel masukkan pompa. Perpipaan sistem pendingin primer reaktor TRIGA 2000 Bandung akan aman beroperasi jika terjadi gempa.yang berasal dari patahan Lembang Kata kunci : gempa bumi, patahan, perpipaan, reaktor, sistem pendingin

  16. ANALISIS KONVEKSI ALAM TERAS REAKTOR TRIGA BERBAHAN BAKAR TIPE PELAT MENGGUNAKAN COOLOD-N2

    Directory of Open Access Journals (Sweden)

    Sudjatmi K A

    2015-06-01

    Full Text Available ABSTRAK Analisis Konveksi Alam Teras Reaktor Triga Berbahan Bakar Tipe Pelat MENGGUNAKAN COOLOD-N2. Rencana penghentian produksi elemen bakar jenis TRIGA oleh produsen elemen bakar reaktor TRIGA, sudah seharusnya diantisipasi oleh badan pengoperasi reaktor TRIGA untuk menggantikan elemen bakar tipe silinder tersebut dengan tipe pelat yang tersedia di pasaran. Pada penelitian ini dilakukan perhitungan untuk model teras reaktor dengan spesifikasi utama menggunakan bahan bakar U3Si2Al dengan pengayaan uranium  sebesar 19,75% dan tingkat muat 2,96 gU/cm3. Analisis dilakukan menggunakan program COOLOD-N2 yang tervalidasi pada konfigurasi teras TRIGA konversi berbahan bakar tipe pelat, yang tersusun atas 16 elemen bakar, 4 elemen kendali dan 1 fasilitas iradiasi yang terletak tepat di tengah teras. Hasil analisis menunjukkan bahwa dengan temperatur pendingin masuk ke teras sebesar 37oC, dan rasio faktor puncak daya radial ≤ 1,92 maka daya maksimum yang dapat dioperasikan pada moda operasi konveksi bebas adalah 600 kW. Karakteristik termohidrolika yang diperoleh antara lain adalah temperatur pendingin di sisi outlet, kelongsong dan meat masing-masing sebesar 82,39oC, 108,88oC, dan 109,02oC, pada ΔTONB (Temperature Onset of Nucleate Boiling =7,18oC dan nilai OFIR (Onset of flow instability ratio =1,03 Hasil yang diperoleh dari perhitungan ini diharapkan dapat dijadikan acuan untuk menentukan tingkat daya reaktor TRIGA berbahan bakar pelat. Kata kunci: TRIGA Konversi, COOLOD-N2, karakteristik termohidrolika, konveksi alam, elemen bakar tipe pelat.   ABSTRACT ANALYSIS OF NATURAL CONVECTION IN TRIGA REACTOR CORE PLATE TYPES FUELED USING COOLOD-N2. Any pretensions to stop the production of TRIGA fuel elements by TRIGA reactor fuel elements manufacturer should be anticipated by the operating agency of TRIGA reactor to replace the cylinder type fuel element with plate type fuel element that available on the market. In this study, the calculation of U3Si2

  17. ANALISIS DESAIN PROSES SISTEM PENDINGIN PADA REAKTOR RISET INOVATIF 50 MW

    Directory of Open Access Journals (Sweden)

    Sukmanto Dibyo

    2015-03-01

    Full Text Available Reaktor Riset Inovatif (RRI merupakan jenis MTR (Material Testing Reactor yang dipersiapkan ke depan sebagai desain reaktor baru. Daya RRI telah ditetapkan dari perhitungan neutronik dan termohidrolika teras yaitu 50 MW termal. Reaktor bertekanan 8 kgf/cm2 dan laju aliran massa pendingin primer 900 kg/s. Tantangan yang penting dalam menindak lanjuti desain reaktor ini adalah analisis desain pada sistem pendingin. Makalah ini bertujuan untuk menganalisis desain proses sistem pendingin utama reaktor RRI daya 50 MW (RRI-50 dengan menggunakan program Chemcad 6.1.4. Dalam analisis ini dilakukan perhitungan neraca massa dan energi (mass/energy balances pada sistem pendingin primer dan sekunder sebagai pendingin utama. Masing-masing sistem pendingin tersebut terdiri dari 2 jalur beroperasi secara paralel dan 1 jalur redundansi. Disamping itu untuk desain termal unit komponen telah dianalisis dengan program RELAP5, frenchcreek dan Metoda Analitik. Hasil analisis yang diperoleh adalah desain diagram sistem pendingin yang mencakup data parameter entalpi, temperatur, tekanan dan laju aliran massa pendingin untuk masing-masing jalur. Adapun hasil desain unit komponen utama pada RRI-50 adalah tangki tunda dengan volume 51,5 m3, 2 unit pompa sentrifugal dan 1 unit pompa cadangan pada pendingin primer daya 141 kW/pompa dan pendingin sekunder daya 206 kW/pompa, 2 unit penukar panas tipe shell-tube dengan koefisien termal overall 1377 W/m2.oC dan 4 unit menara pendingin yang mampu melepaskan panas ke udara dengan desain temperatur approach 5,0 oC dan temperatur range 9,0 oC. Desain sistem pendingin reaktor RRI-50 ini telah menetapkan parameter operasi sistem pendingin yaitu temperatur, tekanan dan laju aliran massa pendingin dengan mempertimbangkan tuntutan aspek keselamatan teras reaktor sehingga desain temperatur maksimum pendingin masuk ke teras 44,5 oC. Kata kunci : RRI 50 MW, desain sistem pendingin, program Chemcad 6.1.4   Innovative Research Reactor RRI

  18. ANALISIS PARAMETER KINETIK DAN TRANSIEN TERAS KOMPAK REAKTOR RSG-GAS

    Directory of Open Access Journals (Sweden)

    Iman Kuntoro

    2015-04-01

    Full Text Available Dalam rangka meningkatkan efisiensi penggunaan bahan bakar reaktor RSG-GAS telah dilakukan studi penentuan teras kompak. Hasil perhitungan parameter neutronik menunjukkan bahwa teras kompak dengan menutup empat fasilitas iradiasi (IP dengan elemen bakar dapat meningkatkan siklus operasi 23,6 %. Selanjutnya perlu dilakukan penentuan parameter kinetik dan analisis transien teras kompak untuk mengetahui keselamatan operasi reaktor. Perhitungan dilakukan dengan menggunakan program WIMS/D4 untuk generasi konstanta difusi sel elemen bakar dan MTRDYN untuk menentukan parameter kinetik dan analisis transien. Hasil perhitungan menunjukkan bahwa harga fraksi neutron kasip total teras kompak naik 2 % dan umur neutron serempak turun 8,3 % dibandingkan dengan teras setimbang. Temperatur maksimum bahan bakar saat transien pada daya awal 1 W adalah 71,64 0C dan pada daya 1 MW adalah 129,60 0C. Hasil ini menunjukkan bahwa teras kompak RSG-GAS aman digunakan sebagai teras alternatif. Kata kunci: parameter kinetik, transien, reaktor   For increasing the efficiency of fuel element of the RSG-GAS reactor, some alternative configuration has been searched to obtain a compact core configuration. Calculation result of the neutronics parameters that the compact core with insertion fuel element to all irradiation facility (IP can increase operation cycle length to about 23.6 %. Then, it is necessary to calculate the kinetic parameters and transient analysis of the compact core to verify the reactor operation safety. Calculations were performed by means of WIMS/D4 and MTRDYN code for generation of cell diffusion constants and for kinetic parameters and transient analysis respectively. The result showed that the total delayed neutron fraction of compact core increases by 2 % and the prompt neutron lifetime decreases 8.3 % compared to the equilibrium core. Maximum temperature of the fuel element at transient at initial power of 1 W is 71.64 0C and at the power 1 MW is 126

  19. Isotopic composition of precipitation at the station Ljubljana (Reaktor, Slovenia – period 2007–2010

    Directory of Open Access Journals (Sweden)

    Polona Vreča

    2014-12-01

    Full Text Available The stable isotopic composition of hydrogen and oxygen (δ2H and δ18O and the tritium activity (A were monitored in monthly collected precipitation at Ljubljana (Reaktor during the period 2007–2010. Monthly and yearly isotope variations are discussed and compared with those observed over the period 1981–2006 and with the basic meteorological parameters for Ljubljana (Bežigrad and Ljubljana (Hrastje stations for the period 2007−2010. The mean values for δ2H and δ18O, weighted by precipitation amount at Ljubljana (Reaktor, are –59.4 ‰ and –8.71 ‰. The reduced major axis local meteoric water line (LMWLRMA is δ2H = (8.19 ± 0.22×δ18O + (11.52 ± 1.97, while the precipitation weighted least square regression results in LMWLPWLSR-Re δ2H = (7.94 ± 0.21×δ18O + (9.76 ± 1.93. The lack of significant difference in the LMWL slopes indicates a relatively homogeneous distribution of monthly precipitation as well as the small number of low-amount monthly precipitation events with low deuterium excess. The deuterium excess weighted mean value is 10.3 ‰ which indicates the prevailing influence of the Atlantic air masses. The temperature coefficient of δ18O is 0.30 ‰/°C. Tritium activity in monthly precipitation shows typical seasonal variations, with a weighted mean tritium activity in this period of 8.5 TU. No decrease of mean annual activity is observed.

  20. ANALISIS KRITIKALITAS BAHAN BAKAR NUKLIR BEKAS REAKTOR RSG-GAS PADA RAK BERBAHAN ALUMINIUM

    Directory of Open Access Journals (Sweden)

    Pungky Ayu Artiani

    2017-08-01

    Full Text Available Penggunaan stainless steel sebagai material rak penyimpanan bahan bakar nuklir bekas (BBNB di fasilitas Kanal Hubung – Instalasi Penyimpanan Sementara Bahan Bakar Bekas (KH-IPSB3 berpotensi menyebabkan terjadinya korosi galvanik pada BBNB sehingga penggantian material rak penyimpanan BBNB perlu dipertimbangkan. Potensi korosi galvanik terjadi karena aluminium sebagai material utama kelongsong Bahan Bakar Nuklir (BBN Reaktor Serba Guna - G. A. Siwabessy (reaktor RSG-GAS berinteraksi dengan stainless steel sebagai material rak penyimpan BBNB. Aluminium dapat digunakan sebagai material alternatif rak penyimpanan BBNB untuk mengurangi efek korosi galvanik. Penelitian ini bertujuan untuk mengkaji kritikalitas rak penyimpanan BBNB dengan material aluminium. Jaminan kritikalitas diperlukan untuk menjaga keselamatan fasilitas KH-IPSB3. Rak penyimpanan aluminium yang optimum dikaji dengan melakukan simulasi ukuran pitch dan menghitung laju serapan neutron pada kondisi normal (tidak terjadi kecelakaan. Perhitungan nilai kritikalitas (keff dilakukan menggunakan program Monte Carlo N-Particle versi 6 (MCNP6. Model yang digunakan adalah model 3-dimensi satu rak utuh yang terisi penuh dengan BBNB di dalam kolam penyimpanan. Hasil perhitungan pada ukuran pitch 127 mm menunjukkan bahwa nilai keff rak penyimpanan BBNB dengan material aluminium (keff = 0,7709 lebih besar 13,20% dibandingkan material stainless steel (keff = 0,6810. Nilai keff rak penyimpanan BBNB dengan material aluminium pada ukuran tersebut masih berada dalam rentang yang disyaratkan yaitu keff kurang dari 0,95. Nilai keff dipengaruhi oleh ukuran pitch, dimana dengan berkurangnya ukuran pitch 1 mm dapat meningkatkan nilai keff sebesar 14,24%. Nilai laju serapan neutron juga mempengaruhi nilai keff, di mana laju serap neutron rak penyimpanan dengan material aluminium lebih kecil dibandingkan material stainless steel. Hasil simulasi menunjukkan bahwa rak penyimpanan dengan material aluminium

  1. STUDI DESAIN DOWN SCALE TERAS REAKTOR DAN BAHAN BAKAR PLTN JENIS PEBBLE BED MODULAR REACTOR – HTR 100 MWe

    Directory of Open Access Journals (Sweden)

    Slamet Parmanto

    2015-04-01

    Full Text Available Telah dilakukan penelitian terhadap teras reaktor Pebble Bed Modular Reactor (PBMR dengan daya 100 Mwe berbahan bakar UO2. Reaktor ini menggunakan moderator grafit dan helium sebagai pendingin. Studi down scale dilakukan tanpa mengubah geometri teras maupun geometri bahan bakar. Parameter yang dianalisis adalah kritikalitas teras, reaktivitas lebih, koefisien reaktivitas temperatur bahan bakar, moderator dan pendingin serta nilai ekonomis bahan bakar. Dari penelitian ini diharapkan diperoleh desain bahan bakar yang bernilai ekonomis dan memiliki fitur keselamatan melekat. Penelitian dilakukan dengan menggunakan program SRAC 2003. Hasil yang diperoleh adalah desain bahan bakar UO2 berbentuk pebble dengan pengkayaan 10% U235 dan 90 ppm racun dapat bakar Gd2O3. Nilai faktor multipilkasi effektif keff pada beginning of life (BOL adalah 1,01115 dan menjadi 1,00588 setelah 2658 hari operasi reaktor (EOL. Koefisien reaktivitas temperatur total diperoleh sebesar - 3,25900E-05 ∆k/k/K saat BOL dan -1,10615E-04 ∆k/k/K saat end of life (EOL. Reaktor ini memenuhi karakteristik keselamatan melekat ditandai dengan nilai koefisien reaktivitas temperatur yang negatif. Kata kunci: PBMR, desain bahan bakar, faktor multipilkasi effektif, reaktivitas lebih, koefisien reaktivitas temperatur.   Research of Pebble Bed Modular Reactor (PBMR 100 MWe which used UO2 fuel has been done. This reactor uses graphite as moderator and helium as coolant. Down scale studies performed without changing the core and fuel geometry. The parameter being analyzed were core criticality, excess reactivity, fuel, moderator, coolant temperature reactivity coefficient, and fuel economy. This research is expected to obtain the design that has fuel economy and inherent safety features. In this research, we have employed SRAC 2003 code. The calculation show that the UO2 pebble fuel design with 10% enrichment of U235 and 90 ppm burnable poison of Gd2O3 results in the effective multiplication

  2. ANALISIS DISTRIBUSI KECEPATAN PENDINGIN DALAM ELEMEN BAKAR TIPE PELAT MENGGUNAKAN METODE CFD UNTUK REAKTOR RISET RSG-GAS

    Directory of Open Access Journals (Sweden)

    Muhammad Subekti

    2015-03-01

    Full Text Available Eksperimen pengukuran distribusi kecepatan pendingin dalam subkanal elemen bakar reaktor riset RSG-GAS sulit dilakukan karena lebar celah yang sangat kecil dan terletak di dalam elemen bakar. Oleh karena itu diperlukan perhitungan untuk memprediksi distribusi kecepatan pendingin dalam subkanal untuk mengkonfirmasi bahwa keberadaan handle tidak merusak distribusi kecepatan pendingin masuk ke dalam setiap subkanal. Perhitungan ini memerlukan metode CFD yang memperhatikan interior 3 dimensi. Perhitungan distribusi kecepatan pendingin dalam subkanal juga belum pernah dilakukan. Tujuan penelitian ini adalah melakukan investigasi distribusi kecepatan pendingin elemen bakar tipe pelat menggunakan metode CFD 3 dimensi untuk reaktor riset RSG-GAS. Penelitian ini juga sangat diperlukan sebagai bagian dari pengembangan desain termohidrolika elemen bakar untuk reaktor riset inovatif. Pemodelan menggunakan ½ model dalam perangkat lunak Gambit dan perhitungan menggunakan persamaan Turbulen dalam perangkat lunak FLUENT 6.3. Hasil perhitungan kecepatan pendingin tiga dimensi dalam subkanal menggunakan metode CFD lebih rendah sekitar 4,06% dari pada hasil perhitungan satu dimensi karena perhitungan satu dimensi mengabaikan keberadaan handle. Kata kunci: Aliran pendingin, elemen bakar, reaktor riset, kondisi tunak, CFD   The measurement experiment for coolant-velocity distribution in the subchannel of fuel element of RSG-GAS research reactor is difficult to be carried out due to too narrow channel and subchannel placed inside the fuel element. Hence, the calculation is required to predict the coolant-velocity distribution inside subchannel to confirm that the handle presence does not ruin the velocity distribution into every subchannel. This calculation utilizes CFD method, which respect to 3-dimension interior. Moreover, the calculation of coolant-velocity distribution inside subchannel was not ever carried out. The research object is to investigate the

  3. INVESTIGASI KARAKTERISTIK TERMOHIDROLIKA TERAS REAKTOR DAYA KECIL DENGAN PENDINGINAN SIRKULASI ALAM MENGGUNAKAN RELAP5

    Directory of Open Access Journals (Sweden)

    Susyadi Susyadi

    2016-02-01

    Full Text Available ABSTRAK INVESTIGASI KARAKTERISTIK TERMOHIDROLIKA TERAS REAKTOR DAYA KECIL DENGAN PENDINGINAN SIRKULASI ALAM MENGGUNAKAN RELAP5. Reaktor modular daya-kecil (small modular reactor, SMR memiliki prospek tinggi untuk dibangun di Indonesia. Keluaran dayanya yang relatif kecil dan disainnya yang kompak serta dapat dikonstruksi secara modular memberikan keunggulan fleksibilitas pembangunan yang lebih baik dibanding reaktor konvensional berdaya besar. Disain sistem reaktor kategori ini sangat bervariasi, salah satu diantaranya adalah jenis reaktor air tekan (pressurized water reactor, PWR yang menerapkan sirkulasi alamiah pada sistem pendingin primernya. Selain itu reaktor ini juga memiliki teras (core lebih pendek dibanding PWR konvensional. Dari kedua perbedaan tersebut maka terdapat kemungkinan perbedaan pola perpindahan panas yang dapat berimplikasi terhadap keselamatan secara keseluruhan. Oleh karena itu, pada penelitian ini dilakukan investigasi terhadap karakteristik termohidrolika teras reaktor tersebut khususnya karakteristik temperatur fluida dan bahan bakar serta laju alir fluidanya. Tujuannya adalah untuk mengetahui perbedaan marjin keselamatan temperatur teras reaktor bila dibanding dengan PWR konvensional. Investigasi dilakukan dengan menggunakan program RELAP5, dimana secara parsial teras reaktor dimodelkan menggunakan model-model generik yang ada pada program dan dilakukan beberapa perhitungan kondisi tunak. Hasil perhitungan menunjukkan bahwa saat beroperasi pada daya nominalnya, reaktor modular ini memiliki margin temperatur pendidihan sebesar 2K lebih baik dibanding reaktor konvensional. Selain itu, keunggulan marjin keselamatan reaktor modular daya-kecil ini juga ditunjukkan dari naiknya laju alir mengikuti kenaikan dayanya yang berarti memiliki sifat keselamatan yang melekat (inherent safety. Kata kunci: reaktor modular daya-kecil, PWR, sirkulasi alam, RELAP5, termohidrolika   ABSTRACT INVESTIGATION ON CORE THERMAL HYDRAULIC

  4. Desain Pengembangan Model Alat Uji Reaktor Nuklir Tipe Small Modular Reactor (Smr) Menggunakan Nanofluida Sebagai Fluida Pendingin

    OpenAIRE

    Dermawan, Erwin; Rasma, Rasma; Diniardi, Ery; Ramadhan, Anwar Ilmar

    2014-01-01

    Perkembangan dan penggunaan energi nuklir saat ini berkembang sangat pesat, untuk mencapaiteknologi yang semakin maju, baik dari segi desain, faktor ekonomi dan juga faktorkeselamatannya. Dari aspek termofluida reaktor nuklir harus dilakukan dengan perhitungan dankondisi yang mendekati sempurna. Termasuk saat ini mulai dikembangkannya reaktor nuklirdengan daya rendah dibawah 300 MW, atau biasa disebut dengan Small Modular Reactor (SMR).Salah satuny...

  5. DESAIN TERAS REAKTOR RISET INOVATIF (RRI. ESTIMASI DAN ANALISIS DISTRIBUSI PANAS GAMMA

    Directory of Open Access Journals (Sweden)

    Setiyanto Setiyanto

    2015-03-01

    Full Text Available Panas gamma merupakan faktor yang sangat diperlukan untuk analisis keselamatan pada setiap fasilitas eksperimen yang akan dilakukan di teras reaktor nuklir. Panas gamma merupakan sumber panas internal yang harus dihitung dengan tepat, karena berkaitan dengan masalah keselamatan. Nilai panas gamma sangat bergantung pada karakteristik teras reaktor secara keseluruhan, sehingga setiap desain teras baru harus dilengkapi dengan penentuan nilai distribusi panas gammanya. Reaktor Riset Inovatif (RRI merupakan reaktor riset desain baru yang harus dilengkapi dengan data keselamatannya, termasuk dalam hal ini nilai dan distribusi panas gammanya. Untuk keperluan tersebut, telah dilakukan perhitungan dan analisis distribusi panas gamma teras dan fasilitas iradiasi refletortor RRI dengan menggunakan program Gamset yang telah dimodifikasi dan divalidasi untuk model teras RRI. Diperoleh hasil bahwa di pusat teras reaktor memiliki nilai panas gamma yang cukup tinggi (11,75 W/g, jauh lebih besar dari reaktor RSG-GAS Akan tetapi penempatan semua fasilitas iradiasi di reflektor menunjukkan bahwa desain RRI jauh lebih aman untuk iradiasi dibanding dengan di RSG-GAS, karena memiliki panas gamma di reflektor yang sangat rendah. Disimpulkan bahwa berdasarkan nilai panas gamma di reflektor yang sangat rendah, desain teras reaktor RRI lebih aman untuk penggunaan berbagai jenis iradiasi. ABSTRACT The Gamma heating value is an important factor needed for safety analysis of each experiments that will be realized on research reactor core. Gamma heat is internal heat source occurs in each irradiation facilities or any material irradiated in reactor core. This value should be determined correctly because of the safety related problems. The gamma heating value is in general depend on reactor core characteristics, different one and other, and then each new reactor design should be completed by gamma heating data. The Innovative Research Reactor is one of the new reactor design

  6. PENINGKATAN KINERJA SISTEM KESELAMATAN PASIF PADA REAKTOR NUKLIR DENGAN PENAMBAHAN KOMPONEN RVACS

    Directory of Open Access Journals (Sweden)

    A. G. Abdullah

    2014-07-01

    Full Text Available Kelengkapan sistem keselamatan pasif dan inheren pada reaktor lanjut merupakan prasyarat utama. Makalah ini mengeksplorasi hasil desain konseptual sistem pembuang sisa panas pada pusat listrik tenaga nuklir berjenis Very High-Temperature Reactor. Tujuan riset ini untuk merancang sistem pembuang sisa panas pusat listrik tenaga nuklir yang terdapat pada dinding reaktor. Studi kinerja Reactor Vessel Auxliary Cooling System (RVACS dilakukan pada dua jenis pendingin yaitu Timbal-Bismut dan Liquid Salt. Panas dari dinding reaktor dihapus melalui sirkulasi alamiah pada keadaan tunak. Analisis melibatkan sistem perpindahan panas secara radiasi, konduksi dan konveksi alami. Perhitungan perpindahan panas dilakukan pada elemen reaktor vessel, dinding luar guard vessel, dan pelat pemisah. Hasil analisis kecelakaan menunjukkan kedua jenis sistem pendingin reaktor dan sistem pasif sisa pembuangan panas cukup menghapus sisa panas hasil peluruhan dengan sirkulasi alami.ABSTRACTCompleteness of passive safety systems and inherent in advanced reactors is a major prerequisite. This paper explores the results of a conceptual design of the heat removal system at the nuclear power plant (NPP type Very High-Temperature Reactor. The purpose of this research was to design the reactor vessel auxiliary cooling system (RVACS of NPP located within the reactor walls. The RVACS performance study was conducted on two types of coolant: Lead-Bismuth and Liquid Salt. Heat was removed from the reactor vessel through the natural circulation in the steady state. Analyses of heat transfer systems involved radiation, conduction and natural convection. Heat transfer calculations were performed on the reactor vessel, guard vessel, and perforated plate. The results from the accident analysis showed that both types, the reactor coolant system and the passive residual heat removal system, adequately remove remaining heat of the decay by a natural circulation.

  7. VERIFIKASI PAKET PROGRAM MVP-II DAN SRAC2006 PADA KASUS TERAS REAKTOR VERA BENCHMARK.

    Directory of Open Access Journals (Sweden)

    Jati Susilo

    2015-03-01

    Full Text Available Dalam penelitian ini dilakukan verifikasi perhitungan benchmark VERA pada kasus Zero Power Physical Test (ZPPT teras reaktor Watts Bar 1. Reaktor tersebut merupakan jenis PWR kelas 1000 MWe yang didesain oleh Westinghouse, tersusun dari 193 perangkat bahan bakar 17×17 dengan 3 jenis pengkayaan UO2 yaitu 2,1wt%, 2,619wt% dan 3,1wt%. Perhitungan nilai k-eff dan distribusi faktor daya dilakukan pada siklus operasi pertama teras dengan kondisi beginning of cycle (BOC dan hot zero power (HZP. Posisi batang kendali dibedakan menjadi uncontrolled (semua batang kendali berada di luar teras, dan controlled (batang kendali Bank D didalam teras. Paket program komputer yang digunakan dalam perhitungan adalah MVP-II dan SRAC2006 modul CITATION dengan data pustaka tampang lintang ENDF/B-VII.0. Hasil perhitungan menunjukkan bahwa perbedaan nilai k-eff teras pada kondisi controlled dan uncontrolled antara referensi dengan MVP-II (-0,07% dan -0,014% dan SRAC2006 (0,92% dan 0,99% sangat kecil atau masih dibawah 1%. Perbedaan faktor daya maksimum teras pada kondisi controlled dan uncontrolled dengan referensi dengan MVP-II adalah 0,38% dan 1,53%, sedangkan dengan SRAC2006 adalah 1,13% dan -2,45%. Dapat dikatakan bahwa kedua paket program komputer menunjukkan hasil perhitungan yang sesuai dengan nilai referensi. Dalam hal penentuan kekritisan teras, maka hasil perhitungan MVP-II lebih konservatif dibandingkan dengan SRAC2006. Kata kunci : MVP-II, SRAC2006, PWR, VERA   In this research, verification calculation for VERA core physics benchmark on the Zero Power Physical Test (ZPPT of the nuclear reactor Watts Bar 1. The reactor is a 1000 MWe class of PWR designed by Westinghouse, arranged from 193 unit of 17×17 fuel assembly consisting 3 type enrichment of UO2 that are 2.1wt%, 2.619wt% and 3.1wt%. Core power factor distribution and k-eff calculation has been done for the first cycle operation of the core at beginning of cycle (BOC and hot zero power (HZP. In this

  8. KARAKTERISASI RADIONUKLIDA PADA TIAP SUB-SISTEM KESELAMATAN REAKTOR DAYA BERBAHAN BAKAR MOX

    Directory of Open Access Journals (Sweden)

    Pande Made Udiyani

    2015-04-01

    Full Text Available Pengganti Bahan bakar UO2, yang tergolong uranium pengkayaan rendah, adalah bahan bakar MOX yang mempunyai pengkayaan yang lebih tinggi. Bahan bakar MOX mempunyai kandungan plutonium dan nuklida dari golongan aktinida yang lebih tinggi dibandingkan bahan bakar UO2, yang akan menghasilkan karakteristik radionuklida yang berbeda untuk setiap sub-sistem reaktor daya. Analisis radionuklida untuk setiap sub-sistem keselamatan pada reaktor daya berbahan bakar MOX dilakukan untuk mengetahui karakteristik radionuklida khususnya plutonium dan aktinida yang akan menimbulkan dampak radiasi dari lepasan radionuklida tersebut. Analisis dilakukan dengan cara menghitung dan mengamati radionuklida untuk setiap sub-sistem keselamatan pada operasi normal dan kecelakaan (small LOCA, large LOCA, severe accident untuk reaktor PWR berkapasitas 1000 MWe. Disimpulkan bahwa penggunaan bahan bakar MOX dapat menambah konsekuensi radiologis ke lingkungan dan masyarakat, terutama karena inventori yang lebih besar termasuk dari radionuklida transuranic dan dari golongan aktinida, antara lain: Pu-239, Am-241, Cm-242, Pu-240, Pu-241 dan Pu-242. Kata kunci: karakteristik nuklida, reaktor daya, bahan bakar, MOX   Substitute UO2 fuel that low enrichment of uranium is that MOX fuel has a higher enrichment. MOX fuel has a content of plutonium and actinide nuclides a higher than UO2 fuel, which will produce different characteristics of radionuclides for each sub-system of power reactors. Analyzis of radionuclide for each safety sub-system at MOX power reactor aims to determine the characteristics of radionuclides, especially plutonium and actinides consequences. Analyzis has done by calculating and observing the radionuclide for each safety sub-system in normal operation and accident (small LOCA, large LOCA, and severe accident on PWR-1000 reactors. It can concluded that the use of MOX fuel can add to the radiological consequences to the environment and public, mainly because a

  9. STUDI KARAKTERISTIK PEMBENTUKAN UAP DALAM PEMBANGKIT UAP HELIKAL PADA REAKTOR MODULAR DAYA KECIL

    Directory of Open Access Journals (Sweden)

    Susyadi Susyadi

    2015-06-01

    Full Text Available Reaktor modular daya kecil (SMR sangat cocok untuk  dibangun Indonesia, terutama pada lokasi-lokasi dengan kapasitas jaringan listrik yang rendah sehingga investigasi lebih jauh tentang reaktor ini sangat diperlukan. Umumnya SMR memiliki bentuk pembangkit uap yang kompak dan terintegrasi di dalam bejana tekan. Disain tersebut menyebabkan perbedaan pendekatan dalam memproduksi uap dibandingkan reaktor nuklir konvensional yang menggunakan pembangkit uap tabung-u terbalik. Oleh karena itu tujuan dari penelitian ini adalah untuk mengetahui karakteristik uap dan pola pembentukkannya di dalam pembangkit uap tipe helikal yang banyak digunakan oleh SMR. Metoda yang dipakai adalah dengan melakukan pemodelan dan perhitungan numerik menggunakan program RELAP5. Dalam pemodelan, aliran air umpan  bertekanan dan temperatur rendah dimasukkan ke dalam tabung helikal sementara aliran fluida bertekanan dan temperatur tinggi, yang mewakili pendingin sistem primer reaktor, berada di sisi luar tabung. Hasil perhitungan menunjukkan bahwa uap yang dihasilkan oleh pembangkit uap helikal bersifat lewat jenuh yakni sekitar 25 K di atas titik jenuhnya. Hal ini memberikan keunggulan komparatif dari segi disain dan operasional pada SMR dibanding reaktor konvensional karena uap lewat jenuh yang dihasilkan dapat mengurangi kerugian turbin dan sekaligus meningkatkan efisiensi termodinamika. Kata kunci: pembangkit uap helikal, SMR, PWR, uap lewat jenuh, RELAP5   Small modular reactor (SMR is very suitable to be deployed in Indonesia especially for locations having low electrical grid capacity, so  further investigation on the characteritic of this reactor is needed. In general SMR has a compact and integrated-to-vessel steam generator design. This design implies different approach in producing steam as compared to conventional nuclear power plant  having inverted u-tube steam generator. For that reason, this research is intended to investigate the steam characteristic and

  10. Pengaruh Laju Alir Inlet Reaktor MSL terhadap Reduksi BOD, COD, TSS, dan Minyak/Lemak Limbah Cair Industri Minyak Goreng

    Directory of Open Access Journals (Sweden)

    Salmariza Sy

    2017-06-01

    Full Text Available This research was conducted by treating edible oil industry wastewater used Multi Soil Layering (MSL method. The MSL reactor was built from a 200x120x200 cm concrete basin. Andisol soil was mixed with sawdust and fine charcoal at each ratio 5:1:1 based on dry weight as an impermeable layer. The flow rate variations were 250, 500, 1000, and 1500 L/m2.day. The observed pollutant parameters were BOD, COD, TSS, oil/fat, and pH. The results showed that MSL reactor was effective to decrease the pollutant content of edible oil industry wastewater. The reactor could reduce concentration of effluent parameters below standard except for oil/fat parameters at high flow rates. In the effluent was found BOD 0.66-14.22 mg/L, COD 5-69 mg/L, TSS 9-26 mg/L, and oil/fat 2-9 mg/L. The flow rate had an effect on reduction efficiency of BOD, COD, TSS, and oil/fat but did not effect pH as all flow rate could raise pH 6.37-6.95 became pH 6.99-7.24. The lower the flow rate the higher the reduction efficiency. The reduction efficiency at flow rates 250 and 1500 L/m2 days for BOD were 99% and 86%, COD were 96% and 71%, TSS were 88% and 77%, and oil/fat were 80% and 60%.ABSTRAK  Penelitian ini dilakukan dengan mengolah air limbah industri minyak goreng menggunakan metoda Multi Soil Layering (MSL. Reaktor MSL dibuat dari beton berbentuk bak ukuran 200x120x200 cm. Tanah andisol dicampur dengan serbuk gergaji dan arang halus pada rasio masing-masing 5:1:1 berdasarkan berat kering sebagai penyusun lapisan impermeable. Variasi laju alir yaitu 250, 500, 1000, dan 1500 L/m2.hari. Parameter pencemar yang dianalisis meliputi BOD, COD, TSS, minyak/lemak, dan pH. Hasil penelitian menunjukkan bahwa reaktor MSL sangat efektif untuk menurunkan kandungan zat pencemar limbah cair industri minyak goreng. Reaktor dapat mereduksi konsentrasi parameter outlet sampai dibawah baku mutu yang distandarkan kecuali untuk parameter miyak/lemak pada perlakuan laju alir tinggi. Pada effluen

  11. PERHITUNGAN SUHU ELEMEN BAKAR REAKTOR TRIGA 2000 DALAM TABUNG SIPPING TEST MENGGUNAKAN CFD

    Directory of Open Access Journals (Sweden)

    K.A. Sudjatmi

    2015-03-01

    Full Text Available Telah dihitung suhu elemen bakar pada perangkat sipping test reaktor TRIGA 2000 Bandung. Perhitungan perlu dilakukan untuk memastikan bahwa suhu elemen bakar masih dibawah atau pada batas suhu elemen bakar yang diizinkan pada saat reaktor beroperasi, sehingga dapat dipastikan bahwa pada pelaksanaan pengujian dengan menggunakan perangkat ini, suhu masih dalam batas keselamatan. Perhitungan dilakukan dengan membuat model tabung sipping test berisi elemen bakar yang dikelilingi oleh 9 buah elemen bakar, sesuai dengan posisi tabung sipping test di teras reaktor, dengan menggunakan GAMBIT. Dimensi model disesuaikan dengan dimensi tabung dan elemen bakar dalam teras reaktor TRIGA 2000 Bandung. Pengoperasian sipping test untuk tiap elemen bakar dilakukan selama 30 menit pada daya 300 kW. Perhitungan dilakukan dengan menggunakan perangkat lunak Computational Fluid Dynamics (CFD dan sebagai inputan disesuaikan dengan parameter reaktor TRIGA 2000. Simulasi dilakukan pada pengoperasian dari 30, 60, 90, 120 150, 180 sampai 210 menit. Hasil perhitungan menunjukan bahwa suhu pusat bahan bakar dalam tabung sipping test sebesar 236,06 oC, sedangkan suhu dinding elemen bakar adalah sebesar 87,58 oC. Suhu maksimum pusat bahan bakar reaktor TRIGA 2000 pada operasi normal adalah 650 oC, dan tidak diizinkan terjadinya pendidihan di dalam teras reaktor. Jadi dapat disimpulkan bahwa pengoperasian perangkat sipping test masih sangat aman karena suhu bahan bakar berada dibawah batasan suhu bahan bakar yang diizinkan pada kondisi operasi normal demikian juga suhu dinding elemen bakar masih dibawah suhu didih air. Kata kunci: sipping test, TRIGA, elemen bakar, CFD   It has been calculated the fuel element temperature in the sipping test of Bandung TRIGA 2000 reactor. The calculation needs to be done to ascertain that the fuel element temperatures are below or at the limit of the allowable temperature fuel elements during reactor operation, ensuring that the

  12. ANALISIS PENGARUH IRADIASI FLUENS NEUTRON CEPAT TERHADAP BERILIUM REFLEKTOR REAKTOR RSG-GAS

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2015-04-01

    Full Text Available Telah dilakukan analisis iradiasi fluens neutron cepat terhadap berilium reflektor reaktor RSG-GAS. Analisis dilakukan dengan cara melakukan pengukuran fluks neutron di posisi berilium elemen dan berilium blok yang berfungsi sebagai reflector. Selanjutnya dilakukan perhitungan untuk menentukan apakah ada pengaruh fluens neutron selama berilium berada di teras reaktor. Selain cara tersebut dilakukan pula visualisasi untuk memastikan ada tidaknya deformasi pada berilium akibat iradiasi. Hasil pengukuran fluks dan fluens neutron cepat maksimal pada daya 200 kW untuk berilium elemen posisi E-2 sebesar 2,30E+07 n/cm2s dan 4,19E+17 n/cm2, J-8 sebesar 3,70E+07 n/cm2s dan 6,74E+17 n/cm2. Hasil pengukutan pada posisi B-3 sebesar 2,19E+12 n/cm2s dan 3,99E+22 n/cm2, G-10 sebesar 2,12E+12 n/cm2s dan 3,86E+22 n/cm2, serta berilium blok posisi (5-6 sebesar 5,02E+07 n/cm2s dan 9,15E+17 n/cm2, (C-D sebesar 2,32E+07 n/cm2s dan 4,23E+17 n/cm2. Deformasi yang diperoleh untuk berilium elemen (∆L/L posisi E-2 sebesar 1,12E-08, J-8 sebesar 1,84E-08, B-3 sebesar 1,60E-03, posisi G-10 sebesar 1,55E-03, sedangkan pada berilium blok di posisi 5-6 sebesar 2,52E-08 dan C-D sebesar 1,13E-08. Dari hasil ini disimpulkan tidak terjadi deformasi pada berilium elemen dan berilium blok. Hasil ini dibuktikan pula dari pengamatan visual, dimana tidak terlihat adanya deformasi pada berilium tersebut. Kata kunci : fluks, fluens, berilium elemen, berilium blok   Analysis of influence fast neutron fluence irradiated to the RSG-GAS beryllium reflector have been done. Methods of analysis was carried out by measuring fluxs neutron in beryllium element and block positio that function as reflector. The calculation done for determination it is there any influence of neutron as long as beryllium in the core. Bisede that, visualization done to make sure it there is any deformation at beryllium as efect of irradiation. Fluxs and fluences of beryllium element measurement result in 200 k

  13. ANALISIS KONDISI TERAS REAKTOR DAYA MAJU AP1000 PADA KECELAKAAN SMALL BREAK LOCA

    Directory of Open Access Journals (Sweden)

    Andi Sofrany Ekariansyah

    2015-06-01

    Full Text Available ABSTRAK ANALISIS KONDISI TERAS REAKTOR DAYA MAJU AP1000 PADA KECELAKAAN SMALL BREAK LOCA. Kecelakaan yang diakibatkan oleh kehilangan pendingin (loss of coolant accident / LOCA dari sistem reaktor merupakan kejadian dasar desain yang tetap diantisipasi dalam desain reaktor daya yang mengadopsi teknologi Generasi II hingga IV. LOCA ukuran kecil (small break LOCA memiliki dampak yang lebih signifikan terhadap keselamatan dibandingkan LOCA ukuran besar (large break LOCA seperti terlihat pada kejadian Three-Mile Island (TMI. Fokus makalah adalah pada analisis small break LOCA pada reaktor daya maju Generasi III+ yaitu AP1000 dengan mensimulasikan tiga kejadian pemicu yaitu membukanya katup Automatic Depressurization System (ADS secara tak disengaja, putusnya salah satu pipa Direct Vessel Injection (DVI secara double-ended, dan putusnya pipa lengan dingin dengan diameter bocoran 10 inci. Metode yang digunakan adalah simulasi kejadian pada model AP1000 yang dikembangkan secara mandiri menggunakan program perhitungan RELAP5/SCDAP/Mod3.4. Dampak yang ingin dilihat adalah kondisi teras selama terjadinya small break LOCA yang terdiri dari pembentukan mixture level dan transien temperatur kelongsong bahan bakar. Hasil simulasi menunjukkan bahwa mixture level untuk semua kejadian small break LOCA berada di atas tinggi teras aktif yang menunjukkan tidak terjadinya core uncovery. Adanya mixture level berpengaruh pada transien temperatur kelongsong yang menurun dan menunjukkan pendinginan bahan bakar yang efektif. Hasil di atas juga identik dengan hasil perhitungan program lain yaitu NOTRUMP. Keefektifan pendinginan teras juga disebabkan oleh berfungsinya injeksi pendingin melalui fitur keselamatan pasif yang menjadi ciri reaktor daya AP1000. Secara keseluruhan, hasil analisis menunjukkan model AP1000 yang telah dikembangkan dengan RELAP5 dapat digunakan untuk keperluan analisis kecelakaan dasar desain pada reaktor daya maju AP1000. Kata kunci: analisis

  14. How ABB Reaktor tackles inspection, repair and cleaning of SG tubes

    International Nuclear Information System (INIS)

    Lahner, K.

    1991-01-01

    Despite the large advances in the materials and chemistry used in nuclear power plants, steam generators remain a vulnerable component in the primary circuit of pressurized water reactors. The inspection, repair and the preventive maintenance of steam generator tubes are increasingly important technical disciplines. As part of its activities as a nuclear service company, ABB Reaktor has developed a family of tools and techniques that have been qualified and used for inspection and repair work on all types of steam generators. These include the remotely controlled DERI manipulator, eddy current testing equipment, removable plugs for tube repairs and two secondary side cleaning processes. (author)

  15. ANALISIS DAN PENGUKURAN PARAMETER REAKTOR KARTINI UNTUK PENERAPAN METODE K0-NAA

    Directory of Open Access Journals (Sweden)

    Sri Murniasih

    2015-03-01

    Full Text Available Metode k0-NAA merupakan metode analisis yang banyak digunakan dengan berbagai keunggulan. Dalam penerapan metode k0-NAA diperlukan nilai parameter reaktor (f dan α, maka tujuan penelitian ini adalah akan dilakukan pengukuran nilai parameter f dan α di fasilitas Lazy Susan reaktor Kartini. Metode yang digunakan meliputi metode Cd-ratio dan triple bare. Telah diukur nilai parameter tersebut pada tiga lubang iradiasi di fasilitas Lazy Susan. Diperoleh perbedaan hasil pengukuran nilai parameter yang signifikan pada setiap lubang iradiasi, nilai ƒ berkisar 13,713 - 22,128 dan α berkisar -0,060 – 0,068. Hasil pengukuran f dan α dengan metode Cd-ratio, memberikan nilai yang lebih stabil dibandingkan metode triple bare. Nilai f dan α yang diperoleh dapat dijadikan basis data pada penerapan metode k0-NAA untuk analisis sampel di laboratorium AAN – PSTA. Kata kunci: parameter reaktor, reaktor Kartini, k0-NAA, fluks neutron   The k0-NAA method is an analysis method that widely used by many of the advantages. In the application of k0-NAA method needed valuea of reactor parameters (f and α, then the purpose of the research would be conducted meaasurement parameter values f and α in the Lazy Susan Kartini reactor facilities. The methods used include Cd-ratio and triple bare methods. The parameter value has been measured in three channels in the irradiation facilities Lazy Susan. Differences of measurement results obtained parameter values are significant in each channel irradiation, the value of ƒ ranged from 13.713 to 22.128 and the value of α ranged from -0.060 – 0.068. The results of measurements for the f and α with the Cd-ratio method, providing more stable value than the triple bare method. The value of f and α obtained can be used a database for the application of k0-NAA method for sample analysis in the laboratory NAA – CAST. Keywords: reactor parameter, Kartini reactor, k0-NAA, neutron flux

  16. PERFORMA OKSIDASI METAN PADA REAKTOR KONTINYU DENGAN PENINGKATAN KETEBALAN LAPISAN BIOCOVER LANDFILL

    Directory of Open Access Journals (Sweden)

    Opy Kurniasari

    2013-11-01

    methane through the form of methanol metabolite. ABSTRAKPenanganan sampah kota di Indonesia pada umumnya dilakukan pada tempat pemrosesan akhir sampah (TPA, yang sebagian besar dilakukan dengan cara pengurugan (landfilling yang cenderung bersifat anaerob (tidak ada oksigen. Cara pengurugan ini biasanya dioperasikan lapis perlapis sehingga memungkinkan terjadinya proses anaerob. Pada kondisi ini dipastikan biogas, yaitu gas metana (CH4 dan CO2, akan muncul. Metana adalah gas rumah kaca dengan potensi pemanasan global lebih besar dari CO2, dan dapat mengabsorpsi radiasi infra merah 23 kali lebih efisien dari CO2 pada periode lebih dari 100 tahun. Salah satu cara yang dapat dilakukan untuk mengurangi gas metana dari landfill yang lepas ke alam adalah dengan mengoksidasinya dengan memanfaatkan material penutup landfill (biocover sebagai media mikroorganisma pengoksidasi metana. Aplikasi kompos sebagai material penutup landfill merupakan pendekatan dengan biaya rendah untuk mereduksi emisi gas dari landfill sehingga cocok untuk negara berkembang. Biocover yang digunakan pada penelitian ini adalah kompos landfill mining, yaitu kompos yang terdegradasi secara alami di landfill. Tujuan penelitian ini adalah mengevaluasi kemampuan biocover kompos landfill mining dalam mengoksidasi metana pada ketebalan lapisan tertentu dengan kondisi aliran kontinyu. Tiga buah reaktor kolom yang digunakan terbuat dari flexy glass berukuran tinggi 70 cm dan diameter 15 cm. Gas metana dialirkan dari bawah reaktor secara kontinyu dengan laju alir 5 ml/menit. Kolom diisi dengan biocover kompos landfill mining dengan ketebalan lapisan 5, 25, 35 dan 60 cm. Hasil percobaan menunjukkan bahwa semakin tebal lapisan biocover, semakin tinggi efisiensi oksidasi metana. Efisiensi oksidasi yang diperoleh pada setiap ketebalan lapisan 15, 25, 35 dan 60 cm adalah masing-masing 56,43%, 63,69%, 74,58% dan 80,03%, dengan laju oksidasi 0,287 mol m-2 d-1 dan fraksi oksidasi 97%. Hasil oksidasi yang diperoleh tersebut

  17. VERIFIKASI KECELAKAAN HILANGNYA ALIRAN AIR UMPAN PADA REAKTOR DAYA PWR MAJU

    Directory of Open Access Journals (Sweden)

    Andi Sofrany Ekariansyah

    2015-03-01

    Full Text Available AP1000 adalah reaktor daya PWR maju dengan daya listrik 1154 MW yang didesain berdasarkan kinerja teruji dari desain PWR lain oleh Westinghouse. Untuk mempersiapkan peran Pusat Teknologi Reaktor dan Keselamatan Nuklir sebagai suatu Technical Support Organization (TSO dalam hal verifikasi keselamatan, telah dilakukan kegiatan verifikasi keselamatan untuk AP1000 yang dimulai dengan verifikasi kecelakaan kegagalan pendingin sekunder. Kegiatan dimulai dengan pemodelan fitur keselamatan teknis yaitu sistem pendinginan teras pasif yang terdiri dari sistem Passive Residual Heat Removal (PRHR, tangki core makeup tank (CMT, dan tangki In-containment Refueling Water Storage Tank (IRWST. Kecelakaan kegagalan pendingin sekunder yang dipilih adalah hilangnya aliran air umpan ke salah satu pembangkit uap yang disimulasikan menggunakan program perhitungan RELAP5/SCDAP/Mod3.4. Tujuan analisis adalah untuk memperoleh sekuensi perubahan parameter termohidraulika reaktor akibat kecelakaan dimana hasil analisis yang diperoleh divalidasi dan dibandingkan dengan hasil analisis menggunakan program perhitungan LOFTRAN di dalam dokumen desain keselamatan AP1000. Hasil verifikasi menunjukkan bahwa kejadian hilangnya suplai air umpan tidak berdampak pada kerusakan teras, sistem pendingin reaktor, maupun sistem sekunder. Penukar kalor PRHR telah terverifikasi kemampuannya dalam membuang kalor peluruhan teras setelah trip reaktor. Hasil validasi dengan dokumen pembanding menunjukkan kesesuaian pada sebagian besar parameter termohidraulika. Secara umum, model PWR maju yang dilengkapi dengan sistem pendinginan teras ciri pasif yang telah dikembangkan tetap selamat ketika terjadi kecelakaan kehilangan aliran pendingin sekunder. Kata kunci: Verifikasi, hilangnya aliran air umpan, AP1000   AP1000 is a PWR power reactor with 1154 MW of electrical power that is designed based on the proven performance of the other Westinghouse PWR designs. To prepare the role of Center for

  18. Pembuatan Biodiesel dari Limbah Minyak Ikan Patin Menggunakan Reaktor Membran

    OpenAIRE

    Rahmi, Silvia; Syarfi, Syarfi; Irdoni, Irdoni

    2015-01-01

    Membrane reactor is an alternative technology is used to produce of biodiesel, one of the advantages of the reaction and separation process takes place in a single stage simultaneous. This research aims to study the effect of the variation of the catalyst and mole ratio feed catfish oil - methanol in biodiesel production, transesterification process in a membrane reactor with a variation of the mole ratio of catfish oil - methanol 1:10, 1:14, and 1:18, the concentration of the base catalyst 0...

  19. Plate type heat exchanger for Reaktor TRIGA PUSPATI

    International Nuclear Information System (INIS)

    Mohd Fairus Abdul Farid; Mohammad Suhaimi Kassim; Mohamad Puad Abu; Mohd Fazli Zakaria; Shaharum Ramli

    2008-08-01

    The PUSPATI TRIGA reactor (RTP) reached its first criticality status on 28 June 1982 with an installed capacity of 1 MW. After 26 years in operation, the ageing process has set in and many systems in the reactor need maintenance and replacement. Among these systems, the more critical one is the heat exchanger system. Currently, the shell and tube type heat exchanger is being used. It has been observed that the performance of the heat exchanger has dropped significantly over the years. Visual inspections indicate that the tubes are corroded or even to the extent of being totally blocked. With this in mind and also with the setting up of the new Nuclear Power Division, whose mission includes upgrading the present reactor to 3 MW, the heat exchanger system is essential and a critical component. Literature indicates that the use of plate type exchangers are more efficient than the current shell and tube type. This paper will look into the engineering and safety aspects of using the plate type heat exchanger to the current TRIGA PUSPATI reactor. (Author)

  20. Disain Sistem Pemantauan Lingkungan Untuk Evaluasi Lepasan Radionuklida dari Subsistem pada Kecelakaan Reaktor Daya PWR

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2013-03-01

    Full Text Available PLTN. (Pembangkit Listrik Tenaga Nuklir sebagai sumber energi baru dipilih sebagai alternatif, karena memiliki berbagai kelebihan yaitu ramah lingkungan, pasokan bahan bakar yang tidak bergantung musim, serta harganya yang dapat bersaing dengan pembangkit listrik yang lain. Namun demikian, adanya keraguan sebagian masyarakat tentang keselamatan radiasi PLTN, maka pemerintah harus bisa meyakinkan tentang operasi PLTN yang aman dan selamat. Penelitian tentang disain sistem pemantauan lingkungan untuk evaluasi lepasan radionuklida dari subsistem reaktor dan lingkungan akibat terjadinya kecelakaan pada reaktor daya telah dilakukan. Penelitian dilakukan dengan melakukan perhitungan sebaran radionuklida ke subsistem dan lingkungan serta membuat sistim monitoring radiasi di lingkungan. Sistem monitoring lingkungan terdiri dari system pencacah radiasi, sistem peringatan dini, sistem pengukuran meteorologi, sistem GPS dan system GIS. Sistem pencacah radiasi digunakan untuk mencatat data radiasi, sistem pengukuran meteorologi digunakan untuk mencatat data arah dan kecepatan angin, sedangkan sistem GPS digunakan untuk menentukan data posisi pengukuran. Data tersebut kemudian dikirimkan ke system akuisisi data untuk ditransmisikan ke pusat kendali. Pengumpulan dan pengiriman data dilakukan melalui SMS menggunakan perangkat modem yang ditempatkan di ruang kendali. Ruang kendali menerima data dari berbagai tempat pengukuran. Dalam hal ini ruang kendali memiliki fungsi sebagai SMS gateway. Sistem ini dapat memvisualisasi untuk lokasi pengukuran yang berbeda. Selanjutnya, data posisi dan data radiasi diintegrasikan dengan peta digital. Integrasi sistem tersebut kemudian divisualisasikan dalam personal komputer. Untuk posisi pengukuran terlihat langsung di peta dan untuk data radiasi ditampilkan di monitor dengan tanda lingkaran merah atau hijau yang digunakan sebagai pemonitor batas aman radiasi. Bila tanda lingkaran berwarna merah maka akan menyalakan alarm di

  1. PEMODELAN KOLIMATOR DI RADIAL BEAM PORT REAKTOR KARTINI UNTUK BORON NEUTRON CAPTURE THERAPY

    Directory of Open Access Journals (Sweden)

    Bemby Yulio Vallenry

    2015-03-01

    Full Text Available Salah satu metode terapi kanker adalah Boron Neutron Capture Therapy (BNCT. BNCT memanfaatkan tangkapan neutron oleh 10B yang terendapkan pada sel kanker. Keunggulan BNCT dibandingkan dengan terapi radiasi lainnya adalah tingkat selektivitas yang tinggi karena tingkatannya adalah sel. Pada penelitian ini dilakukan pemodelan kolimator di radial beamport reaktor Kartini sebagai dasar pemilihan material dan manufature kolimator sebagai sumber neutron untuk BNCT. Pemodelan ini dilakukan dengan simulasi menggunakan perangkat lunak Monte Carlo N-Particle versi 5 (MCNP 5. MCNP 5 adalah suatu paket program untuk memodelkan sekaligus menghitung masalah transpor partikel dengan mengikuti sejarah hidup neutron semenjak lahir, bertranspor pada bahan hingga akhirnya hilang karena mengalami reaksi penyerapan atau keluar dari sistem. Pemodelan ini menggunakan variasi material dan ukurannya agar menghasilkan nilai dari tiap parameter-parameter yang sesuai dengan rekomendasi I International Atomic Energy Agency (IAEA untuk BNCT, yaitu fluks neutron epitermal (Фepi > 9 n.cm-2.s-1, rasio antara laju dosis neutron cepat dan fluks neutron epitermal (Ḋf/Фepi 0,7. Berdasarkan hasil optimasi dari pemodelan ini, material dan ukuran penyusun kolimator yang didapatkan yaitu 0,75 cm Ni sebagai dinding kolimator, 22 cm Al sebagai moderator dan 4,5 cm Bi sebagai perisai gamma. Keluaran berkas radiasi yang dihasilkan dari pemodelan kolimator radial beamport yaitu Фepi = 5,25 x 106 n.cm-2s-1, Ḋf/Фepi =1,17 x 10-13 Gy.cm2.n-1, Ḋγ/Фepi = 1,70 x 10-12 Gy.cm2.n-1, Фth/Фepi = 1,51 dan J/Фepi = 0,731. Berdasarkan penelitian ini, hasil optimasi 5 parameter sebagai persyaratan kolimator untuk BNCT yang keluar dari radial beam port tidak sepenuhnya memenuhi kriteria yang direkomendasikan oleh IAEA sehingga perlu dilakukan penelitian lebih lanjut agar tercapainya persyaratan IAEA. Kata kunci: BNCT, radial beamport, MCNP 5, kolimator   One of the cancer therapy methods is

  2. PEMBUATAN SERBUK U-6Zr DENGAN PENGKAYAAN URANIUM 19,75 % UNTUK BAHAN BAKAR REAKTOR RISET

    Directory of Open Access Journals (Sweden)

    Masrukan Masrukan

    2016-03-01

    Full Text Available ABSTRAK PEMBUATAN SERBUK PADUAN U-6Zr DENGAN PENGKAYAAN URANIUM 19,75 % UNTUK BAHAN BAKAR REAKTOR RISET. Telah dilakukan pembuatan serbuk paduan U-6Zr dengan pengkayaan 19,75 % untuk bahan bakar reaktor riset. Pembuatan bahan bakar U-6Zr ini dalam rangka mencari bahan bakar baru yang mempunyai densitas tinggi untuk mengganti bahan bakar yang sudah ada U3Si2-Al. Tujuan dari percobaan ini untuk mengetahui sifat-sifat serbuk paduan U- 6Zr yang diperoleh dari proses hydriding-dehydriding sebagai kandidat bahan bakar reaktor riset. Serbuk yang diperoleh dari proses hydriding-dehydriding dikenai pengujian, diantaranya pungujian komposisi kimia, densitas, kandungan hidrogen, fasa dan sifat termal. Hasil pengujian komposisi kimia menunjukkan beberapa unsur seperti Al, Ca, Cu, dan Ni melebihi batas yang diijinkan dimana masing-masing unsur terdapat sebesar 202,21 ppm; 214,05 ppm; 61,25 ppm dan 134,53 ppm. Pada pengujian diperolah densitas serbuk U-6Zr sebesar 13,58 g/cm3 dan pada pengujian kandungan hidrogen sisa diperoleh kandungan hidrogen sebesar 0,16 %. Untuk pengujian fasa, diperoleh fasa αU dan δU, sedangkan pada pengujian sifat termal yakni transformasi temperatur terdapat dua puncak yakni puncak pertama terjadi pada temperatur 274 hingga 311 oC dan puncak kedua terjadi pada temperatur 493 hingga 527oC. Puncak pertama terjadi reaksi endotermik dengan menyerap panas sebesar ∆H = 6,23 cal/g tetapi tidak terbentuk fasa baru, sedangkan puncak kedua terjadi reaksi eksotermik dengan mengeluarkan panas sebesar ∆H = -9.34 cal/g dan terbentuk fasa αZr. Sementara itu, dari pengujian kapasitas panas pada temperatur 34 hingga 75 oC, terjadinya penurunan nilai kapasitas panas yang disertai dengan penyerapan panas. Pada temperatur yang lebih tinggi hingga temperatur 437oC nilai kapasitas panas menjadi lebih kecil disertai pengeluaran panas. Reaksi termokimia antara Zr dengan hidrogen sisa menunjukkan terbentuknya fasa αZr yang diindikasikan oleh reaksi

  3. PENGEMBANGAN MODEL UNTUK SIMULASI KESELAMATAN REAKTOR PWR 1000 MWe GENERASI III+ MENGGUNAKAN PROGRAM KOMPUTER RELAP5

    Directory of Open Access Journals (Sweden)

    Andi Sofrany Ekariansyah

    2015-04-01

    Full Text Available Reaktor daya PWR AP1000 yang didesain oleh Westinghouse adalah reaktor Generasi III+ pertama yang telah menerima persetujuan desain dari U.S. Nuclear Regulatory Commission (NRC. Saat ini utilitas China telah memulai pembangunan beberapa unit AP1000 di dua tapak terpilih untuk rencana operasi pada 2013-2015. AP1000 sebagai desain PWR berdasarkan teknologi teruji dari desain PWR lainnya yang dibuat oleh Westinghouse dengan penguatan pada sistem keselamatan pasif dengan demikian dapat dipertimbangkan untuk dibangun di Indonesia bila mengacu pada persyaratan pada PP 43/2006 mengenai Perijinan Reaktor Nuklir. Namun demikian, desain tersebut perlu diverifikasi oleh Technical Support Organization (TSO independen sebelum dapat dibangun di Indonesia. Verifikasi dapat dilakukan menggunakan paket program RELAP5 dalam bentuk analisis kecelakaan. Selama ini analisis kecelakaan PLTN dilakukan untuk tipe PWR 1000 MWe dari generasi II atau tipe konvensional. Mengingat saat ini referensi yang menggambarkan teknologi AP1000 yang menyertakan teknologi keselamatan pasif sudah tersedia maka dilakukan kegiatan pemodelan yang nantinya dapat digunakan untuk melakukan analisis kecelakaan. Metode pengembangan model mengacu pada pedoman IAEA yang terdiri dari pengumpulan data instalasi, pengembangan engineering data dan penyusunan input deck, verifikasi dan validasi data input. Model yang berhasil dikembangkan secara umum telah mewakili sistem AP1000 secara keseluruhan dan dianggap sebagai model dasar. Model tersebut telah diverifikasi dan divalidasi dengan data desain yang terdapat pada referensi dimana respon parameter termohidraulika menunjukkan perbedaan hasil ± 3% selain untuk parameter penurunan tekanan teras yang lebih rendah 13%. Sebagai model dasar, input deck yang diperoleh dapat dikembangkan lebih lanjut dengan mengintegrasikan pemodelan sistem keselamatan, sistem proteksi, dan sistem kendali yang spesifik AP1000 untuk keperluan simulasi keselamatan yang lebih

  4. APLIKASI TEKNIK AAN DI REAKTOR RSG-GAS PADA PENENTUAN UNSUR ESENSIAL DAN TOKSIK DI DALAM IKAN DAN PAKAN IKAN

    Directory of Open Access Journals (Sweden)

    Saeful Yusuf

    2015-03-01

    Full Text Available Pada makalah ini diuraikan tentang aplikasi teknik AAN (Analisis Aktivasi Neutron dalam penentuan konsentrasi unsur-unsur esensial dan cemaran yang terkandung di dalam beberapa spesies ikan dan pakan ikan. Unsur-unsur esensial yang terkandung dalam pakan ikan buatan juga dianalisis untuk mengetahui pengaruhnya terhadap ikan. Penentuan unsur menggunakan teknik AAN dengan metode perbandingan dan metode k0-AAN. Sampel diiradiasi di reaktor RSG-GAS yang memiliki fluks neutron thermal 5 x 1013 n.cm-2.s-1 pada daya 15 MW. Hasil penelitian menunjukkan bahwa 12 unsur di dalam 11 spesies ikan air laut dan air tawar telah ditentukan yaitu As, Br, Cr, Co, Cs, Fe, Hg, K, Na, Rb, Se and Zn. Konsentrasi cemaran As didalam ikan laut sudah melampaui batas maksimum 1 mg/kg, sedangkan konsentrasi cemaran Hg masih dibawah batas maksimum 0,5 mg/kg, baik untuk ikan laut maupun ikan air tawar. Unsur K dan Na merupakan unsur makroesensial sedangkan unsur Cr, Co, Fe, Se and Zn adalah termasuk unsur mikroesensial. Secara umum ditunjukkan bahwa kandungan mineral didalam ikan laut lebih tinggi konsentrasinya dibandingkan ikan air tawar. Br, Cs dan Rb merupakan unsur-unsur non esensial yang teridentifikasi dalam semua ikan yang dianalisis. Penelitian terhadap pakan ikan air tawar menunjukkan bahwa semua unsur yang teridentifikasi juga terdapat di dalam ikan laut dan ikan air tawar. Hal ini menunjukkan bahwa pakan ikan berkontribusi terhadap konsentrasi unsur di dalam ikan air tawar. Kata kunci : Analisis aktivasi neutron, unsur esensial, unsur cemaran, ikan, pakan ikan   This paper reported on the application of NAA (Neutron Activation Analysis Technique in the determination of the concentration of the essential and toxic elements in some species of fish and fish feed. Determination of elements using instrumental NAA technique with comparison and k0-INAA methods. Samples were irradiated in the RSG-GAS which has a thermal neutron flux  5.0E +13 ncm-2s-1. The results

  5. PENGARUH KONSENTRASI ZrO2 TERHADAP KORELASI PERPINDAHAN PANAS NANOFLUIDA AIR-ZrO2 UNTUK PENDINGIN REAKTOR

    Directory of Open Access Journals (Sweden)

    K.A. Sudjatmi

    2015-03-01

    Full Text Available Sejalan dengan perkembangan konsep keselamatan pasif pada sistem keselamatan PLTN, maka sistem perpindahan panas konveksi alam memegang peranan penting. Pemakaian nanofluid sebagai fluida pendingin pada sistem keselamatan nuklir dapat digunakan pada Sistem Pendingin Teras Darurat dan Sistem Pendingin Pengungkung Luar Reaktor. Beberapa peneliti telah melakukan studi desain konseptual aplikasi nanofluid untuk meningkatkan keselamatan AP1000 dan sistem pendingin teras darurat pada reaktor daya eksperimen. Penerapan nanofluida juga mulai dikembangkan melalui hasil penelitian perpindahan panas konveksi alamiah pada sub-buluh dengan nanofluida sebagai fluida kerjanya sangat dibutuhkan. Penelitian ini bertujuan untuk menentukan pengaruh perubahan konsentrasi ZrO2 terhadap korelasi perpindahan panas konveksi alamiah dengan pendekatan eksperimental. Data eksperimental yang diperoleh digunakan untuk mengembangkan korelasi umum empirik perpindahan panas konveksi alamiah. Metode penelitian dengan menggunakan alat uji sub-buluh vertikal dengan geometri segitiga dan segiempat menggunakan air dan nanofluida air-ZrO2 sebagai fluida kerjanya. Konsentrasi nanopartikel dalam larutan yang digunakan sebesar 0,05 %, 0,10% dan 0,15 % dalam persen berat. Hasil penelitian menunjukan bahwa untuk bilangan Rayleigh yang sama, kemampuan pemindahan kalor oleh nanofluida air-ZrO2 lebih baik dari pada pemindahan kalor oleh air. Namun peningkatan konsentrasi nanofluida tidak selalu mendapatkan kemampuan pemindahan kalor yang lebih baik. Kata kunci: nanofluida air-ZrO2, konveksi alamiah, sub-buluh segitiga, sub-buluh segi segiempat   In line with the development of the passive safety concept for the safety systems of nuclear power plants, the natural convection heat transfer system plays an important role. The nanofluid as coolant fluid on nuclear safety system can be used in Emergency core cooling system and in reactor coolant system confinement. Several researchers have

  6. Pembuatan Biodiesel Dari Minyak Kelapa Sawit RBD Dengan Menggunakan Katalis Berpromotor Ganda Berpenyangga γ-Alumina (CaO/MgO/ γ-Al2O3 Dalam Reaktor Fluidized Bed

    Directory of Open Access Journals (Sweden)

    Niar Kurnia Julianti

    2014-09-01

    Full Text Available Biodiesel merupakan salah satu energi alternatif pengganti bahan bakar fosil dari hasil reaksi transesterifikasi minyak nabati dengan metanol. Proses pembuatan biodiesel selama ini menggunakan katalis homogen NaOH atau KOH yang memiliki kelemahan terbentuknya produk samping berupa sabun dan rumitnya pemisahan produk biodiesel dengan katalis. Maka dari itu, mulai dikembangkan katalis heterogen. Penelitian ini mengembangkan katalis berpromotor ganda berpenyangga y-alumina (CaO/MgO/y-Al2O3 dalam reaktor fluidized bed. Pembuatan katalis melalui metode presipitasi CaO dan MgO pada y-Al2O3 serta asam asetat sebagai larutan precursor. Kemudian, katalis dioven selama 12 jam pada suhu 110C dan dikalsinasi pada suhu 700 C selama 5 jam. Katalis yang diperoleh digunakan untuk proses transesterifikasi dengan ratio molar minyak metanol 1:36; variabel massa katalis 4, 7, 10, 13, 16 gram; laju alir reaktan 4, 7, 10, 13, 16 ml/menit; dan suhu 125, 150, 175, 200, 225 C. Dimana yield dan % konversi terbaik dari penelitian diperoleh sebesar 0,642 gr biodiesel/gr minyak dan 63,975% pada massa katalis 16 gram, suhu 225 C dan laju alir reaktan 4 ml/menit.

  7. PENENTUAN KOEFISIEN DISPERSI ATMOSFERIK UNTUK ANALISIS KECELAKAAN REAKTOR PWR DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Pande Made Udiyani

    2015-03-01

    Full Text Available Atmosfer merupakan pathway penting pada perpindahan radionuklida yang lepas dari Pembangkit Listrik Tenaga Nuklir (PLTN ke lingkungan dan manusia. Penerimaan dosis pada lingkungan dan manusia dipengaruhi oleh sourceterm dan kondisi tapak PLTN. Untuk mengetahui penerimaan dosis lingkungan untuk PLTN di Indonesia, maka diperlukan nilai koefisien dispersi untuk tapak potensial yang dipilih. Model perhitungan dalam penelitian ini menggunakan model yang diterapkan pada paket program pada modul ATMOS dan CONCERN dari PC-Cosyma yaitu model perhitungan segmented plume model. Perhitungan dilakukan untuk PLTN tipe PWR kapasitas 1000 MWe berbahan bakar UO2, postulasi kejadian untuk kecelakaan DBA, kondisi tapak kasar, untuk 6 tapak contoh tapak Semenanjung Muria, Pesisir Banten, dan tapak yang didominasi oleh stabilitas cuaca C,D,E, dan F. Koefisien dispersi dihitung untuk 8 kelompok nuklida produk fisi yang lepas dari PLTN yaitu: kelompok gas mulia, lantanida, logam mulia, halogen, logam alkali, tellurium, cerium, dan kelompok stronsium & barium. Perhitungan input menggunakan paket program ORIGEN-2 dan Arc View untuk penyiapan input perhitungan. Hasil pemetaan untuk parameter dispersi maksimum rerata diperoleh pada jarak radius 800 m dari sumber lepasan untuk nuklida dari kelompok logam mulia, logam alkali dan kelompok nuklida cerium. Parameter dispersi untuk Tapak Muria maksimum 1,53E-04 s/m3, Tapak Serang adalah 1,40E-03 s/m3, tapak dengan stabilitas C: 1,72E-04 s/m3, stabilitas D: 1,40E-04 s/m3, Stabilitas E: 1,07E-04 s/m3, dan tapak dengan stabilitas F : 2,14E-05 s/m3. Kata kunci: koefisien dispersi, atmosferik, PWR, kecelakaan, Indonesia   The atmosphere is an important pathway in the migration of radionuclides transport from the Nuclear Power Plant (NPP to the environment and humans. The dose accepted in the environment and humans is influenced by the sourceterm and NPP siting condition. Distribution of radionuclides in the atmosphere is determined

  8. PENJERAPAN GAS CO HASIL PEMBAKARAN SAMPAH MENGGUNAKAN SORBENT TERMODIFIKASI DALAM REAKTOR FIXED BED

    Directory of Open Access Journals (Sweden)

    Mariana Mariana

    2013-11-01

    Full Text Available ADSORPTION OF CO FROM WASTE COMBUSTION USING MODIFIED SORBENT IN A FIXED BED REACTOR. Gases produced by garbage burning consist of dangerous gases such as CO, SO2 and other gases. Technology for reducing dangerous gases from incinerator outlet can be done by using a dry or wet process. The dry process is more economical process because of simple process, easy maintenance and no liquid waste as product. However, the weakness of the dry process is low absorption conversion and low gas removal efficiency. One way to overcome these problems is to use sorbent which has high reactivity. An inexpensive sorbent that commonly used is Ca(OH2. The aim of this research was to increase the reactivity of Ca(OH2 sorbent by using diatomaceous earth and compost as a source of silica and biosorbent, respectively. Diatomaceous earth contains CaO, SiO2 and Al2O3 and compost contains bacteria as a biosorbent that can convert CO to CO2 and CH4. The reaction between SiO2 and Ca(OH2 would form calcium silicate hydrate (CaO.SiO2.2H2O that has a high porosity and reactivity. The results showed that the reactivity of Ca(OH2 sorbent increased by addition of diatomaceous earth and compost. The results also showed that the sorption of CO gas increases with increasing of height of sorbent bed and temperature. The highest CO gas sorption was obtained at temperature of 150oC and sorbent bed height of 6 cm using the modified sorbent with Ca(OH2/DE/compost ratio of 3:1:1. Gas hasil pembakaran sampah terdiri dari gas-gas yang berbahaya seperti CO, SO2 dan lain sebagainya. Teknologi penghilangan gas-gas tersebut dapat dilakukan dengan menggunakan proses kering maupun proses basah. Penghilangan dengan proses kering lebih ekonomis karena sederhana, mudah pemeliharaan dan tidak menghasilkan limbah cair. Namun demikian, kelemahan proses kering adalah konversi absorpsi rendah dan efisiensi penyisihan  gas relatif kecil. Salah satu cara mengatasi masalah tersebut di atas adalah dengan

  9. UNJUK KERJA REAKTOR PLASMA DIELECTRIC BARRIER DISCHARGE UNTUK PRODUKSI BIODIESEL DARI MINYAK KELAPA SAWIT

    Directory of Open Access Journals (Sweden)

    Ardian Dwi Yudhistira

    2013-10-01

    Full Text Available Biodiesel is one of alternative renewable energy source to substitute diesel fuel. Various biodiesel productionprocesses through transesterification reaction with a variety of catalysts have been developed by previousresearcher. This process still has the disadvantage of a long reaction time, and high energy need. DielectricBarrier Discharge (DBD plasma electro-catalysis may become a solution to overcome the drawbacks in theconventional transesterification process. This process only needs a short time reaction and low energy process.The purpose of this study was to assess the performance of DBD plasma rector in making biodiesel such as: theeffect of high voltage electric value, electrodes gap, mole ratio of methanol / oil, and reaction time. TheResearch method was using GC-MS (Gas Cromatography-Mass Spectrofotometry and FTIR (FourierTransform Infrared Spectrofotometry and then it will be analysed the change of chemical bond betweenreactant and product. So, the reaction mechanism can be predicted. Biodiesel is produced using methanol andpalm oil as reactants and DBD plasma used as reactor in batch system. Then, reactants contacted by highvoltage electric. From the results of this research can be concluded that the reaction mechanism occurs in theprocess is the reaction mechanism of cracking, the higher of electric voltage and the longer of reaction time leadto increasing of product yield. The more of mole ratio of methanol / oil and widening the gap between theelectrodes lead to decreased product yield. From this research, product yield maksimum is 89,8% in the variableof rasio mol metanol/palm oil 3:1, voltage 10 kV, electrode gap 1,5 cm, and reaction time 30 seconds.

  10. Pembuatan Biodiesel dari Minyak Goreng Bekas (Jelantah) Menggunakan Reaktor Menbran (Variasi Rasio Molar Umpan dan Konsentrasi Katalis)

    OpenAIRE

    Kalsum, Ummi; Syarfi, Syarfi; Herman, Syamsu

    2015-01-01

    Membrane reactor is an alternative technology that is used in the manufacture of biodiesel, one of the advantages that the reaction and separation process takes place in a single stage simultaneous. This research aims to study the effect of the variation of the catalyst and mole ratio feed waste cooking oil- methanol in biodiesel production, transesterification process which was held in a membrane reactor with a variation of the mole ratio of waste cooking oil - methanol 1:12, 1:16, and 1:20,...

  11. INVESTIGASI TRANSIEN TEKANAN DAN TEMPERATUR SUNGKUP REAKTOR AP1000 DALAM KECELAKAAN SBO DENGAN SET-POINT TEKANAN PENGGUYURAN BERBEDA

    Directory of Open Access Journals (Sweden)

    Hendro Tjahjono

    2015-03-01

    AP1000 reactor applying external cooling concept to anticipate the increase in pressure due to Station Black Out (SBO. Disposal mechanism of decay heat conducted through the Passive Residual Heat Removal System (PRHRS to In-containment Refueling Water Storage Tank (IRWST and subsequently forwarded to the reactor containment. Containment is externally cooled through natural convection in the air gap and through evaporation cooling water poured on the outer surface of the containment wall when the pressure attaints 1.7 bars according to the applied pressure set-point. With this mechanism, the pressure will increase until it reaches certain maximum value and then decrease when containment cooling already begun effectively. The purpose of this study was to determine the effect of the set-point to the maximum pressure and temperature reached. The utilized method is to perform simulations using Matlab-07 model of analytical calculations based on a transient state that is capable of estimating the power of heat evacuated and the pressure in the containment. The simulation results show the pattern of pressure and temperature transient rises to a maximum and drops back to a value that is relatively constant. With the set-point variation ranging from 1.7 bars to 5 bars, the maximum pressure varies from 3.5 bars to 5 bars and the maximum temperature varies from 117 °C to 125 °C. It can be concluded that with increasing the set-point pressure of starting the external cooling with water, the maximum pressure and temperature increase. Keywords: Transient pressure, containment external cooling set-point, AP1000, SBO.

  12. ANALISIS PERUBAHAN MASSA BAHAN FISIL DAN NON FISIL DALAM TERAS PWR 1000 MWe DENGAN ORIGEN-ARP 5.1

    Directory of Open Access Journals (Sweden)

    Anis Rohanda

    2015-03-01

    Full Text Available Teras reaktor merupakan tempat terjadinya reaksi pembelahan (fisi yang terkendali. Komponen reaktor seperti bahan bakar, kelongsong (cladding dan air pendingin memiliki peranan penting dalam keberlangsungan reaksi fisi. Reaksi fisi mengakibatkan terbentuknya sejumlah nuklida hasil fisi dan hasil aktivasi. Hasil fisi berasal dari reaksi tangkapan neutron termal dengan bahan fisil sedangkan hasil aktivasi berasal dari interaksi bahan non fisil seperti material kelongsong dan pendingin oleh neutron dan gamma. Pada setiap pengoperasian suatu reaktor, informasi perubahan massa bahan fisil dan non fisil sangat berguna untuk manajemen bahan bakar dalam teras, seperti pengaturan reaktivitas, optimasi dan pemuatan bahan bakar. Untuk itu perlu dilakukan penelitian mengenai perubahan bahan fisil dan non fisil tersebut dalam teras reaktor. Hal ini dapat dilakukan dengan mengamati perubahan massa dari material dalam teras reaktor. Penelitian ini memiliki tujuan untuk mengetahui perubahan massa unsur penyusun material dalam teras, seperti massa dari unsur penyusun elemen bahan bakar nuklir, kelongsong dan air pendingin setelah digunakan dalam teras. Dari perubahan massa tersebut dapat diketahui fraksi bakar atau tingkat konsumsi bahan bakar yang digunakan. Penelitian dilakukan pada basis reaktor PLTN tipe PWR buatan pabrikan asal Amerika Serikat berdaya 1000 MWe dengan menggunakan code penghitung inventori hasil fisi ORIGEN-ARP 5.1, yaitu versi terbaru dari ORIGEN dengan library khusus reaktor daya. Hasil analisis menunjukkan bahwa bahan fisil U-235 mengalami pengurangan massa hingga 58% atau lebih dari separuhnya dari massa U-235 awal untuk tiap kali siklus operasi. Bahan fertil U-238 hanya mengalami pengurangan massa sekitar 2% dari massa awalnya tiap kali siklus operasi. Lain halnya dengan bahan non fisil yang mengalami perubahan massa yang berbeda-beda untuk tiap kali siklus operasinya yang tergantung pada tampang lintang aktivasi serta laju peluruhan dan

  13. PEMBUATAN BAHAN BAKU SPREADS KAYA KAROTEN DARI MINYAK SAWIT MERAH MELALUI INTERESTERIFIKASI ENZIMATIK MENGGUNAKAN REAKTOR BATCH [Preparation of Red Palm Oil Based-Spreads Stock Rich in Carotene Through Enzymatic Interesterification in Batch-type Reactor

    Directory of Open Access Journals (Sweden)

    Nur Wulandari1,2

    2012-12-01

    Full Text Available Enzymatic interesterification of red palm oil (a mixture of red palm olein/RPO and red palm stearin/RPS in 1:1 weight ratio and coconut oil (CNO blends of varying proportions using a non-specific immobilized Candida antartica lipase (Novozyme 435 was studied for the preparation of spread stock. The interesterification reaction was held in a batch-type reactor. Two substrate blends were chosen for the production of spread stock i.e. 77.5:22,5 and 82.5:17.5 (RPO/RPS:CNO, by weight through enzymatic interesterification in three different reaction times (2, 4, and 6 hours. The interesterification reactions were conducted at 60°C, 200 rpm agitation speed and 10% of Novozyme 435. The interesterified products were evaluated for their physical characteristics (slip melting point or SMP and solid fat content or SFC and chemical characteristics (carotene retention, moisture content, and free fatty acid/FFA content. All of the interesterified products had lower SFC and SMP as compared to the initial blends. The SMP and SFC increased in longer reaction times. The SMP ranged from 30.8°C to 34.9°C. The carotene retention ranged from 74.80% to 81.08%, while the moisture content and FFA content increased in longer reaction times. The interesterified products had desirable physical properties for possible use as a spread stock rich in carotene.

  14. Kajian Tekno-ekonomi Reaktor Inovatif Iris-350

    OpenAIRE

    Lumbanraja, Sahala Maruli; Rijanti, Arum Puni; Bastori, Imam

    2005-01-01

    THE TECHNO-ECONOMIC STUDY OF INNOVATIVE REACTOR IRIS-350. Disturbance of security of electricity supply in Indonesia, especially in Jawa-Madura-Bali grid system should be addressed wisely. The disturbance in electricity supply maybe resulted from the rise of hydrocarbon fuel prices as well as only a few of power plants in operation. This problem may impose negative effect to the national socio economic system. NPP may become one of viable options to support the security of electricity supply,...

  15. Analisis Dimensional Reaktor Berpengaduk Statis untuk Produksi Biodiesel

    Directory of Open Access Journals (Sweden)

    Akhmad Irfan

    2016-10-01

    Full Text Available Biodiesel production can be done using static mixing reactor (SMR. The production by this method requires less energy than blade agitator. However, the use of elements in the helix-shaped stirrer reactors causing large pressure drop. The other factors that affect the flow in the SMR can be determined using dimensional analysis. Dimensional analysis can be used to eliminate the variables that are not required so that can be done to optimize the energy used in the SMR design. The variables that influence the pressure drop (ΔP in the SMR can be formulated into mathematical equation as: Total irreversibility due to the use of a static mixer in the SMR tested is 0.237 W.

  16. Procedure to determine the optimal main primary coolant pump parameters of the FRG-1 reactor. P.1: Development concept, optimization criteria and general logical structure of the procedure; Verfahren zur Bestimmung der optimalen Kenndaten der Hauptprimaerumwaelzpumpe nach der Kernkompaktierung des Reaktors FRG-1. T.1: Entwicklungskonzept, Optimierungskriterien und allgemeine logische Struktur des Verfahrens

    Energy Technology Data Exchange (ETDEWEB)

    Pihowicz, W. [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Zentralabteilung Forschungsreaktoren

    1998-12-31

    First a development concept of the procedure was derived. Following this concept the procedure has to be derived stepwise, i.e. on subsequent logical levels. Furthermore, the report contains the results of the first two logical levels. On the first (basic) level the optimization criteria had been formulated. The general logical structure of the procedure results from the second logical level (macro level) of the evaluation process. This structure consists of four determination blocks, one identification unit and some determination elements as well as their logical interconnections in the form of decision and result units. The blocks serve for the realization of the closed and composed partial tasks of the procedure. They themselves form the complicated but not yet deviced partial structures, which again are the logical connections of the determination elements. In contrast to the blocks all determination elements are simple enough, so that their direct mathematical determination becomes possible. They serve for the solution of simple partial tasks. (orig.) [Deutsch] Zuerst wurde ein Konzept zur Entwicklung des Verfahrens erstellt. Nach dem Konzept soll das Verfahren stufenweise, auf nacheinander folgenden logischen Ebenen abgeleitet werden. Ausserdem enthaelt die Abhandlung noch die auf den zwei anfaenglichen logischen Ebenen des Entwicklungsprozesses erzielten Resultate. Auf der ersten Ebene (Grundebene) wurden die Optimierungskriterien formuliert. Die allgemeine logische Struktur des Verfahrens ergibt sich als Resultat der zweiten logischen Ebene (Makroebene) des Entwicklungsprozesses. Diese Struktur setzt sich aus vier Bestimmungsbloecken, einer Identifikationseinheit und einigen Bestimmungselementen sowie ihrer logischen Verknuepfung in Form der Entscheidungs- und Ergebniseinheiten zusammen. Die Bloecke dienen zur Realisierung der geschlossenen und zusammengesetzten Teilaufgaben des Verfahrens. Sie bilden selbst die komplizierten, jedoch noch nicht abgeleiteten Teilstrukturen, die wieder die logischen Verbindungen der Bestimmungselemente sind. Im Unterschied zu den Bloecken sind alle Bestimmungselemente ausreichend elementar, so dass ihre direkte mathematische Erfassung schon moeglich wird. Sie dienen zur Loesung der einfachen Teilaufgaben. (orig.)

  17. SAFIRA. Sub-project B 1.3: Development of coupled in-situ reactors and optimisation of the geochemical processes in the discharge of different in situ reactor sytems. Final report; SAFIRA. Teilprojekt B 1.3: Entwicklung von gekoppelten in situ-Reaktoren und Optimierung der geochemischen Prozesse im Abstrom von verschiedenen in situ-Reaktor-Systemen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Dahmke, A.; Schaefer, D.; Koeber, R.; Plagentz, V.

    2002-12-01

    The Bitterfeld ground water is contaminated with many different pollutants over a large area. Long-term measures like reactive barriers for purification are required. However, groundwater contaminated with multiple contaminants cannot be purified by a single reactive material; for this reason, the effectivity of combinations of different reactive materials was investigated. Of the combinations investigated, reducing iron and activated carbon connected in series was the most effective: The iron will remove the reducible chlorinated hydrocarbons, while the rest of the contaminants are adsorbed to the activated carbon. Iron and ORC was another interesting option, but the combination of iron and activated carbon was found to be the most favourable option. Until a better method is available, it is recommended to connect iron and activated carbon in parallel for removing contaminant mixtures. Directly behind reactive iron barriers (also when combined with activated carbon), the limiting values of the Freshwater Ordinance for Fe(II) and pH are exceeded. Directly behind ORC reactors, the limiting values for Mg and pH are exceeded. Investigations in the outflow of these reactive materials showed that the high pH values are buffered by contact with the aquifer material to values typical of aquifers, which usually are below the limiting values of the Freshwater Ordinance. However, as the buffer capacity of the soil is exhausted, a zone with a higher pH starts to grow in the aquifer. The growth of this zone depends on the pH and on the aquifer material. Especially in soils as found at Bitterfeld, with a high concentration of organic matter, we find long-term desorption of pollutants from the aquifer materials which will burden the purified water leaving the water treatment system and prohibit its utilization. [German] Der Grundwasserleiter im Raum Bitterfeld ist grossraeumig mit vielen verschiedenen Substanzen kontaminiert. Aufgrund der grossraeumigen Erstreckung kommen nur langfristig kostenguenstige passive Massnahmen wie reaktive Barrieren zur Sanierung in Frage. Grundwasser, das mit mehreren und unterschiedlich reagierenden Stoffen kontaminiert ist, kann jedoch nicht mit Hilfe eines einzelnen reaktiven Materials gereinigt werden, daher wurde die Effektivitaet von Kombinationen unterschiedlicher reaktiver Materialien zur Sanierung untersucht. Von den untersuchten Kombinationen erwies sich die Hintereinanderschaltung von reduzierendem Eisen und Aktivkohle als besonders effektiv. Reduzierbare chlorierte Kohlenwasserstoffe werden im Eisen entfernt, die verbleibenden Kontaminanten adsorbieren auf der Aktivkohle. Auch die Hintereinanderschaltung von Eisen und Sauerstoff abgebenden ORC, in denen ein aerober mikrobieller Abbau statt findet, ist zur Entfernung von Mischkontaminationen geeignet. Eine Kostenschaetzung zeigt, dass die Kombination von Eisen und Aktivkohle in Abhaengigkeit von der Zusammensetzung der Kontamination guenstiger als Aktivkohle allein sein kann und generell guenstiger als die Kombination von Eisen und ORC ist. Ohne ein guenstigeres Verfahren zum Einbringen von Sauerstoff in den Aquifer wird die Hintereinanderschaltung von Eisen und Aktivkohle zur Sanierung von Mischkontaminationen empfohlen. Im direkten Abstrom von reaktiven Eisenbarrieren (auch in Kombination mit Aktivkohle) sind die Grenzwerte fuer Fe(II) und pH entsprechend der Trinkwasserverordnung ueberschritten. Im Abstrom von ORC-Reaktoren werden die zulaessigen Werte fuer Mg und pH ueberschritten. Untersuchungen im Abstrom dieser reaktiven Materialien zeigen, dass die hohen pH-Werte durch den Kontakt mit dem Aquifermaterial auf Aquifer-typische Werte gepuffert werden, die ueblicherweise unter den Grenzwerten der Trinkwasserverordnung liegen. Mit Erschoepfen der Pufferkapazitaet des Bodens breitet sich jedoch eine Zone mit erhoehtem pH-Wert im Aquifer aus. Die Geschwindigkeit dieser Ausbreitung haengt vom pH-Wert und dem Aquifermaterial ab. Gerade fuer sehr Organik reiche Boeden wie in Bitterfeld wird auch eine lange anhaltende Desorption von Schadstoffen aus dem Aquifermaterial beobachtet, durch die das saubere Wasser, das die Sanierungsanlage verlaesst, wieder mit Schadstoffen beladen wird, was zu einer anhaltenden Nutzungseinschraenkung fuehrt. (orig.)

  18. Analisis Computational Fluid Dynamics untuk Perancangan Reaktor Gasifikasi Sekam Padi Tipe Downdraft

    Directory of Open Access Journals (Sweden)

    Dziyad Dzulfansya

    2014-10-01

    Full Text Available Rice husk is one of biomass type which can be utilized as gasification’s feedstock for producing combustible gas which can be used as fuel in internal combustion engine. The objective of this research was to obtain the best design of small scale rice husk gasifier from among geometry scenarios by applying computational fluid dynamics method. The geometry scenarios used in this study were angle of throat 70O, 80O, and 90O, and also angle of nozzel 10O and 20O. The softwares used in this study were Gambit 2.4.6 (meshing 3D model and Ansys Fluent 13.0 (simulation. The reactions involved in gasification (3 heterogeneous reactions and 6 homogeneous reactions were solved by finite rate/Eddy dissipation model. Results of simulation showed that gasifier with angle of throat 90O and angle of nozzel 10O produced the highest heating value of gas with volume fraction of CO, H2, and CH4 is 14.49%, 9.65%, and 2.39% respectively. This result showed reasonable agreement with experimental data from other researchers on rice husk gasification.

  19. PENGOLAHAN LIMBAH CAIR ORGANIK SECARA BIOLOGI MENGGUNAKAN REAKTOR ANAEROBIK LEKAT DIAM

    OpenAIRE

    Indriyati, Indriyati

    2018-01-01

       Organic waste water can be treated biolocally by using anaerobic fixed bed reactor. Fixed bed reactor is bioreactor which is compleeted with support material inside reactor for bacteria fixation in the surface area of support material. The benefit of using this kind of technology are it needs low energy, low nutrien, low sludge production and could treat high organic concentraion waste water.   The support material  has important role in the  Fixed Bed reactor performance, therefore it mus...

  20. Start-up and Performance Characteristics of a Trickle Bed Reaktor Degrading Toluene

    Czech Academy of Sciences Publication Activity Database

    Misiaczek, O.; Paca, J.; Halecký, M.; Gerrard, A. M.; Sobotka, Miroslav; Soccol, C. R.

    2007-01-01

    Roč. 50, č. 5 (2007), s. 871-877 ISSN 1516-8913 Grant - others:GA ČR(CZ) GA104/05/0194 Institutional research plan: CEZ:AV0Z50200510 Source of funding: V - iné verejné zdroje Keywords : biotrickling filter * constructed mixed population * toluene Subject RIV: EE - Microbiology, Virology Impact factor: 0.349, year: 2007

  1. Pembuatan Biodiesel dari Cpo Off Grade Menggunakan Reaktor Membran (Variasi Katalis dan Fraksi Mol Umpan

    OpenAIRE

    Vovilya, Enang '; ', Syarfi '; Saputra, Edy '

    2015-01-01

    Membrane reactor is an alternative technology that is used in the manufacture of biodiesel, one of the advantages that the reaction and separation process takes place in a single stage simultaneous. This research aims to study the effect of the variation of the catalyst and mole ratio feed CPO off grade - methanol in biodiesel production, a pretreatment process performed on the raw materials that aim to reduce the FFA content CPO off grade, the results obtained pretreatment FFA content of 0.7...

  2. 1

    Science.gov (United States)

    Fotiou, Maria; Fotakis, Charalambos; Tsakoumaki, Foteini; Athanasiadou, Elpiniki; Kyrkou, Charikleia; Dimitropoulou, Aristea; Tsiaka, Thalia; Chatziioannou, Anastasia Chrysovalantou; Sarafidis, Kosmas; Menexes, George; Theodoridis, Georgios; Biliaderis, Costas G; Zoumpoulakis, Panagiotis; Athanasiadis, Apostolos P; Michaelidou, Alexandra-Maria

    2018-03-06

    Maternal diet may influence offspring's health, even within well-nourished populations. Amniotic fluid (AF) provides a rational compartment for studies on fetal metabolism. Evidence in animal models indicates that maternal diet affects AF metabolic profile; however, data from human studies are scarce. Therefore, we have explored whether AF content may be influenced by maternal diet, using a validated food-frequency questionnaire and implementing NMR-based metabolomics. Sixty-five AF specimens, from women undergoing second-trimester amniocentesis for prenatal diagnosis, were analysed. Complementary, maternal serum and urine samples were profiled. Hierarchical cluster analysis identified 2 dietary patterns, cluster 1 (C1, n = 33) and cluster 2 (C2, n = 32). C1 was characterized by significantly higher percentages of energy derived from refined cereals, yellow cheese, red meat, poultry, and "ready-to-eat" foods, while C2 by higher (P cereals, vegetables, fruits, legumes, and nuts. 1 H NMR spectra allowed the identification of metabolites associated with these dietary patterns; glucose, alanine, tyrosine, valine, citrate, cis-acotinate, and formate were the key discriminatory metabolites elevated in C1 AF specimens. This is the first evidence to suggest that the composition of AF is influenced by maternal habitual dietary patterns. Our results highlight the need to broaden the knowledge on the importance of maternal nutrition during pregnancy.

  3. 1

    Science.gov (United States)

    Dekkers, Ilona A; de Heer, Paul; Bizino, Maurice B; de Vries, Aiko P J; Lamb, Hildo J

    2018-03-08

    Renal steatosis (fatty kidney) is a potential biomarker for obesity-related renal disease; however, noninvasive assessment of renal fat content remains a technical challenge. To evaluate reproducibility and explore clinical application of renal metabolic imaging for the quantification of renal triglyceride content (TG) using proton magnetic resonance spectroscopy ( 1 H-MRS). Reproducibility and clinical cohort study. Twenty-three healthy volunteers (mean age 30.1 ± 13.4 years) and 15 patients with type 2 diabetes mellitus (T2DM) (mean age 59.3 ± 7.0 years). 3T, single-voxel point resolved spectroscopy (PRESS). Intra- and interexamination reproducibility of renal TG was assessed in healthy volunteers, and compared to T2DM patients. Intraexamination differences were obtained by repeating the 1 H-MRS measurement directly after the first 1 H-MRS without repositioning of the subject or changing surface coil and measurement volumes. Interexamination variability was studied by repeating the scan protocol after removal and replacement of the subject in the magnet, and subsequent repositioning of body coil and measurement volumes. Reproducibility was determined using Pearson's correlation and Bland-Altman analyses. Differences in TG% between healthy volunteers and T2DM patients were assessed using the Mann-Whitney U-test. After logarithmic (log) transformation, both intraexamination (r = 0.91, n = 19) and interexamination (r = 0.73, n = 9) measurements of renal TG content were highly correlated with the first renal TG measurements. Intraexamination and interexamination limits of agreement of renal log TG% were respectively [-1.36%, + 0.84%] and [-0.77%, + 0.62%]. Backtransformed limits of agreement were [-0.89%,+0.57%] and [-0.55%, + 0.43%] multiplied by mean TG for intra- and interexamination measurements. Overall median renal TG content was 0.12% [0.08, 0.22; 25th percentile, 75th percentile] in healthy volunteers and 0.20% [0.13, 0

  4. 1

    Science.gov (United States)

    Shi, Ting; Zhu, MengTing; Chen, Yi; Yan, XiaoLi; Chen, Qian; Wu, XiaoLin; Lin, Jiangnan; Xie, Mingyong

    2018-03-01

    Proton nuclear magnetic resonance ( 1 H NMR) and chemometrics were employed to detect the adulteration of camellia oil (CAO) with 3 different cheap vegetable oils. With the intensity of 15 selected 1 H NMR signals as input variables, principal component analysis (PCA) showed good group clustering results for pure and nonpure CAO, but unsatisfied identification accuracy for the adulterated oil types, indicating relatively small difference among those oils. Whereas these difference could be revealed by orthogonal projection to latent structures discriminant analysis (OPLS-DA), with identification accuracy higher than 90%. Partial least squares (PLS) was further applied for the prediction of adulteration level in CAO. With less than 6 variables screened out by variable importance in the projection (VIP) scores as potential key markers, the developed PLS models showed better accuracy. The prediction results for 10 hold-out samples also confirmed that this method was accurate and fast for the detection of CAO adulteration. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. 1

    Science.gov (United States)

    Kresse, B; Becher, M; Privalov, A F; Hofmann, M; Rössler, E A; Vogel, M; Fujara, F

    2017-04-01

    Field-Cycling (FC) NMR experiments were carried out at 1 H Larmor frequencies down to about 3Hz. This could be achieved by fast switching a high polarizing magnetic field down to a low evolution field which is tilted with respect to the polarization field. Then, the low frequency Larmor precession of the nuclear spin magnetization about this evolution field is registered by means of FIDs in a high detection field. The crucial technical point of the experiment is the stabilization of the evolution field, which is achieved by compensating for temporal magnetic field fluctuations of all three spatial components. The paper reports on some other basic low field experiments such as the simultaneous measurement of the Larmor frequency and the spin-lattice relaxation time in such small fields as well as the irradiation of oscillating transversal magnetic field pulses at very low frequencies as a novel method for field calibration in low field FC NMR. The potential of low field FC is exemplified by the 1 H relaxation dispersion of water at frequencies below about 2kHz stemming from the slow proton exchange process. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. 1

    Science.gov (United States)

    Zhao, Lijuan; Hu, Jerry; Huang, Yuxiong; Wang, Hongtao; Adeleye, Adeyemi; Ortiz, Cruz; Keller, Arturo A

    2017-01-01

    It is imperative to study the interaction of nanoparticles residuals with crop plants in agricultural soils, due to the increased application of nanotechnology in agriculture. So far, a few studies have focused on the impact of nanoparticles on fruit quality and nutritional supply. In this work, a thorough and comprehensive analysis of metabolite changes of cucumber fruits from plants under nano-Cu stress was possible through the use of both 1 H NMR and GC-MS. The results of supervised partial least-squares discriminant analysis from both platforms showed that cucumber fruit extracts samples were clearly grouped based on the nano-Cu level in soil. This indicates that the fruit metabolite profile was influenced by exposure to nano-Cu. GC-MS data showed concentrations of some sugars, organic acids, amino acids, and fatty acids were increased or decreased by nano-Cu. Several metabolites, such as methylnicotinamide (MNA), trigonelline, imidazole, quinolinate were only detected and quantified by 1 H NMR. Our results showed that combining the two platforms provided a comprehensive understanding about the metabolites (nutrient supply) changes in cucumber fruits impacted by exposure to nano-Cu. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  7. 1

    Science.gov (United States)

    Francini, Alessandra; Romeo, Stefania; Cifelli, Mario; Gori, Daniele; Domenici, Valentina; Sebastiani, Luca

    2017-04-15

    Dry and fresh apples have been studied monitoring their polyphenolic profiles through 1 H NMR, antioxidant capacity and total polyphenol content. Six ancient and underutilized apple varieties (Mantovana, Mora, Nesta, Cipolla, Ruggina, Sassola) and a commercial one (Golden Delicious) were dried with an air-drying system at 45°C for 19h. Although some of their polyphenol constituents were lost during drying, the antioxidant capacity of some apple varieties remained higher compared to Golden Delicious. This result is very important for ancient and underutilized varieties that are not consumed on large scale as fresh product since they have low attractiveness, due to their ugly appearance. Combining quantitative NMR spectroscopy with principal component analysis we have identified and quantified several polyphenols (such as catechin, epicathechin, and chlorogenic acid) that are important to establish the nutraceutical value of the different investigated apple varieties. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. ANALISIS KUAT SUMBER NEUTRON DAN PERHITUNGAN LAJU DOSIS NEUTRON TERAS AWAL RDE

    Directory of Open Access Journals (Sweden)

    Suwoto Suwoto

    2017-02-01

    Full Text Available Teras reaktor RDE (Reaktor Daya Eksperimental berbentuk silinder non anular, mengadopsi teknologi HTGR (High Temperature Gas-cooled Reactor berbahan bakar kernel partikel berlapis TRISO dalam bentuk bola (pebble dan berpendingin gas helium. Desain teras reaktor RDE ini mengadopsi teknologi reaktor temperatur tinggi HTGR dengan keselamatan inherent pasif yang sangat aman. Temperatur keluaran panas gas helium teras reaktor RDE dirancang pada kisaran 700°C dengan temperatur masukan sekitar 250°C. Di samping menghasilkan listrik, reaktor RDE didisain menghasilkan panas temperatur tinggi yang dapat digunakan untuk keperluan kogenerasi lainnya (penelitian panas proses lainnya. Bahan bakar pada RDE berbentuk bola yang berisikan kernel partikel berlapis TRISO yang berupa uranium oksida (UO2 berpengkayaan 17%. Lapisan TRISO terdiri 4 lapisan yaitu lapisan karbon penyangga berpori, lapisan karbon pirolitik bagian dalam (IPyC, Inner Pyrolitic Carbon, lapisan Silikon Karbida (SiC dan lapisan pirolitik karbon bagian luar (OPyC, OuterPyrolitic Carbon. Analisis kuat sumber dan perhitungan awal laju dosis neutron pada teras RDE dilakukan menggunakan program Monte Carlo MCNP5v1.2. Pemodelan heterogenitas ganda pada bahan bakar kernel partikel berlapis TRISO dan pada bahan bakar bola pada teras RDE. Dengan memanfaatkan program EGS99304, jumlah struktur group energi yaitu 640 (SAND-II group structure digunakan dalam perhitungan spektrum neutron pada reaktor RDE. Teras reaktor RDE dibagi dalam 100 zona (10 arah radial dan 10 arah aksial. Analisis hasil perhitungan menunjukkan bahwa kuat sumber neutron reaktor RDE sebesar 8,47027X1017 neutron/sekon. Distribusi laju dosis neutron ditentukan menggunakan faktor konversi fluks ke dosis neurton dari International Commission on Radiological Protection, ICRP dan NCRP. Hasil perhitungan awal laju dosis neutron dengan faktor konversi ICRP-21 dan NCRP-38 untuk pekerja radiasi pada arah radial di perisai biologis sudah

  9. Nový úkol hybridních reaktorů – likvidace jaderného odpadu

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    2009-01-01

    Roč. 57, č. 11 (2009), s. 24-a33 ISSN 0040-1064 Institutional research plan: CEZ:AV0Z20430508 Keywords : fusion * ITER * hybrid * nuclear waste * LIFE * FFTS * CFNS * SXD * FDF Subject RIV: BL - Plasma and Gas Discharge Physics

  10. Proses Hidrolisis Sampah Organik Menjadi Gula Dengan Katalis Asam

    OpenAIRE

    Zainal Arifin, Dedy Irawan

    2012-01-01

    Proses Hidrolisis merupakan satu tahap penting dari rangkaian tahapan proses produksi bioetanol berbahan baku sampah organik. Hidrolisis dengan asam klorida encer konsentrasi 0,25-1% dengan suhu divariasikan 120-180 oC dan waktu 15-120 menit. Perbandingan pereaksi 1:6 antara sampah kota dan larutan asam untuk tiap tahap hidrolisis yang dilakukan dalam sebuah reaktor sistem batch. Hasil hidrolisis berupa gula ditentukan kadarnya menggunakan metode Nelson-Somogy. Hasil analisis kadar gula menun...

  11. Pengaruh Pengadukan Dan Variasi Feeding Terhadap Pembentukan Biogas Dari Sampah Dapur Rumah Makan Pada Reaktor Batch Dengan Aktivator Feses Sapi (Bos Taurus)

    OpenAIRE

    Tri Utomo, Doron; Hadiwidodo, Mochtar; Sudarno, Sudarno

    2014-01-01

    Food waste is organic waste that is quite lot and have not good treatment now. Food waste in anaerobic treatment have potential to produce biogas with addition cow feces as an activator. Stirring is one effort to increase the production of biogas. Research has been conducted in a batch system but the results have not been produced an optimal biogas. This research use two big reactors (19 liter) and 16 small reactors (600 ml dan 500 ml). There are four parameters that were observed the biogas...

  12. Základy fúzní energetiky II - Základní fyzika fúzních reaktorů

    Czech Academy of Sciences Publication Activity Database

    Entler, Slavomír; Mlynář, Jan; Dostál, V.

    Srpen (2016), č. článku 14538. ISSN 1801-4399 Institutional support: RVO:61389021 Keywords : Nuclear fusion * fusion reactors * plasma Subject RIV: JF - Nuclear Energetics http://energetika.tzb-info.cz/elektroenergetika/14538-zaklady-fuzni-energetiky-ii-zakladni-fyzika-fuznich-reaktoru

  13. SAMPAH UNTUK ENERGI: KELAYAKAN PEMANFAATAN LIMBAH ORGANIK DARI KANTIN DI LINGKUNGAN UNDIP BAGI PRODUKSI ENERGI DENGAN MENGGUNAKAN REAKTOR BIOGAS SKALA RUMAH TANGGA

    Directory of Open Access Journals (Sweden)

    Irawan Wisnu Wardana

    2012-09-01

    Full Text Available Harga minyak yang melonjak mempengaruhi aktifitas perekonomian dunia termasuk Indonesia, hal tersebut mendorong pemerintah untuk mengembangkan energi terbarukan termasuk diantaranya biogas. Limbah-limbah kantin memiliki potensi untuk menjadi sumber energi terbarukan, yaitu biogas.Limbah sisa makanan dan aktifitas dapur dalam jumlah yang cukup dari kantin di lingkungan fakultas teknik dikumpulkan, dilakukan perlakuan seperti penghalusan dan homogenisasi, lalu tahap memasukkan substrat beserta ekstrak rumen sapi sebagai sumber bakteri anaerob kedalam batch reactor dengan penambahan air sebagai variasi. Dari hasil penelitian diperoleh kesimpulan, bahwa penambahan air mempengaruhi jumlah gas yang dihasilkan. Diketahui bahwa limbah yang ditambahkan air sebanyak 64 ml, mampu menghasilkan volume gas lebih banyak dibanding yang lainnya. Umur produksi gas mampu menghasilkan gas hingga hari ke 19. Dalam penelitian didapatkan adanya penurunan dan peningkatan produksi gas. Hal ini disebabkan adanya tahap pembentukan gas yang terjadi, mulai dari tahap hidrolisis, acidogenesis, asetogenesis, dan metanogenesis

  14. The vegetation as sink and biochemical reactor for airborne pollutants. Final report; Die Vegetation als Senke und biochemischer Reaktor fuer luftgetragene Schadstoffe. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Weissflog, L.; Wenzel, K.D. [UFZ - Umweltforschungszentrum Leipzig-Halle GmbH, Leipzig (Germany). Sektion Chemische Oekotoxikologie

    1997-06-30

    The present project involved extensive studies on the air pollution situation and interactions between organic as well as inorganic air pollutant levels and the vegetation in three east German states. Seven monitoring sites with different emission profiles were selected in Saxony-Anhalt, one typically polluted site in Saxony, and two less polluted sites in Mecklenburg-Western Pomerania. The following emitter types were found to exhibit consistent pollutant patterns: landfills receiving chloroorganic special wastes; hard-coal-fuelled firing installations; commercial charcoal plants; industry; industry - car traffic - domestic fuel combustion; car traffic. [Deutsch] Im Verlauf der Projektarbeiten wurden an sieben durch unterschiedliche Emittententypen belasteten Standorten in Sachsen-Anhalt, einem typisch belasteten Standort in Sachsen und an zwei weniger belasteten Standorten in Mecklenburg/Vorpommern umfangreiche Untersuchungen zur Immissionssituation und der Wechselwirkung der luftgetragenen anorganischen und organischen Schadstofffracht mit der Vegetation durchgefuehrt. Dabei konnten fuer folgende Emittenten charakteristische Schadstoffmuster ermittelt werden: - Deponien mit chlororganischem Sondermuell - Feuerungsanlagen fuer Steinkohle - Gewerbliche Anlagen zur Herstellung von Holzkohle - Industrie - Industrie/Kfz-Verkehr/Hausbrand - Kfz-Verkehr. (orig.)

  15. Kajian Pemilihan Sumber Mikroorganisme Solid Phase Microbial Fuel Cell (SMFC Berdasarkan Jenis dan Volume Sampah, Power Density dan Efisiensi Penurunan COD

    Directory of Open Access Journals (Sweden)

    Ganjar Samudro

    2017-06-01

    Full Text Available Mikroorganisme merupakan salah satu komponen penting dalam proses Solid Phase Microbial Fuel Cell (SMFC untuk degradasi bahan organik dan transfer elektron. Pemilihan sumber mikroorganisme menjadi metode yang paling sederhana untuk dikaji sebagai informasi awal ketersediaan dan identifikasi jenis mikroorganisme yang mendukung proses SMFC. Tujuan kajian ini adalah untuk memilih sumber mikroorganisme tanah, septic tank dan sedimen sungai yang tepat digunakan dalam proses SMFC berdasarkan jenis dan volume sampah, power density, dan efisiensi penurunan COD. Kajian ini didasarkan pada hasil penelitian menggunakan reaktor SMFC tipe single chamber microbial fuel cell dengan variabel jenis dan volume sampah , serta sumber mikroorganisme. Metode perbandingan secara kuantitatif dilakukan berdasarkan kecenderungan nilai power density dan efisiensi penurunan COD tertinggi di antara jenis dan volume sampah kantin, dedaunan dan komposit kantin-dedaunan. Hasil yang didapatkan adalah sumber mikroorganisme tanah dan sedimen sungai tepat digunakan untuk volume sampah 1/3 dan 2/3 dari volume reaktor, sedangkan sumber mikroorganisme septic tank tepat digunakan untuk volume sampah 1/3 dan 1/2 dari volume reaktor. Sumber mikroorganisme dari septic tank menunjukkan kinerja power density dan efisiensi penurunan COD yang lebih rendah dibandingkan sumber mikroorganisme tanah dan sedimen sungai.

  16. Studio 1:1

    Index Scriptorium Estoniae

    2011-01-01

    Projekteerimis- ja disainistuudiost STUDIO 1:1 (Eindhoven), mis tegeleb avaliku ruumi loomise ja selle kasutamise kujundamisega. Projektidest "Linnulinn - linn lindude segakogukonna jaoks" ja ICT kogemuskeskus "De Verdieping"

  17. WOOD 1:1

    DEFF Research Database (Denmark)

    2013-01-01

    Report from 1:1 workshop at Virserum Konsthall in May 2013 with a team of Master's students from Royal Academy of Fine Arts, School of Architecture, Dpt. 3.......Report from 1:1 workshop at Virserum Konsthall in May 2013 with a team of Master's students from Royal Academy of Fine Arts, School of Architecture, Dpt. 3....

  18. FACTORS INFLUENCING HUMAN RELIABILITY OF HIGH TEMPERATURE GAS COOLED REACTOR OPERATION

    Directory of Open Access Journals (Sweden)

    Sigit Santoso

    2016-10-01

    ABSTRAK Peran dan tindakan operator pada reaktor berpendingin gas akan berbeda dengan peran operator pada operasi tipe reaktor lain. Analisis unjuk kerja operator dan faktor yang berpengaruh dapat dilakukan secara komprehensif melalui analisis keandalan manusia(HRA. Melalui HRA dampak dari kesalahan manusia pada sistem maupun cara untuk mengurangi dampak dan frekuensi kesalahan dapat diketahui. Makalah membahas faktor yang berpengaruh pada tindakan operator, yaitu pada kejadian kecelakaan pendingin reaktor gas bersuhu tinggi-HTGR. Analisis untuk kualifikasi faktor pembentuk kinerja(PSF dilakukan berdasarkan kurva keandalan fungsi waktu, dan metode keandalan manusia yang dikembangkan berdasar pada aspek kognitif yaitu Cognitive Reliability and Error Analysis Method (CREAM. Hasil analisis berdasar kurva keandalan fungsi waktu menunjukkan komponen waktu berkontribusi positif pada peningkatan keandalan operator (PSF<1 pada kondisi semua fitur keselamatan berfungsi sesuai rancangan. Sedangkan pada metoda analisis dengan pendekatan kognitif CREAM diketahui selain faktor ketersediaan waktu, faktor pelatihan dan rancangan HMI juga berkontribusi meningkatkan keandalan operator. Faktor pembentuk kinerja keseluruhan diketahui sebesar 0,25 dengan faktor kontribusi positif dominan atau berpengaruh pada penurunan kesalahan manusia adalah ketersediaan waktu (PSF=0,01, dan faktor kontribusi negatif dominan adalah prosedur dan siklus kerja (PSF=5. Nilai PSF tersebut sebagai faktor pengali dalam perhitungan probabilitas kesalahan manusia. Analisis faktor pembentuk kinerja perlu dikembangkan pada skenario kejadian lain untuk selanjutnya digunakan untuk perhitungan dan analisis keandalan manusia yang komprehensif dan perancangan sistem interaksi manusia mesin di ruang kendali. Kata kunci: PSF, HTGR, operator, ruang kendali, keandalan manusia

  19. Penurunan Logam Timbal (Pb pada Limbah Cair TPA Piyungan Yogyakarta dengan Constructed Wetlands Menggunakan Tumbuhan Eceng Gondok (Eichornia Crassipes

    Directory of Open Access Journals (Sweden)

    Eko Siswoyo

    2015-10-01

    Full Text Available Salah satu permasalahan lingkungan yang ditimbulkan dari adanya lindi di TPA Piyungan yaitu pencemaran pada badan air, sungai dan air tanah. Untuk mengatasi permasalahan ini salah satunya dengan sistem Constructed Wetlands dengan menggunakan tumbuhah eceng gondok. Tujuan dari penelitian ini adalah untuk mengetahui tingkat penurunan konsentrasi Timbal (Pb yang terdapat dalam limbah cair TPA Piyungan dengan Constructed Wetlands menggunakan tumbuhan eceng gondok dan untuk mengetahui seberapa besar kapasitas serapan tumbuhan eceng gondok terhadap kandungan Timbal (Pb dalam limbah cair TPA Piyungan.Dalam penelitian ini digunakan reaktor yang terbuat dari kayu yang dilapisi plastik dengan ukuran 0,5 m x 1,0 m. Setiap reaktor diberi media tanah 5 cm, dan diberi tumbuhan sebanyak 14 buah. Reaktor tersebut diberi perlakuan dengan konsentrasi limbah yang bervariasi (100%, 75%, 50%, 25%, dan 0%, dan waktu pengambilan sampel (0, 3, 6, 9, 12 hari. Dengan menggunakan metode SSA (Spektrofotometri Serapan Atom.Berdasarkan pengujian diperoleh bahwa penurunan logam Pb pada limbah cair TPA Piyungan hari ke- 12, yaitu sebesar 0.0501mg/L pada konsentrasi 100%, 0.0295mg/L pada konsentrasi 75%, 0.0267mg/L pada konsentrasi 50% dan 0.0041 mg/L pada konsentrasi 25%.

  20. resources 1..1

    Indian Academy of Sciences (India)

    http://www.ias.ac.in/jgenet/OnlineResources/90/e34.pdf. Morinha F., Carvalho M., Ferro A., Guedes-Pinto H., Rodrigues R. and Bastos E. 2011 Molecular sexing and analysis of CHD1-Z and. CHD1-W sequence variations in wild common quail (Coturnix c. coturnix) and domesticated Japanese quail (Coturnix c. japonica).

  1. Agrosearch 1 Vol. 1

    African Journals Online (AJOL)

    and finance) are largely provided by the public sector. However, the performance of the public sector in ..... Table 3: Result of Exponential Model for Yield Gap of Pfs. Variables. Unstandardized coefficient. Standardized coefficient t. Sig. PF n = 170. B. Std. Error. Beta. Constant. 1.940. 0.819. 2.370. 0.019. Labour. 0.001.

  2. Agrosearch 1 Vol. 1

    African Journals Online (AJOL)

    are kept outside of the formal banking system and are often lent to group members to finance emergencies and other expenses. .... 2.4599. 1. Coefficients obtained from multiple regression analysis. Model. Unstandardized coefficients. Standard coefficients t sig. $. Std error. Beta. (Constant). 7.107. 2.272. 3.128 .002. Age.

  3. 1-1-3

    African Journals Online (AJOL)

    tertiary hyperparathyroidism with severe metabolic bone disease. Five patients presented with rapidly progressing calciphylaxis. Three patients had grossly elevated serum calcium levels (l was comatose and 1 was confused) and an emergency parathyroidectomy was performed in these patients. Other symptoms were ...

  4. Agrosearch 1 Vol. 1

    African Journals Online (AJOL)

    (p<0.05), poor access to credit (p<0.05),poor collateral status (p<0.01) and high tax levies (p<0.05) on cocoa production negatively affects welfare of Cocoa Farming Households while literacy. (p<0.1), type of land tenure system used on cocoa farm (p<0.01), price increase of produce. (p<0.01), good harvest from plantations ...

  5. Shootin1

    DEFF Research Database (Denmark)

    Toriyama, Michinori; Shimada, Tadayki; Kim, Ki Bum

    2006-01-01

    organization of shootin1 by excess shootin1 disrupted polarization, whereas repressing shootin1 expression inhibited polarization. Overexpression and RNA interference data suggest that shootin1 is required for spatially localized phosphoinositide-3-kinase activity. Shootin1 was transported anterogradely...

  6. Juba teine "1+1 = 1"

    Index Scriptorium Estoniae

    2004-01-01

    15. III Okupatsioonimuuseumis toimuva "1+1=1" teise ürituse kavast. Presentatsioonide õhtu keskendub konkreetse ruumikogemuse vahendamisele kunstis (helis, slaidi-installatsioonis, tänava-aktsioonis, skulptuuris, videos, filmis). Esinevad Cevdet Erek, Andres Lõo, Andres Kurg (arhitektuur ja interjöörid Marko Raadi filmis "Agent Sinikael") jt.

  7. Educational Modelling Language 1.1 (EML 1.1)

    NARCIS (Netherlands)

    Koper, Rob; Vogten, Hubert; Martens, Harrie

    2003-01-01

    Package contains the EML 1.1 dtd, schema and documentation as is created for the Edubox Player. It is slightly different from IMS Learning Design and provides an intermediate solution between EML 1.0 and IMD Learning Design. The Edubox Player 3.x works on EML 1.1. This package is stored for

  8. TRPV1

    DEFF Research Database (Denmark)

    Gram, Dorte X; Holst, Jens J; Szallasi, Arpad

    2017-01-01

    -1 (TRPV1) antagonists are potent anti-inflammatory agents with proven clinical safety. In rodent models of T2D, TRPV1 blockade was shown to halt disease progression and improve glucose metabolism. Thus, we propose that TRPV1 antagonists merit further study as novel therapeutic approaches...

  9. STUDI MODEL ALIRAN FLUIDA DAN PERPINDAHAN PANAS PADA PBMR.

    Directory of Open Access Journals (Sweden)

    Achmad Fatich Al-Qodri

    2013-11-01

    Full Text Available Reaktor tipe Pebble bed merupakan opsi yang menjanjikan untuk teknologi reaktor generasi mendatang dan memiliki potensi untuk memberikan pembangkitan listrik dengan efisiensi tinggi dan murah.Perpindahan panas reaktor ini menghadapi kendala akibat kompleksitas yang berkaitan dengan desain aliran panas.Dengan demikian, untuk mensimulasikan secara baik aliran dan perpindahan panas reaktor modular pebble bed ini memerlukan suatu model perpindahan panas yang berhubungan dengan radiasi serta konveksi dan konduksi panas.Dalam studi ini, suatu model dengan kemampuan untuk mensimulasikan aliran fluida dan perpindahan panas dalam teras reaktor modular pebble bed telah dikembangkan.Model ini diterapkan pada suatu personal computer (PC yang menggunakan program komputer Matlab r2008a Versi 7.1.Beberapa parameter penting aliran fluida dan perpindahan panas telah dipelajari, termasuk penurunan tekanan (pressure drop di teras reaktor, koefisien perpindahan panas, bilangan Nusselt, dan konduktivitas panas efektif pebble bahan bakar. Hasil yang diperoleh dari percobaan simulasi menunjukkan adanya suatu tekanan yang merata pada arah radial untuk suatu rasio diameter teras terhadap elemen bakar (D/d > 20 dan koefisien perpindahan panas meningkat seiring dengan peningkatan temperatur dan laju alir massa pendingin. Model ini dapat menjelaskan secara memadai fenomena aliran panas dan perpindahan panas dan kehilangan tekanan melalui friksi dalam PBMR tipe pebble bed.Kata kunci: Aliran fluida, perpindahan panas, PBMR, packed bed, penurunan tekananAbstractThe pebble bed type high temperature gas cooled nuclear reactor is a promising option for next generation reactor technology and has the potential to provide high efficiency and cost effective electricity generation. The reactor unit heat transfer poses a challenge due to the complexity associated with the thermalflow design. Therefore to reliably simulate the flow and heat transport of the pebble bed modular reactor

  10. Table 1

    African Journals Online (AJOL)

    Authorized Customer

    Then, the sample was titrated with 0.1N Sodium Hydroxide solution. The titration was continued until pink color becomes intense. Finally, the burette reading was recorded. The reading was multiplied by a factor 1.74. (Foley et al.,. 1974). 74.1 x reading. Burette protein. Percent. = . Casein: The percentage casein was.

  11. CCR1

    African Journals Online (AJOL)

    Chemokine Receptor 1 (CCR1) Derived from Viral ... the potential role and mechanism of peptide C18P derived from viral macrophage inflammatory protein ..... 4. Kauts ML, Pihelgas S, Orro K, Neuman T, Piirsoo A. CCL5/CCR1 axis regulates multipotency of human adipose tissue derived stromal cells. Stem Cell Res. 2013 ...

  12. GLP-1

    DEFF Research Database (Denmark)

    Aaboe, Kasper; Krarup, Thure; Madsbad, Sten

    2008-01-01

    and endothelial dysfunction. Enhancing incretin action for therapeutic use includes GLP-1 receptor agonists resistant to degradation (incretin mimetics) and dipeptidyl peptidase (DPP)-4 inhibitors. In clinical trials with type 2 diabetic patients on various oral antidiabetic regimes, both treatment modalities......Glucagon-like peptide 1 (GLP-1) is a gut-derived incretin hormone with the potential to change diabetes. The physiological effects of GLP-1 are multiple, and many seem to ameliorate the different conditions defining the diverse physiopathology seen in type 2 diabetes. In animal studies, GLP-1...... stimulates beta-cell proliferation and neogenesis and inhibits beta-cell apoptosis. In humans, GLP-1 stimulates insulin secretion and inhibits glucagon and gastrointestinal secretions and motility. It enhances satiety and reduces food intake and has beneficial effects on cardiovascular function...

  13. Karakterisasi Unjuk Kerja Diesel Engine Generator Set Sistem Dual Fuel Solar-Syngas Hasil Gasifikasi Briket Municipal Solid Waste (MSW Secara Langsung

    Directory of Open Access Journals (Sweden)

    Achmad Rizkal

    2017-01-01

    Full Text Available Sejalan dengan semakin banyaknya kebutuhan energi untuk dapat digunakan sebagai bahan bakar maka perlu adanya pengembangan gas biomassa sebagai bahan bakar alternatif pada motor pembakaran dalam maka akan dilakukan penelitian mengenai aplikasi sistem dual fuel gas hasil gasifikasi biomassa municipal solid waste (msw pada sistem downdraft dengan minyak solar pada motor diesel stasioner. Penelitian ini bertujuan untuk mengetahui seberapa besar solar yang tersibtitusi dengan adanya penambahan syngas yang disalurkan secara langsung. Penelitian ini dilakukan secara eksperimental dengan proses pemasukan aliran syngas yang dihasilkan downdraft municipal solid waste (MSW kedalam saluran udara mesin diesel generator set secara langsung menggunakan sistem mixer. Pengujian dilakukan dengan putaran konstan 2000 rpm dengan pembebanan bervariasi dari 200 watt sampai dengan 2000 watt dengan interval 200 watt. Bahwa produksi syngas dari reaktor gasifikasi ditambahkan sistem bypass untuk mengetahui kesesuaian antara reaktor gasifikasi dan mesin generatorset data ṁ syngas yang dibutuhkan mesin diesel, ṁ syngas yang di bypass untuk mendapatkan kesesuaian antara produksi syngas dan yang di bypass.  Data-data yang diukur dari penelitian ini menunjukkan bahwa besar nilai mass flowrate gas syngas yang dibutuhkan mesin diesel pada AFR reaktor gasifier 1,39 sebesar 0,0003748 kg/s. Mass flowrate gas syngas yang di bypass menunjukkan nilai 0 pada saat sistem dijalankan karena seluruh gas syngas masuk kedalam ruang bakar. AFR rata-rata sebesar 14,54 ,Nilai Spesifik fuel consumption (sfc mengalami peningkatan 68% dari kondisi standar single fuel , Nilai efesiensi thermal mengalami kenaikan sebesar 7% dari kondisi single fuel, Nilai daya rata-rata sebesar 2,28kW, Nilai torsi rata-rata sebesar 10,94 N.m. Solar yang tersibtitusi sebesar 48%. Nilai temperatur (coolant, mesin, oil, dan gas buang pada setiap pembebanan mengalami kenaikan.

  14. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    an ordered pair of real numbers (x, y) called its. Cartesian ... Denotes A1 X A2 X - - - Am = { ( a1, a2, - - - am)/ ai ϵAi and i=1, 2, - - -, m }. Subsets of .... Using Matrices to denote Cartesian Products of the set. G = { T, I, Z } The table of the Cartesian product G X. G is the table of first phyla generation of nine different families. X. T.

  15. RASA1

    Science.gov (United States)

    Kitajima, Shunsuke; Barbie, David A

    2018-03-15

    Although mutation of NF1 has been described in non-small cell lung cancer (NSCLC), co-mutation with RASA1 , another Ras-GTPase activating protein (RasGAP), defines a novel genetically defined subclass of NSCLC. RASA1 / NF1 -mutant cell lines are highly sensitive to MEK inhibitors, warranting clinical evaluation of MAPK inhibition in this subclass of patients. Clin Cancer Res; 24(6); 1243-5. ©2018 AACR See related article by Hayashi et al., p. 1436 . ©2018 American Association for Cancer Research.

  16. Supplementary 1

    Indian Academy of Sciences (India)

    moj

    The name and origin of studied oily sunflower genotypes under well watered and water stressed conditions over two years. No. Name. Origin. Research centre No. Name. Origin. Research centre. 1 H100A/83HR4 France. ASGROW. 51 RHA265. France. ASGROW. 2 H209A/LC1064 France. ASGROW. 52 PM1-3. USA.

  17. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Cancers and BRCA1 and BRCA2 Mutations in a population-. Based Series of Early Onset Breast Cancer.J. Nut. 1 Cancer. Inst. Aug 15, 93. (16:1215-1223). Miller AB, Ailtenburg HP, Bueno-de-Mesquita B (2004):. Fruits and vegetable and lung cancer: findings from the. European Prospective Investigation into Cancer and ...

  18. Slide 1

    Indian Academy of Sciences (India)

    Problem 1: Direct Materials Procurement at GM · Slide 8 · Slide 9 · Slide 10 · Game Theory · Strategic Form Games (Normal Form Games) · Example : Prisoner's Dilemma · Dominant Strategy Equilibrium · Nash Equilibrium · Nash's Theorem · Slide 17 · Slide 18 · Example 1: Mechanism Design Fair Division of a Cake.

  19. APOL1

    Science.gov (United States)

    Cooper, Anneli; Ilboudo, Hamidou; Alibu, V Pius; Ravel, Sophie; Enyaru, John; Weir, William; Noyes, Harry; Capewell, Paul; Camara, Mamadou; Milet, Jacqueline; Jamonneau, Vincent; Camara, Oumou; Matovu, Enock; Bucheton, Bruno; MacLeod, Annette

    2017-05-24

    Reduced susceptibility to infectious disease can increase the frequency of otherwise deleterious alleles. In populations of African ancestry, two apolipoprotein-L1 (APOL1 ) variants with a recessive kidney disease risk, named G1 and G2, occur at high frequency. APOL1 is a trypanolytic protein that confers innate resistance to most African trypanosomes, but not Trypanosoma brucei rhodesiense or T.b. gambiense, which cause human African trypanosomiasis. In this case-control study, we test the prevailing hypothesis that these APOL1 variants reduce trypanosomiasis susceptibility, resulting in their positive selection in sub-Saharan Africa. We demonstrate a five-fold dominant protective association for G2 against T.b. rhodesiense infection. Furthermore, we report unpredicted strong opposing associations with T.b. gambiense disease outcome. G2 associates with faster progression of T.b. gambiense trypanosomiasis, while G1 associates with asymptomatic carriage and undetectable parasitemia. These results implicate both forms of human African trypanosomiasis in the selection and persistence of otherwise detrimental APOL1 kidney disease variants.

  20. AGTR1

    Science.gov (United States)

    Chen, Ruhua; Hong, Qingxiao; Jiang, Jianzhong; Chen, Xiaoying; Jiang, Zhenhuan; Wang, Jinzhi; Liu, Shunlin; Duan, Shiwei; Shi, Shunbin

    2017-10-01

    Aberrant DNA methylation is associated with non-small cell lung cancer (NSCLC), suggesting that gene promoter methylation may be a potential biomarker for the detection or risk prediction of NSCLC. The present study aimed to evaluate the potential usage of angiotensin II receptor type 1 ( AGTR1 ) methylation in two major pathologic subtypes: Lung adenocarcinoma (LUAD) and lung squamous cell carcinoma (LUSC). Quantitative methylation-specific polymerase chain reaction was used to investigate the effect of AGTR1 promoter methylation in the tumor and the paired adjacent non-tumor tissue samples from 42 patients with LUSC, and 69 with LUAD. The percentage of methylated reference was calculated and presented as the median (interquartile range 25th-75th percentile). The results of the current study revealed that there was significantly increased AGTR1 promoter methylation in the tumor tissues compared with the paired adjacent non-tumor tissue [97.4 (57.22-130.5) vs. 85 (48.25-123); P=0.024]. Furthermore, higher AGTR1 promoter methylation was observed in patients with LUSC compared with LUAD (odds ratio=2.483; 95% confidence interval=1.125-5.480; P=0.023). Significant differences were identified in AGTR1 methylation between non-tumor and the tumor tissues in LUSC [113.5 (68.33-148.73) vs. 93.04 (45.94-140); P=0.008]. In addition, the Cancer Genome Atlas data of 378 patients with LUSC and 477 with LUAD revealed an inverse correlation between gene expression and the methylation status of AGTR1 promoter.. These data suggest that AGTR1 hypermethylation is a promising biomarker to assist in LUSC detection and diagnosis.

  1. Book 1

    African Journals Online (AJOL)

    type 3 (defect in MDR-3, a canalicular phospholipids transporter). - Hereditary cholestasis with. Lymphedema (Aagenaes syndrome). - Benign recurrent cholestasis (BRIC). - Dubin-Johnson syndrome. - Rotor syndrome. IV. Metabolic disorders: - ∞1-Antitrypsin deficiency. - Cystic fibrosis. - Neonatal iron storage disease.

  2. Neurofibromatosis-1

    Science.gov (United States)

    ... education, people with NF can live a normal life. Although mental impairment is generally mild, NF1 is a known cause of attention deficit hyperactivity disorder. Learning disabilities are a common problem. Some people are treated ...

  3. author's correction 1..1

    Indian Academy of Sciences (India)

    J. Genet. 89, e25Ye29 (http://www.ias.ac.in/jgenet/OnlineResources/90/e25.pdf). In table 1, for locus Aaz1, the core motif should be (ACAT)8 ATAAA(TG)6 and not (ACAT)8. Genetic polymorphism of serotonin transporter 5-HTTLPR: involvement in smoking behaviour. Maria Angelica Ehara Watanabe, Sandra Odebrechet ...

  4. 1/N

    International Nuclear Information System (INIS)

    Coleman, S.

    1980-03-01

    There exist families of field theories with symmetry group SO(N) (or SU(N)) that become simpler as N becomes larger. More precisely, the solutions to these theories possess an expansion in powers of 1/N. This expansion is the subject of these lectures. The 1/N expansion can be used to analyze model field theories. The 1/N expansion is developed for phi 4 theory and applied to two two-dimensional models with similar combinatoric structures, the Gross-Neveu model and the CP/sup N-1/ model. These models display (in the leading 1/N approximation) such interesting phenomena as asymptotic freedom, dynamical symmetry breaking, dimensional transmutation, and non-perturbative confinement. It is possible that the 1/N expansion, with N the number of colors, might fruitfully be applied to quantum chromodynamics. Unfortunately, it is not possible to make a decisive test of the approximation, because no one knows how to compute even the first term in the expansion in closed form. However, it is possible to argue that this first term, whatever its detailed form, has many properties that are also shared by the real world, and which are otherwise underived from field theory. These include the saturation of scattering amplitudes by an infinite number of narrow resonances, the essential feature of dual-resonance models

  5. 1+1 Gaudin Model

    Directory of Open Access Journals (Sweden)

    Andrei V. Zotov

    2011-07-01

    Full Text Available We study 1+1 field-generalizations of the rational and elliptic Gaudin models. For sl(N case we introduce equations of motion and L-A pair with spectral parameter on the Riemann sphere and elliptic curve. In sl(2 case we study the equations in detail and find the corresponding Hamiltonian densities. The n-site model describes n interacting Landau-Lifshitz models of magnets. The interaction depends on position of the sites (marked points on the curve. We also analyze the 2-site case in its own right and describe its relation to the principal chiral model. We emphasize that 1+1 version impose a restriction on a choice of flows on the level of the corresponding 0+1 classical mechanics.

  6. EHMT1

    Science.gov (United States)

    de Boer, Anneke; Vermeulen, Karlijn; Egger, Jos I M; Janzing, Joost G E; de Leeuw, Nicole; Veenstra-Knol, Hermine E; den Hollander, Nicolette S; van Bokhoven, Hans; Staal, Wouter; Kleefstra, Tjitske

    2018-01-01

    Genetic mosaicism is only detected occasionally when there are no obvious health or developmental issues. Most cases concern healthy parents in whom mosaicism is identified upon targeted testing of a genetic defect that was initially detected in their children. A germline genetic defect affecting the euchromatin histone methyltransferase 1 ( EHMT1 ) gene causes Kleefstra syndrome, which is associated with the typical triad of distinct facial appearance, (childhood) hypotonia, and intellectual disability. A high degree of psychopathology is associated with this syndrome. A few parents with a mosaic EHMT1 mutation have been detected upon testing after a child was diagnosed with a germline EHMT1 defect. At first glance, carriers of a mosaic EHMT1 mutation appeared to function normally. However, recent studies have shown that de novo, postzygotic mutations in important developmental genes significantly contribute to autism spectrum disorder (ASD). Therefore, we hypothesized that EHMT1 mosaicism could cause neuropsychiatric defects. To investigate this, we performed a detailed investigation of cognitive neuropsychiatric parameters in parents identified with EHMT1 mosaicism. Three adults (two males, one female) with a genetically confirmed diagnosis of EHMT1 mosaicism were examined by means of a battery of tests and observational instruments covering both neurocognitive and psychiatric features. The battery included the following instruments: the Autism Diagnostic Observation Schedule (ADOS), the mini Psychiatric Assessment Schedules for Adults with Developmental Disabilities (mini PAS-ADD), the Vineland Adaptive Behavior Scales (VABS), and the Cambridge Neuropsychological Test Automated Battery (CANTAB). These measures were compared with our previously reported data from Kleefstra syndrome patients with confirmed (germline) EHMT1 defects. All three subjects achieved maximum total scores on the VABS, indicative of adequate (adaptive) functioning. In all, scores above

  7. KLF1

    Science.gov (United States)

    Borgio, J Francis; AbdulAzeez, Sayed; Al-Muslami, Ahmed M; Naserullah, Zaki A; Al-Jarrash, Sana; Al-Suliman, Ahmed M; Al-Madan, Mohammed S; Al-Ali, Amein K

    2018-01-01

    Elevated HbA 2 (hemoglobin A 2 ) level is considered the most reliable hematological parameter for the detection of β-thalassemia carriers. However, some carriers are difficult to recognize because the level of HbA 2 is not in the distinctive carrier range, i.e. 4.0-6.0%; instead, some carriers have HbA 2 levels between normal and carrier levels, i.e. borderline HbA 2 (HbA 2 = 3.1-3.9%). Studies have shown that variations in the erythroid Krüppel-like factor ( KLF1 ) gene lead to borderline HbA 2 in β-thalassemia carriers from various populations. The incidence of borderline HbA 2 in Saudis is high. To confirm the influence of variations in KLF1 , HBA1 , HBA2 and HBB genes for the reduction of the level of HbA 2 in Saudi β-thalassemia carriers, we performed a direct sequence analysis of KLF1 , HBA1 , HBA2 and HBB genes from 212 healthy Saudis (88 subjects: HbA 2 4.3). The presence of the borderline HbA 2 level is not specific to any type of β-thalassemia variation or β + -thalassemia variations in Saudis. Two exonic (c.304T>C and c.544T>C) and two 3' untranslated region (3'UTR) (c.*296G>A and c.*277C>G) variations have been identified in the KLF1 gene for the first time from an Arab population. None of these four variations in KLF1 genes are significantly associated with the Saudis with borderline HbA 2 . α Globin genotype, -α 2 3.7 /α 1 α 2 , is found to be the most frequent (55.55%) among healthy Saudis with borderline HbA 2 compared with the other groups (HbA 2 4.3 = 13.51%). Further studies are necessary to determine the influence of other factors on the presence of borderline HbA 2 in 41.67% of Saudis.

  8. Osborne 1

    CERN Multimedia

    1981-01-01

    The Osborne 1 Released by the Osborne Computer Corporation is considered to be the first true portable, full-featured computer intended for a larger audience than companies. It includes all the components required to be a completely useful and operational computer system. Indeed the Osborne 1 was cost $ 1,795which is now $ 4,773. Another attractive point was that it was sold with several software, which, sold separately, cost almost the same price as the machine. However this computer has some disadvantages like its weight (11 kg) or its tiny screen that could display only a little character per lines and sized the average size of a phone screen . Another problem was that the computer was a bit prone to overheating.

  9. Danida1

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    1996-01-01

    At the request of Danish Ministry of Foreign Affairs, Department TSA.4, electrical testing of possibly damaged cables has been evaluated. This matter concerns three different types of cable, which are10 km 30(36) kV XLPE armoured submarine power cable, 1-phase15 km 30(36) kV XLPE armoured...... underground power cable, 1-phase20 km 10(12) kV XLPE armoured underground power cable, 3-phase.The possible damage of said cables took place during shipment from Denmark to Bangladesh....

  10. Kjemi 1

    DEFF Research Database (Denmark)

    Brandt, Harald; Hushovd, Odd T.

    Kemi 1 er en lærebog til den gymnasiale kemiundervisning i Norge (VG2, studieforberedende) tilsvarende det danske kemi B-niveau i det almene gymnasium (stx). Lærebogen er et del af af et bogsystem med tilhørende netsted til elever og online-lærervejledning (lokus.no).......Kemi 1 er en lærebog til den gymnasiale kemiundervisning i Norge (VG2, studieforberedende) tilsvarende det danske kemi B-niveau i det almene gymnasium (stx). Lærebogen er et del af af et bogsystem med tilhørende netsted til elever og online-lærervejledning (lokus.no)....

  11. AFRIMEDIC VOL. 1, NO. 1

    African Journals Online (AJOL)

    Buchi

    patients managed for cancer of the cervix between January 1 st. 1999 and December 31 , 2008. Results: Thirty seven patients were included in the study. The mean age of the patients was 59.7 + 13.3 years while the mean parity was 6.4 + 3.2. Only 23.1% of the women had at least a secondary education while 46.2% had ...

  12. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    implicated in regulating processes such as glial cell function, neuronal cell development and apoptosis. (Ndong, Landry et al. 2012). Similarly, decreased. MKP-1 levels have been reported in some neurological disorders such as multiple sclerosis, Huntington's disease, cerebral hypoxia and ischemia (Taylor, Moser et al.

  13. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    interviewer administered questionnaire containing a 47- point knowledge scale were used for data collection. Data were analysed ... FMOH guidelines. The contraceptives ever dispensed by respondents included: male condoms (96.1%), female condoms (4.3%), .... every wrong response had zero mark. Maximum.

  14. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    College Hospital Ethics Review Committee. This study was aimed to address the following: one, ..... (80.6%) and least among the University graduates. (53.1%). Economic violence is not significantly related to ..... Dickinson, L.M., Degruy 3rd, F.V., And Candib, L.M.. (1999): Healthy-related quality of life and symptom profiles.

  15. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Pregnancy outcome in different clinical phenotypes of antiphospholipid syndrome. Lupus Jan 19(1):58-64. Christensson A., Ekberg J., Grubb A., Ekberg H.,. Lindstrom V and Lilja H. (2003). Serum cystatin C is a more sensitive and more accurate marker of glomerular filtration rate than enzymatic measurements of creatinine ...

  16. Book 1

    African Journals Online (AJOL)

    with CVD compared to those without CVD and control groups, while no sig- nificant difference was found between SLE patients without CVD and control group. As regard PON1 55 gene polymorphism, there was no significant dif- ference in genotype distribution or allele frequency between the three groups. The Odds ratio ...

  17. Slide 1

    Indian Academy of Sciences (India)

    Table of contents. Slide 1 · Slide 2 · Slide 3 · Slide 4 · Slide 5 · Slide 6 · Slide 7 · Slide 8 · Slide 9 · Slide 10 · Slide 11 · Slide 12 · Slide 13 · Slide 14 · Slide 15 · Slide 16 · Slide 17.

  18. 1. Sizia

    African Journals Online (AJOL)

    analysis were confounding the relationship between district (urban, peri-urban, and rural) and tobacco smoking. Relationship between District and Smoking. In bivariate analysis (Table 1), while respondents in a peri-urban district were less likely to smoke compared to respondents in an urban district, respondents in a rural ...

  19. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Department of Biological Sciences, College of Science, Engineering and Technology Minnesota State University,. Mankato, MN 56001 .... in a cage that is placed on a receiver plate connected to a computer. Each telemetry device is assigned a code and hence could be used for different animals at a given time. Fig. 1: Total ...

  20. Slide 1

    Indian Academy of Sciences (India)

    Game Theory · Strategic Form Games (Normal Form Games) · Example : Prisoner's Dilemma · Dominant Strategy Equilibrium · Nash Equilibrium · Nash's Theorem · Slide 17 · Slide 18 · Example 1: Mechanism Design Fair Division of a Cake · Example 2: Mechanism Design Truth Elicitation through an Indirect Mechanism.

  1. Book 1

    African Journals Online (AJOL)

    We report on a 1 5/12 years old male patient with clinical manifestations of. Peters'-Plus syndrome. The patient had Peters' anomaly (central adherent leu- coma, bilateral congenital cataract), growth deficiency, disproportionate short stature, mild mental retardation. He had also short hands with nearly complete cutanous ...

  2. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    scientific reports have equally highlighted these positive effects of TCAs in healing ulcer, but the mechanism .... peroxidation in units/mg protein or gram tissue was computed with a molar extinction coefficient of 1.56 x .... the stomach wall friction during peristalsis (Venables,. 1986). 10 and 25 mg/kg Imipramine significantly.

  3. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Adequate supervision of health workers as well as health education of pregnant women is needed to encourage adherence to IPTp-SP. Keywords: Intermittent preventive treatment uptake, Sulfadoxine-pyrimethamine, Antenatal clinic, Malaria in pregnancy. INTRODUCTION. 1. Malaria during pregnancy is a major cause of ...

  4. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    cardiovascular, nervous and musculoskeletal systems. With the development of tissue-specific knock- out models most of .... training mediated immune remodeling that could be beneficial for athletes (Rastogi, Du et al. 2011). There ... fat feeding (Lawan, Zhang et al. 2015). These studies established that MKP-1 is a major ...

  5. Slide 1

    Indian Academy of Sciences (India)

    Projected Rainfall (Weighted Mean CDF; A1B scenario) · Slide 18 · Imprecise Probability · Bounds for Probability of Drought · Slide 21 · Possibility Distribution of GCMs and Scenarios · Mahanadi River Basin - Streamflow · Projections for future monsoon inflows to Hirakud Reservoir · Slide 25 · Rule curve for adaptive policies.

  6. Book 1

    African Journals Online (AJOL)

    brain anomalies are included in this study. Patient ... Was performed for all patients as it was our clue for patient's selection. All pa- tients needed sedation during neuroim- aging examinations. Sedation by chlo- .... sagittal T1 brain MRI showing cerebellar hypoplasia/atrophy with brain stem hypoplasia and thin corpus.

  7. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Brushing once daily was the most prevalent oral cleansing practice ... Afr. J. Biomed. Res. Vol. 18, No.3 (September) 2015. Okoje-Adesomoju et al. Table 1: Pattern of Oral Microbial Isolates. Oral microbial isolates. Frequency (%). Klebsiella species ... Distribution of microbial culture by trimester of pregnancy. The pattern of ...

  8. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Full Length Research Paper. Evaluation of ... Diabetes complications contribute to reduction in health-related quality of life of patients and increased health resources usage. This study was ... and 14.1% in peripheral vascular disease and presence of foot ulcer respectively but the females had a higher figure (7.8%) than.

  9. Book 1

    African Journals Online (AJOL)

    disease of grade II, a picture suggestive of bladder neck obstruction, most prob- ably due to posterior uretheral valve anomaly and mild hepatosplenomegaly. Opthalmological evaluation showed right central adherent leucoma and bilateral congenital cataract, (Peters' anomaly). Tables 1 and 2 Compare features of our.

  10. Diapositive 1

    Indian Academy of Sciences (India)

    pasb

    Understanding the South Asian monsoon response to greenhouse gas (GHG) and aerosol forcing. 28th Mid-Year Meeting. Indian Academy of Sciences, Bengaluru. 30 June – 1 July 2017. R. Krishnan. Centre for Climate Change Research (CCCR). Indian Institute of Tropical Meteorology, Pune ...

  11. PTCH1

    Science.gov (United States)

    Ponti, Giovanni; Manfredini, Marco; Pastorino, Lorenza; Maccaferri, Monia; Tomasi, Aldo; Pellacani, Giovanni

    2018-01-01

    Nevoid basal cell carcinoma syndrome (NBCCS) is an autosomal dominantly inherited disorder characterized by multiple basal cell carcinomas (BCC), odontogenic tumors and various skeletal anomalies. Basaloid follicular hamartomas (BFHs) constitute rare neoplasms that can be detected in sporadic and familial settings as in the Basaloid Follicular Hamartoma Syndrome (BFHS). Although BFHS shares clinical, histopathological and genetic overlapping with the NBCCS, they are still considered two distinctive entities. The aim of our single-institution study was the analysis of a cohort of PTCH1-mutated patients in order to define clinical and biomolecular relationship between NBCCS and BFHs. In our study we evaluated PTCH1 gene-carrier probands affected by NBCCS to detect the incidence of BFHs and their correlation with this rare syndrome. Among probands we recognized 4 patients with BFHs. We found 15 germline PTCH1 mutations, uniformly distributed across the PTCH1 gene. Six of them had familial history of NBCCS, two of them were novel and have not been described previously. NBCCS and BFHS may be the same genetic entity and not two distinctive syndromes. The inclusion of BFH in the NBCCS cutaneous tumor spectrum might be useful for the recognition of misdiagnosed NBCCS cases that could benefit from tailored surveillance strategies. Copyright© 2018, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

  12. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    1Department of Anatomy, College of Medicine, University of Ibadan, Ibadan, Nigeria. 2Department of Radiotherapy, College of Medicine/University College Hospital, Ibadan, Nigeria. 3Department of Surgery, University of ... Radiotherapy is used either alone or as an adjunct to chemotherapy and surgical management in the ...

  13. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    2001-02-01

    Feb 1, 2001 ... medical centers that may have had impact on structure and therefore functioning of basic medical science departments. Real or ... Keywords: Biomedical science, basic medical science, research, education, academic department, driving force ... problem-based learning and evidence based medicine).

  14. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    21.0. The study revealed that the younger children (3 years old) were more severely malnourished than any other age, although the nutritional status improved with increased age. There was no difference in gender. 19.1, 17.9 and 18.9% were stunted, underweight and wasted respectively. In terms of dietary diversity score, ...

  15. Slide 1

    Indian Academy of Sciences (India)

    Click here to start. Table of contents. Slide 1 · Slide 2 · Slide 3 · Slide 4 · Slide 5 · Slide 6 · Slide 7 · Slide 8 · Slide 9 · Slide 10 · Slide 11 · Slide 12 · Slide 13 · Slide 14 · Slide 15 · Slide 16 · Slide 17.

  16. Datablock: 1

    Indian Academy of Sciences (India)

    pl. 1/4. checkCIF (basic structural check) running. checkCIF/PLATON (basic structural check). You have not supplied any structure factors. As a result the full set of tests cannot be run. No syntax errors found. CIF dictionary. Please wait while ...

  17. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    2001-02-01

    Feb 1, 2001 ... Impact of Improved Facilities on Medical Education Outcome: Lessons from the United States ... The author opines, in conclusion, that African academic leadership needs to do research on existing academic processes in order to .... engineers and physicians, thus creating a new class of super-educated ...

  18. Threatre 1

    African Journals Online (AJOL)

    USER

    self-grounding in an African universe manifesting a tripartite, complementary planes of existence, namely; the world of the living, the ancestors and the unborn. It is this Soyinka's “original discourse's legitimacy” (Foucault 1), characterized by what Tiffin calls a. “centrist philosophy” (19) ascribed to the Yoruba by Soyinka, and.

  19. LDD 1

    African Journals Online (AJOL)

    HP27975994114

    Higher education access in South. Africa for students with criminal records. TAABO MUGUME. Researcher, University of the Free State. 1 INTRODUCTION. The post-1994 ... education in South Africa: a social realist .... African higher education: key concepts, perspectives, and common concerns” in Luescher TM, Klemenčič.

  20. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    A Biometric Study of Some Reproductive Components of the. Male Domestic Local Breed Cat (Felis catus domestica) in. Northwest Nigeria. *1M.A Umaru;2 A. Bello; ... and security test for new drugs (Elcock and Schoning,. 1984). Little information is available regarding the morphology and biometry of the male genitalia of ...

  1. CASE 1

    African Journals Online (AJOL)

    Guest

    Introduction. In Nigerians bladder calculi account for 44.4%2 while in North America, they account for 5%1 urinary calculi 2 .Infection and bladder foreign bodies seem to be predisposing. Giant vesical calculus may be defined as a stone in the urinary bladder weighing more than 100g. Giant vesical stones are universally ...

  2. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    MATERIALS AND METHODS. Animal Care. All animals received humane care according to the Principle of the National Institutes of Health Guide for the Care and ..... Genotoxicity, mitochondrial damage, and apoptosis in human lymphoblastoid cells exposed to peroxynitrite generated from SIN-1. Chem Res. Toxicol 15: ...

  3. Introduction1

    African Journals Online (AJOL)

    sulaiman.adebowale

    2008-09-10

    Sep 10, 2008 ... constituted by a number of African graduate students then based at North- ... 2. Africa Development, Vol. XXXIII, No. 1, 2008 scholars. When a call for papers for the CODESRIA 30th Anniversary cel- ebration came to our attention, the group submitted a panel proposal on this .... stream study of Africans.

  4. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    and alleviating the haemolytic crisis in sickle cell patients. We further highlighted that the herozygote HbS state has greater osmotic reistance that nprmal hemogblobin but lesser than that of the homozygous state HbSS. INTRODUCTION1. The homozygous state of SCA causes moderate to severe anemia resulting both from ...

  5. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Enhanced Phenylephrine Contractions in Rabbit Carotid Arteries. Following ... characterize, in vitro, the modulatory role of erythrocyte components from subjects with ... muscle contraction. Vasoconstriction of arterioles and resistance arteries induced by α1-adrenergic agonists is associated not only with an increase in the.

  6. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    2014-01-31

    Jan 31, 2014 ... immunodeficiency virus infection. Arch Intern Med.;150(1):73-7. Anochie P.I, Obinna, VAC Onyeneke, E.C. SreekanthA. ,Onyeozirila A.C, Ogu A.C. (2014): Clinical Management of. HIV/AIDS Infection UsingAntiretroviral Drugs in A Nigerian. Endemic Setting. Indian Journal of Medical Research and.

  7. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    1Department of Physiotherapy, Faculty of College Allied Health Sciences, Bayero University, Kano, Nigeria. 2Department ... The disability caused by stroke could lead to significant decline in the level of functioning and deterioration of quality of life. (QoL). ... social and emotional domains of QoL were all affected. Language ...

  8. CTNNB1

    Science.gov (United States)

    Na, Kiyong; Kim, Eun Kyung; Jang, Wonjun; Kim, Hyun-Soo

    2017-06-01

    Microcystic stromal tumor (MCST) is a rare stromal tumor of the ovary. In this study, we describe clinicopathological characteristics and results of mutational analyses of the CTNNB1gene in two cases of ovarian MCST and we provide a thorough review of previously published cases alongside our current cases and clarify the clinicopathological characteristics of ovarian MCST. Patients' age was 33 and 31 years, respectively. One patient presented with fever and low abdominal pain, whereas a pelvic mass was incidentally detected in another patient. Grossly, the cut surface of the tumors was mixed solid and cystic. Histologically, the tumor characteristically displayed numerous microcysts, solid cellular areas, and intervening hyalinized stroma. Areas of moderate-to-severe nuclear pleomorphism with occasional multinucleated giant cells and bizarre nuclei were noted in one of the two cases. Immunohistochemically, both cases demonstrated diffuse and strong β-catenin expression in the nuclei and the cytoplasm. The tumor cells were also diffusely positive for CD10, vimentin, Wilms tumor 1, and cyclin D1. The tumor cells were consistently negative for E-cadherin, inhibin-α, calretinin, estrogen receptor, and progesterone receptor. Mutational analyses using direct sequencing and pyrosequencing methods exhibited a single nucleotide mutation in CTNNB1 exon 3 (c.122C>T) in one case. We also found a novel deletion mutation in the same exon (c.88_99delTACCTGGACTCT) in another case. We demonstrated a previously reported CTNNB1 point-mutation using pyrosequencing and a novel deletion mutation in ovarian MCSTs. The review of the literature of previously published cases in combination with our current cases clarifies the clinicopathological characteristics of ovarian MCST and the comprehensive analysis of these cases would expand our knowledge regarding ovarian MCST. Copyright© 2017, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

  9. Announcement of recommendations of the Reaktor-Sicherheitskommission. As of 24 July 1997. Joint recommendations of RSK and GPR for safety requirements of future nuclear PWR-type power plants. English versions published in the years 1995 through 1997

    International Nuclear Information System (INIS)

    1997-01-01

    The recommendations, most parts given in English, refer to the European Pressurized Water Reactor (EPR) and have been established by the German RSK (reactor safety commission), the corresponding French organization GPR and the German SSK (radiation protection commission). This publication continues earlier joint recommendations by the national bodies, last published by the German BMU (responsible German ministry) on 5 May 1995, in BAnz. page 7452. The safety recommendations establish the basis for further activities in the Franco-German project for development of the EPR, a PWR type reactor of the next generation. (CB) [de

  10. The development of fast reactors - Effects on the Swedish system of management of spent fuel; Utveckling av snabba reaktorer - Paaverkan paa det svenska systemet foer hantering av anvaent braensle

    Energy Technology Data Exchange (ETDEWEB)

    Hans Forsstroem, Hans [SKB International AB, Stockholm (Sweden)

    2013-09-15

    Since the start of the nuclear power era studies have been performed of how to utilise the uranium energy resource in the most effective way. Only about one percent of the energy potential of uranium is utilised in the light water reactors of today. To improve the utilization other types of reactors are needed. With fast reactors theoretically 50-100 times more energy can be extracted from the uranium. This will require reprocessing of the uranium and multiple recycling of the plutonium. Plutonium and uranium can also be recycled in light water reactors, but this will only improve the uranium utilisation by about 20 %. Recycling of plutonium on a routine basis is presently only done in France. The development of fast reactors has been going on since the end of the 1940ies. During the 1970ies the planning was that a large number of fast reactors and their associated fuel cycle facilities would be in operation by the year 2000. The development has, however, for different reasons been much slower than planned. The general assessment today is that fast reactor, if they will be realised, will hardly give an important contribution to energy production until after 2050. Nuclear power production has instead been dominated by light water reactors similar to the ones in use in Sweden. Light water reactors are believed to continue to dominate during the next decades. To start a fast reactor system plutonium (or highly enriched uranium) will be needed. Such plutonium is contained in spent nuclear fuel from light water reactors. This raises the question: Should the spent nuclear fuel be stored so that the potential energy resource in the fuel can be used in the future instead of disposing of it as a waste? The answer to this question will depend on when the material will be useful, i.e. when fast reactors have been introduced on a large scale. It will also depend on the demand for plutonium at this time, i.e. will plutonium be a scarce redundant resource at this point of time. In this context it should be considered that fast reactors will generate their own plutonium, as breeder reactors. Plutonium from other reactors will thus only be needed for the first years of operation. To provide a basis for the answer to the question if the Swedish spent fuel is a resource or a waste this report provides an overview of the present development status for fast reactors and their potential for large scale commercial use. It further describes the impact on the Swedish system for management of spent nuclear fuel if the fuel were to be reprocessed and the uranium and plutonium reused as fuel for fast reactors or for the present reactors.

  11. ASC-1

    DEFF Research Database (Denmark)

    Jakimoski, Goce; Khajuria, Samant

    2011-01-01

    uses leak extraction from diÆerent AES rounds to compute the key material that is XOR-ed with the message to compute the ciphertext. Unlike LEX, the ASC-1 operates in a CFB fashion to compute an authentication tag over the encrypted message. We argue that ASC-1 is secure by reducingits (IND-CCA , INT......The goal of the modes of operation for authenticated encryption is to achieve faster encryption and message authentication by performing both the encryption and the message authentication in a single pass as opposed to the traditional encrypt-then-mac approach, which requires two passes......-CTXT) security to the problem of distinguishing the case when the round keys are uniformly random from the case when the round keys are generated by a key scheduling algorithm....

  12. EPAS1

    Science.gov (United States)

    vonHoldt, Bridgett; Fan, Zhenxin; Ortega-Del Vecchyo, Diego; Wayne, Robert K

    2017-01-01

    Admixture can facilitate adaptation. For example, black wolves have obtained the variant causing black coat color through past hybridization with domestic dogs and have higher fitness than gray colored wolves. Another recent example of the transfer of adaptive variation between the two species has been suggested by the similarity between high altitude Tibetan mastiffs and wolves at the EPAS1 gene, a transcription factor induced in low oxygen environments. Here, we investigate the directionality of admixture in EPAS1 between 28 reference highland gray wolves, 15 reference domestic dogs, and 21 putatively admixed highland wolves. This experimental design represents an expanded sample of Asian dogs and wolves from previous studies. Admixture was inferred using 17,709 publicly available SNP genotypes on canine chromosome 10. We additionally conducted a scan for positive selection in the highland dog genome. We find an excess of highland gray wolf ancestry at the EPAS1 locus in highland domestic dogs, suggesting adaptive introgression from wolves to dogs. The signal of admixture is limited in genomic extent to a small region on chromosome 10, indicating that it is the focus of selection in an oxygen-limited environment. Our results suggest that an adaptive variant of EPAS1 in highland wolves was transferred to highland dogs, carrying linked variants that potentially function in hypoxia response at high elevation. The intertwined history of dogs and wolves ensures a unique evolutionary dynamic where variants that have appeared in the history of either species can be tested for their effects on fitness under natural and artificial selection. Such coupled evolutionary histories may be key to the persistence of wild canines and their domesticated kin given the increasing anthropogenic modifications that characterize the future of both species.

  13. Slide 1

    Indian Academy of Sciences (India)

    The Archaeological Context · Slide 4 · The History of Rock Art Research · Slide 6 · Slide 7 · Slide 8 · The Chronology of Rock Art · The Rock Art · Slide 11 · Slide 12 · Rock art sites in Andhra pradesh · Rock art Sites in Kerala · Rock Art sites in Tamilnadu · Mesolithic Art 1.A huge Rabbit in red ochre,Chintakunta,AP. 2.A huge ...

  14. Slide 1

    Indian Academy of Sciences (India)

    Table of contents. Slide 1 · Matsyagandhya A case of genetic disorder · Slide 3 · Slide 4 · Slide 5 · Slide 6 · Slide 7 · Active Site with Molybdopterin Ligation · Disadvantage of a Chemist to Model the Cofactor · Slide 10 · Slide 11 · Slide 12 · Active Site Investigation · Slide 14 · Slide 15 · Slide 16 · Slide 17 · Slide 18 · Slide 19.

  15. Slide 1

    Indian Academy of Sciences (India)

    Table of contents. Slide 1 · Slide 2 · Membrane Phospholipids · Slide 4 · NAE and NAPE · Biological and Pharmacological properties · Slide 7 · Slide 8 · Slide 9 · Slide 10 · Slide 11 · Slide 12 · Slide 13 · Slide 14 · Slide 15 · Slide 16 · Slide 17 · Slide 18 · Slide 19 · Slide 20 · Slide 21 · Slide 22 · Slide 23 · Slide 24 · Slide 25.

  16. Slide 1

    Indian Academy of Sciences (India)

    Table of contents. Slide 1 · Potency of Stem Cells · Slide 3 · Slide 4 · Slide 5 · World Wide Clinical trials using MSCs · Slide 7 · Bone Marrow derived Human MSCs (hMSC) in culture · Slide 9 · Slide 10 · Slide 11 · Slide 12 · Slide 13 · Fetal MSCs · Morphology of murine fetal heart derived stem cells (fHSCs) · Growth Kinetics of ...

  17. Slide 1

    Indian Academy of Sciences (India)

    The History of Rock Art Research · Slide 6 · Slide 7 · Slide 8 · The Chronology of Rock Art · The Rock Art · Slide 11 · Slide 12 · Rock art sites in Andhra pradesh · Rock art Sites in Kerala · Rock Art sites in Tamilnadu · Mesolithic Art 1.A huge Rabbit in red ochre,Chintakunta,AP. 2.A huge deer figure in Red ochre, ...

  18. AFRIMEDIC VOL. 1, NO. 1

    African Journals Online (AJOL)

    Buchi

    Life expectancy is a proxy for the general state of health, but it also possesses an intrinsic value. ..... Internet. 2. 1.6. TABLE IV: SOURCES OF KNOWLEDGE ABOUT PAP SMEAR. [N=123]. DISCUSSION. Most (84.9%) of the respondents were aware of cervical cancer. This shows a higher level of awareness than that of. 10.

  19. Slide 1

    Indian Academy of Sciences (India)

    Table of contents. Slide 1 · Slide 2 · Slide 3 · Slide 4 · Slide 5 · Slide 6 · Slide 7 · Immunology of VL · Slide 9 · Slide 10 · Slide 11 · Slide 12 · Slide 13 · Slide 14 · Strategies To Design Drugs · Slide 16 · Slide 17 · Slide 18 · Slide 19 · Slide 20 · Slide 21 · Slide 22 · Slide 23 · Slide 24 · Slide 25 · Slide 26 · Slide 27 · Slide 28.

  20. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    The pre-patent periods in groups A, B, C and D were 3.5 ± 0.9, 3.1 ± 0.9, 3.2 ± 0.6 and 3.5 ± 0.9 days respectively. There was no significant (P> 0.05) ..... Parts I and II. Rev. Elev. Med. Vet. Pays Trop. 41: 65-78, 151-164. Chatfield, C. (1983): Statistics for Technology. A course in. Applied Statistics, 3rd edn. Chapman and Hall ...

  1. Figures1

    OpenAIRE

    2014-01-01

    NB. Soulignons que cette carte, établie à partir de statistiques officielles, est en contradiction avec de nombreuses enquêtes locales.Source : Diop Salif, Rekacewicz Philippe, 2003, Atlas mondial de l’eau, Paris, Éditions Autrement.Figure 1. Part de la population urbaine ayant accès à l'eau potable en Afrique subsaharienne Source : Diop, Rekacewicz, 2003.Figure 2. Afrique subsaharienne : pénurie d'eau douce et stress hydrique en 1990 et 2025 (projection) Source : Diop, Rekacewicz, 2003.Fig...

  2. C 1

    Science.gov (United States)

    Nguyen, Thien; Karčiauskas, Kęstutis; Peters, Jörg

    2016-01-01

    Geometrically continuous ( G k ) constructions naturally yield families of finite elements for isogeometric analysis (IGA) that are C k also for non-tensor-product layout. This paper describes and analyzes one such concrete C 1 geometrically generalized IGA element (short: gIGA element) that generalizes bi-quadratic splines to quad meshes with irregularities. The new gIGA element is based on a recently-developed G 1 surface construction that recommends itself by its a B-spline-like control net, low (least) polynomial degree, good shape properties and reproduction of quadratics at irregular (extraordinary) points. Remarkably, for Poisson's equation on the disk using interior vertices of valence 3 and symmetric layout, we observe O ( h 3 ) convergence in the L ∞ norm for this family of elements. Numerical experiments confirm the elements to be effective for solving the trivariate Poisson equation on the solid cylinder, deformations thereof (a turbine blade), modeling and computing geodesics on smooth free-form surfaces via the heat equation, for solving the biharmonic equation on the disk and for Koiter-type thin-shell analysis.

  3. 1-Benzylimidazolium hexafluorophosphate–1-benzylimidazole (1/1

    Directory of Open Access Journals (Sweden)

    Qing-Xiang Liu

    2008-02-01

    Full Text Available In the title compound, C10H11N2+·PF6−·C10H10N2, the H atom involved in protonation is disordered equally between the cation and the neutral molecule. The dihedral angle between the phenyl and imidazole rings is 82.6 (2°. In the crystal structure, there are head-to-tail π–π stacking interactions between imidazole rings; the interplanar separation is 3.295 (1 Å and the centroid–centroid separation is 3.448 (3 Å. In the centrosymmetric anion, two F atoms are disordered over two positions; the refined site-occupancy factors are 0.855 (11 and 0.145 (11.

  4. Hidrolisis Eceng Gondok dan Sekam Padi untuk Menghasilkan Gula Reduksi sebagai Tahap Awal Produksi Bioetanol

    Directory of Open Access Journals (Sweden)

    Wilda Azmia Naufala

    2015-12-01

    Full Text Available Eceng gondok (Eichhornia crassipes merupakan gulma air dengan pertumbuhan cepat yang disebabkan oleh eutrofikasi di badan air. Eceng gondok yang mengandung struktur lignoselulosa ini memiliki ketersediaan yang sangat melimpah. Lignoselulosa yang terdiri dari lignin, selulosa, dan hemiselulosa ini juga terkandung dalam sekam padi. Sekam padi merupakan limbah pertanian yang pemanfaatannya masih belum maksimum. Penelitian ini bertujuan untuk mengetahui campuran terbaik eceng gondok dan sekam padi yang dapat menghasilkan gula reduksi terbanyak. Perbandingan campuran eceng gondok dan sekam padi yang digunakan adalah 100:0, 75:25, 50:50, 25:72, 0:100 dengan berat total 100 gram. Tahap awal penelitian ini yaitu pretreatment dengan H2SO4 1% sebanyak 1000 mL dan pemanasan suhu 100oC selama 60 menit. Tahap selanjutnya adalah hidrolisis enzimatik dengan memanfaatkan Aspergillus niger dan Trichoderma viride dengan perbandingn 2:1. Reaktor yang digunakan merupakan reaktor kaca dengan volume 2 L. Parameter yang diukur meliputi lignoselulosa dan gula reduksi. Hasil penelitian ini menunjukkan bahwa sampel yang mengandung 100:0 eceng gondok dan sekam padi mampu menghasilkan kadar gula reduksi tertinggi, yaitu sebesar 23,33 mg/g.

  5. Studi Eksperimental Pengaruh Penambahan Sistem Ceratan pada Gasifikasi Biomassa Briket Municipal Solid Waste terhadap Performa Gasifier Tipe Downdraft

    Directory of Open Access Journals (Sweden)

    Hendra Bhakti

    2017-01-01

    Full Text Available Pemanfaatan syngas sebagai bahan bakar campuran bahan bakar mesin diesel dual fuel (DDF menimbulkan permasalahan yaitu terbuangnya syn-gas karena kelebihan produksi. Penelitian dimaksudkan melakukan penambahan sistem ceratan untuk mengalirkan kembali syngas yang terbuang karena sisa pembakaran mesin DDF ke dalam reaktor. Syngas yang dipakai berasal dari proses gasifikasi yang dilakukan pada downdraft gasifier dengan bahan bakar briket MSW. Mekanisme ceratan gas hasil gasifikasi dilakukan dengan pemasangan katup pada pipa aliran syn-gas setelah induced fan menuju reaktor gasifikasi kembali. Syngas hasil ceratan di campur dengan udara sebagai gasifying agent dengan mixer sebelum masuk ke blower udara. Laju alir massa syn-gas yang dicerat divariasikan mulai 0%, 11%, 23%, dan 54%. Dari penelitian dan analisa yang telah dilakukan, diketahui bahwa nilai rasio udara-bahan bakar menurun seiring penambahan ceratan syn-gas yaitu dari 1,04 – 0,44 dan equivalence ratio dari 0,18 – 0,09. Dengan penambahan ceratan diketahui efisiensi terbaik terjadi saat penambahan prosentasi ceratan 11% dengan efisiensi sebesar 66,81%. LHV meningkat seiring penambahan ceratan dengan LHV terbaik terjadi pada ceratan syn-gas 55% sebesar 3912,37 kJ/kg. Temperatur kerja gasifikasi cenderung menurun dengan penambahan ceratan syn-gas. Temperatur kerja T1 – T5 berada pada kisaran 70, 250, 983, 589, dan 115 ᵒC. Kandungan combustible gas meningkat dan uncombustible gas menurun seiring dengan penambahan ceratan syn-gas. Nilai kalor briket MSW sebesar 4698 kJ/kg

  6. KINETIKA HIDRODESULFURISASI DIBENZOTHIOPHENE (HDS DBT MENGGUNAKAN KATALIS NiMo/γ-Al2O3

    Directory of Open Access Journals (Sweden)

    Subagjo Subagjo

    2014-12-01

    Full Text Available Evaluasi kinetika reaksi hidrodesulfurisasi (HDS dibenzothiophene dan simulasi nafta hydrotreater yang berada di PT. PERTAMINA Refinery Unit II Dumai menggunakan katalis NiMo/Al2O3 hasil pengembangan telah dilakukan. Kinetika reaksi HDS DBT dilakukan dalan sistem reaktor batch dengan variasi temperatur 280-320oC dan tekanan 30 bar. Data kinetika diolah dengan persamaan hukum pangkat (law power dan persamaan kinetik mekanistik (Langmuir Hinshelwood, LH. Berdasarkan model hukum pangkat, kinetika HDS DBT menggunakan NiMo/Al2O3 hasil pengembangan merupakan  orde satu  terhadap DBT dengan konstanta Arhenius  sebesar 165633 detik-1 dan energi aktivasi 69017 J/mol (16,56 kkal/mol. Model LH yang cocok untuk reaksi HDS DBT menggunakan NiMo/Al2O3 hasil pengembangan adalah model LH yang mengilustrasikan adanya kompetisi antara reaktan DBT dan H2 pada tipe pusat aktif yang sama, dengan DBT teradsorb secara kuat sedangkan H2 teradsorpsi secara lemah. Energi aktifasi dan konstanta Arhenius berdasarkan model LH ini ini berturut-turut adalah 81409 J/mol (19,34 kkal/mol dan 1658133 s-1. Dengan menggunakan persamaan laju reaksi hukum pangkat, model memberikan hasil konversi sulfur yang sama dengan hasil keluaran reaktor nafta hydrotreater RU II-Dumai, yaitu mencapai 98%.

  7. Prediksi Potensi Pencemaran Pengolahan Sampah dengan Metode Gasifikasi Fluidized Bed (Studi Kasus: TPA Benowo, Surabaya

    Directory of Open Access Journals (Sweden)

    Lailatun Nikmah

    2013-03-01

    Full Text Available Sistem pengelolaan sampah di TPA Benowo masih bersistem open dumping dan belum memperhatikan dampak pencemaran terhadap lingkungan. Kuantitas sampah yang masuk ke TPA sebesar 461.705,782 ton pada tahun 2012. Kuantitas sampah diperkirakan meningkat sebanding dengan pertumbuhan penduduk, sehingga dibutuhkan skenario pengolahan sampah yang ramah lingkungan. Skenario pengolahan sampah yang akan dikaji adalah gasifikasi  fluidized bed. Potensi pencemaran gasifikasi  fluidized bed akan dikaji menggunakan metode Life Cycle Assessment (LCA dengan software SimaPro versi 7.1. Satu ton sampah pada studi ini ditentukan sebagai satu fungsi unit. Data input Life Cycle Inventory (LCI meliputi jumlah sampah yang masuk ke reaktor gasifikasi dan energi yang dibutuhkan pada proses gasifikasi berdasarkan pendekatan efisiensi reaktor gasifikasi. Penentuan nilai Life Cycle Impact Assesment (LCIA meliputi Global Warming Potential (GWP dan asidifikasi menggunakan metode Environmental Product Declarations (EPD 2008. Besar dampak dinyatakan dalam faktor emisi yang ekivalen. Kesimpulan pada penelitian ini menunjukkan bahwa skenario pengolahan sampah dengan metode gasifikasi fluidized bed memberikan dampak GWP sebesar 1067,8 kg CO2/fu pada fase start-up dan 875 kg CO2/fu pada fase energy recovery serta asidifikasi sebesar 5,93 kg SO2/fu pada fase start-up dan 4,81 kg SO2/fu pada fase energy recovery.

  8. 30 CFR 1.1 - Official emblem.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Official emblem. 1.1 Section 1.1 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR OFFICIAL EMBLEM AND OMB CONTROL NUMBERS... OFFICIAL EMBLEM § 1.1 Official emblem. The following emblem is established and shall be used as the...

  9. Superconformal SU(1, 1|n) mechanics

    OpenAIRE

    Galajinsky, Anton; Lechtenfeld, Olaf

    2016-01-01

    Recent years have seen an upsurge of interest in dynamical realizations of the superconformal group SU(1, 1|2) in mechanics. Remarking that SU(1, 1|2) is a particular member of a chain of supergroups SU(1, 1| n ) parametrized by an integer n , here we begin a systematic study of SU(1, 1| n ) multi-particle mechanics. A representation of the superconformal algebra su(1, 1| n ) is constructed on the phase space spanned by m copies of the (1, 2 n , 2 n −1) supermultiplet. We show that the dynami...

  10. Main: 1FK1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1FK1 トウモロコシ Corn Zea mays L. Nonspecific Lipid-Transfer Protein Precursor Zea Mays ...RGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN corn_1FK1.jpg ...

  11. 26 CFR 1.1-1 - Income tax on individuals.

    Science.gov (United States)

    2010-04-01

    ... section 1(a) as amended by the Tax Reform Act of 1969. For other rates of tax on individuals, see section... Code as amended by the Tax Reform Act of 1969) Single individual Sec. 1(a)(1) Sec. 1(a)(2) Sec. 1(c... indicated in such table. (4) The provisions of section 1 of the Code, as amended by the Tax Reform Act of...

  12. 45 CFR 1211.1-1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Purpose. 1211.1-1 Section 1211.1-1 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE VOLUNTEER GRIEVANCE PROCEDURES § 1211.1-1 Purpose. This part establishes procedures under which certain volunteers...

  13. 26 CFR 1.556-1 - Definition.

    Science.gov (United States)

    2010-04-01

    ... TAXES (CONTINUED) Foreign Personal Holding Companies § 1.556-1 Definition. Undistributed foreign personal holding company income is the amount which is to be included in the gross income of the United... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Definition. 1.556-1 Section 1.556-1 Internal...

  14. 26 CFR 1.545-1 - Definition.

    Science.gov (United States)

    2010-04-01

    ... TAXES (CONTINUED) Personal Holding Companies § 1.545-1 Definition. (a) Undistributed personal holding company income is the amount which is subject to the personal holding company tax imposed under section... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Definition. 1.545-1 Section 1.545-1 Internal...

  15. H1N1 influenza (Swine flu)

    Science.gov (United States)

    Swine flu; H1N1 type A influenza ... The H1N1 virus is now considered a regular flu virus. It is one of the three viruses included in the regular (seasonal) flu vaccine . You cannot get H1N1 flu virus from ...

  16. 48 CFR 1.602-1 - Authority.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 1.602-1 Section... ACQUISITION REGULATIONS SYSTEM Career Development, Contracting Authority, and Responsibilities 1.602-1 Authority. (a) Contracting officers have authority to enter into, administer, or terminate contracts and...

  17. 16 CFR 1.1 - Policy.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Policy. 1.1 Section 1.1 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL PROCEDURES Industry... substantial or novel question of fact or law and there is no clear Commission or court precedent; or (2) The...

  18. USEEIO v1.1 - Matrices

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset provides the basic building blocks for the USEEIO v1.1 model and life cycle results per $1 (2013 USD) demand for all goods and services in the model in...

  19. Glucagon-like peptide-1 (GLP-1)

    DEFF Research Database (Denmark)

    Skov, Jeppe; Dejgaard, Anders; Frøkiær, Jørgen

    2013-01-01

    Glucagon-like peptide-1 (GLP-1) is an incretin hormone with multiple actions in addition to control of glucose homeostasis. GLP-1 is known to cause natriuresis in humans, but the effects on basic renal physiology are still partly unknown.......Glucagon-like peptide-1 (GLP-1) is an incretin hormone with multiple actions in addition to control of glucose homeostasis. GLP-1 is known to cause natriuresis in humans, but the effects on basic renal physiology are still partly unknown....

  20. Variant Humicola grisea CBH1.1

    Energy Technology Data Exchange (ETDEWEB)

    Goedegebuur, Frits; Gualfetti, Peter; Mitchinson, Colin; Larenas, Edmund

    2017-05-09

    Disclosed are variants of Humicola grisea CeI7A (CBH1.1), H. jecorina CBH1 variant or S. thermophilium CBH1, nucleic acids encoding the same and methods for producing the same. The variant cellulases have the amino acid sequence of a glycosyl hydrolase of family 7A wherein one or more amino acid residues are substituted.

  1. H1N1 viral pneum

    Directory of Open Access Journals (Sweden)

    Ahmed Samir

    2016-12-01

    Conclusion: MDCT picture of H1N1 chest infection is highly variable with a spectrum of HRCT findings ranging from focal patchy ground glass attenuation to diffuse alveolar damage (DAD or adult respiratory distress syndrome (ARDS. Still, constellation of clinical data and HRCT findings especially in endemic areas can raise the suspicion of H1N1.

  2. 18 CFR 1b.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Section 1b.1 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY GENERAL RULES RULES RELATING TO INVESTIGATIONS § 1b.1 Definitions. For purposes of this part— (a... pipelines, electric utilities and hydroelectric projects. [43 FR 27174, June 23, 1978, as amended by Order...

  3. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    Henriksen, Lars; Autrup, Herman

    1970-01-01

    The reaction of dipotassium 2-nitroethylene-1,1-dithiolate (III) with α-halogeno aldehydes or ketones leads to derivatives of 3-nitro-thiophene-2-thiols. These reactions proceed by an acid catalyzed cyclization of the initially formed 1-(acylmethylthio)-2-nitroethylene-1-thiolates (IV). The infra...

  4. 75 FR 27411 - Airworthiness Directives; Turbomeca Arriel 1B, 1D, 1D1, and 1S1 Turboshaft Engines

    Science.gov (United States)

    2010-05-17

    ..., Version 148), 1D1, and 1D. since-new (TSN) or in-service-since-last- E, dated October 29, time-since...,200 hours TSN Within 150 hours TSLRPC A292 72 0810, Version or TSO or 3,500 CSN or C, dated July 24...

  5. 75 FR 11072 - Airworthiness Directives; Turbomeca Arriel 1B, 1D, 1D1, and 1S1 Turboshaft Engines

    Science.gov (United States)

    2010-03-10

    ..., Version 148), 1D1, and 1D. since-new (TSN) or in-service-since-last- E, dated October 29, time-since...,200 hours TSN Within 150 hours TSLRPC A292 72 0810, Version or TSO or 3,500 CSN or C, dated July 24...

  6. Carboxylesterase 1 genes

    DEFF Research Database (Denmark)

    Rasmussen, Henrik Berg; Madsen, Majbritt Busk

    2018-01-01

    The carboxylesterase 1 gene (CES1) encodes a hydrolase that metabolizes commonly used drugs. The CES1-related pseudogene, carboxylesterase 1 pseudogene 1 (CES1P1), has been implicated in gene exchange with CES1 and in the formation of hybrid genes including the carboxylesterase 1A2 gene (CES1A2...... region was revealed. In conclusion, many procedures for CES1, CES1A2 and CES1P1 genotyping appear to lack specificity. Knowledge about the segmental duplications may improve the typing of these genes....

  7. Technetium (tin) ethane-1-hydroxy-1, 1-diphosphonate complexes

    International Nuclear Information System (INIS)

    Brand, J.A.G.M.

    1981-10-01

    The aim of this thesis is to establish the experimental conditions for the optimal preparation of the sup(99m)Tc(Sn)EHDP bone scanning agent. The pH and the concentrations of EHDP (ethane-1-hydroxy-1,1-disodium diphosphonate) and of Sn(II) may affect the yield and the biodistribution of the radiopharmacon. The investigation of the influence of these parameters is the subject of this investigation. (Auth.)

  8. Next-Generation 9-1-1.

    Science.gov (United States)

    2012-01-01

    The nations current 9-1-1 system is designed around outdated telephone technology : and cannot handle the text, data, images, and video that are common in personal : communications and critical to future safety and mobility advances. In addition, ...

  9. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    Henriksen, L.; Autrup, Herman

    1972-01-01

    A series of thieno[3,2-e]-3,4-dihydro-1,2,3-triazin-4-ones (V) and thieno[3,4-e]-3,4-dihydro-1,2,3-triazin-4-ones (VI) were prepared by diazotation of 3-aminothiophene-2-carboxamides (III) and 4-amino-thiophene-3-carboxamides (IV), respectively, both obtained by cyclization of 2-cyanoethylene-1,1...

  10. USEEIOv1.1 - openLCA

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is a version of the full USEEIO v1.1 model in the openLCA schema serialized as JSON-LD that can be imported into openLCA software (www.openlca.org) v1.5 and...

  11. Pandemic influenza A (H1N1)

    African Journals Online (AJOL)

    ... in Port Shepstone, South Africa. Introduction. Influenza A (H1N1) 2009 'swine flu' variant is currently a global pandemic.1 The infection associated with this virus is usually a mild, self-limiting illness. However, it may progress to severe pneumonia requiring intensive care unit (ICU) therapy in 31% of patients.2 This may.

  12. SHEBA Research Project D1.1

    DEFF Research Database (Denmark)

    Boteler, Benjamin; Tröltzsch, Jenny; Abhold, Katrina

    2015-01-01

    activity can be assessed. This assessment is conducted within the BONUS project Sustainable Shipping and Environment of the Baltic Sea region (SHEBA), Work Package 1, Policies, Activity Data and Scenarios, Task 1.1 Drivers and policy for the shipping sector. The results of this Task will be used to help...

  13. Some basics of $su(1,1)$

    OpenAIRE

    Novaes, Marcel

    2004-01-01

    A basic introduction to the $su(1,1)$ algebra is presented, in which we discuss the relation with canonical transformations, the realization in terms of quantized radiation field modes and coherent states. Instead of going into details of these topics, we rather emphasize the existing connections between them. We discuss two parametrizations of the coherent states manifold $SU(1,1)/U(1)$: as the Poincar{\\'e} disk in the complex plane and as the pseudosphere (a sphere in a Minkowskian space), ...

  14. PODAAC-SST00-1D1M1

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains sea surface temperature (SST) data on a monthly 1 degree grid from the Advanced Microwave Scanning Radiometer (AMSR-E) aboard NASA's Aqua...

  15. PODAAC-DYNTO-1D1M1

    Data.gov (United States)

    National Aeronautics and Space Administration — The absolute dynamic topography data (similar to sea level but with respect to the geoid) are on monthly 1 degree grids. These data were generated to help support...

  16. AMSRE_L3_SST_1DEG_1MO:1

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains sea surface temperature (SST) data on a monthly 1 degree grid from the Advanced Microwave Scanning Radiometer (AMSR-E) aboard NASA's Aqua...

  17. PODAAC-SSTNO-1D1M1

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains the number of observations corresponding to sea surface temperature (SST) data on monthly 1 degree grids from the Advanced Microwave Scanning...

  18. Data of evolutionary structure change: 1YDVA-1AG1O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-1AG1O 1YDV 1AG1 A O --RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDV...SGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGFMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTGKVATPQQAQEAHALIRSWVSSKIGADVA.../index> 1YDV A 1YDVA 1 1YDV A 1YDVA...> CYS CA 492 1YDV A 1YDVA

  19. Cloning and tissue expression of cytochrome P450 1B1 and 1C1 ...

    African Journals Online (AJOL)

    Cytochrome P450 1 (CYP1) is widely used as an indicator of exposure to environmental contaminants. In the study, two full-length complementary DNAs encode for CYP1B1 and CYP1C1 were cloned from medaka liver exposed to 500 ppb β-naphthoflavone for 24 h. CYP1B1, having 1984 bp, contains an open reading ...

  20. Density functional study of hypophosphite adsorption on Ni (1 1 1) and Cu (1 1 1) surfaces

    International Nuclear Information System (INIS)

    Zeng Yue; Liu Shubin; Ou Lihui; Yi Jianlong; Yu Shanci; Wang Huixian; Xiao Xiaoming

    2006-01-01

    Surface structures and electronic properties of hypophosphite, H 2 PO 2 - , molecularly adsorbed on Ni(1 1 1) and Cu(1 1 1) surfaces are investigated in this work by density functional theory at B3LYP/6-31++g(d, p) level. We employ a four-metal-atom cluster as the simplified model for the surface and have fully optimized the geometry and orientation of H 2 PO 2 - on the metal cluster. Six stable orientations have been discovered on both Ni (1 1 1) and Cu (1 1 1) surfaces. The most stable orientation of H 2 PO 2 - was found to have its two oxygen atoms interact the surface with two P-O bonds pointing downward. Results of the Mulliken population analysis showed that the back donation from 3d orbitals of the transition metal substrate to the unfilled 3d orbital of the phosphorus atom in H 2 PO 2 - and 4s orbital's acceptance of electron donation from one lone pair of the oxygen atom in H 2 PO 2 - play very important roles in the H 2 PO 2 - adsorption on the transition metals. The averaged electron configuration of Ni in Ni 4 cluster is 4s 0.63 4p 0.02 3d 9.35 and that of Cu in Cu 4 cluster is 4s 1.00 4p 0.03 3d 9.97 . Because of this subtle difference of electron configuration, the adsorption energy is larger on the Ni surface than on the Cu surface. The amount of charge transfers due to above two donations is larger from H 2 PO 2 - to the Ni surface than to the Cu surface, leading to a more positively charged P atom in Ni n H 2 PO 2 - than in Cu n H 2 PO 2 - . These results indicate that the phosphorus atom in Ni n H 2 PO 2 - complex is easier to be attacked by a nucleophile such as OH - and subsequent oxidation of H 2 PO 2 - can take place more favorably on Ni substrate than on Cu substrate

  1. 2+1 gravity for genus >1

    International Nuclear Information System (INIS)

    Nelson, J.E.; Regge, T.

    1991-01-01

    We analysed the algebra of observables for the simple case of a genus 1 initial data surface Σ 2 for 2+1 De Sitter gravity. Here we extend the analysis to higher genus. We construct for genus 2 the group of automorphisms H of the homotopy group π 1 induced by the mapping class group. The group H induces a group D of canonical transformations on the algebra of observables which is related to the braid group for 6 threads. (orig.)

  2. Growth of monocrystalline Cu(1 1 1) films on MgO(1 1 1) by pulsed laser deposition

    Energy Technology Data Exchange (ETDEWEB)

    Aweke, F.; Antoni, F. [ICube, Université de Strasbourg-CNRS(UMR 7357), 23 rue du Loess, 67037 Strasbourg (France); Hulik, J. [ICube, Université de Strasbourg-CNRS(UMR 7357), 23 rue du Loess, 67037 Strasbourg (France); Comenius University in Bratislava, Faculty of Mathematics, Physics and Informatics, Department of Experimental Physics, Mlynská dolina F2, 842 48 Bratislava (Slovakia); Morvan, G. [LHyGeS – Laboratoire d’Hydrologie et de Géochimie de Strasbourg, Université de Strasbourg-CNRS-EOST, 1 rue Blessing, 67084 Strasbourg (France); Speisser, C. [ICube, Université de Strasbourg-CNRS(UMR 7357), 23 rue du Loess, 67037 Strasbourg (France); Veis, P. [Comenius University in Bratislava, Faculty of Mathematics, Physics and Informatics, Department of Experimental Physics, Mlynská dolina F2, 842 48 Bratislava (Slovakia); Le Normand, F., E-mail: francois.le-normand@unistra.fr [ICube, Université de Strasbourg-CNRS(UMR 7357), 23 rue du Loess, 67037 Strasbourg (France)

    2015-05-01

    Copper (Cu) films with a minimal thickness of 300 nm were grown on MgO(1 1 1) substrates in high vacuum by pulsed laser deposition (PLD) at various temperatures to achieve a single crystal Cu film with flat terraces without grain boundaries. We investigated the effect of the substrate temperature, the pulse repetition rate, the deposition time and the laser fluence. A temperature threshold is observed above which the growth mode is changed from a uniform flat mode to a three dimensional mode. A combined process involving a germination step at moderate temperature followed by a growth step at higher temperature yields a 450 nm almost continuous film.

  3. 26 CFR 302.1-1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... TAXES UNDER THE INTERNATIONAL CLAIMS SETTLEMENT ACT, AS AMENDED AUGUST 9, 1955 § 302.1-1 Definitions. (a... claiming an interest in vested property or liable or charged with liability for internal revenue tax in... vesting and any successor in interest by inheritance, devise, bequest, or operation of law, of such owner...

  4. 33 CFR 1.08-1 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... criminal penalty procedures under subpart 1.07 of this part: (1) 46 CFR 25.05 whistles or other sound...) 46 U.S.C. 103, documented yachts; (7) 33 CFR part 155 oil pollution prevention; and (8) 46 CFR 25.30...

  5. Ciencias 1. (Science 1). [Student's Workbook].

    Science.gov (United States)

    Raposo, Lucilia

    Ciencias 1 is the first in a series of science books designed for elementary Portuguese-speaking students. The book contains five sections divided into 43 lessons. The five sections are (1) Matter, (2) The Human Body, (3) Weather, (4) Solids, Liquids, and Gases, and (5) Living Things. Pictorial presentations and picture exercises are included for…

  6. General Relativity in (1 + 1) Dimensions

    Science.gov (United States)

    Boozer, A. D.

    2008-01-01

    We describe a theory of gravity in (1 + 1) dimensions that can be thought of as a toy model of general relativity. The theory should be a useful pedagogical tool, because it is mathematically much simpler than general relativity but shares much of the same conceptual structure; in particular, it gives a simple illustration of how gravity arises…

  7. Antiviral Prophylaxis and H1N1

    Centers for Disease Control (CDC) Podcasts

    2011-07-14

    Dr. Richard Pebody, a consultant epidemiologist at the Health Protection Agency in London, UK, discusses the use of antiviral post-exposure prophylaxis and pandemic H1N1.  Created: 7/14/2011 by National Center for Emerging Zoonotic and Infectious Diseases (NCEZID).   Date Released: 7/18/2011.

  8. Release Notes for Whisper-1.1

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Forrest B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rising, Michael Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Alwin, Jennifer Louise [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-04-27

    Whisper is a statistical analysis package developed in 2014 to support nuclear criticality safety (NCS) validation [1-3]. It uses the sensitivity profile data for an application as computed by MCNP6 [4-6] along with covariance files [7,8] for the nuclear data to determine a baseline upper-subcritical-limit (USL) for the application. Whisper version 1.0 was first developed and used at LANL in 2014 [3]. During 2015-2016, Whisper was updated to version 1.1 [9] and is to be included with the upcoming release of MCNP6.2. This document describes the Whisper-1.1 package that will be included with the MCNP6.2 release during 2017. Specific details are provided on the computer systems supported, the software quality assurance (SQA) procedures, installation, and testing. This document does not address other important topics, such as the importance of sensitivity-uncertainty (SU) methods to NCS validation, the theory underlying SU methodology, tutorials on the usage of MCNP-Whisper, practical approaches to using SU methodology to support and extend traditional validation, etc. There are over 50 documents included with Whisper-1.1 and available in the MCNP Reference Collection on the MCNP website (mcnp.lanl.gov) that address all of those topics and more. In this document, however, a complete bibliography of relevant MCNP-Whisper references is provided.

  9. Mammalian CD1 and MR1 genes.

    Science.gov (United States)

    Reinink, Peter; Van Rhijn, Ildiko

    2016-08-01

    All higher vertebrates share the fundamental components of the adaptive immune system: the B cell receptor, the T cell receptor, and classical MHC proteins. At a more detailed level, their immune systems vary considerably, especially with respect to the non-polymorphic MHC class I-like proteins. In mammals, the CD1 family of lipid-presenting proteins is encoded by clusters of genes of widely divergent sizes and compositions. Another MHC class I-like protein, MR1, is typically encoded by a single gene that is highly conserved among species. Based on mammalian genomes and the available data on cellular expression profiles and protein structure, we review MR1 genes and families of CD1 genes in modern mammals from a genetic and functional perspective. Understanding the CD1 and MR1 systems across animal species provides insights into the specialized functions of the five types of CD1 proteins and facilitates careful consideration of animal models for human diseases in which immune responses to lipids and bacterial metabolites play a role.

  10. Type 1 diabetes

    Science.gov (United States)

    Insulin-dependent diabetes; Juvenile onset diabetes; Diabetes - type 1; High blood sugar - type 1 diabetes ... Type 1 diabetes can occur at any age. It is most often diagnosed in children, adolescents, or young adults. Insulin is ...

  11. 26 CFR 1.1083-1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... company is not so large (considering the state of the art and the area or region affected) as to impair... O, chapter 1 of the Code. As therein defined, the term includes voting trust certificates and stock...

  12. G1SST, 1km blended SST

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A daily, global Sea Surface Temperature (SST) data set is produced at 1-km (also known as ultra-high resolution) by the JPL ROMS (Regional Ocean Modeling System)...

  13. PODAAC-QSNON-L1CA1

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset contains geo-located and averaged Level 1B Sigma-0 measurements and wind retrievals from the SeaWinds on QuikSCAT platform, initiated in the months...

  14. SPARK Version 1.1 user manual

    International Nuclear Information System (INIS)

    Weissenburger, D.W.

    1988-01-01

    This manual describes the input required to use Version 1.1 of the SPARK computer code. SPARK 1.1 is a library of FORTRAN main programs and subprograms designed to calculate eddy currents on conducting surfaces where current flow is assumed zero in the direction normal to the surface. Surfaces are modeled with triangular and/or quadrilateral elements. Lorentz forces produced by the interaction of eddy currents with background magnetic fields can be output at element nodes in a form compatible with most structural analysis codes. In addition, magnetic fields due to eddy currents can be determined at points off the surface. Version 1.1 features eddy current streamline plotting with optional hidden-surface-removal graphics and topological enhancements that allow essentially any orientable surface to be modeled. SPARK also has extensive symmetry specification options. In order to make the manual as self-contained as possible, six appendices are included that present summaries of the symmetry options, topological options, coil options and code algorithms, with input and output examples. An edition of SPARK 1.1 is available on the Cray computers at the National Magnetic Fusion Energy Computer Center at Livermore, California. Another more generic edition is operational on the VAX computers at the Princeton Plasma Physics Laboratory and is available on magnetic tape by request. The generic edition requires either the GKS or PLOT10 graphics package and the IMSL or NAG mathematical package. Requests from outside the United States will be subject to applicable federal regulations regarding dissemination of computer programs. 22 refs

  15. Persuasion in 1 Corinthians 1:1-9

    Directory of Open Access Journals (Sweden)

    Andries H. Snyman

    2009-09-01

    Full Text Available In this article, 1 Corinthians 1:1�9 is analysed from a perspective that differs from the typical approach of researchers, who tend to force ancient rhetorical categories on the letter. The analysis is done in terms of what is called a �grounded theoretical approach�. This approach is briefly summarised, followed by a description of the rhetorical situation of the letter and a systematic analysis of these nine verses. It will be argued that these verses are an integral part of Paul�s rhetorical strategy, constructed from the text itself and aimed at persuading the Corinthians to accept his authority as apostle and to follow his instructions in realising their new life in Christ. The conclusion is that a text-centred approach with its focus on the functional aspects of the text provides a better understanding of Paul�s rhetorical strategy than a typical rhetorical analysis, with its focus on the formal aspects of the text.

  16. Master equipment list -- Phase 1. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Jech, J.B.

    1995-04-28

    The purpose of this document is to define the system requirements for the Master Equipment List (MEL) Phase 1 project. The intended audience for this document includes Data Automation Engineering (DAE), Configuration Management Improvement and Control Engineering (CMI and CE), Data Administration Council (DAC), and Tank Waste Remedial System (TWRS) personnel. The intent of Phase 1 is to develop a user-friendly system to support the immediate needs of the TWRS labeling program. Phase 1 will provide CMI and CE the ability to administrate, distribute, and maintain key information generated by the labeling program. CMI and CE is assigning new Equipment Identification Numbers (EINs) to selected equipment in Tank Farms per the TWRS Data Standard ``Tank Farm Equipment Identification Number``. The MEL Phase 1 system will be a multi-user system available through the HLAN network. It will provide basic functions such as view, query, and report, edit, data entry, password access control, administration and change control. The scope of Phase 1 data will encompass all Tank Farm Equipment identified by the labeling program. The data will consist of fields from the labeling program`s working database, relational key references and pointers, safety class information, and field verification data.

  17. Table S1.xls

    Indian Academy of Sciences (India)

    Choong Yong

    38, Medaka (Oryzias latipes), Nome. 39, Stickleback (Gasterosteus aculeatus), None. 40, Fugu (Takifugu rubripes), Fugu_PPP1R1A, ENSTRUP00000023365. 41, Tetraodon (Tetraodon nigroviridis), Tetraodon_PPP1R1A, ENSTNIP00000017863. 42, Tilapia (Oreochromis niloticus), None. 43, Zebrafish (Danio rerio), None.

  18. PENURUNAN COD, TSS DAN TOTAL FOSFAT PADA SEPTIC TANK LIMBAH MATARAM CITRA SEMBADA CATERING DENGAN MENGGUNAKAN WASTEWATER GARDEN (Degradation of COD, TSS and Total Phosphate in Septic Tank Wastewater of Mataram Citra Sembada Catering Using Wastewater

    Directory of Open Access Journals (Sweden)

    Dradjat Suhardjo

    2008-07-01

    Full Text Available ABSTRAK  Sumber limbah berasal dari septictank industri restauran (catering Citra Sembada Catering, termasuk dalam kategori limbah domestik. Limbah tersebut banyak mengandung komponen yang tidak diinginkan bila dibuang ke badan air. Konsentrasi limbah yang masih di atas baku mutu, di antaranya akan memunculkan masalah pencemaran. Reaktor Wastewater Garden yang menggunakan krikil (0,5Cm-1cm dan 6 jenis tanaman yaitu : melati air (Echinodoras paleafias, Cyperus (Cyperus, Futoi (Hippochaetes lymnenalis, Pisang air (Typhonodorum indleyanum, Pickerel rush (Pontedoria cordata, Cattail (Typha latifulia. Penelitian ini bertujuan untuk mengetahui tingkat efektivitas reaktor Wastewater Garden, apabila digunakan untuk menurunkan konsentrasi Chemical Oxygen Demand (COD, Total Suspended Solid (TSS dan Fosfat Total sebagai faktor pencemar pada limbah industri restauran (Citra Sembada Catering yang tertampung pada septictank. Penelitian dilakukan dengan menggunakan reaktor Wastewater Garden dengan sistem batch dan dimensi reaktor lm x 0.5m x lm. Zona air limbah 75 cm, dan zona substrat atau krikil 80 cm, akar tanaman ditanam sedalam l0-15 cm. Metode penelitian yang digunakan berdasarkan SNI, di mana COD mengacu pada SNI 06-6989.2-2004 metode refluks tertutup secara spektrofotometri, TSS mengacu pada SK SNI M-03-1990-F metode pengujian secara gravimetri dan Fosfat total mengacu pada SNI M-52-1990-03 metode asam askorbat dengan alat spektrofotometer. Penelitian ini dilakukan selama 12 hari di mana setiap 3 hari sampel diambil pada outlel kemudian dianalisis. Berdasarkan hasil penelitian ini, diperoleh bahwa penggunaan wastewater garden pada limbah cair Mataram Citra Sembada Catering dapat menurunkan COD dengan efektivitas optimum 40,81% pada hari ke-6, penurunan TSS 89,l2% pada efektifitas optirnum hari ke-12 dan penurunan fosfat total dengan efektivitas optimum pada hari ke-6 yaitu sebesar 99,73 %. Tanaman dapat hidup dengan subur.   ABSTRACT  Wastewater

  19. Pengaruh Jenis Bahan pada Proses Pirolisis Sampah Organik menjadi Bio-Oil sebagai Sumber Energi Terbarukan

    Directory of Open Access Journals (Sweden)

    M. Sigit Cahyono

    2013-06-01

    Full Text Available Sampah organik merupakan potensi sumber energi yang melimpah di Indonesia. Sampah organik berupa daun dan ranting kering bisa dikonversi menjadi bahan bakar berupa bio-oil melalui proses fast pirolisis. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh jenis bahan terhadap rendemen dan nilai kalor bio-oil yang dihasilkan dari proses pirolisis sampah organik. Bahan baku berupa daun dan ranting kering campuran tanaman angsana, mahoni dan mangga dengan komposisi daun bervariasi 0%, 50%, dan 100%, dipotong-potong dengan ukuran maksimal 10 cm. Kemudian bahan baku tersebut dipanaskan di dalam reaktor pirolisis pada suhu 500 C selama 1 jam. Hasil penelitian menunjukkan bahwa nilai kalor tertinggi (5175,35 J/g dan rendemen tertinggi (24,5% didapatkan pada bio-oil yang dihasilkan dari pirolisis ranting 100%. Kata kunci: Sampah Organik, Bio-oil, Pirolisis, Rendemen, Nilai Kalor

  20. Mammalian CD1 and MR1 genes

    OpenAIRE

    Reinink, Peter; Van Rhijn, Ildiko

    2016-01-01

    All higher vertebrates share the fundamental components of the adaptive immune system: the B cell receptor, the T cell receptor, and classical MHC proteins. At a more detailed level, their immune systems vary considerably, especially with respect to the non-polymorphic MHC class I-like proteins. In mammals, the CD1 family of lipid-presenting proteins is encoded by clusters of genes of widely divergent sizes and compositions. Another MHC class I-like protein, MR1, is typically encoded by a sin...

  1. Data of evolutionary structure change: 1YDVA-1AG1T [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-1AG1T 1YDV 1AG1 A T --RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDV...EPVWAIGTGKVATPQQAQEAHALIRSWVSSKIGADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPEFVDIIKATQ -- EEEE HH...in> 1YDV A 1YDVA NLDFDPSKLDV 1YDV A 1YDVA

  2. Rwanda Journal - Vol 1, No 1 (2016)

    African Journals Online (AJOL)

    Investigation of quasi periodic signals of X-Ray bursts from neutron star AXP 1E2259+586 using Fourier analysis techniques · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Ally, N.T. Jiwaji ...

  3. 1 - 6_Abubakar and Muhammad_1

    African Journals Online (AJOL)

    User

    A research was carried out to determine the role of Bacillus megaterium and soil pH in relation to ... microorganisms solubilize inorganic phosphate. .... Organic carbon was determined using walkley and Black method. (Walkley and Black, 1934).Available phosphorus was determined using Bray No 1 (Bray and Kurtz, 1945).

  4. AFRREV IJAH, Vol.1 (1) Feb., 2012

    African Journals Online (AJOL)

    User

    This geological background and the anthropogenic nature of the environment are sufficient indication of pollutional stress on the rivers. The study reveal that the chemical .... electricity by the Power Holding Company of Nigeria (PHCN) (iv) The ... The foregoing discussion of the geology of the study area reveals that:- 1.

  5. Mizan 1.1, post-print

    African Journals Online (AJOL)

    eliasn

    B, LL.M, Lecturer in Law, St. Mary's. University College. 1 “The Law of Lagos” Resolution in M. Hamalengwa and others (eds) The ..... would mean that the Court would lose its independence from the AU and possible from the political concerns ...

  6. Annual report 2002. 1.1.-21.1.2002

    International Nuclear Information System (INIS)

    Pillar, V.

    2003-01-01

    In this Annual report of the Slovak Electric, plc (Slovenske elektrarne, a.s.) the results of operation in 2002 for the period from January 1 to January 21 are presented. It is unusual for a year to be considered as a matter of a few days, however, this is the case given the events at Slovak Electric, joint stock company which as of 21. 1. 2002 was dissolved and from which three new joint stock companies were established. Further proof of this is the annual report for 2002, which details the economic performance of the company during these 21 days, and the quantity of electricity and heat it generated and supplied to consumers. I am pleased to be able to state that this period of far-reaching changes during which the division of Slovak Electric, joint stock company into the new Slovak Electric, joint stock company, Slovak Electricity Transmission System, joint stock company and Heat Plant Kosice, joint stock company took place, did not cause any problems for Slovak consumers of electricity and heat. During the mentioned 21 January days of 2002, the sources of Slovak Electric generated 836,751 MWh of electricity, which represents 107 percent of the planned generation. The net profit for this period was 742,920 thousand crowns, the main influence being, of course, its short duration. As our economists have confirmed, the most important fact with a significant impact on net profit can be considered to be the amount of deferred taxes, which totalled 1,026,789 thou. Sk. With respect to the dissolution of the company, the company will apply 50 % tax depreciation from annual depreciation, which will, however, be reflected in the results of the newly established company - SE, a.s., as in the subsequent 344 day period its tax deductible depreciation will fall. It is clear that in the forthcoming period, in addition to this, many financial issues remain to be resolved by the management connected with the new form of the business, price, and management relationships within

  7. NEUTRONICS ANALYSIS ON MINI TEST FUEL IN THE RSG-GAS CORE

    Directory of Open Access Journals (Sweden)

    Tukiran Surbakti

    2016-03-01

    Full Text Available Abstract NEUTRONICS ANALYSIS ON MINI TEST FUEL IN THE RSG-GAS CORE. Research of UMo fuel for research reactor has been developing  right now. The fuel of  research reactor used is uranium low enrichment with high density. For supporting the development of fuel, an assessment of mini fuel in the RSG-GAS core was performed. The mini fuel are U7Mo-Al and U6Zr-Al with densitis of 7.0gU/cc and 5.2 gU/cc, respectively. The size of both fuel are the same namely 630x70.75x1.30 mm were inserted to the 3 plates of dummy fuel. Before being irradiated in the core, a calculation for safety analysis  from neutronics and thermohydrolics aspects were required. However, in this paper will discuss safety analysis of the U7Mo-Al and U6Zr-Al mini fuels from neutronic point of view.  The calculation was done using WIMSD-5B and Batan-3DIFF code. The result showed that both of the mini fuels could be irradiated in the RSG-GAS core with burn up less than 70 % within 12 cycles of operation without over limiting the safety margin. Power density of U7Mo-Al mini fuel bigger than U6Zr-Al fuel.   Key words: mini fuel, neutronics analysis, reactor core, safety analysis   Abstrak ANALISIS NEUTRONIK ELEMEN BAKAR UJI MINI DI TERAS RSG-GAS. Penelitian tentang bahan bakar UMo untuk reaktor riset terus berkembang saat ini. Bahan bakar reaktor riset yang digunakan adalah uranium pengkayaan rendah namun densitas tinggi.  Untuk mendukung pengembangan bahan bakar dilakukan uji elemen bakar mini di teras reakror RSG-GAS dengan tujuan menentukan jumlah siklus di dalam teras sehingga tercapai fraksi bakar maksimum. Bahan bakar yang diuji adalah U7Mo-Al dengan densitas 7,0 gU/cc dan U6Zr-Al densitas 5,2 gU/cc. Ukuran kedua bahan bakar uji tersebut adalah sama 630x70,75x1,30 mm dimasukkan masing masing kedalam 3 pelat dummy bahan bakar. Sebelum diiradiasi ke dalam teras reaktor maka perlu dilakukan perhitungan keselamatan baik secara neutronik maupun termohidrolik. Dalam makalah ini

  8. DESAIN KONSEP TANGKI PENAMPUNG BAHAN BAKAR PASSIVE COMPACT MOLTEN SALT REACTOR

    Directory of Open Access Journals (Sweden)

    A. Hadiwinata

    2015-04-01

    Full Text Available Passive Compact Molten Salt Reactor (PCMSR merupakan pengembangan dari reaktor MSR. Desain reaktor PCMSR membutuhkan tempat khusus penampung sementara bahan bakar pada saat terjadi insiden, misalnya kecelakaan yang menyebabkan peningkatan suhu bahan bakar. Tangki penampung bahan bakar tersusun dari 3 bagian yang saling terhubung yaitu bagian penampung cairan bahan bakar, cerobong (chimney, dan penukar kalor. Dalam penelitian ini, tangki dimodelkan secara lump dan dilakukan variasi daya awal reaktor dan ketinggian cerobong. Syarat batas model ditetapkan suhu bahan bakar maksimum 1400 °C, yang didasarkan pada titik didih larutan garam LiF-BeF2-ThF4-UF4. Analisis dilakukan dengan cara menghitung rugi tekanan total dan transfer kalor untuk variasi daya awal antara 1800-3000 MWth dan ketinggian cerobong antara 1-10 m. Hasil penelitian menunjukan semakin besar daya reaktor, maka tinggi tangki penampung bahan bakar dan tinggi alat penukar kalor yang dibutuhkan akan semakin besar, tejadi kenaikan suhu fluida pendingin dan suhu udara pendingin, dan menyebabkan kenaikan laju aliran masa fluida pendingin, sedangkan laju aliran masa udara menurun. Peningkatan ketinggian cerobong menyebabkan ketinggian tangki penampung bahan bakar dan ketinggian alat penukar kalor semakin menurun, penurunan suhu fluida pendingin, tetapi suhu udara meningkat, dan menyebabkan peningkatan laju aliran masa fluida pendingin, tetapi laju aliran masa udara akan semakin menurun. Kata kunci: PCMSR, cerobong, alat penukar kalor, variasi daya.   The Passsive Compact Molten Salat Reactor (PCMSR reactor is developed from MSR reactor. The PCMSR reactor design requires special place to temporarily storage for reactor fuel when incident occurs, such as when there is an accident which caused the temperature of the fuel increases. The tank consist of three interconnected parts, the reservoir liquid fuel, chimney, and the heat exchanger. In this research, the tank system is modeled based on

  9. ANALISIS TERMAL-ALIRAN KISI BAHAN BAKAR BOLA TERAS RGTT200K DENGAN FLUENT

    Directory of Open Access Journals (Sweden)

    Mohammad Dhandhang Purwadi

    2015-03-01

    Full Text Available Sejalan dengan Perpres No.5/2010, PTRKN-BATAN mengembangkan dua varian desain konseptual reaktor daya maju kogenerasi, yaitu RGTT200K dan RGTT200KT. Energi termal pada kedua sistem reaktor ini dipasok oleh teras reaktor berbahan bakar bola dengan daya termal 200 MWt. Komposisi geometri dan struktur teras didesain agar dapat menghasilkan keluaran pendingin gas helium bertemperatur 950OC sehingga dapat digunakan untuk produksi hidrogen dan atau unit industri proses lainnya secara kogeneratif. Luaran gas helium bertemperatur sangat tinggi ini akan menimbulkan tegangan termal pada bola bahan bakar yang mengancam integritas sistem pengungkungan produk fisi di dalamnya. Oleh karena itu perlu dilakukan analisis termal-aliran untuk mengetahui distribusi temperatur dan aliran pendingin gas helium dalam kisi bahan bakar bola. Salah satu cara terbaik untuk melakukan analisis termal-aliran adalah dengan pemodelan tiga dimensi menggunakan perangkat lunak komputasi dinamika fluida (computational fluid dynamics yang teruji. Dalam penelitian ini digunakan perangkat lunak FLUENT 6.3. Analisis termal aliran pada kisi bola bahan bakar dilakukan dengan memodelkan dinamika fluida pendingin dengan perpindahan panas kombinasi tiga moda, konduksi, konveksi dan radiasi, serta mempertimbangkan adanya turbulensi aliran gas. Model Discret Ordinate dan Reynolds-Averaged Navier-Stokes (RANS masing-masing digunakan dalam perhitungan perpindahan panas radiasi dan turbulensi. Dari distribusi temperatur bola bahan bakar hasil pemodelan CFD dengan aliran turbulen pada pendinginnya diketahui bahwa temperatur maksimum bahan bakar bola mencapai 1036,1OC. Temperatur setinggi ini masih jauh dari temperatur yang dapat menyebabkan kegagalan pengungkungan produksi fisi, yaitu 1600OC. Kata kunci: pemodelan pendinginan, model kisi kubus sederhana, reaktor kogenerasi, RGTT, komputasi dinamika fluida   In accordance to the Presidential Regulation No.5/2010, PTRKN-BATAN develops two variants

  10. Active SU(1,1) atom interferometry

    Science.gov (United States)

    Linnemann, D.; Schulz, J.; Muessel, W.; Kunkel, P.; Prüfer, M.; Frölian, A.; Strobel, H.; Oberthaler, M. K.

    2017-12-01

    Active interferometers use amplifying elements for beam splitting and recombination. We experimentally implement such a device by using spin exchange in a Bose-Einstein condensate. The two interferometry modes are initially empty spin states that get spontaneously populated in the process of parametric amplification. This nonlinear mechanism scatters atoms into both modes in a pairwise fashion and generates a non-classical state. Finally, a matched second period of spin exchange is performed that nonlinearly amplifies the output signal and maps the phase onto readily detectable first moments. Depending on the accumulated phase this nonlinear readout can reverse the initial dynamics and deamplify the entangled state back to empty spin states. This sequence is described in the framework of SU(1,1) mode transformations and compared to the SU(2) angular momentum description of passive interferometers.

  11. ORCID implementation in Invenio 1.1

    CERN Multimedia

    CERN. Geneva

    2017-01-01

    We present an extension to the Invenio 1.1 software for semi-automatically harvesting ORCID IDs of users and allowing them to upload publications to their respective ORCID profile. This extension was created in the context of the Join2 initiative, however, it can easily be adapted to other Invenio instances because it is only loosely coupled with Invenio itself. It opens its own local webserver to handle the additional endpoints, and calls Invenio API functions and command line programs to interact with the database. We also present a recommended workflow for successfully harvesting ORCID ID in an institution. The implementation is realised in well-documented Python 2.6 and Go and will be published as Free Software.

  12. Critical N = (1, 1) general massive supergravity

    Science.gov (United States)

    Deger, Nihat Sadik; Moutsopoulos, George; Rosseel, Jan

    2018-04-01

    In this paper we study the supermultiplet structure of N = (1, 1) General Massive Supergravity at non-critical and critical points of its parameter space. To do this, we first linearize the theory around its maximally supersymmetric AdS3 vacuum and obtain the full linearized Lagrangian including fermionic terms. At generic values, linearized modes can be organized as two massless and 2 massive multiplets where supersymmetry relates them in the standard way. At critical points logarithmic modes appear and we find that in three of such points some of the supersymmetry transformations are non-invertible in logarithmic multiplets. However, in the fourth critical point, there is a massive logarithmic multiplet with invertible supersymmetry transformations.

  13. Galactose-1-phospate uridyltransferase

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003636.htm Galactose-1-phosphate uridyltransferase blood test To use the sharing features on this page, please enable JavaScript. Galactose-1-phosphate uridyltransferase is a blood test that ...

  14. (S-(+-1-(1-Naphthyl-1-(2-thienylmethyleneethylamine

    Directory of Open Access Journals (Sweden)

    Armando Espinosa Leija

    2009-07-01

    Full Text Available The title chiral imine, C17H15NS, has been obtained via a direct synthesis route. The imine group displays the common E configuration, and is almost coplanar with the thiophene heterocycle; the dihedral angle between the C=N—C group and the thiophene ring is 5.1 (8°. In contrast, the naphthyl group makes an angle of 83.79 (13° with the thiophene ring. The observed solid-state molecular conformation is suitable for the use of this molecule as an N,S-bidentate Schiff base ligand. The molecular packing features double C—H...π interactions between naphthyl groups of neighboring molecules, which form chains in the [100] direction. The crystal structure is further stabilized by a short C—H...π contact involving the methyl group and one ring of a naphthyl group. The resulting two-dimensional network is completed by a weak intermolecular C—H(imine...π(thiophene interaction.

  15. Melaminium nitrate–melamine–water (1/1/1

    Directory of Open Access Journals (Sweden)

    Farook Adam

    2010-11-01

    Full Text Available In the crystal structure of the title salt, C3H7N6+·NO3−·C3H6N6·H2O, the asymmetric unit consists of two neutral melamine (1,3,5-triazine-2,4,6-triamine molecules, two melaminium cations, two nitrate anions and two solvent water molecules. One of the nitrate anions is disordered over two sets of positions, with a refined occupancy ratio of 0.909 (3:0.091 (3. The cations and neutral molecules are approximately planar, with maximum deviations of 0.018 (2, 0.024 (2, 0.019 (2 and 0.007 (2 Å for each, respectively. In the crystal structure, melaminium cations and netural melamine molecules self-assemble via N—H...N hydrogen bonds to form a supramolecular hexagonal-shaped motif. In addition, the nitrate anions and water molecules are connected by N—H...O hydrogen bonds to form a three-dimensional network.

  16. The First Digit 1

    Indian Academy of Sciences (India)

    IAS Admin

    1075. RESONANCE | December 2013. GENERAL | ARTICLE. Table 2. The first digits distri- bution according to Benford's law. First Frequency. Digit. 1. 30.1 %. 2. 17.6 %. 3. 12.4 %. 4. 9.7 %. 5. 7.9 %. 6. 6.7 %. 7. 5.8 %. 8. 5.1 %. 9. 4.5 % ...

  17. Spot 1 Spot 2

    Indian Academy of Sciences (India)

    2011-08-23

    Aug 23, 2011 ... Gel Idx/Pos. 129/F4. Plate [#] Name. [1] T056P10. Rank. Protein Name. Accession No. Protein. Protein. Total Ion. Total Ion. Score. Score. Score. C. I. %. C. I. %. 1. Myosin regulatory light chain 2, ventricular/cardiac. MLRV_MOUSE. 661. 100. 507. 100 muscle isoform OS=Mus musculus GN=Myl2 PE=1 SV.

  18. Vitamin B1

    Science.gov (United States)

    ... Farm Game - Why do we need vitamin B1? - What food contains vitamin B1? - What is the disease beriberi? This fast-paced game relies on a keen knowledge of food containing vitamin B1 and good keyboard skills to ...

  19. Preparation of 1-bromoheptacosane

    International Nuclear Information System (INIS)

    Hernandez, L.; Hernandez, A.; Gonzalez, J.C.

    1996-01-01

    Alkybromides are ones of the main organic precursors for fatty acids and alcohols labelling with Carbon 1-14. In this work the preparation of 1-bromoheptacosane by bromodescarboxylation of 1-octacosanoic acid is described. The synthesis yielded 80.5% of final product and more than 97% of chemical purity. Clean-up procedure modifications and spectral data bromoheptacosane are also reported

  20. Porcine SLITRK1

    DEFF Research Database (Denmark)

    Larsen, Knud Erik; Momeni, Jamal; Farajzadeh, Leila

    2014-01-01

    introns, as does its human and mouse counterparts. RT-PCR cloning revealed two SLITRK1 transcripts: a full-length mRNA and a transcript variant that results in a truncated protein. The encoded SLITRK1 protein, consisting of 695 amino acids, displays a very high homology to human SLITRK1 (99%). The porcine...

  1. supp1.doc

    Indian Academy of Sciences (India)

    hexa decane]-2'(7'),4',6',8'-tetraene-2,5,13',15'-tetrone (cis-3a). Pale pink solid, mp: 118-120 oC; Rf = 0.23 (60% ethylacetate: petroleum ether); IR (KBr): 1196, 1352, 1715, 2961, 3235 cm-1; 1H NMR (500 MHz, CDCl3): δ 2.86 (d, 1H, J = 18.3 ...

  2. BACE1 modulates gating of KCNQ1 (Kv7.1) and cardiac delayed rectifier KCNQ1/KCNE1 (IKs).

    Science.gov (United States)

    Agsten, Marianne; Hessler, Sabine; Lehnert, Sandra; Volk, Tilmann; Rittger, Andrea; Hartmann, Stephanie; Raab, Christian; Kim, Doo Yeon; Groemer, Teja W; Schwake, Michael; Alzheimer, Christian; Huth, Tobias

    2015-12-01

    KCNQ1 (Kv7.1) proteins form a homotetrameric channel, which produces a voltage-dependent K(+) current. Co-assembly of KCNQ1 with the auxiliary β-subunit KCNE1 strongly up-regulates this current. In cardiac myocytes, KCNQ1/E1 complexes are thought to give rise to the delayed rectifier current IKs, which contributes to cardiac action potential repolarization. We report here that the type I membrane protein BACE1 (β-site APP-cleaving enzyme 1), which is best known for its detrimental role in Alzheimer's disease, but is also, as reported here, present in cardiac myocytes, serves as a novel interaction partner of KCNQ1. Using HEK293T cells as heterologous expression system to study the electrophysiological effects of BACE1 and KCNE1 on KCNQ1 in different combinations, our main findings were the following: (1) BACE1 slowed the inactivation of KCNQ1 current producing an increased initial response to depolarizing voltage steps. (2) Activation kinetics of KCNQ1/E1 currents were significantly slowed in the presence of co-expressed BACE1. (3) BACE1 impaired reconstituted cardiac IKs when cardiac action potentials were used as voltage commands, but interestingly augmented the IKs of ATP-deprived cells, suggesting that the effect of BACE1 depends on the metabolic state of the cell. (4) The electrophysiological effects of BACE1 on KCNQ1 reported here were independent of its enzymatic activity, as they were preserved when the proteolytically inactive variant BACE1 D289N was co-transfected in lieu of BACE1 or when BACE1-expressing cells were treated with the BACE1-inhibiting compound C3. (5) Co-immunoprecipitation and fluorescence recovery after photobleaching (FRAP) supported our hypothesis that BACE1 modifies the biophysical properties of IKs by physically interacting with KCNQ1 in a β-subunit-like fashion. Strongly underscoring the functional significance of this interaction, we detected BACE1 in human iPSC-derived cardiomyocytes and murine cardiac tissue and observed

  3. Supplementary Table 1.xlsx

    Indian Academy of Sciences (India)

    Guma

    25, Bos gaurus. 26, Asian elephant, 42, 0, 5, 7, 5, 1, 6, 0, 8, 7, 3. 27, Elephas maximus. 28, Indian Porcupine, 44, 0, 4, 4, 6, 0, 5, 5, 5, 9, 6. 29, Hystrix indica. 30, Black-naped hare, 28, 0, 4, 4, 4, 2, 0, 3, 4, 4, 3. 31, Lepus nigricollis. 32, Civet, 29, 0, 1, 4, 4, 1, 3, 4, 4, 3, 5. 33, Viverricula indica. 34, Mongoose, 2, 0, 1, 0, 0, 0, 1, 0, 0 ...

  4. G--PAGEMA~1-kndoyendir (1).mdi

    African Journals Online (AJOL)

    USER

    Lorsqu'un système enzymatique révèle plus d'une zone d'activité, la zone de migration la plus rapide est désignée locus 1 (ou A), la zone suivante est alors désignée locus 2 (ou B) ainsi de suite. Cette procédure a été aussi suivie pour le numérotage des allèles de chaque locus. L'interprétation des loci à partir des bandes.

  5. The E1 proteins

    International Nuclear Information System (INIS)

    Bergvall, Monika; Melendy, Thomas; Archambault, Jacques

    2013-01-01

    E1, an ATP-dependent DNA helicase, is the only enzyme encoded by papillomaviruses (PVs). It is essential for replication and amplification of the viral episome in the nucleus of infected cells. To do so, E1 assembles into a double-hexamer at the viral origin, unwinds DNA at the origin and ahead of the replication fork and interacts with cellular DNA replication factors. Biochemical and structural studies have revealed the assembly pathway of E1 at the origin and how the enzyme unwinds DNA using a spiral escalator mechanism. E1 is tightly regulated in vivo, in particular by post-translational modifications that restrict its accumulation in the nucleus. Here we review how different functional domains of E1 orchestrate viral DNA replication, with an emphasis on their interactions with substrate DNA, host DNA replication factors and modifying enzymes. These studies have made E1 one of the best characterized helicases and provided unique insights on how PVs usurp different host-cell machineries to replicate and amplify their genome in a tightly controlled manner. - Highlights: • The papillomavirus E1 helicase orchestrates replication of the viral DNA genome. • E1 assembles into a double-hexamer at the viral origin with the help of E2. • E1 interacts with cellular DNA replication factors. • E1 unwinds DNA using a spiral escalator mechanism. • Nuclear accumulation of E1 is regulated by post-translational modifications

  6. KINERJA KATALIS Ag/Al2O3 UNTUK REDUKSI NOx

    Directory of Open Access Journals (Sweden)

    Rakhman Sarwono

    2012-02-01

    Full Text Available NOx merupakan hasil samping dari suatu reaksi pembakaran. NOx merupakan gas yang beracun sangat berbahaya terhadap kesehatan manusia dan hewan bila terhirup pada waktu bernafas. Untuk mengurangi kadar NOx pada gas buang, banyak penelitian diarahkan pada reduksi NOx dengan katalis secara selektif dengan hidrokarbon dan oksigen berlebihan. Katalis yang digunakan adalah katalis alumina (Al2O3 yang didapat dari katalis komersial (AlO1-7 dan katalis hasil sintesa (ALOA. Katalis Ag/Al2O3 didapat dengan memasukkan logam Ag ke dalam alumina (Al2O3 dengan cara impregnasi dengan larutan perak nitrat. Katalis diuji aktifitasnya pada reaktor fixed bed yang diluarnya terdapat pemanas yang bisa diatur suhunya. Reaktan seperti gas NO, C2H4  dan oksigen dimasukkan kedalam reaktor dengan laju yang ditentukan. Hasil reaksi dianalisa dengan gas chromatography dan dicatat pada recorder, selanjutnya bisa ditentukan kuantitas dan prosentase konversinya. Katalis alumina  ALOA mempunyai kemampuan mereduksi NO dengan konversi  sekitar 40-45% gas NO menjadi N2. Loading logam perak (Ag kedalam Al2O3 sebesar 2-3% berat menambah daya reduksi NO menjadi sekitar 45-50% pada suhu 500oC. Pada umpan NO + C2H4  + O2  reaksi reduksi terjadi pada suhu 300oC, sedangkan pada umpan NO + C2H4   (tanpa oksigen reaksi reduksi baru terjadi pada suhu 450oC, dengan demikian adanya oksigen sangat berperan dalam proses reduksi NOx. Reaksi peruraian C2H4 menjadi COx berkebalikan dengan kinerja katalis pada proses reduksi NOx

  7. 1-Methylpiperazine-1,4-diium dipicrate

    Directory of Open Access Journals (Sweden)

    Grzegorz Dutkiewicz

    2011-02-01

    Full Text Available In the crystal structure of the title compound [systematic name: 1-methylpiperazine-1,4-diium bis(2,4,6-trinitrophenolate], C5H14N22+·2C6H2N3O7−, the ionic components are connected by relatively strong N—H...O hydrogen bonds into centrosymmetric six-membered conglomerates, which comprise two dications and four anions. Besides Coulombic interactions, only weak C—H...O interactions and some stacking between picrates (separation between the planes of ca. 3.4 Å but only a small overlapping can be identified between these `building blocks' of the crystal structure. The piperazine ring adopts a chair conformation with the methyl substituent in the equatorial position. In the picrate anions, the twist angles of the nitro groups depend on their positions relative to the phenolate O atom: it is much smaller for the NO2 groups para to the C—O− group [15.23 (9and 3.92 (14°] than for the groups in the ortho positions [28.76 (13–39.84 (11°].

  8. Event generation with SHERPA 1.1

    Energy Technology Data Exchange (ETDEWEB)

    Gleisberg, T.; Hoche, Stefan.; Krauss, F.; Schoenherr, M.; Schumann, S.; Siegert, F.; Winter, J.

    2008-12-18

    In this paper the current release of the Monte Carlo event generator Sherpa, version 1.1, is presented. Sherpa is a general-purpose tool for the simulation of particle collisions at high-energy colliders. It contains a very flexible tree-level matrix-element generator for the calculation of hard scattering processes within the Standard Model and various new physics models. The emission of additional QCD partons off the initial and final states is described through a parton-shower model. To consistently combine multi-parton matrix elements with the QCD parton cascades the approach of Catani, Krauss, Kuhn and Webber is employed. A simple model of multiple interactions is used to account for underlying events in hadron-hadron collisions. The fragmentation of partons into primary hadrons is described using a phenomenological cluster-hadronization model. A comprehensive library for simulating tau-lepton and hadron decays is provided. Where available form-factor models and matrix elements are used, allowing for the inclusion of spin correlations; effects of virtual and real QED corrections are included using the approach of Yennie, Frautschi and Suura.

  9. ITER EDA Newsletter. Vol. 1, No. 1

    International Nuclear Information System (INIS)

    1992-11-01

    After the ITER Engineering Design Activities (EDA) Agreement and Protocol 1 had been signed by the four ITER parties on July 21, 1992 and had entered into force, the ITER Council suggested at its first meeting (Vienna, September 10-11, 1992) that the publication of the ITER Newsletter be continued during the EDA with assistance of the International Atomic Energy Agency. This suggestion was supported by the Agency and subsequently the ITER office in Vienna assumed its responsibilities for planning and executing activities related to the publication of the Newsletter. The ITER EDA Newsletter is planned to be a monthly publication aimed at disseminating broad information and understanding, including the description of the personal and institutional involvements in the ITER project in addition to technical facts about it. The responsibility for the Newsletter rests with the ITER council. In this first issue the signing of the ITER EDA Activities and Protocol 1 is reported. The EDA organizational structure is described. This issue also reports on the first ITER EDA council meeting, the opening of the ITER EDA NAKA Co-Centre, the first meeting of the ITER Technical Advisory Committee, activities of special working groups, an ITER Technical Meeting, as well as ''News in Brief'' and ''Coming Events''

  10. Gfi1b

    Science.gov (United States)

    Beauchemin, Hugues; Shooshtarizadeh, Peiman; Vadnais, Charles; Vassen, Lothar; Pastore, Yves D; Möröy, Tarik

    2017-03-01

    Mutations in GFI1B are associated with inherited bleeding disorders called GFI1B -related thrombocytopenias. We show here that mice with a megakaryocyte-specific Gfi1b deletion exhibit a macrothrombocytopenic phenotype along a megakaryocytic dysplasia reminiscent of GFI1B -related thrombocytopenia. GFI1B deficiency increases megakaryocyte proliferation and affects their ploidy, but also abrogates their responsiveness towards integrin signaling and their ability to spread and reorganize their cytoskeleton. Gfi1b -null megakaryocytes are also unable to form proplatelets, a process independent of integrin signaling. GFI1B-deficient megakaryocytes exhibit aberrant expression of several components of both the actin and microtubule cytoskeleton, with a dramatic reduction of α-tubulin. Inhibition of FAK or ROCK, both important for actin cytoskeleton organization and integrin signaling, only partially restored their response to integrin ligands, but the inhibition of PAK, a regulator of the actin cytoskeleton, completely rescued the responsiveness of Gfi1b -null megakaryocytes to ligands, but not their ability to form proplatelets. We conclude that Gfi1b controls major functions of megakaryocytes such as integrin-dependent cytoskeleton organization, spreading and migration through the regulation of PAK activity whereas the proplatelet formation defect in GFI1B-deficient megakaryocytes is due, at least partially, to an insufficient α-tubulin content. Copyright© Ferrata Storti Foundation.

  11. Z physics at LEP 1. Vol. 1

    International Nuclear Information System (INIS)

    Altarelli, G.; Kleiss, R.; Verzegnassi, C.

    1989-01-01

    The contents of this final report from the Workshop on Z Physics at LEP can be divided into two parts. The first part, comprising Vols. 1 and 2, is a relatively concise but fairly complete handbook on the physics of e + e - annihilation near the Z peak (with normal LEP luminosity and unpolarized beams, appropriate for the first phase of LEP operation). The second part (Vol. 3) is devoted to a review of the existing Monte Carlo event generators for LEP physics. A special effort has been made to co-ordinate the different parts of this report, with the aim of achieving a systematic and balanced review of the subject, rather than having simply a collection of separate contributions. (orig.)

  12. 19 (No. 1)

    African Journals Online (AJOL)

    Tooth decay is caused by: Frequent eating of sweet food staff and not brushing with fluoride tooth paste. 410. 99.5. Eating fruits. 1. 0.25. I don't know. 1. 0.25. Dental caries is associated with: Cavity on tooth, pain, sometime swelling. 405. 98.3. Bleeding gums. 5. 1.2. I don't Know. 2. 0.5. Dental caries can be prevented by:.

  13. Endothelin-1 and -2

    DEFF Research Database (Denmark)

    Compeer, Matthijs G; Suylen, Dennis P L; Hackeng, Tilman M

    2012-01-01

    AIMS: Endothelin-1 (ET-1) and endothelin-2 (ET-2; Trp(6)Leu(7)ET-1) are expressed by different cell types, but are considered to display identical pharmacological properties on endothelin receptors. We studied agonist-dependent aspects of endothelin(A) (ET(A))-receptor function and the importance...... arterial responses to ET-1. SIGNIFICANCE: Arterial smooth muscle ET(A)-receptor function displays agonist-dependent aspects. This involves roles of amino acids on position 6 and 7 of the endothelin sequence. Agonist-dependent pathologies may benefit from the design of specific, agonist-selective ET...

  14. PECAM-1 and Angiogenesis

    Science.gov (United States)

    2009-12-01

    for the REN-HP cells to be twice that of the nontransfected REN cells (Fig. 4F). Although the mean filop- odia lengths for the REN-HP/WT-SHP-2 and REN...siRNA. In addition, expres- sion of PECAM-1 in cellular transfectants promoted filop- odia formation. The expression of PECAM-1 increased the protein...Taken together these data indicate that PECAM-1 in- creases the rate and/or promotes the efficiency of filop- odia formation in ECs. Anti-PECAM-1

  15. Diabetes Type 1

    Science.gov (United States)

    Diabetes means your blood glucose, or blood sugar, levels are too high. With type 1 diabetes, your pancreas does not make insulin. Insulin is ... kidneys, nerves, and gums and teeth. Type 1 diabetes happens most often in children and young adults ...

  16. HIV-1 envelope glycoprotein

    Science.gov (United States)

    Caulfield, Michael; Cupo, Albert; Dean, Hansi; Hoffenberg, Simon; King, C. Richter; Klasse, P. J.; Marozsan, Andre; Moore, John P.; Sanders, Rogier W.; Ward, Andrew; Wilson, Ian; Julien, Jean-Philippe

    2017-08-22

    The present application relates to novel HIV-1 envelope glycoproteins, which may be utilized as HIV-1 vaccine immunogens, and antigens for crystallization, electron microscopy and other biophysical, biochemical and immunological studies for the identification of broad neutralizing antibodies. The present invention encompasses the preparation and purification of immunogenic compositions, which are formulated into the vaccines of the present invention.

  17. Excavation of LSS1

    CERN Multimedia

    CERN PhotoLab

    1972-01-01

    Excavation of the long straight-section LSS1 by an Alpine boring machine. View of the connection chamber, in the background, the roofs of the enlarged sections (8.5 m and 6 m). On the right, the access tunnel to PP1.

  18. JOS JOURNAL 1

    African Journals Online (AJOL)

    **Department of community health & Epidemiology College of health sciences, Benue State University. Makurdi ... the least used in developing countries of the world. ... 1 increasing by 75million yearly .Overpopulation continues to be a significant contributor to environmental degradation and human suffering. 1 worldwide .

  19. PGM1 deficiency

    DEFF Research Database (Denmark)

    Voermans, N C; Preisler, N; Madsen, K L

    2017-01-01

    Mutations in PGM1 (phosphoglucomutase 1) cause Glycogen Storage Disease type XIV, which is also a congenital disorder of protein N-glycosylation. It presents throughout life as myopathy with additional systemic symptoms. We report the effect of oral galactose treatment during five months in a pat...

  20. Anguillid herpesvirus 1 transcriptome

    NARCIS (Netherlands)

    Beurden, van S.J.; Gatherer, D.; Kerr, K.; Galbraith, J.; Herzyk, P.; Peeters, B.P.H.; Rottier, P.J.M.; Engelsma, M.Y.; Davidson, A.J.

    2012-01-01

    We used deep sequencing of poly(A) RNA to characterize the transcriptome of an economically important eel virus, anguillid herpesvirus 1 (AngHV1), at a stage during the lytic life cycle when infectious virus was being produced. In contrast to the transcription of mammalian herpesviruses, the overall

  1. 1,3-Butadiene

    Science.gov (United States)

    Learn about 1,3-butadiene, exposure to which can raise your risk of leukemia. 1,3-Butadiene is a gas used to produce synthetic rubber products, such as tires, resins, and plastics. Other sources of exposure include car exhaust; tobacco smoke; and polluted air and water near industrial facilities.

  2. SIndex 1..24

    Indian Academy of Sciences (India)

    interaction with glycine and GABA. 203. A1 resonance in water. Dynamics of the dissociative electron attachment in. H2O and D2O: The A1 resonance and axial recoil approximation. 271. Ab initio. Bhageerath—Targeting the near impossible: Pushing the frontiers of atomic models for protein tertiary structure prediction. 83.

  3. ALG1-CDG

    DEFF Research Database (Denmark)

    Ng, Bobby G; Shiryaev, Sergey A; Rymen, Daisy

    2016-01-01

    Congenital disorders of glycosylation (CDG) arise from pathogenic mutations in over 100 genes leading to impaired protein or lipid glycosylation. ALG1 encodes a β1,4 mannosyltransferase that catalyzes the addition of the first of nine mannose moieties to form a dolichol-lipid linked oligosacchari...

  4. 1 - 5_Bunza

    African Journals Online (AJOL)

    DR. AMINU

    2014-06-01

    Jun 1, 2014 ... This is due to the fact that: 1) diabetes, particularly types 2, is increasing in prevalence; 2) diabetes patients now live longer; and 3) patients with diabetic ESRD are now being accepted for treatment in ESRD programme where formerly they had been excluded. (ADA, 2004). In the U.S, diabetic nephropathy.

  5. 17 (No. 1)

    African Journals Online (AJOL)

    mwakagugu

    2011-11-16

    Nov 16, 2011 ... Fig. 1a: Case No. 1 before treatment. An old female patient presented with rampant caries, mostly affecting the upper teeth. Examination and Diagnosis. On examination, teeth number 11 & 21 had dentinal caries mostly cervical, with spared coronal parts. Teeth 12, 13 & 22 were grossly carious leaving only.

  6. Determination of taste receptor type 1 member 1 (TAS1R1) gene ...

    African Journals Online (AJOL)

    In this article, the objective was to investigate variations in goat TAS1R1 gene and their associations with growth traits in 317 goats by PCR-SSCP and DNA sequencing methods. The results showed two novel single nucleotide polymorphisms (SNPs): HM449123:g. [T3974C, C4037T]. In detail, two different alleles, A and B, ...

  7. Temitope et al (1)

    African Journals Online (AJOL)

    DELL

    against specific bacterial strains and moderate activities against other bacterial strains. The compounds did not show any sensitivity against the tested fungal strains. The quantitative structure-antibacterial activity relationship was studied using some quantum chemical parameters with the aid of Spartan 10 (V1.0.1) and.

  8. Determination of taste receptor type 1 member 1 (TAS1R1) gene ...

    African Journals Online (AJOL)

    Jane

    2011-10-10

    Oct 10, 2011 ... Most of the previous studies laid particular emphasis on the taste sensitivity to umami substances or the relation of umami taste ... AB, and BB with the frequency distribution of allele B from 0.59 to 0.67 in analyzed populations. The ... locus within TAS1R1 gene possessed moderate genetic diversity in goat.

  9. Type 1 Tyrosinaemia

    LENUS (Irish Health Repository)

    Mannion, MA

    2016-06-01

    Tyrosinaemia type 1 (TYR1, OMIM# 276700) is a rare autosomal recessive disease that results from an enzyme defect that leads to a deficiency in fumarylacetoacetase (FAH)1. We present 3 cases of TYR1 in the Irish population over a 9 year period, the only cases known to have been diagnosed in Ireland since 1989. The common presenting symptom was hypoglycaemia and the diagnosis was made by the identification of the pathognomonic biomarker succinylacetone on urine organic acid analysis. We discuss the clinical presentation, biochemical and genetic results including one novel mutation. We also highlight the importance of early initiation of Nitisinone (NTBC), which reduces the complications of TYR1 and the incidence of liver transplantation in this population2.

  10. Adamkus : EU might be willing to negotiate on postponing Ignalina reactor closure

    Index Scriptorium Estoniae

    2008-01-01

    President Valdas Adamkus teatas võimalusest, et EL alustab arutelu Ignalina tuumaelektrijaama sulgemise edasilükkamisest. Uue jaama valmimise aeg pole teada ning praegune reaktor on tänu rootslaste abile turvaline

  11. Põhja-Korea lubas taas jätta tuumaplaanid / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2007-01-01

    Pekingis toimunud kuuepoolsete desarmeerimiskõneluste tulemusena on Põhja-Korea nõus andma ülevaate riigi tuumarajatistest ning alustama nende likvideerimist. 14. juulil suleti Yongbyoni tuumakeskuse reaktor. Lisa: Tuumavaidlus

  12. Open Praxis, volumen 1 issue 1

    Directory of Open Access Journals (Sweden)

    Editor Open Praxis

    2007-01-01

    Full Text Available Table of Contents - A Study on the Importance of Fostering Trust in a Distance Learning Community Sónia Sousa, David Lamas & Brian Hudson (1-10 - Teacher Upgrading through Distance Education in a South African Context C. G. Kruger & Prof. E. J. Spamer (11-19 - An Investigation into Delivery of On-Line Courses within an Early Childhood Teacher Education Distance Programme in New Zealand Susan E. Smart (20-29 - Transnational Online Project Management Curriculum Model for Engineering Students Enrique Benimeli Bofarull, Anke Muendler, Peter Haber (30-39 - China Rural Distance Education and Construction of the New Countryside Li Fanghong & Zeng Yichun (40-46 - E-Learning in Japan: Steam Locomotive on Shinkansen Ali E. Ozkul, Ph.D. & Kumiko Aoki, Ph.D.  (47-55 - Widening Access to Higher Education: Open and Distance Learning in Higher Education Setting in Indonesia Paulina Pannen (56-65 - Research and Development of a Costing Toolkit for Distance, Flexible and ICT-Based Education for Teacher Development in Africa Frank R J Banks (66-75 - Fostering E-Learning in Medical Education: The Eurovacc Team Experience Guilherme Andrade Marson, Nathalie Debard, Jean-Pierre Kraehenbuhl, Pascal Py, Yan Cornneille, Laurent Richard, Alain Meystre (76-86 - Program Upgrading Teachers in Education Irene Hardy de Gómez (87-95 - ICT based learning strategies for Educating nomads Yogesh Kulkarni & Dr. Madhav Gaikwad (96-102 - Information and Communication Technology and Distance Education in Brazil Marta de Campos Maia & Fernando de Souza Meirelles (103-112 - ICDE’s interview with Susan D’Antoni, UNESCO International Institute for Educational Planning (IIEP (113-117 - ICDE Task Force Open Educational Resources – Inquiry Results (118-125 - 22nd ICDE – World Conference on Distance Education: Facts and figures (126-131

  13. A comparative study of the adsorption and hydrogenation of acrolein on Pt(1 1 1), Ni(1 1 1) film and Pt Ni Pt(1 1 1) bimetallic surfaces

    Science.gov (United States)

    Murillo, Luis E.; Chen, Jingguang G.

    In this study we have investigated the reaction pathways for the decomposition and hydrogenation of acrolein (CH 2dbnd CH-CH dbnd O) on Ni/Pt(1 1 1) surfaces under ultra-high vacuum (UHV) conditions using temperature programmed desorption (TPD) and high-resolution electron energy loss spectroscopy (HREELS). While gas-phase hydrogenation products are not observed from clean Pt(1 1 1), the subsurface Pt-Ni-Pt(1 1 1), with Ni residing below the first layer of Pt, is active for the self-hydrogenation of the C dbnd O bond to produce unsaturated alcohol (2-propenol) and the C dbnd C bond to produce saturated aldehyde (propanal), with the latter being the main hydrogenation product without the consecutive hydrogenation to saturated alcohol. For a thick Ni(1 1 1) film prepared on Pt(1 1 1), the self-hydrogenation yields for both products are lower than that from the Pt-Ni-Pt(1 1 1) surface. The presence of pre-adsorbed hydrogen further enhances the selectivity toward C dbnd O bond hydrogenation on the Pt-Ni-Pt(1 1 1) surface. In addition, HREELS studies of the adsorption of the two hydrogenation products, 2-propenol and propanal, are performed on the Pt-Ni-Pt(1 1 1) surface to identify the possible surface intermediates during the reaction of acrolein. The results presented here indicate that the hydrogenation activity and selectivity of acrolein on Pt(1 1 1) can be significantly modified by the formation of the bimetallic surfaces.

  14. Diet Treatment Glucose Transporter Type 1 Deficiency (G1D)

    Science.gov (United States)

    2017-10-17

    GLUT1DS1; Epilepsy; Glut1 Deficiency Syndrome 1, Autosomal Recessive; Glucose Metabolism Disorders; Glucose Transport Defect; Glucose Transporter Type 1 Deficiency Syndrome; Glucose Transporter Protein Type 1 Deficiency Syndrome

  15. External Ballistics. Part 1

    Science.gov (United States)

    1978-07-11

    and their tctque/momer.ts). LaEt/latter three factcrs are 4 usually related to seccndar) (supplementary) factors. Ccntrcl forces and torque/ scents ...ccrrexjcmdsi tc S0o/o (;i rel-itive he a id 1t y -r .v= 28h8W K (o=+ 15’ C 1,206 kg /a eo .1229 k9 *Ea ,,,,=340.8 m/s. Just as in other staneard...400 ; , 5 t=4,61431,45. Key: (1) kg. (2) k9 /s. (3) m/s. is usual, let us break trajectory iqtc twc section - active and Faazive. For the

  16. Linac 1, inner structure

    CERN Multimedia

    1968-01-01

    This photo shows the inner structure of Linac 1. As injector to the PS, and later to the Booster, Linac 1 accelerated protons to 50 MeV, but it has also accelerated heavier ions. Fitted with a 520 keV RFQ pre-injector (instead of the original Cockcroft-Walton generator), it delivered protons and heavy ions to LEAR, from 1982 to 1992. After 33 years of faithful service, Linac 1 was dismantled in 1992 to make room for Linac 3 (Pb ions).

  17. A Distributed Tier-1

    DEFF Research Database (Denmark)

    Fischer, Lars; Grønager, Michael; Kleist, Josva

    2008-01-01

    The Tier-1 facility operated by the Nordic DataGrid Facility (NDGF) differs significantly from other Tier-1s in several aspects: firstly, it is not located at one or a few premises, but instead is distributed throughout the Nordic countries; secondly, it is not under the governance of a single...... organization but instead is a meta-center built of resources under the control of a number of different national organizations. We present some technical implications of these aspects as well as the high-level design of this distributed Tier-1. The focus will be on computing services, storage and monitoring....

  18. 41 CFR 101-1.104-1 - Publication.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Publication. 101-1.104-1 Section 101-1.104-1 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101-1.104-1...

  19. Influenza Stigma during the 2009 H1N1 Pandemic

    OpenAIRE

    Earnshaw, Valerie A.; Quinn, Diane M.

    2013-01-01

    The current study examines the extent to which H1N1 was stigmatized at the height of the 2009 H1N1 pandemic in the U.S. and explores the role that H1N1 stigma played in people’s desire for physical distance from others with H1N1. H1N1 was the most stigmatized disease, with participants endorsing greater prejudice towards people with H1N1 than people with cancer or HIV/AIDS. Further, H1N1 stigma partially mediated the relationship between participants’ perceptions that H1N1 was threatening and...

  20. Alpha-1 Antitrypsin Deficiency

    Science.gov (United States)

    ... the Liver Galactosemia Gilbert’s Syndrome Diseases of the Liver Glycogen Storage Disease Type 1 (von Gierke) Hemochromatosis Hepatic Encephalopathy Hepatitis A Hepatitis B Hepatitis C Intrahepatic Cholestasis of Pregnancy (ICP) Jaundice In Newborns ...

  1. Cold Sores (HSV-1)

    Science.gov (United States)

    ... anywhere on the body, including the genital area. Genital herpes isn't typically caused by HSV-1; it's ... February 2014 More on this topic for: Teens Genital Herpes Tips for Taking Care of Your Skin Mononucleosis ...

  2. Type 1 diabetes

    DEFF Research Database (Denmark)

    Green, Anders; Kyvik, Kirsten Ohm

    2001-01-01

    Prediction of Type 1 diabetes at individual level is relevant for any possible intervention before clinical disease develops. Currently available markers of Type 1 diabetes include genetic specificities and immune markers, in addition to a positive family history. This chapter reviews the measures...... and methods of importance in predicting Type 1 diabetes. Based on numerical examples it is demonstrated that available markers have a low level of performance, even when combined. Even so, combined marker information may allow for the identification of the large majority of the general population who...... is at very low disease risk. The impact at population level of predicting Type 1 diabetes varies between societies because the performance of markers depends on levels of disease risk and distribution of markers within a population. The incorporation of the influence of non-genetic etiological factors may...

  3. Contaminant Candidate List 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — CCL 1 is a list of contaminants that are currently not subject to any proposed or promulgated national primary drinking water regulations, that are known or...

  4. Technology in L1

    DEFF Research Database (Denmark)

    Elf, Nikolaj Frydensbjerg; Hanghøj, Thorkild; Skaar, Håvard

    2015-01-01

    -of-school literacy practices. A final finding is the emphasis on teacher uncertainty regarding how and why to integrate technology within existing paradigms of the subject. This calls for further research on how technology may be justified in L1 practice, including various forms of teacher education.......In recent decades, several Scandinavian research projects have had an explicit focus on how technology intervenes in L1 (or so-called Mother Tongue Education) practices in Swedish, Norwegian and Danish educational contexts, and how this may impact on understanding of the subject. There is currently...... no systematic overview of the documented possibilities and challenges related to the use of technology in L1. At the same time, there is terminological confusion in use of ‘technology’ and related concepts in L1. Finally, there is a general lack of critical reflection on the relation between technological...

  5. IML-1 Logo

    Science.gov (United States)

    1989-01-01

    The primary payload for Space Shuttle Mission STS-42, launched January 22, 1992, was the International Microgravity Laboratory-1 (IML-1), a pressurized manned Spacelab module. The goal of IML-1 was to explore in depth the complex effects of weightlessness of living organisms and materials processing. Around-the-clock research was performed on the human nervous system's adaptation to low gravity and effects of microgravity on other life forms such as shrimp eggs, lentil seedlings, fruit fly eggs, and bacteria. Materials processing experiments were also conducted, including crystal growth from a variety of substances such as enzymes, mercury iodide and a virus. More than 200 scientists from 16 countries participated in the investigations. This is the logo or emblem that was designed to represent the IML-1 payload.

  6. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

  7. Class 1 Areas

    Data.gov (United States)

    U.S. Environmental Protection Agency — A "Class 1" area is a geographic area recognized by the EPA as being of the highest environmental quality and requiring maximum protection. Class I areas are areas...

  8. 3+1 Pariisis

    Index Scriptorium Estoniae

    2000-01-01

    Pariisis Arhitektuurigaleriis La Galerie d'Architecture näitus "4 Architectures", kuhu on valitud arhitektuuribürood neljast riigist: 3+1 arhitektid Eestist, Archis Lätist, Private Ideology Leedust, White arkitekter Rootsist.

  9. Chapter 1: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2009-01-18

    This report describes analysis undertaken by EERE to better understand the extent to which the technologies and market improvements funded by its fiscal year (FY) 2006 Budget Request1 will make energy more affordable, cleaner, and more reliable.

  10. Mark 1 Test Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Mark I Test Facility is a state-of-the-art space environment simulation test chamber for full-scale space systems testing. A $1.5M dollar upgrade in fiscal year...

  11. 2-(Naphthalen-1-ylaminocyclohexanol

    Directory of Open Access Journals (Sweden)

    Rachid Outouch

    2011-07-01

    Full Text Available The title compound, C16H19NO, was synthesized under solvent-free conditions by reaction of 7-oxa-bicyclo[4.1.0]heptane and naphthalen-1-amine in the presence of Ca(CF3COO2 as catalyst. The cyclohexane ring adopts a chair conformation. In the crystal, molecules are linked by intermolecular N—H...O hydrogen bonds and C—H...π interactions into chains parallel to the c axis.

  12. RFQ1 diagnostic devices

    International Nuclear Information System (INIS)

    Chidley, B.G.; Arbique, G.M.; de Jong, M.S.; McMichael, G.E.; Michel, W.L.; Smith, B.H.

    1991-01-01

    The diagnostic devices in use on RFQ1 will be described. They consist of a double-slit emittance-measuring unit, a 45 degree deflection energy-analysis magnet, parametric current transformers, optical beam sensors, beam-stop current monitors, and an x-ray end-point analyzer. All of these devices are able to operate up to the full output current of RFQ1 (75 mA cw at 0.6 MeV)

  13. Aggressive HIV-1?

    Science.gov (United States)

    Berkhout, Ben; de Ronde, Anthony; van der Hoek, Lia

    2005-02-28

    New York City health officials announced on February 11, 2005 that a patient rapidly developed full-blown AIDS shortly after being diagnosed with a rare, drug-resistant strain of HIV-1. The New York City Department of Health issued an alert to all hospitals and doctors and a press conference was held to announce the emergence of an aggressive HIV-1 strain that may be difficult to treat and that appears to trigger rapid progression to AIDS. Is the panic justified?

  14. 1 - 7_Abubakar

    African Journals Online (AJOL)

    USER

    S/No. Determined design parameters. Calculated values. 1. Tilt angle of the solar collector, (N). 17. 2. Area of the solar collector, Ac (m2). 3.15. 3. Weight of moisture to be removed from the rice, Mw (kg). 7.7. 4. Thickness of the bottom insulator, X (mm). 9.2. 5. Thickness of the absorber plate, (. ) 1. 6. Drying period of a batch ...

  15. Formation of TRAPPIST-1

    Science.gov (United States)

    Ormel, C. W.; Liu, B.; Schoonenberg, D.

    2017-09-01

    We present a model for the formation of the recently-discovered TRAPPIST-1 planetary system. In our scenario planets form in the interior regions, by accretion of mm to cm-size particles (pebbles) that drifted from the outer disk. This scenario has several advantages: it connects to the observation that disks are made up of pebbles, it is efficient, it explains why the TRAPPIST-1 planets are ˜Earth mass, and it provides a rationale for the system's architecture.

  16. Pesticidrester 1. kvartal 2015

    DEFF Research Database (Denmark)

    Andersen, Jens Hinge; Jensen, Bodil Hamborg

    Resultaterne af den danske pesticidkontrol fra Fødevarestyrelsen og DTU Fødevareinstituttet fra 1. kvartal 2015 viser, at ingen af de påviste sprøjterester udgør en sundhedsmæssig risiko.......Resultaterne af den danske pesticidkontrol fra Fødevarestyrelsen og DTU Fødevareinstituttet fra 1. kvartal 2015 viser, at ingen af de påviste sprøjterester udgør en sundhedsmæssig risiko....

  17. Volume 9 Number 1

    African Journals Online (AJOL)

    OLUWOLE

    infection could result in loss of planting materials and total crop failure (Fokunang et al; 2000). In Nigeria, the disease ... The mixture was boiled on a hot plate of a magnetic stirrer to dissolve the agar. It was autoclaved at 1210C, 1.03 kgcm2 pressure for. 15 minutes. After cooling to 400C, 1ml of lactic acid (to inhibit bacterial ...

  18. TCL1A

    Science.gov (United States)

    Ho, Ming-Fen; Ingle, James N; Bongartz, Tim; Kalari, Krishna R; Goss, Paul E; Shepherd, Lois E; Mushiroda, Taisei; Kubo, Michiaki; Wang, Liewei; Weinshilboum, Richard M

    2017-08-01

    In a previous genome-wide association study (GWAS) for musculoskeletal adverse events during aromatase inhibitor therapy for breast cancer, we reported that single nucleotide polymorphisms (SNPs) near the TCL1A gene were associated with this adverse drug reaction. Functional genomic studies showed that TCL1A expression was induced by estradiol, but only in cells with the variant sequence for the top GWAS SNP (rs11849538), a SNP that created a functional estrogen response element. In addition, TCL1A genotype influenced the downstream expression of a series of cytokines and chemokines and had a striking effect on nuclear factor κ B (NF- κ B) transcriptional activity. Furthermore, this SNP-dependent regulation could be reversed by selective ER modulators (SERMs). The present study was designed to pursue mechanisms underlying TCL1A SNP-mediated, estrogen-dependent NF- κ B activation. Functional genomic studies were performed using a panel of 300 lymphoblastoid cell lines for which we had generated genome-wide SNP and gene expression data. It is known that toll-like receptors (TLRs) can regulate NF- κ B signaling by a process that requires the adaptor protein MYD88. We found that TLR2, TLR7, TLR9, and TLR10 expression, as well as that of MYD88, could be modulated by TCL1A in a SNP and estrogen-dependent fashion and that these effects were reversed in the presence of SERMs. Furthermore, MYD88 inhibition blocked the TCL1A SNP and estrogen-dependent NF- κ B activation, as well as protein-protein interaction between TCL1A and MYD88. These observations greatly expand the range of pathways influenced by TCL1A genotype and raise the possibility that this estrogen- and SNP-dependent regulation might be altered pharmacologically by SERMs. Copyright © 2017 by The American Society for Pharmacology and Experimental Therapeutics.

  19. aflatoxina b1

    Directory of Open Access Journals (Sweden)

    A. Valdivia

    2004-01-01

    Full Text Available Con el objetivo de probar que la suplementación dietética de ácido elágico (AE o N-Acetilcisteína (NAC en pollos de engorda, atenúa los efectos de una intoxicación aguda por la aflatoxina B1 (AFB1, se intoxicaron con AFB1 pura, tres grupos de diez pollos cada uno (3.0 mb/kg pc, IP. Otros tres grupos recibieron solamente el vehículo (aceite de maíz 2.0 ml/kg pc, IP. Cuatro días antes se administró un alimento testigo, o bien, la misma dieta adicionada con AE (2.5 g/kg o NAC (200 mg/kg pc/6 h. A las 24 horas de la administración de AFB1, se cuantificaron las concentraciones hepáticas de glutatión (GSH, de actividad enzimática específica de la transferasa de glutatión (GST, alanina aminotransferasa, aspartato aminotransferasa y de proteínas hepáticas totales. Los resultados mostraron que NAC atenúa el impacto negativo de la AFB1 sobre el crecimiento corporal y al igual que AE, incrementa la GST y revierte parcialmente los efectos de AFB1 sobre GSH, lo cual sugiere que ambas sustancias pudieran conferir un efecto protector de las aves

  20. Studi Awal Desain Pebble Bed Reactor Berbasis Htr-pm Dengan Skema Resirkulasi Bahan Bakar Once-through-then-out

    OpenAIRE

    Setiadipura, Topan; Pane, Jupiter Sitorus; Zuhair, Zuhair

    2016-01-01

    STUDI AWAL DESAIN PEBBLE BED REACTOR BERBASIS HTR-PM DENGAN RESIRKULASI BAHAN BAKAR ONCE-THROUGH-THEN-OUT. Reaktor nuklir tipe pebble bed reactor (PBR) adalah salah satu reaktor canggih dengan fitur keselamatan pasif yang kuat. Pada desain tipe ini berpotensi untuk dilakukan kogenerasi yang bermanfaat untuk pengolahan berbagai mineral di berbagai pulau di Indonesia. Operasi PBR dapat lebih disederhanakan dengan menerapkan skema pengisian bahan bakar once-through-then-out (OTTO) dimana bahan b...

  1. Studi Operasi Resin Penukar Ion Dalam Sistem Purifikasi Air Primer Pwr

    OpenAIRE

    Biyantoro, Dwi; Basuki, Kris Tri; Subagiono, Subagiono

    2006-01-01

    STUDI OPERASI RESIN PENUKAR ION DALAM SISTEM PURIFIKASI AIR PRIMER PWR. Telah dilakukan studioperasi resin penukar ion dalam sistem purifikasi air primer PWR. Air pendingin reaktor yang pada awalnya sesuaidengan persyaratan setelah pengoperasian reaktor sering kualitasnya berubah, sehingga harus dimurnikan. Unsurunsurpengotor dalam air primer PWR diidentifikasi sebagai penyebab pengotor seperti korosi, pelepasan produk fisi(Cs137, Sr90, Co60,C14, Tc99), dan pelepasan kembali unsur oleh resin ...

  2. Gaia DR1 documentation

    Science.gov (United States)

    van Leeuwen, F.; de Bruijne, J. H. J.; Arenou, F.; Comoretto, G.; Eyer, L.; Farras Casas, M.; Hambly, N.; Hobbs, D.; Salgado, J.; Utrilla Molina, E.; Vogt, S.; van Leeuwen, M.; Abreu, A.; Altmann, M.; Andrei, A.; Babusiaux, C.; Bastian, U.; Biermann, M.; Blanco-Cuaresma, S.; Bombrun, A.; Borrachero, R.; Brown, A. G. A.; Busonero, D.; Busso, G.; Butkevich, A.; Cantat-Gaudin, T.; Carrasco, J. M.; Castañeda, J.; Charnas, J.; Cheek, N.; Clementini, G.; Crowley, C.; Cuypers, J.; Davidson, M.; De Angeli, F.; De Ridder, J.; Evans, D.; Fabricius, C.; Findeisen, K.; Fleitas, J. M.; Gracia, G.; Guerra, R.; Guy, L.; Helmi, A.; Hernandez, J.; Holl, B.; Hutton, A.; Klioner, S.; Lammers, U.; Lecoeur-Taïbi, I.; Lindegren, L.; Luri, X.; Marinoni, S.; Marrese, P.; Messineo, R.; Michalik, D.; Mignard, F.; Montegriffo, P.; Mora, A.; Mowlavi, N.; Nienartowicz, K.; Pancino, E.; Panem, C.; Portell, J.; Rimoldini, L.; Riva, A.; Robin, A.; Siddiqui, H.; Smart, R.; Sordo, R.; Soria, S.; Turon, C.; Vallenari, A.; Voss, H.

    2017-12-01

    We present the first Gaia data release, Gaia DR1, consisting of astrometry and photometry for over 1 billion sources brighter than magnitude 20.7 in the white-light photometric band G of Gaia. The Gaia Data Processing and Analysis Consortium (DPAC) processed the raw measurements collected with the Gaia instruments during the first 14 months of the mission, and turned these into an astrometric and photometric catalogue. Gaia DR1 consists of three parts: an astrometric data set which contains the positions, parallaxes, and mean proper motions for about 2 million of the brightest stars in common with the Hipparcos and Tycho-2 catalogues (the primary astrometric data set) and the positions for an additional 1.1 billion sources (the secondary astrometric data set). The primary set forms the realisation of the Tycho-Gaia Astrometric Solution (TGAS). The second part of Gaia DR1 is the photometric data set, which contains the mean G-band magnitudes for all sources. The third part consists of the G-band light curves and the characteristics of 3000 Cepheid and RR Lyrae stars observed at high cadence around the south ecliptic pole. The positions and proper motions in the astrometric data set are given in a reference frame that is aligned with the International Celestial Reference Frame (ICRF) to better than 0.1 mas at epoch J2015.0, and non-rotating with respect to the ICRF to within 0.03 mas yr^-1. For the primary astrometric data set, the typical standard error for the positions and parallaxes is about 0.3 mas, while for the proper motions the typical standard error is about 1 mas yr^-1. Whereas it has been suggested in Gaia Collaboration et al. (2016a) that a systematic component of ∼0.3 mas should be 'added' (in quadrature) to the parallax uncertainties, Brown (2017) clarifies that reported parallax standard errors already include local systematics as a result of the calibration of the TGAS parallax uncertainties by comparison to Hipparcos parallaxes. For the subset of

  3. Polymorphisms of UGT1A1*6, UGT1A1*27 & UGT1A1*28 in three major ethnic groups from Malaysia.

    Science.gov (United States)

    Teh, L K; Hashim, H; Zakaria, Z A; Salleh, M Z

    2012-08-01

    Genetic polymorphisms of uridine diphosphate glucuronyltransferase 1A1 (UGT1A1) have been associated with a wide variation of responses among patients prescribed with irinotecan. Lack of this enzyme is known to be associated with a high incidence of severe toxicity. The objective of this study was to investigate the prevalence of three different variants of UGT1A1 (UGT1A1*6, UGT1A1*27 and UGT1A1*28), which are associated with reduced enzyme activity and increased irinotecan toxicity, in the three main ethnic groups in Malaysia (Malays, Chinese and Indians). A total of 306 healthy unrelated volunteers were screened for UGT1A1*28, UGT1A1*6 and UGT1A1*27. Blood samples (5 ml) were obtained from each subject and DNA was extracted. PCR based methods were designed and validated for detection of UGT1A1*, UUGT1A1*27 and UUGT1A1*28. Direct DNA sequencing was performed to validate the results of randomly selected samples. Malays and Indian have two-fold higher frequency of homozygous of UGT1A1*28 (7TA/7TA) which was 8 and 8.8 per cent, respectively compared to the Chinese (4.9%). However, the distribution of UGT1A1*6 and UGT1A1*27 showed no significant differences among them. UGT1A1*27 which has not been detected in Caucasian and African American population, was found in the Malaysian Malays (3.33%) and Malaysian Chinese (2.0%). There was interethnic variability in the frequency of UGT1A1*28 in the Malaysian population. Our results suggest that genotyping of UUGT1A1*6, UGT1A1*28 and UGT1A1*27 need to be performed before patients are prescribed with irinotecan due to their high prevalence of allelic variant which could lead to adverse drug reaction.

  4. Covalent-bond stabilization of the Si(111)-(3 1 -1 1)-Pb structure

    DEFF Research Database (Denmark)

    Kumpf, C.; Nielsen, M.; Feidenhans'l, R.

    2001-01-01

    At room temperature a monolayer coverage of Pb on Si(1 1 1) forms a hexagonal incommensurate structure which changes into a commensurate Si(1 1 1)-((3 2)(-1 1)) -Pb structure at temperatures below 230 K. A similar ((-1 1) (3 2))- reconstruction, but stable at room temperature, is formed...

  5. ATG16L1

    DEFF Research Database (Denmark)

    Salem, Mohammad; Ammitzboell, Mette; Nys, Kris

    2015-01-01

    (autophagy-related 16-like 1 [S. cerevisiae]), a key component in the autophagic response to invading pathogens, have been associated with an increased risk of developing Crohn disease. The most common and well-studied genetic variant of ATG16L1 (rs2241880; leading to a T300A conversion) exhibits a strong...... association with risk for developing Crohn disease. The rs2241880 variant plays a crucial role in pathogen clearance, resulting in imbalanced cytokine production, and is linked to other biological processes, such as the endoplasmic reticulum stress/unfolded protein response. In this review, we focus......Genetic variations in the autophagic pathway influence genetic predispositions to Crohn disease. Autophagy, the major lysosomal pathway for degrading and recycling cytoplasmic material, constitutes an important homeostatic cellular process. Of interest, single-nucleotide polymorphisms in ATG16L1...

  6. 26 CFR 1.1377-1 - Pro rata share.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Pro rata share. 1.1377-1 Section 1.1377-1...) INCOME TAXES Small Business Corporations and Their Shareholders § 1.1377-1 Pro rata share. (a) Computation of pro rata shares—(1) In general. For purposes of subchapter S of chapter 1 of the Internal...

  7. BIOTECHNOLOGY BIOPRODUCTS "HEALING-1"

    Directory of Open Access Journals (Sweden)

    S. I. Artiukhova

    2014-01-01

    Full Text Available Summary. The article presents data on the development of technology and qualitative research, bio-products «Healing-1». One of the promising directions in food biotechnology is the development of new integrated starter-based consortia of microorganisms, which have higher activity compared with cultures prepared using pure cultures. So it was interesting studies on the development of new biotechnology and bio-based microbial consortium of lactic acid bacteria. Based on the analysis of biotechnological properties of native cultures created a new consortium of microorganisms containing lactic acid streptococci and bacilli, allowing the maximum extent possible to implement the physiological, biochemical and technological potential of microorganisms. Scientifically substantiated and experimentally developed a new biotechnology production of bioproducts «Healing-1», obtained on the basis of microbial consortium with broad spectrum antimicrobial activity. Experimentally investigated quality parameters of organic food «Healing-1» using a new microbial consortium as freshly prepared and during storage. Found that antagonistic activity of microflora bio «Healing-1» with respect to pathogenic and conditionally pathogenic bacteria, as well as its resistance to substances in the gastrointestinal tract of man is more pronounced compared to bioproducts obtained using a separate starter, members of the microbial consortium. It should be noted a more pronounced synthesis of exopolysaccharides in bioproduct «Healing-1», which leads to increased viscosity of the system and improves the consistency of bio. New bioproducts have good organoleptic characteristics and contain a high number of viable cells of lactic acid bacteria. High stability and survival of lactic acid bacteria during storage. In the study of attacked proteins bioproducts digestive proteinases «in vitro» found that the fermentation of milk microbial consortium increases the digestibility

  8. Aggressive HIV-1?

    Directory of Open Access Journals (Sweden)

    van der Hoek Lia

    2005-02-01

    Full Text Available Abstract New York City health officials announced on February 11, 2005 that a patient rapidly developed full-blown AIDS shortly after being diagnosed with a rare, drug-resistant strain of HIV-1. The New York City Department of Health issued an alert to all hospitals and doctors and a press conference was held to announce the emergence of an aggressive HIV-1 strain that may be difficult to treat and that appears to trigger rapid progression to AIDS. Is the panic justified?

  9. SMORN VII. V.1

    International Nuclear Information System (INIS)

    1996-01-01

    These proceedings of the first volume (1 of 2) of the Smorn VII symposium on nuclear reactor surveillance and diagnostics are divided into 7 sessions bearing on: 1) Nuclear power plant surveillance: feedback experience (10 papers); 2) BWR stability monitoring (5 papers); 3) Signal processing advances and applications (11 papers); 4) Neural networks: utilization for monitoring (11 papers); 5) Leak detection in primary systems (6 papers); 6) Thermohydraulics measurements and boiling detection (10 papers); 7) System feedback experience and new system development (8 papers)

  10. AAU-BOT1

    DEFF Research Database (Denmark)

    Svendsen, Mads Sølver; Helbo, Jan; Hansen, Michael Rygaard

    2009-01-01

    This paper describes the development of the humanoid robot AAU-BOT1. The purpose of the robot is to investigate human-like walking and in this connection, test prosthetic limbs. AAU-BOT1 has been designed with modularity in mind making it possible to replace, e.g. the lower leg to test transfemoral...... at Aalborg University and supported by the Department of Health Sciences and Technology (HST). To further reduce the cost, the robot uses off-the-shelf hardware which also reduced the time from idea to practical implementation. The result is a low-cost humanoid robot fully assembled and equipped with sensors...

  11. DNM1 encephalopathy

    DEFF Research Database (Denmark)

    von Spiczak, Sarah; Helbig, Katherine L; Shinde, Deepali N

    2017-01-01

    evolving into Lennox-Gastaut syndrome. Two patients had profound global developmental delay without seizures. In addition, we describe a single patient with normal development before the onset of a catastrophic epilepsy, consistent with febrile infection-related epilepsy syndrome at 4 years. All mutations...... cluster within the GTPase or middle domains, and structural modeling and existing functional data suggest a dominant-negative effect on DMN1 function. CONCLUSIONS: The phenotypic spectrum of DNM1-related encephalopathy is relatively homogeneous, in contrast to many other genetic epilepsies. Up to one...

  12. Opgavesamling Biokemi 1

    DEFF Research Database (Denmark)

    Bjergegaard, Charlotte

    Opgavesamling til bachelorkurset LKEB10077 Biokemi 1. Opgaverne er et supplement til forelæsninger og øvelser og har til formål at støtte op om indlæringen af biokemien. Der er inkluderet ret grundige løsninger til de enkelte opgaver.......Opgavesamling til bachelorkurset LKEB10077 Biokemi 1. Opgaverne er et supplement til forelæsninger og øvelser og har til formål at støtte op om indlæringen af biokemien. Der er inkluderet ret grundige løsninger til de enkelte opgaver....

  13. HIV-1 reverse transcription.

    Science.gov (United States)

    Hu, Wei-Shau; Hughes, Stephen H

    2012-10-01

    Reverse transcription and integration are the defining features of the Retroviridae; the common name "retrovirus" derives from the fact that these viruses use a virally encoded enzyme, reverse transcriptase (RT), to convert their RNA genomes into DNA. Reverse transcription is an essential step in retroviral replication. This article presents an overview of reverse transcription, briefly describes the structure and function of RT, provides an introduction to some of the cellular and viral factors that can affect reverse transcription, and discusses fidelity and recombination, two processes in which reverse transcription plays an important role. In keeping with the theme of the collection, the emphasis is on HIV-1 and HIV-1 RT.

  14. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  15. NUMERICAL STUDY ON CONDENSATION IN IMMERSED CONTAINMENT SYSTEM OF ADVANCED SMR DURING UNCONTROLLED DEPRESSURIZATION

    Directory of Open Access Journals (Sweden)

    Susyadi Susyadi

    2017-11-01

    STUDI NUMERIK PROSES KONDENSASI PADA SISTEM PENGUNGKUNG TERENDAM UNTUK SMR SAAT DEPRESURISASI TAK TERKENDALI. Sejumlah disain reaktor modular daya kecil (SMR sedang dikembangkan dan dibangun oleh beberapa negara dan umumnya masing masing  reaktor tersebut memiliki  inovasi tersendiri. Salah satunya adalah reaktor NuScale yang menggunakan sistem penggungkung ukuran kecil berbahan logam yang terendam dalam kolam air. Pendekatan  baru ini memunculkan tantangan baru karena pengendalian  temperatur dan tekanan dalam pengungkung dilakukan tanpa sistem aktif (peralatan bertenaga listrik. Sehingga perpindahan panas dan kondensasi secara pasif merupakan parameter penting yang perlu diinvestigasi untuk disain pengungkung seperti ini.  Oleh karena itu, penelitian ini akan memeriksa kondensasi, tekanan dan pengaruh temperatur kolam terhadap kemampuan pengungkung memindahkan panas dan menjaga integritasnya. Investigasi dilakukan menggunakan simulasi numerik dengan memodelkan reaktor ke dalam program RELAP5. Hasil perhitungan menunjukkan bahwa selama depresurisasi, batas maksimum tekanan sebesar 5,5 MPa tidak terlampaui. Selain itu, disain pengungkung mampu memindahkan panas ke kolam reaktor secara pasif. Penelitian ini juga melakukan  analisis sensitivitas temperatur kolam reaktor dan hasilnya menunjukkan bahwa untuk kenaikan temperatur kolam sebesar 17 oC, pemindahan panas dari  pengungkung ke kolam hanya sedikit terpengaruh, yakni kurang dari 3 persen. Kata kunci : Pengungkung, Kondensasi, RELAP5, NuScale, Depresurisasi

  16. Efek Durasi Pencahayaan Pada Sistem HRAR Untuk Menurunkan Kandungan Minyak Solar Dalam Air Limbah

    Directory of Open Access Journals (Sweden)

    Dian Puspitasari

    2014-09-01

    Full Text Available Kandungan minyak di dalam air limbah industri perminyakan umumnya bersifat toksik terhadap mikroorganisme dan mengganggu proses pengolahan secara biologis. Sistem HRAR diperkirakan dapat mengatasi hambatan tersebut melalui proses fotosintesis untuk menghasilkan oksigen yang dibutuhkan mikroorganisme dalam mendegradasi senyawa hidrokarbon. Penelitian ini bertujuan mengkaji pengaruh perpanjangan waktu pencahayaan pada kemampuan HRAR dalam menurunkan kandungan minyak di dalam limbah. Variabel yang digunakan pada penelitian ini adalah variasi durasi pencahayaan dan variasi penambahan volume minyak solar yang ditambahkan ke dalam reaktor. Variasi durasi pencahayaan yang digunakan adalah pencahayaan selama 12 jam dan pencahayaan selama 24 jam. Sedangkan penambahan volume minyak solar ke dalam masing-masing reaktor adalah sebesar 346 ppm, 519 ppm dan 692 ppm. Hasil yang didapatkan dari penelitian ini adalah durasi pencahayaan selama 12 jam memiliki efek yang lebih baik terhadap penurunan konsentrasi minyak dibandingkan pencahayaan selama 24 jam. Hal ini dapat terlihat dari baiknya pertumbuhan alga dan bakteri di dalam reaktor serta tingginya penurunan konsentrasi minyak solar di dalamnya. Penurunan konsentrasi minyak solar terbaik terdapat pada reaktor dengan penambahan minyak solar sebesar 346 ppm. Pada reaktor dengan durasi pencahayaan selama 12 jam terjadi penurunan konsentrasi minyak sebesar 78,4%. Sedangkan penurunan kandungan minyak solar pada reaktor dengan durasi pencahayaan selama 24 jam adalah sebesar 73,9%.

  17. IDEA papers no. 1

    International Nuclear Information System (INIS)

    Garrigues, P.

    2002-04-01

    The Information network on the Economic Development in Aquitaine (IDEA) aims to collect and spread the environmental information concerning the Aquitaine, in order to implement an observatory of the regional environment and of the sustainable development. The IDEA paper no. 1 provides information such as, meeting, Internet addresses and programs, for the month of April 2002. (A.L.B.)

  18. Oyesiku (1).cdr

    African Journals Online (AJOL)

    Timothy Ademakinwa

    The mechanism of water condition in the Musci considered in relation to habitat. III. Mosses growing in dry environments. Annals of Botany 47: 889-912. Clausen, E. 1952.Hepatics and humidity. Dansk. Botany Arkive15 (1): 80. Dilks, T.J.K. &Proctor, M.C.F. 1979. Photosynthesis, respiration and water content in bryophytes.

  19. Table S1

    Indian Academy of Sciences (India)

    Synthesis, crystal structure, theoretical study and luminescence property of a butterfly-like W/Cu/S cluster with 1,10-phenanthroline. CHEN AI-HUA a, b , MENG SU-CI b, d, ZHANG JIN-FANG b, c and ZHANG CHI b, c[*]. a School of Chemical and Biological Engineering, Yancheng Institute of Technology, Yancheng 224051, ...

  20. Short Corr1munication

    African Journals Online (AJOL)

    development of Platycerium bifurcatum. Amer. Fern J 89(2): 124-1 32. Hickok, L., G., Warne, T., R., and Slocum, M., K. (1987). Ceratopteris richardii: Applications for experimental plant biology. Amer. J. Bot. 59: 458-465. Knop, N. (1885). Quantitative untersuchungan uber die ernahrungsprozesse der ptlangen. land wirtsch ...

  1. JCSC Supporting Information(1).

    Indian Academy of Sciences (India)

    TLC or HPLC routinely checked for the purity of all compounds. IR spectra were recorded on a Perkin-Elmer model 2000 instrument in KBr phase. 1H-NMR (400 MHz) and 13C-NMR (100 MHz) spectra were recorded in CDCl3 or DMSO using Bruker instrument and Mass spectra were recorded on a Perkin-Elmer mass ...

  2. Frameworks in CS1

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak; Caspersen, Michael Edelgaard

    2002-01-01

    In this paper we argue that introducing object-oriented frameworks as subject already in the CS1 curriculum is important if we are to train the programmers of tomorrow to become just as much software reusers as software producers. We present a simple, graphical, framework that we have successfully...

  3. HIV-1 vaccines

    Science.gov (United States)

    Excler, Jean-Louis; Robb, Merlin L; Kim, Jerome H

    2014-01-01

    The development of a safe and effective preventive HIV-1 vaccine remains a public health priority. Despite scientific difficulties and disappointing results, HIV-1 vaccine clinical development has, for the first time, established proof-of-concept efficacy against HIV-1 acquisition and identified vaccine-associated immune correlates of risk. The correlate of risk analysis showed that IgG antibodies against the gp120 V2 loop correlated with decreased risk of HIV infection, while Env-specific IgA directly correlated with increased risk. The development of vaccine strategies such as improved envelope proteins formulated with potent adjuvants and DNA and vectors expressing mosaics, or conserved sequences, capable of eliciting greater breadth and depth of potentially relevant immune responses including neutralizing and non-neutralizing antibodies, CD4+ and CD8+ cell-mediated immune responses, mucosal immune responses, and immunological memory, is now proceeding quickly. Additional human efficacy trials combined with other prevention modalities along with sustained funding and international collaboration remain key to bring an HIV-1 vaccine to licensure. PMID:24637946

  4. JOS JOURNAL 1

    African Journals Online (AJOL)

    1 syndrome of congenital anomalies. These syndromes include Holt-Oram syndrome, Down's syndrome, Fanconi Polycytemia, Meckel syndrome, Lawrence Moon Biedl syndrome,. Patau's syndrome and klippel-Trenaunay syndrome. There may also be associated cleft palate, hearing difficulties, renal anomalies, other. 3.

  5. IUPHAR Review 1

    DEFF Research Database (Denmark)

    Harmar, Anthony J; Fahrenkrug, Jan; Gozes, Illana

    2012-01-01

    in the control of circadian rhythms, learning and memory, anxiety and responses to stress and brain injury. Recent genetic studies also implicate the VPAC(2) receptor in susceptibility to schizophrenia and the PAC(1) receptor in post-traumatic stress disorder. In the periphery, VIP and PACAP play important roles...

  6. Projektrapport: Studieliv 1

    DEFF Research Database (Denmark)

    Ibsen, Marianne; Nordbjerg, Finn Ebertsen; Rasmussen, Rikke Cathrine Bøgeskov

    Projektet er et mixed methods studie med et ikke-randomiseret eksperimentelt design (kvasieksperimentelt). Deltagerne er 1. års studerende på henholdsvis sygeplejerskeuddannelsen og datamatikeruddannelsen. Undersøgelsens data er indsamlet mellem september 2014 og december 2015. Formålet med...

  7. September 1, 2013

    African Journals Online (AJOL)

    Osondu

    2013-09-01

    Sep 1, 2013 ... This study evaluated selected physico-chemical properties of topsoil under monoculture plantation of an indigenous tree species - Nauclea diderrichii, and those of four exotic tree species – Theobroma cacao, Gmelina arborea, Pinus caribaea and Tectona grandis, located in Omo Biosphere Reserve, Ogun ...

  8. Aggressive HIV-1?

    NARCIS (Netherlands)

    Berkhout, Ben; de Ronde, Anthony; van der Hoek, Lia

    2005-01-01

    New York City health officials announced on February 11, 2005 that a patient rapidly developed full-blown AIDS shortly after being diagnosed with a rare, drug-resistant strain of HIV-1. The New York City Department of Health issued an alert to all hospitals and doctors and a press conference was

  9. Rescue Manual. Module 1.

    Science.gov (United States)

    Ohio State Univ., Columbus. Instructional Materials Lab.

    This learner manual for rescuers covers the current techniques or practices required in the rescue service. The first of 10 modules contains 9 chapters: (1) introduction; (2) occupational stresses in rescue operations; (3) size-up; (4) critique; (5) reports and recordkeeping; (6) tools and equipment for rescue operations; (7) planning for…

  10. Temitope et al (1)

    African Journals Online (AJOL)

    DELL

    positive bacteria. Table 2: Minimum Inhibitory Concentration (mg/mL) of the synthesized compounds against. Gram-positive and Gram-negative Bacterial Strains at 10 mg/mL. Bacterial Isolate. 1. 2a. 2b. 2c. 2d. 2e. 2f. Amp. Strep. E. coli (-ve). 2.5.

  11. JOS JOURNAL 1

    African Journals Online (AJOL)

    the modification of vaccine candidates to improve development techniques and further scientific understanding is known as 'iterative development'. The advantage of DNA vaccines over classical attenuated vaccines are numerous and include being able to mimic MHC class 1 CD8+ T cell specific responses that potentially ...

  12. BEGINNING INDONESIAN. VOLUME 1.

    Science.gov (United States)

    DYEN, ISIDORE

    VOLUME 1 OF A 4-VOLUME WORK ON BEGINNING INDONESIAN CONTAINS THE FIRST 6 LESSONS OF A TOTAL OF 24. THESE SIX LESSONS PROVIDE DRILLS IN BASIC INDONESIAN SENTENCE PATTERNS INVOLVING THE USE OF TERMS OF ADDRESS, POLITE FORMULAS AND RESPONSES, AUXILIARIES, COMMANDS, AND ABSOLUTE EXPRESSIONS. RELATED REPORTS ARE ED 010 456 THROUGH ED 010 459. (GD)…

  13. Synthesis de 1-dotriacotanol

    International Nuclear Information System (INIS)

    Hernandez, L.; Gonzalez, J.C.

    1996-01-01

    In order to prepare isotopic labeled long chain aliphatic primary alcohol's, the synthesis overall yielding and chemical purity of 1-dotriacotanol were 41% and 98%, respectively. This procedure is very useful for carbon-14 and tritium labeling at Beta position of saturated fatty alcohol's

  14. supplementary1.doc

    Indian Academy of Sciences (India)

    Electrochemical preparation of Nitrogen doped Graphene Quantum Dots and their Size-dependent Electrocatalytic Activity for Oxygen Reduction. Dhanraj B. Shindea, Vishal M. Dhavalea, Sreekumar Kurungota* and Vijayamohanan K. Pillaib*. Cyclic voltammetry of different size N-GQDs: Figure S1. Cyclic voltammetry study ...

  15. JOS JOURNAL 1

    African Journals Online (AJOL)

    a spontaneous rupture of a blind eye. Panophthalmitis accounted for 16.7% while retinoblastoma accounted for 8.3% of the indications (table 1). Trauma was the leading indication for removal of the eye in adults while measles infection in 75% of the children led to ocular complications necessitating surgical removal of the ...

  16. 16 (No.1)

    African Journals Online (AJOL)

    mwakagugu

    2010-05-18

    May 18, 2010 ... during their working lives (1) these are associated with significant ... self-esteem, depression and anxiety, and feelings of hopelessness ... job satisfaction. While the particular areas of stressful interaction are as numerous and varied as are the approaches to deal with such situations, what may be of ultimate ...

  17. Unit 1: Labour Law

    OpenAIRE

    Montoya Medina, David

    2014-01-01

    Versión en inglés de la Lección 1ª y de materiales complementarios (diapositivas Pwp y cuestionario) de la asignatura Derecho del Trabajo I del Grado en Derecho. Concepto de Derecho del Trabajo y factores de aparición histórica del Derecho del Trabajo.

  18. Number 1, July

    Indian Academy of Sciences (India)

    Energy distribution of cosmic rays in the Earth's atmosphere and avionic area using Monte. Carlo codes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . M Ould Mohamed, A S A Dib and A H Belbachir. 1. Influence of nuclear dissipation on fission dynamics of the excited nucleus 248Cf within a stochastic approach .

  19. 1.0 Introduction

    African Journals Online (AJOL)

    ADDRESSING AFRICAN FEMINISM. H F Chidammodzi. 1.0 Introduction. Popular struggles for democracy and human rights in Africa today have, among other things, precipitated a reflective consciousness upon the status and conditions of women. The African woman herself has become sensitised to the multiple forms.

  20. supp1.doc

    Indian Academy of Sciences (India)

    Supporting Information. Salts and cocrystals of Theobromine and their phase transformations in water. PALASH SANPHUI and ASHWINI NANGIA*. School of Chemistry, University of Hyderabad, Prof. C. R. Rao Road, Gachibowli, Central University P.O., Hyderabad 500 046, India. Table S1. Hydrogen bonds in crystal ...

  1. RASSF1A

    Science.gov (United States)

    Gordon, Marilyn

    2011-01-01

    The Ras association domain family (RASSF) of genes are commonly silenced by promoter specific methylation in human cancers. After the cloning of the first two family members in early 2000 (RASSF1 and RASSF5), eight other related genes have been identified (RASSF2, 3, 4 and 6–10). The unifying motif amongst all RASSF family members is the presence of the Ras association (RA) domain that could potentially associate with the Ras family of GTPases. Detailed analyses have determined that RASSF family members are tumor suppressor proteins, activators of cell death, cell cycle modulators, microtubule stabilizers and possibly inflammatory mediators linked to NFκB. As such, exploring the biological function of this gene family is needed and if indeed RASSF proteins could be the missing link between Ras signaling and apoptosis. Several RASSF family members have been demonstrated to associate with Ras. However, there is still controversy regarding the ability of RASSF1A to utilize Ras to promote cell death and of the importance of the RASSF1A RA domain. The focus of this review is to highlight the importance of Ras binding to the RASSF family of proteins and discuss what we currently know about the biology of RASSF1A. PMID:21776416

  2. Parcelhusatlas 1.0

    DEFF Research Database (Denmark)

    2016-01-01

    Parcelhusatlas 1.0 er et interaktivt GIS-kort i form af en web-app, der kan tilgås fra forskellige platforme. Kortet rummer data om Danmarks parcelhuse, aggregeret på sogneniveau. Referenceåret er 2013. Atlasset rummer forskellige temaer indenfor byggedata, socio-økonomiske data og energiforhold...

  3. binding protein (HABP1)

    Indian Academy of Sciences (India)

    Unknown

    of HA in a concentration-dependent manner, suggesting its multiligand affinity amongst carbohydrates. rHABP1 shows differential affinity ... site is seen to correspond to the carbohydrate-binding site in E-selectin, which has similarity in the ... adsorbed on carbon coated copper grid (400 mesh) for. 5 min at room temperature.

  4. Alpha1-antitrypsin deficiency

    DEFF Research Database (Denmark)

    Stolk, Jan; Seersholm, Niels; Kalsheker, Noor

    2006-01-01

    The Alpha One International Registry (AIR), a multinational research program focused on alpha1-antitrypsin (AAT) deficiency, was formed in response to a World Health Organization recommendation. Each of the nearly 20 participating countries maintains a national registry of patients with AAT defic...... epidemiology, inflammatory and signalling processes, therapeutic advances, and lung imaging techniques....

  5. Adisa & Adekoya (1)

    African Journals Online (AJOL)

    USER

    linear correlation matrix was generated from the logarithmically transformed data using SPSS version 16.0 software. RESULTS AND DISCUSSION. Frequency Distribution Plots. Table 1 shows the basic statistical parameters of the raw data. A study of the raw data frequency plots (Fig. 4) revealed that twenty of the twenty-.

  6. county_1m

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — This is a raster grid dataset (1-Meter Resolution) of the ground points derived from the acquired LiDAR. The Light Detection and Ranging (LiDAR) DEM dataset is a...

  7. 1 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    therapeutic agent that can be employed in wound care and management. Key Words: Enterocin, Enterococcus faecalis, wounds, bacteriocin, Staphylococcus aureus, skin. L'ACTIVITE ANTIMICROBIENNE IN VITRO ET IN ... in the food industry since they inhibit the growth of most bacteria that spoil and contaminate food (1,6 ...

  8. 1 _. FOR RURAL FARMERS

    African Journals Online (AJOL)

    Therefore the design consideration and material. - selection, in this work are mainly heat ... 29.5 C fo ambient temperature, FR = 0.487 for heaglremoval factor, 1= 465.9W/m for solar radiation, Te = 0.95 for .... dryer above ambient temperature level enhanced the quick drying of the crop in the dryer. Hence the solar mud ...

  9. Supplementary 1..2

    Indian Academy of Sciences (India)

    spermatocyte stage (SC) cysts, respectively. Note that in both cases the GFP fluorescence is excluded from the germline cells and localized in the somatic cyst cells. WB marks the waste bags at the end of elongated spermatids within the cysts. Supplementary table 1. Fly stocks used in the study. Stocks. Source. Reference.

  10. Volume 9 Number 1

    African Journals Online (AJOL)

    OLUWOLE

    CLOTHING INDUSTRY IN NIGERIA. Iloeje1, C.I. and Anyakoha2, E.U. ... categories- small, medium and large as well as test the fit of the garments constructed from the blocks. The area of study was Enugu State. ... Key words: Block, Pattern, Technology, Clothing Industry, Nigerian's economy. INTRODUCTION. The clothing ...

  11. 1, 2, 3 ... FAIR !

    International Nuclear Information System (INIS)

    Sturm, C.; Sharkov, B.; Stoecker, H.

    2010-01-01

    The Facility for Antiproton and Ion Research FAIR at Darmstadt/Germany will provide worldwide unique accelerator and experimental facilities allowing for a large variety of unprecedented forefront research in hadron, nuclear, atomic and plasma physics and applied sciences. The start version of FAIR, the so called Modularized Start Version includes a basic accelerator as well as three experimental modules - 1, 2, 3 FAIR!

  12. Intersection I-1

    CERN Multimedia

    CERN PhotoLab

    1971-01-01

    Intersection I-1 of the ISR in August 1971 showing the 90 degree large acceptance spectrometer of the Saclay-Strasbourg Collaboration which is studying the momentum spectra of electrons at large angles. On the left of the crossing region can be seen the track used by the CERN-Bucharest-Cracow-Tata Collaboration to bring nuclear emulsions into the ISR.

  13. The First Digit 1

    Indian Academy of Sciences (India)

    IAS Admin

    RESONANCE | December 2013. GENERAL | ARTICLE. The First Digit 1. Tanya Kaushal Srivastava. Keywords. Random numbers, unpredict- able, equidistribution, Weyl cri- terion, absorptive property. Tanya Kaushal Srivastava is a BS-MS student at the. Department of Mathemat- ics, IISER Mohali and is a. KVPY fellow.

  14. Konversationel kompetence (1) - Teori

    DEFF Research Database (Denmark)

    Ambjørn, Lone

    Kompendiet er en ny og revideret udgave af 'Den spanske samtale – Teori' fra 2009. Det er specielt udarbejdet til 1,2. og 3. semesters spanskundervisning inden for disciplinen 'Spansk kommunikation' på BA-studiet. Kompendiet, der anvendes parallelt med 'Konversationel kompetence – Træning', udgør...

  15. Cyp8b1

    Science.gov (United States)

    Bertaggia, Enrico; Jensen, Kristian K; Castro-Perez, Jose; Xu, Yimeng; Di Paolo, Gilbert; Chan, Robin B; Wang, Liangsu; Haeusler, Rebecca A

    2017-08-01

    Bile acids (BAs) are cholesterol derivatives that regulate lipid metabolism, through their dual abilities to promote lipid absorption and activate BA receptors. However, different BA species have varying abilities to perform these functions. Eliminating 12α-hydroxy BAs in mice via Cyp8b1 knockout causes low body weight and improved glucose tolerance. The goal of this study was to determine mechanisms of low body weight in Cyp8b1 -/- mice. We challenged Cyp8b1 -/- mice with a Western-type diet and assessed body weight and composition. We measured energy expenditure, fecal calories, and lipid absorption and performed lipidomic studies on feces and intestine. We investigated the requirement for dietary fat in the phenotype using a fat-free diet. Cyp8b1 -/- mice were resistant to Western diet-induced body weight gain, hepatic steatosis, and insulin resistance. These changes were associated with increased fecal calories, due to malabsorption of hydrolyzed dietary triglycerides. This was reversed by treating the mice with taurocholic acid, the major 12α-hydroxylated BA species. The improvements in body weight and steatosis were normalized by feeding mice a fat-free diet. The effects of BA composition on intestinal lipid handling are important for whole body energy homeostasis. Thus modulating BA composition is a potential tool for obesity or diabetes therapy. Copyright © 2017 the American Physiological Society.

  16. JOS JOURNAL 1

    African Journals Online (AJOL)

    En coup de sabre (ECDS) is a peculiar variant of morphea characterized by linear, atrophic cutaneous depressed plaques that usually develops during childhood. We present a case of a 5year old boy whose lesion started at the age of 3. Introduction. Scleroderma may occur as a systemic disease or as. 1 a localised form.

  17. Distribution of HLA-DRB1/DQB1 alleles and DRB1-DQB1 ...

    African Journals Online (AJOL)

    Marwa Chaouali

    2017-03-17

    Mar 17, 2017 ... Moreover, elevated transaminase and immunoglob- ulin G (IgG) levels, and the presence of antibodies characterize the physiopathology of AIH [3]. Based on the nature of the serum autoantibodies, clinical behavior and age of presentation, two types of AIH are described, type 1 and type 2 AIH [4]. The most.

  18. S1PR1 Tyr143 phosphorylation downregulates endothelial cell surface S1PR1 expression and responsiveness

    Science.gov (United States)

    Chavez, Alejandra; Schmidt, Tracy Thennes; Yazbeck, Pascal; Rajput, Charu; Desai, Bhushan; Sukriti, Sukriti; Giantsos-Adams, Kristina; Knezevic, Nebojsa; Malik, Asrar B.; Mehta, Dolly

    2015-01-01

    ABSTRACT Activation of sphingosine-1-phosphate receptor 1 (S1PR1) plays a key role in repairing endothelial barrier function. We addressed the role of phosphorylation of the three intracellular tyrosine residues of S1PR1 in endothelial cells in regulating the receptor responsiveness and endothelial barrier function regulated by sphingosine 1-phosphate (S1P)-mediated activation of S1PR1. We demonstrated that phosphorylation of only Y143 site was required for S1PR1 internalization in response to S1P. Maximal S1PR1 internalization was seen in 20 min but S1PR1 returned to the cell surface within 1 h accompanied by Y143-dephosphorylation. Cell surface S1PR1 loss paralleled defective endothelial barrier enhancement induced by S1P. Expression of phospho-defective (Y143F) or phospho-mimicking (Y143D) mutants, respectively, failed to internalize or showed unusually high receptor internalization, consistent with the requirement of Y143 in regulating cell surface S1PR1 expression. Phosphorylation of the five S1PR1 C-terminal serine residues did not affect the role of Y143 phosphorylation in signaling S1PR1 internalization. Thus, rapid reduction of endothelial cell surface expression of S1PR1 subsequent to Y143 phosphorylation is a crucial mechanism of modulating S1PR1 signaling, and hence the endothelial barrier repair function of S1P. PMID:25588843

  19. 26 CFR 1.267(b)-1 - Relationships.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Relationships. 1.267(b)-1 Section 1.267(b)-1...) INCOME TAXES Items Not Deductible § 1.267(b)-1 Relationships. (a) In general. (1) The persons referred to... partnership separately. Therefore, if the other person and a partner are within any one of the relationships...

  20. 26 CFR 1.1201-1 - Alternative tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Alternative tax. 1.1201-1 Section 1.1201-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Wash Sales of Stock Or Securities § 1.1201-1 Alternative tax. (a) Corporations—(1) In...

  1. 47 CFR 1.1 - Proceedings before the Commission.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Proceedings before the Commission. 1.1 Section 1.1 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE General Rules of Practice and Procedure General § 1.1 Proceedings before the Commission. The Commission may on its...

  2. 2009 H1N1 Flu Vaccine Facts

    Science.gov (United States)

    ... turn Javascript on. Feature: Flu 2009 H1N1 Flu Vaccine Facts Past Issues / Fall 2009 Table of Contents ... H1N1 flu vaccine. 1 The 2009 H1N1 flu vaccine is safe and well tested. Clinical trials conducted ...

  3. 26 CFR 1.85-1 - Unemployment compensation.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Unemployment compensation. 1.85-1 Section 1.85-1...) INCOME TAXES (CONTINUED) Items Specifically Included in Gross Income § 1.85-1 Unemployment compensation... unemployment compensation (as defined in paragraph (b)(1) of this section) paid in taxable years beginning...

  4. 26 CFR 1.704-1 - Partner's distributive share.

    Science.gov (United States)

    2010-04-01

    ... allocations 1.704-1(b)(1)(vii) Substantial economic effect 1.704-1(b)(2) Two-part analysis 1.704-1(b)(2)(i... credit (or item thereof) to a partner but such allocation does not have substantial economic effect, then... economic effect, is not in accordance with the partner's interest in the partnership, and is not deemed to...

  5. 45 CFR 1.1 - Location of HHS regulations.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Location of HHS regulations. 1.1 Section 1.1 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION HHS'S REGULATIONS § 1.1 Location of HHS regulations. Regulations for HHS's programs and activities are located in several different...

  6. 26 CFR 1.46-1 - Determination of amount.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Determination of amount. 1.46-1 Section 1.46-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY INCOME TAX INCOME TAXES Rules for Computing Credit for Investment in Certain Depreciable Property § 1.46-1 Determination of amount. (a...

  7. 41 CFR 300-1.1 - What is the FTR?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false What is the FTR? 300-1.1 Section 300-1.1 Public Contracts and Property Management Federal Travel Regulation System GENERAL INTRODUCTION 1-THE FEDERAL TRAVEL REGULATION (FTR) § 300-1.1 What is the FTR? The FTR is the regulation...

  8. CYP1A1, CYP1B1, GSTM1 and GSTT1 genetic variants and breast cancer risk in Mexican women

    Directory of Open Access Journals (Sweden)

    Angélica García-Martínez

    2017-08-01

    Full Text Available Objective. To evaluate if variants in the genes CYP1A1 (T3801C and A4889G, CYP1B1 (G119T, GSTM1 (indel and GSTT1 (indel are associated with breast cancer (BC among Mexican women. Materials and methods. 952 incident cases with histologically confirmed BC were matched by age(± 5 years and zone of residence with 998 healthy population controls. Genetic variants in genes CYP1A1, CYP1B1, GSTM1 and GSTT1were genotyped by allelic discrimination and multiplex PCR. In a subsample of women, 105 markers for ancestry were determined. Results. An increased BC risk, independent of other BC risk factors, was observed among carriers of CYP1B1 G119T genotype (T/T vs. G/G: OR=1.9; 95%CI 1.4-2.5. Conclusion. Our results support the existence of genetic susceptibility for BC conferred by CYP1B1 G119T variant among Mexican women.

  9. Improving surface smoothness and photoluminescence of CdTe(1 1 1)A on Si(1 1 1) substrates grown by molecular beam epitaxy using Mn atoms

    International Nuclear Information System (INIS)

    Wang, Jyh-Shyang; Tsai, Yu-Hsuan; Chen, Chang-Wei; Dai, Zi-Yuan; Tong, Shih-Chang; Yang, Chu-Shou; Wu, Chih-Hung; Yuan, Chi-Tsu; Shen, Ji-Lin

    2014-01-01

    Highlights: • CdTe(1 1 1)A epilayers were grown on Si(1 1 1) substrates by molecular beam epitaxy. • We report an enhanced growth using Mn atoms. • The significant improvements in surface quality and optical properties were found. - Abstract: This work demonstrates an improvement of the molecular beam epitaxial growth of CdTe(1 1 1)A epilayer on Si(1 1 1) substrates using Mn atoms. The reflection high-energy electron diffraction patterns show that the involvement of some Mn atoms in the growth of CdTe(1 1 1)A is even more effective than the use of a buffer layer with a smooth surface for forming good CdTe(1 1 1)A epilayers. 10 K Photoluminescence spectra show that the incorporation of only 2% Mn significantly reduced the intensity of defect-related emissions and considerably increased the integral intensity of exciton-related emissions by a large factor of about 400

  10. Summary: after LS1

    International Nuclear Information System (INIS)

    Pojer, M.; Schmidt, R.

    2012-01-01

    After LS1 the energy will be about 6.5 TeV. The physics potential of LHC is determined by the integrated luminosity useful for the experiments and not only by the peak luminosity. The integrated luminosity is determined by the peak luminosity, the luminosity decay and the efficiency of operation (availability). In this session two of these parameters are addressed, the peak luminosity and the availability. In this paper peak luminosity is discussed through the performance potential of the injectors and through the global performance reach of LHC after LS1. LHC availability is tackled through the issues of the reliability of the magnet powering and of the beam system and of the occurrence of quenches

  11. Heat Roadmap Europe 1

    DEFF Research Database (Denmark)

    Connolly, David; Mathiesen, Brian Vad; Østergaard, Poul Alberg

    2012-01-01

    Heat Roadmap Europe (Pre-study 1) investigates the role of district heating in the EU27 energy system by mapping local conditions across Europe, identifying the potential for district heating expansion, and subsequently simulating the potential resource in an hourly model of the EU27 energy system....... In 2010, approximately 12% of the space heating demand in Europe is met by district heating, but in this study four alternative scenarios are considered for the EU27 energy system: 1. 2010 with 30% district heating 2. 2010 with 50% district heating 3. 2030 with 30% district heating 4. 2050 with 50......% district heating These scenarios are investigated in two steps. Firstly, district heating replaces individual boilers by converting condensing power plants to combined heat and power plants (CHP) to illustrate how district heating improves the overall efficiency of the energy system. In the second step...

  12. Evaluation report no.1

    International Nuclear Information System (INIS)

    1995-06-01

    This document, which is the first evaluation report from the French National Evaluation Commission about research on radioactive waste management, was sent to the French Government on June 30, 1995. The Commission was created in January 1994 and started its investigations on April 1994. The evaluation concerns the three axes of the 91-1381 law from December 30, 1991 (1 - separation-transmutation and minimization of wastes, 2 - underground disposal, 3 - choices for conditioning, storage and disposal). The document has been written after hearing of the principal French research organisms. The report focusses on the necessity for a scientific and technical coordination between all the organisms concerned, for a consistent and open analysis of all research topics. This implies a compatibility between schedules and specifications, and with the 15 years allowed by the law. (J.S.). 15 figs., 14 tabs., 4 annexes., 1 glossary

  13. (1-Bromonaphthalen-2-ylacetonitrile

    Directory of Open Access Journals (Sweden)

    Andria D. Harris

    2008-07-01

    Full Text Available The title compound, C12H8BrN, was prepared as a starting material for a Suzuki cross-coupling reaction with a pinacol ester. The torsion angle about the ring–methylene C—C bond is 30.7 (3°, such that the N atom is displaced by 1.174 (4 Å from the plane of the naphthalene ring system.

  14. UOA1: Hardware Manual

    Energy Technology Data Exchange (ETDEWEB)

    Wolfers, G.; Sanchez, E.

    2012-07-01

    The UOA1 is a versatile printed circuit board which can be configured to accommodate up to four analogue signal channels of either electrical to optical or optical to electrical converters. A charge-balance voltage to frequency technique is used for the conversion. The board can be adapted to different electrical input or output range and the full scale frequency can be adjusted to provide the best accuracy-to bandwidth compromise for each application. (Author)

  15. Applied N=1 Supergravity

    Science.gov (United States)

    Nath, Pran

    A review of recent developments in the applications of N=1 Supergravity to the construction of unified models of elementary particle interactions is given. Couplings of N=1 Supergravity with matter consisting of an arbitrary set of l handed multiplets and a gauge multiplet are discussed. General formulation of spontaneous symmetry breaking and the criteria for breaking of internal symmetry and of local supersymmetry are described. Construction of specific Supergrvity GUT models, the gauge heirarchy in GUT models and a deduction of the low energy effective potential are discussed. The phenomena of SU(2)XU(1) electro-weak gauge invariance breakdown by Supergravity in tree models and by radiative corrections using renormalization group methods are described. Model independent formulations of low energy physics which encompass tree and the renormalization group methods of breaking SU(2)XU(1), but also allow more general scenarios are discussed. The particle content of Supergravity unified theories at low energy is given which includes predictions, for a class of supergravity models, of light gauge fermins, i.e. of a charged Dirac fermion, the Wino, with a mass below the W boson mass and a neutral fermion, the Zino, below the mass of the Z boson mass. "Direct" gaugino masses arising from loops for the photino and the gluino, (which are massless at the tree level) are exhibited. Decays of the W and Z into photino. Vino, and Zino modes and their branching ratios into various channels are given. Experimental signals for the supersymmetrie decays are discussed and some prominent signatures such as decays into one and two jets with unbalanced energy and momentum are pointed out. The current status of the ρ-parameter, including supergravity GUT effects is given. Other experimental consequences of supergravity unified theories are also discussed.

  16. RESTAURANT No. 1

    CERN Multimedia

    2002-01-01

    Customers are kindly requested to note the modified opening times of restaurant no. 1 from Monday, February 4 to Sunday, March 3, 2002 : from Monday to Friday 07h00 - 23h00 Saturday / Sunday 08h00 - 21h00 Hot meals will be served between 11h30 and 14h00, then from 18h00 to 19h30. Restaurant Supervisory Committee, tel. 77551

  17. EuroHYP-1

    DEFF Research Database (Denmark)

    van der Worp, H Bart; Macleod, Malcolm R; Bath, Philip M W

    2014-01-01

    RATIONALE: Cooling reduced infarct size and improved neurological outcomes in animal studies modeling ischemic stroke, and also improved outcome in randomized clinical trials in patients with hypoxic-ischemic brain injury after cardiac arrest. Cooling awake patients with ischemic stroke has been ......% absolute improvement at the 5% significance level. The full trial protocol is available at http://www.eurohyp1.eu. ClinicalTrials.gov Identifier: NCT01833312....

  18. FLOOD 1. Final Report

    OpenAIRE

    Adams, Brian; Bloomfield, John; Gallagher, Alexander; Jackson, Christopher; Rutter, Helen; Williams, Ann

    2008-01-01

    The FLOOD 1 project was carried out by the French Geological Survey (BRGM), the University of Brighton and the British Geological Survey from April 2004 to June 2008 inclusive. It was carried out under the INTERREG IIIA initiative of the European Union which provided 50% of the funding, the remainder coming from the three project partners and a number of industrial partners who also formed the Project Advisory Group. The project was set up to develop appropriate early warning s...

  19. Chapter 1: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2009-01-18

    The Office of Energy Efficiency and Renewable Energy (EERE) develops–and encourages consumers and business to adopt–technologies that improve energy efficiency and increase the use of renewable energy. This report describes analysis undertaken by EERE to better understand the extent to which the technologies and market improvements funded by its FY 2004 Budget Request1 will make energy more affordable, cleaner, and more reliable.

  20. Spacetime extensions Pt. 1

    International Nuclear Information System (INIS)

    Racz, I.

    1991-09-01

    The problem of the existence of local extensions of spacetime is considered. It is shown that for a spacetime including an incomplete inextendible non-coiling causal geodesic curve there exists a particular C k (resp. C k- ) local extension provided that the curvature and its covariant derivatives are well behaved up to order k + 1 (resp. k) along a family of causal geodetics (around the chosen one). (R.P.) 15 refs

  1. Vitiligo - Part 1*

    Science.gov (United States)

    Tarlé, Roberto Gomes; do Nascimento, Liliane Machado; Mira, Marcelo Távora; de Castro, Caio Cesar Silva

    2014-01-01

    Vitiligo is a chronic stigmatizing disease, already known for millennia, which mainly affects melanocytes from epidermis basal layer, leading to the development of hypochromic and achromic patches. Its estimated prevalence is 0.5% worldwide. The involvement of genetic factors controlling susceptibility to vitiligo has been studied over the last decades, and results of previous studies present vitiligo as a complex, multifactorial and polygenic disease. In this context, a few genes, including DDR1, XBP1 and NLRP1 have been consistently and functionally associated with the disease. Notwithstanding, environmental factors that precipitate or maintain the disease are yet to be described. The pathogenesis of vitiligo has not been totally clarified until now and many theories have been proposed. Of these, the autoimmune hypothesis is now the most cited and studied among experts. Dysfunction in metabolic pathways, which could lead to production of toxic metabolites causing damage to melanocytes, has also been investigated. Melanocytes adhesion deficit in patients with vitiligo is mainly speculated by the appearance of Köebner phenomenon, recently, new genes and proteins involved in this deficit have been found. PMID:24937821

  2. Indico 1.0

    CERN Document Server

    Lopez, J B Gonzalez; Baron, T; Ferreira, P; Kolobara, B; Pugh, M A; Resco, A; Trzaskoma, J P

    2014-01-01

    Indico has evolved into the main event organization software, room booking tool and collaboration hub for CERN. The growth in its usage has only accelerated during the past 9 years, and today Indico holds more that 215,000 events and 1,100,000 files. The growth was also substantial in terms of functionalities and improvements. In the last year alone, Indico has matured considerably in 3 key areas: enhanced usability, optimized performance and additional features, especially those related to meeting collaboration. Along the course of 2012, much activity has centred around consolidating all this effort and investment into 'version 1.0', recently released in 2013.Version 1.0 brings along new features, such as the Microsoft Exchange calendar synchronization for participants, many new and clean interfaces (badges and poster generation, list of contributions, abstracts, etc) and so forth. But most importantly, it brings a message: Indico is now stable, consolidated and mature after more than 10 years of non-stop de...

  3. UA1 prototype detector

    CERN Multimedia

    1980-01-01

    Prototype of UA1 central detector inside a plexi tube. The UA1 experiment ran at CERN's Super Proton Synchrotron and made the Nobel Prize winning discovery of W and Z particles in 1983. The UA1 central detector was crucial to understanding the complex topology of proton-antiproton events. It played a most important role in identifying a handful of Ws and Zs among billions of collisions. The detector was essentially a wire chamber - a 6-chamber cylindrical assembly 5.8 m long and 2.3 m in diameter, the largest imaging drift chamber of its day. It recorded the tracks of charged particles curving in a 0.7 Tesla magnetic field, measuring their momentum, the sign of their electric charge and their rate of energy loss (dE/dx). Atoms in the argon-ethane gas mixture filling the chambers were ionised by the passage of charged particles. The electrons which were released drifted along an electric field shaped by field wires and were collected on sense wires. The geometrical arrangement of the 17000 field wires and 6...

  4. Point 1 Updates

    CERN Multimedia

    Inigo-Golfin, J.

    The ATLAS experimental area is located in Point 1, just across the main CERN entrance, in the commune of Meyrin. There people are ever so busy to finish the different infrastructures for ATLAS. Not only has Civil Engineering finished the construction of the USA15 technical cavern, but the excavation of the main UX15 cavern has resumed below the machine tunnel, after a brief halt to allow the construction of the UJ-caverns for the power converters of the LHC machine. The excavation work should end in August 2002. The UX15 hand-over to ATLAS is expected in April 2003. On the surface civil engineering is starting to complete the last two surface buildings (SDX1 and SH1), once the services (cooling pipes, ventilation ducts and the largest item, the lift modules and its lift of course) in the shaft PX15 have been completed. But the civil engineering is not all. A lot more is under way. The site installation of the steel structures in the caverns is to begin in Autumn, along with all the cooling pipes, airconditi...

  5. Indico 1.0

    International Nuclear Information System (INIS)

    Lopez, J B Gonzalez; Avilés, A; Baron, T; Ferreira, P; Kolobara, B; Pugh, M A; Resco, A; Trzaskoma, J P

    2014-01-01

    Indico has evolved into the main event organization software, room booking tool and collaboration hub for CERN. The growth in its usage has only accelerated during the past 9 years, and today Indico holds more that 215,000 events and 1,100,000 files. The growth was also substantial in terms of functionalities and improvements. In the last year alone, Indico has matured considerably in 3 key areas: enhanced usability, optimized performance and additional features, especially those related to meeting collaboration. Along the course of 2012, much activity has centred around consolidating all this effort and investment into 'version 1.0', recently released in 2013.Version 1.0 brings along new features, such as the Microsoft Exchange calendar synchronization for participants, many new and clean interfaces (badges and poster generation, list of contributions, abstracts, etc) and so forth. But most importantly, it brings a message: Indico is now stable, consolidated and mature after more than 10 years of non-stop development. This message is addressed not only to CERN users but also to the many organisations, in or outside HEP, which have already installed the software, and to others who might soon join this community. In this document, we describe the current state of the art of Indico, and how it was built. This does not mean that the Indico software is complete, far from it! We have plenty of new ideas and projects that we are working on and which we have shared during CHEP 2013.

  6. AMF 1 Site Science

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Mark Alan [Rutgers Univ., New Brunswick, NJ (United States)

    2016-08-18

    This report documents progress on DOE Grant# DE-FG02-08ER64531 funded by the Department of Energy’s Atmospheric Systems Research (ASR) program covering the period between its inception in 2008 and its conclusion in 2014. The Atmospheric Radiation Measurement (ARM) Program’s Mobile Facility #1 (AMF#1) is a collection of state-of-the art atmospheric sensing systems including remote and in situ instrumentation designed to characterize the atmospheric column above and in the immediate vicinity of the deployment location. The grant discussed in this report funded the activities of the AMF#1 Site Scientist Team. Broad responsibilities of this team included examining new deployment sites and recommending instrument deployment configurations; data quality control during the early stages of deployments and for certain instruments through the course of the deployment; scientific outreach in the host country or location (particularly international deployments); scientific research oriented toward basic questions about cloud physics and radiation transfer in the deployment region; and training of Ph.D. students to conduct future research relevant to the Atmospheric Systems Research (ASR) program.

  7. Sequential Seasonal H1N1 Influenza Virus Infections Protect Ferrets against Novel 2009 H1N1 Influenza Virus

    Science.gov (United States)

    Carter, Donald M.; Bloom, Chalise E.; Nascimento, Eduardo J. M.; Marques, Ernesto T. A.; Craigo, Jodi K.; Cherry, Joshua L.; Lipman, David J.

    2013-01-01

    Individuals H1N1 influenza. Many people >60 years old also had preexisting antibodies to novel H1N1. These observations are puzzling because the seasonal H1N1 viruses circulating during the last 60 years were not antigenically similar to novel H1N1. We therefore hypothesized that a sequence of exposures to antigenically different seasonal H1N1 viruses can elicit an antibody response that protects against novel 2009 H1N1. Ferrets were preinfected with seasonal H1N1 viruses and assessed for cross-reactive antibodies to novel H1N1. Serum from infected ferrets was assayed for cross-reactivity to both seasonal and novel 2009 H1N1 strains. These results were compared to those of ferrets that were sequentially infected with H1N1 viruses isolated prior to 1957 or more-recently isolated viruses. Following seroconversion, ferrets were challenged with novel H1N1 influenza virus and assessed for viral titers in the nasal wash, morbidity, and mortality. There was no hemagglutination inhibition (HAI) cross-reactivity in ferrets infected with any single seasonal H1N1 influenza viruses, with limited protection to challenge. However, sequential H1N1 influenza infections reduced the incidence of disease and elicited cross-reactive antibodies to novel H1N1 isolates. The amount and duration of virus shedding and the frequency of transmission following novel H1N1 challenge were reduced. Exposure to multiple seasonal H1N1 influenza viruses, and not to any single H1N1 influenza virus, elicits a breadth of antibodies that neutralize novel H1N1 even though the host was never exposed to the novel H1N1 influenza viruses. PMID:23115287

  8. 78 FR 79007 - 1,1,1,2-Tetrafluoroethane From China

    Science.gov (United States)

    2013-12-27

    ... COMMISSION 1,1,1,2-Tetrafluoroethane From China Determinations On the basis of the record \\1\\ developed in... reason of imports from China of 1,1,1,2- Tetrafluoroethane, provided for in subheadings 2903.39.20 of the... the Government of China. \\1\\ The record is defined in sec. 207.2(f) of the Commission's Rules of...

  9. Protein: FBB1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBB1 CNC family transcription factors NFE2L1 HBZ17, NRF1, TCF11 NFE2L1 Nuclear factor erythro...id 2-related factor 1 Locus control region-factor 1, Nuclear factor, erythroid derived 2, like 1,

  10. Protein: MPA1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA1 TLR signaling molecules Nlrp3 Cias1, Mmig1, Nalp3, Pypaf1 NACHT, LRR and PYD d...n-associated-inducible protein 1, PYRIN-containing APAF1-like protein 1 10090 Mus musculus 216799 Q8R4B8 Q8R4B8 20007575 ...

  11. Nimbus-1/HRIR Level 1 Brightness Temperature V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The Nimbus-1 High Resolution Infrared Radiometer (HRIR) Level 1 Brightness Temperature Data Product (HRIRN1L1) contains infrared radiances converted to equivalent...

  12. Atlantic Oceanography. Volume 1

    Science.gov (United States)

    1978-08-01

    on GILLISS , and Leg 2 on ALVIN. A portion of the salaries in this budget and Items 1, 2, and 3 of Expendables are for this service. Items 4 and 5 in...load the major instrument systems aboard the R/V GILLISS , which is based in Miami. (OPERATIONS BUDGET) The funds requested in this budget are also...transport this equipment to Miami to be loaded on board the GILLISS , and funds have been requested from I.D.O.E. to ship the equipment back to Woods Hole

  13. S1 new

    Indian Academy of Sciences (India)

    DMSO Release. ATRi Release. Only EdU. Only ATRi. *. *. *. n.s. n.s. B. 0. 10. 20. 30. 40. 50. 60. 15 mins 20 mins 30 mins 40 mins 60 mins. % o. f p. R a d. 1. 7 p o s tiv e c e lls. HU + DMSO. HU + ATRi. *. *. *. *. n.s. 0. 0. 20. 30. 40. 50. 60. 70. 80. 2 h Treatment. 24 h Treatment γ. H. 2. A. X. P o s i t i v e. N u c l e i. HU+DMSO ...

  14. ISR Intersection 1

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    The experimental apparatus used at intersection 1 by the CERN-Bologna Collaboration (experiment R105). It consists of two almost identical magnetic spectrometers centered at 90 degrees on opposite sides of the intersection region. In each spectrometer one can see magnetostrictive wire spark chambers, a magnet, more chambers and various hodoscopes of scintillation counters. Gas Cerenkov counters (almost invisible in the picture) are located in the gap of each magnet. On the left hand side, a matrix of 119 lead glass Cerenkov counters is located behind some concrete and iron shielding.

  15. R806 (part 1)

    CERN Multimedia

    CERN PhotoLab

    1976-01-01

    R806 was designed by the BNL-CERN-Syracuse-Yale Collaboration (Bill Willis spokesman) to study large transverse momentum phenomena, and installed in intersection 8 of the ISR. The main detectors were Lithium foil transition radiation detectors to identify electrons and liquid argon calorimeters to measure the energy of the electrons and photons (among the first such calorimeters to be used in an experiment). In part 1 there were two modules, top and bottom of the horizontal beam pipe; the black vertical pipe contains the cryogenics (LN2 and Lar) and is connected to the two modules with the horizontal piping.

  16. 1-Methylhydrazinium picrate

    Directory of Open Access Journals (Sweden)

    Xiao-Gang Mu

    2011-12-01

    Full Text Available In the title salt, CH7N2+·C6H2N3O7−, the dihedral angles between the three nitro groups and the plane of the benzene ring are 22.4 (2, 35.3 (2 and 2.8 (2°. In the crystal, the components are linked by N—H...O and N—H...N hydrogen bonds into a two-dimensional network parallel to (10overline{1}.

  17. Characterisation of polymers, 1

    CERN Document Server

    Crompton, Roy

    2008-01-01

    This essential guide to Polymer Characterisation is a complete compendium of methodologies that have evolved for the determination of the chemical composition of polymers. This 478-page book gives an up-to-date and thorough exposition of the state-of-the-art theories and availability of instrumentation needed to effect chemical and physical analysis of polymers. This is supported by approximately 1200 references. Volume 1 covers the methodology used for the determination of metals, non-metals and organic functional groups in polymers, and for the determination of the ratio in which different m

  18. Pig PON1

    DEFF Research Database (Denmark)

    Larsen, Knud Erik; Farajzadeh, Leila; Kristensen, Kaja Kjaer

    2018-01-01

    Atherosclerosis is an inflammatory disease promoted by oxidized low density lipoprotein (LDL). High density lipoprotein (HDL) is an important antioxidant, protecting LDL and itself from oxidation and by detoxifying the hydroperoxides from oxidized LDL. Paraoxonase, encoded by the PON1 gene......, is an enzyme involved in oxidant defense by hydrolyzing oxidized lipids, including oxLDL, and in detoxification of organophosphate pesticides. Aging is the major risk factor for developing atherosclerosis and as paraoxonase is responsible for the antioxidant effect of HDL, aging might be accompanied...

  19. H1N1: pandemia e perspectiva atual H1N1: overview and perspectives

    Directory of Open Access Journals (Sweden)

    Nancy Bellei

    2011-12-01

    Full Text Available O vírus influenza de origem suína, A/California/04/2009 (H1N1, foi inicialmente detectado no México e determinou a pandemia de influenza de 2009. Em agosto de 2010, a Organização Mundial da Saúde (OMS declarou o início da fase pós-pandêmica. As características dessa última pandemia foram marcadamente diferentes das anteriores. O vírus emergiu de rearranjos genéticos originários em hospedeiro mamífero não humano, demonstrou transmissibilidade interespécies e afetou a população humana de forma diferente dos vírus pandêmicos anteriores (1918, 1957 e 1968 com maior morbidade e mortalidade em crianças e adultos jovens. Atualmente, o vírus apresenta padrão sazonal da mesma forma que o influenza A H3N2 e o influenza B, mantendo, até o momento, o mesmo perfil de patogenicidade, espectro clínico e sensibilidade a antivirais. A cepa foi incluída na vacina sazonal trivalente anual recomendada, principalmente para proteção dos grupos de risco mais vulneráveis a complicações pelas diferentes cepas de influenza.The swine origin influenza virus A/CALIFORNIA/04/2009 (H1N1 was first detected in Mexico and determined the 2009 influenza pandemic. In August 2010, World Health Organization (WHO declared the beginning of the post-pandemic period. This last pandemic was distinctly different from previous ones. The virus emerged from genetic rearrangement in non-human mammalian host. Moreover, its inter-species transmission is fully reported. However, it affected human population differently from previous pandemic viruses (1918, 1957, 1968, with increased morbidity and mortality among children and young adults. Currently, the virus has a seasonal pattern in the same way as influenza A H3N2 and influenza B, maintaining the same pathogenicity profile, clinical spectrum and sensitivity to antiviral agents. The strain was included in the annual trivalent seasonal vaccine formulation, mainly for risk groups, which are more vulnerable to

  20. Frameworks in CS1

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak; Caspersen, Michael Edelgaard

    2002-01-01

    In this paper we argue that introducing object-oriented frameworks as subject already in the CS1 curriculum is important if we are to train the programmers of tomorrow to become just as much software reusers as software producers. We present a simple, graphical, framework that we have successfull...... point for introducing graphical user interface frameworks such as Java Swing and AWT as the students are not overwhelmed by all the details of such frameworks right away but given a conceptual road-map and practical experience that allow them to cope with the complexity....

  1. CYP7B1

    DEFF Research Database (Denmark)

    Roos, P; Svenstrup, K; Danielsen, E R

    2014-01-01

    UNLABELLED: The SPG5A subtype of Hereditary Spastic Paraplegia (HSP) is a rare autosomal recessive neurodegenerative disorder caused by mutations in the CYP7B1 gene, which encodes a steroid cytochrome P450 7α-hydroxylase. This enzyme provides the primary metabolic route for neurosteroids......, electrophysiology, brain MRI and MR spectroscopy. RESULTS: One patient had saccadic pursuit eye movements in addition to a pure HSP phenotype. Motor evoked potential (MEP) examinations revealed prolonged central conduction time. MRI of the brain showed white matter hyperintensities (WMH) in one patient. MRS showed...

  2. Naphthalene-1-carbaldehyde oxime

    Directory of Open Access Journals (Sweden)

    Alexander R. Green

    2017-12-01

    Full Text Available The title compound, C11H9NO, crystallizes with two molecules, A and B, with similar conformations (r.m.s. overlay fit = 0.030 Å in the asymmetric unit: the C—C=N...O torsion angles are −177.8 (3 and −179.1 (3°. In the crystal, molecules are linked by alternating O—H...N (A → B and O—H...O (B → A hydrogen bonds to generate [100] chains. A weak C—H...O interaction is also observed.

  3. Type 1 narcolepsy

    DEFF Research Database (Denmark)

    Degn, Matilda; Kornum, Birgitte Rahbek

    2015-01-01

    Type 1 narcolepsy is a sleep disorder characterized by excessive daytime sleepiness with unintentional sleep attacks and cataplexy. The disorder is caused by a loss of hypocretinergic neurons in the brain. The specific loss of these neurons in narcolepsy is thought to result from an autoimmune...... attack, and this is supported by evidence of both environmental and genetic factors pointing toward an involvement of the immune system. However, definitive proof of an autoimmune etiology is still missing. Several different immune-mediated disorders targeting neurons are known, and many...

  4. Universal graphs at $\\aleph_{\\omega_1+1}$

    OpenAIRE

    Davis, Jacob

    2016-01-01

    Starting from a supercompact cardinal we build a model in which $2^{\\aleph_{\\omega_1}}=2^{\\aleph_{\\omega_1+1}}=\\aleph_{\\omega_1+3}$ but there is a jointly universal family of size $\\aleph_{\\omega_1+2}$ of graphs on $\\aleph_{\\omega_1+1}$. The same technique will work for any uncountable cardinal in place of $\\omega_1$.

  5. Genetic regulation ofIL1RL1methylation and IL1RL1-a protein levels in asthma.

    Science.gov (United States)

    Dijk, F Nicole; Xu, Chengjian; Melén, Erik; Carsin, Anne-Elie; Kumar, Asish; Nolte, Ilja M; Gruzieva, Olena; Pershagen, Goran; Grotenboer, Neomi S; Savenije, Olga E M; Antó, Josep Maria; Lavi, Iris; Dobaño, Carlota; Bousquet, Jean; van der Vlies, Pieter; van der Valk, Ralf J P; de Jongste, Johan C; Nawijn, Martijn C; Guerra, Stefano; Postma, Dirkje S; Koppelman, Gerard H

    2018-03-01

    Interleukin-1 receptor-like 1 ( IL1RL1 ) is an important asthma gene. (Epi)genetic regulation of IL1RL1 protein expression has not been established. We assessed the association between IL1RL1 single nucleotide polymorphisms (SNPs), IL1RL1 methylation and serum IL1RL1-a protein levels, and aimed to identify causal pathways in asthma.Associations of IL1RL1 SNPs with asthma were determined in the Dutch Asthma Genome-wide Association Study cohort and three European birth cohorts, BAMSE (Children/Barn, Allergy, Milieu, Stockholm, an Epidemiological survey), INMA (Infancia y Medio Ambiente) and PIAMA (Prevention and Incidence of Asthma and Mite Allergy), participating in the Mechanisms of the Development of Allergy study. We performed blood DNA IL1RL1 methylation quantitative trait locus (QTL) analysis (n=496) and (epi)genome-wide protein QTL analysis on serum IL1RL1-a levels (n=1462). We investigated the association of IL1RL1 CpG methylation with asthma (n=632) and IL1RL1-a levels (n=548), with subsequent causal inference testing. Finally, we determined the association of IL1RL1-a levels with asthma and its clinical characteristics (n=1101). IL1RL1 asthma-risk SNPs strongly associated with IL1RL1 methylation (rs1420101; p=3.7×10 -16 ) and serum IL1RL1-a levels (p=2.8×10 -56 ). IL1RL1 methylation was not associated with asthma or IL1RL1-a levels. IL1RL1-a levels negatively correlated with blood eosinophil counts, whereas there was no association between IL1RL1-a levels and asthma.In conclusion, asthma-associated IL1RL1 SNPs strongly regulate IL1RL1 methylation and serum IL1RL1-a levels, yet neither these IL1RL1- methylation CpG sites nor IL1RL1-a levels are associated with asthma. Copyright ©ERS 2018.

  6. The Spartan 1 mission

    Science.gov (United States)

    Cruddace, Raymond G.; Fritz, G. G.; Shrewsberry, D. J.; Brandenstein, D. J.; Creighton, D. C.; Gutschewski, G.; Lucid, S. W.; Nagel, J. M.; Fabian, J. M.; Zimmerman, D.

    1989-01-01

    The first Spartan mission is documented. The Spartan program, an outgrowth of a joint Naval Research Laboratory (NRL)/National Aeronautics and Space Administration (NASA)-Goddard Space Flight Center (GSFC) development effort, was instituted by NASA for launching autonomous, recoverable payloads from the space shuttle. These payloads have a precise pointing system and are intended to support a wide range of space-science observations and experiments. The first Spartan, carrying an NRL X-ray astronomy instrument, was launched by the orbiter Discovery (STS51G) on June 20, 1985 and recovered successfully 45 h later, on June 22. During this period, Spartan 1 conducted a preprogrammed series of observations of two X-ray sources: the Perseus cluster of galaxies and the center of our galaxy. The mission was successful from both on engineering and a scientific viewpoint. Only one problem was encountered, the attitude control system (ACS) shut down earlier than planned because of high attitude control system gas consumption. A preplanned emergency mode then placed Spartan 1 into a stable, safe condition and allowed a safe recovery. The events are described of the mission and presents X-ray maps of the two observed sources, which were produced from the flight data.

  7. ATLAS Point 1 Construction

    CERN Multimedia

    Inigo-Golfin, J

    After 3 years of work in point 1, a number of surface buildings have already been completed and handed over to CERN (the control, the gas and the cooling and ventilation buildings) and, probably more appealing to the public, 60,000 m3 of earth have already been excavated from underground. At present, the technical cavern USA15 and its access shaft are almost finished, leaving only the main cavern and the liaison galleries to be completed in the coming year and a half. The main cavern has been excavated down to the radiation limit and its walls and vault will presently be concreted (see below the picture of the section of the vault with the impressive shell of 1.2 m thickness). The excavation of the bench (27 vertical metres to go yet!) will proceed from August, when some additional civil engineering work in the LHC tunnel will be undertaken. Needless to say many different services are necessary around the detector, both for its installation and future operation for physics. To that end much of the heavy...

  8. (E-1-Phenylethanone semicarbazone

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2009-08-01

    Full Text Available In the title compound, C9H11N3O, the benzene ring is disordered over two positions with refined occupancies of 0.922 (5 and 0.078 (5. The program PLATON [Spek (2009. Acta Cryst. D65, 148–155] recommends the solution in the space group C2/m with a = 7.3050 (3, b = 6.6745 (2, c = 18.3853 (6 Å and β = 96.986 (2°. However, the large number of non-extinct reflections needed to be ignored if C2/m is chosen suggested that the space group is incorrect, even though the R values are lower than that for P21/c. The semicarbazone group is essentially planar, with a maximum deviation of 0.046 (1 Å for one of the N atoms. The mean plane of the semicarbazone group forms dihedral angles of 33.61 (8 and 39.1 (9° with the benzene ring of the major and minor components, respectively. In the crystal structure, molecules are linked by intermolecular N—H...O hydrogen bonds into extended chains along the c axis. The crystal structure is further stabilized by weak intermolucular C—H...π interactions.

  9. Alpha-1-antitrypsin deficiency.

    Science.gov (United States)

    Bals, Robert

    2010-10-01

    Alpha-1-antitrypsin deficiency (AATD) is a rare genetic disorder associated with the development of liver and lung disease. AAT is a 52-kD glycoprotein, produced mainly by hepatocytes and secreted into the blood. Agglomeration of the AAT-protein in hepatocytes can result in liver disease. Exposure to smoke is the major risk factor for the development of lung disease characterised as early chronic obstructive lung disease (COPD). Diagnosis is based on the analysis of the AAT genotype and phenotype. The measurement of the AAT serum level is useful as screening test. Liver biopsy is not necessary to establish the diagnosis. Therapy for AAT-related liver disease is supportive, a specific therapy is not available. AATD is a rare condition (1:5000-10000) and, as a consequence, data and information on diagnosis and treatment are not easily accessible. This chapter provides a comprehensive overview on AATD, covering basic biology, diagnostic and therapeutic approaches. Copyright © 2010 Elsevier Ltd. All rights reserved.

  10. 26 CFR 1.102-1 - Gifts and inheritances.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Gifts and inheritances. 1.102-1 Section 1.102-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Items Specifically Excluded from Gross Income § 1.102-1 Gifts and inheritances...

  11. 26 CFR 1.1492-1 - Nontaxable transfers.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES Tax on Transfers to Avoid Income Tax § 1.1492-1 Nontaxable transfers. (a) The tax imposed by... Federal income taxes. (b) Whether a transfer of stock or securities is in pursuance of a plan having as... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Nontaxable transfers. 1.1492-1 Section 1.1492-1...

  12. 26 CFR 1.460-1 - Long-term contracts.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 6 2010-04-01 2010-04-01 false Long-term contracts. 1.460-1 Section 1.460-1...) INCOME TAXES Taxable Year for Which Items of Gross Income Included § 1.460-1 Long-term contracts. (a..., building, installation, or construction of property is a long-term contract under section 460 and what...

  13. 26 CFR 1.1-2 - Limitation on tax.

    Science.gov (United States)

    2010-04-01

    ... as defined by section 1348, the tax imposed by section 1, as amended by the Tax Reform Act of 1969... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Limitation on tax. 1.1-2 Section 1.1-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY INCOME TAX INCOME TAXES Normal Taxes and...

  14. 26 CFR 1.167(m)-1 - Class lives.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Class lives. 1.167(m)-1 Section 1.167(m)-1...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.167(m)-1 Class lives. (a) For rules regarding the election to use the class life system authorized by section 167(m), see...

  15. 26 CFR 1.1202-1 - Deduction for capital gains.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Deduction for capital gains. 1.1202-1 Section 1.1202-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Wash Sales of Stock Or Securities § 1.1202-1 Deduction for capital gains. (a) In...

  16. 26 CFR 1.1092(c)-1 - Qualified covered calls.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Qualified covered calls. 1.1092(c)-1 Section 1.1092(c)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Wash Sales of Stock Or Securities § 1.1092(c)-1 Qualified covered calls. (a) In...

  17. 26 CFR 1.806-1 - Adjustment for certain reserves.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Adjustment for certain reserves. 1.806-1 Section 1.806-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Investment Income § 1.806-1 Adjustment for certain reserves. (a) For taxable years...

  18. 26 CFR 1.807-1 - Mortality and morbidity tables.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Mortality and morbidity tables. 1.807-1 Section 1.807-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Investment Income § 1.807-1 Mortality and morbidity tables. (a) Tables to be used...

  19. 26 CFR 1.860F-1 - Qualified liquidations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Qualified liquidations. 1.860F-1 Section 1.860F-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Real Estate Investment Trusts § 1.860F-1 Qualified liquidations. A plan of...

  20. 26 CFR 1.860-1 - Deficiency dividends.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Deficiency dividends. 1.860-1 Section 1.860-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Real Estate Investment Trusts § 1.860-1 Deficiency dividends. Section 860 allows a qualified...

  1. 26 CFR 1.884-1 - Branch profits tax.

    Science.gov (United States)

    2010-04-01

    ..., even if A invests the proceeds from the dividend in additional stock of the REIT. (Stock in a REIT that... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Branch profits tax. 1.884-1 Section 1.884-1...) INCOME TAXES Foreign Corporations § 1.884-1 Branch profits tax. (a) General rule. A foreign corporation...

  2. 26 CFR 1.305-1 - Stock dividends.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Stock dividends. 1.305-1 Section 1.305-1...) INCOME TAXES Effects on Recipients § 1.305-1 Stock dividends. (a) In general. Under section 305, a distribution made by a corporation to its shareholders in its stock or in rights to acquire its stock is not...

  3. 26 CFR 1.554-1 - Stock ownership.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Stock ownership. 1.554-1 Section 1.554-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Foreign Personal Holding Companies § 1.554-1 Stock ownership. For regulations under...

  4. 26 CFR 1.998-1.1000 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false [Reserved] 1.998-1.1000 Section 1.998-1.1000 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Domestic International Sales Corporations §§ 1.998-1.1000 [Reserved] ...

  5. 26 CFR 1.761-1 - Terms defined.

    Science.gov (United States)

    2010-04-01

    ... TAXES Definitions § 1.761-1 Terms defined. (a) Partnership. The term partnership means a partnership as... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Terms defined. 1.761-1 Section 1.761-1 Internal... means a member of a partnership. (c) Partnership agreement. For the purposes of subchapter K, a...

  6. Asymmetric oxidation of 1,3-dithianes to 1,3-dithiane 1-oxides

    OpenAIRE

    Yoshihiko, Watanabe; Yojiro, Ono; Yoshio, Ueno; Takeshi, Toru

    1998-01-01

    Oxidation of 2-(1-hydroxy-1-methylethyl)-1,3-dithiane with the Sharpless reagent has been examined under various reaction conditions. Oxidation of 2-(1-hydroxy-1-methylethyl)-1,3-dithiane with Ti(OPri)4-diethyl L-(+)-tartrate-tert-butyl hydroperoxide (1:2:1.5) in CH2Cl2 in the presence of 4 A molecular sieves gives (1S,2S)-2-(1-hydroxy-1-methylethyl)-1,3-dithiane 1-oxide with high trans selectivity and with moderate enantioselectivity. The enantioselectivity depends upon the substituent at t...

  7. BACE1-Dependent Neuregulin-1 Signaling: An Implication for Schizophrenia

    Directory of Open Access Journals (Sweden)

    Zhengrong Zhang

    2017-09-01

    Full Text Available Schizophrenia is a chronic psychiatric disorder with a lifetime prevalence of about 1% in the general population. Recent studies have shown that Neuregulin-1 (Nrg1 is a candidate gene for schizophrenia. At least 15 alternative splicing of NRG1 isoforms all contain an extracellular epidermal growth factor (EGF-like domain, which is sufficient for Nrg1 biological activity including the formation of myelin sheaths and the regulation of synaptic plasticity. It is known that Nrg1 can be cleaved by β-secretase (BACE1 and the resulting N-terminal fragment (Nrg1-ntf binds to receptor tyrosine kinase ErbB4, which activates Nrg1/ErbB4 signaling. While changes in Nrg1 expression levels in schizophrenia still remain controversial, understanding the BACE1-cleaved Nrg1-ntf and Nrg1/ErbB4 signaling in schizophrenia neuropathogenesis is essential and important. In this review paper, we included three major parts: (1 Nrg1 structure and cleavage pattern by BACE1; (2 BACE1-dependent Nrg1 cleavage associated with schizophrenia in human studies; and (3 Animal studies of Nrg1 and BACE1 mutations with behavioral observations. Our review will provide a better understanding of Nrg1 in schizophrenia and a potential strategy for using BACE1 cleavage of Nrg1 as a unique biomarker for diagnosis, as well as a new therapeutic target, of schizophrenia.

  8. Type 1 autoimmune pancreatitis.

    Science.gov (United States)

    Zen, Yoh; Bogdanos, Dimitrios P; Kawa, Shigeyuki

    2011-12-07

    Before the concept of autoimmune pancreatitis (AIP) was established, this form of pancreatitis had been recognized as lymphoplasmacytic sclerosing pancreatitis or non-alcoholic duct destructive chronic pancreatitis based on unique histological features. With the discovery in 2001 that serum IgG4 concentrations are specifically elevated in AIP patients, this emerging entity has been more widely accepted. Classical cases of AIP are now called type 1 as another distinct subtype (type 2 AIP) has been identified. Type 1 AIP, which accounts for 2% of chronic pancreatitis cases, predominantly affects adult males. Patients usually present with obstructive jaundice due to enlargement of the pancreatic head or thickening of the lower bile duct wall. Pancreatic cancer is the leading differential diagnosis for which serological, imaging, and histological examinations need to be considered. Serologically, an elevated level of IgG4 is the most sensitive and specific finding. Imaging features include irregular narrowing of the pancreatic duct, diffuse or focal enlargement of the pancreas, a peri-pancreatic capsule-like rim, and enhancement at the late phase of contrast-enhanced images. Biopsy or surgical specimens show diffuse lymphoplasmacytic infiltration containing many IgG4+ plasma cells, storiform fibrosis, and obliterative phlebitis. A dramatic response to steroid therapy is another characteristic, and serological or radiological effects are normally identified within the first 2 or 3 weeks. Type 1 AIP is estimated as a pancreatic manifestation of systemic IgG4-related disease based on the fact that synchronous or metachronous lesions can develop in multiple organs (e.g. bile duct, salivary/lacrimal glands, retroperitoneum, artery, lung, and kidney) and those lesions are histologically identical irrespective of the organ of origin. Several potential autoantigens have been identified so far. A Th2-dominant immune reaction and the activation of regulatory T-cells are assumed

  9. Type 1 autoimmune pancreatitis

    Directory of Open Access Journals (Sweden)

    Zen Yoh

    2011-12-01

    Full Text Available Abstract Before the concept of autoimmune pancreatitis (AIP was established, this form of pancreatitis had been recognized as lymphoplasmacytic sclerosing pancreatitis or non-alcoholic duct destructive chronic pancreatitis based on unique histological features. With the discovery in 2001 that serum IgG4 concentrations are specifically elevated in AIP patients, this emerging entity has been more widely accepted. Classical cases of AIP are now called type 1 as another distinct subtype (type 2 AIP has been identified. Type 1 AIP, which accounts for 2% of chronic pancreatitis cases, predominantly affects adult males. Patients usually present with obstructive jaundice due to enlargement of the pancreatic head or thickening of the lower bile duct wall. Pancreatic cancer is the leading differential diagnosis for which serological, imaging, and histological examinations need to be considered. Serologically, an elevated level of IgG4 is the most sensitive and specific finding. Imaging features include irregular narrowing of the pancreatic duct, diffuse or focal enlargement of the pancreas, a peri-pancreatic capsule-like rim, and enhancement at the late phase of contrast-enhanced images. Biopsy or surgical specimens show diffuse lymphoplasmacytic infiltration containing many IgG4+ plasma cells, storiform fibrosis, and obliterative phlebitis. A dramatic response to steroid therapy is another characteristic, and serological or radiological effects are normally identified within the first 2 or 3 weeks. Type 1 AIP is estimated as a pancreatic manifestation of systemic IgG4-related disease based on the fact that synchronous or metachronous lesions can develop in multiple organs (e.g. bile duct, salivary/lacrimal glands, retroperitoneum, artery, lung, and kidney and those lesions are histologically identical irrespective of the organ of origin. Several potential autoantigens have been identified so far. A Th2-dominant immune reaction and the activation of

  10. CREB1/ATF1 activation in photoreceptor degeneration and protection.

    Science.gov (United States)

    Beltran, William A; Allore, Heather G; Johnson, Elizabeth; Towle, Virginia; Tao, Weng; Acland, Gregory M; Aguirre, Gustavo D; Zeiss, Caroline J

    2009-11-01

    The cAMP response element binding protein 1 (CREB1) and activating transcription factor 1 (ATF1) are closely related members of the bZIP superfamily of transcription factors. Both are activated in response to a wide array of stimuli, including cellular stress. This study was conducted to assess the CREB1/ATF1 pathway in photoreceptor disease and protection. The expression levels of p-CREB1, CREB1, and ATF1 were examined by immunoblot and immunohistochemistry in normal canine retina and retinas of several canine models of retinal degeneration (rcd1, rcd2, erd, prcd, XLPRA1, XLPRA2, T4R RHO). Humans retinas affected with age-related macular degeneration (AMD) were also examined. p-CREB1/ATF1 immunolabeling was assessed in normal and rcd1 dogs treated with ciliary neurotrophic factor (CNTF), to examine the effect of a neuroprotective stimulus on activation of CREB1/ATF1. Native CREB1 and ATF1 as well as phosphorylated CREB1/ATF1 was examined in normal canine retina by immunoblot. The p-CREB1 antibody identified phosphorylated CREB1 and ATF1 and labeled the inner retina only in normal dogs. In degenerate canine and human retinas, strong immunolabeling appeared in rod and cone photoreceptors, indicating increased expression of native CREB1 and ATF1, as well as increased phosphorylation of these proteins. Retinal protection by CNTF in rcd1 dogs was accompanied by a significant increase in the number of p-CREB1/ATF1-labeled photoreceptor nuclei. Positive association of CREB1/ATF1 phosphorylation with photoreceptor protection suggests that it may contribute to an innate protective response. These data identify a signaling mechanism in rods and cones of potential importance for therapies of RP and AMD.

  11. Moessbauer experiments, ch. 1

    International Nuclear Information System (INIS)

    Maring, K.W.

    1977-01-01

    The magnetic properties of iron base alloys have been investigated as a function of the concentrations of the sp-elements Al, Si, Ga, Ge, As, Sn, and Sb. An extensive description of the Moessbauer Effect Spectroscopy (MES) technique is given. The results of MES experiments at room temperature for FeX alloys (X stands for one of the sp-elements) and impurity concentrations of 1, 3 and 5 a/o are presented. Through temperature dependant measurements the hyperfine fields H ((m,n)T) at iron nuclei in different surroundings are obtained. The change of the Curie temperature of the various dilute iron-base alloys, with respect to pure iron, as a function of the impurity concentration is investigated. Average magnetic hyperfine fields and isomer shifts measured at 119 Sn nuclei in Fe 119 Sn are discussed

  12. The H1 detector

    International Nuclear Information System (INIS)

    Cozzika, G.

    1992-11-01

    The H1 detector presently operating at the HERA e-p collider is described. A general overview of the detector is given with particular emphasis on the calorimeters, the main element of which is a liquid Argon calorimeter enclosed within a large radius solenoid. Calorimetry in the proton direction, close to the beam-pipe is provided by a copper-silicon pad hadronic calorimeter. In the electron direction a lead-scintillator electromagnetic calorimeter closes the solid angle between the rear part of the liquid Argon calorimeter and the beam-pipe. An iron limited streamer tube tail catcher using the return yoke of the solenoid as absorber completes the calorimetry of the detector. The hardware triggers derived from the calorimeters are also described and some performance details of the calorimeters are given

  13. Petroleum resources assessment 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-01

    This report consists of two articles. (1) Petroleum resources assessment of the Okinawa Trough: The hydrocarbon potential has been evaluated for the Tertiary strata in the northwestern margin of the Okinawa Trough on the basis of the pale-ontological, petrological, geochemical data from two wells (Nikkan 8-9 and JDZ 7-3), and geophysical data. (2) Petroliferous basin analysis in Jinju area (2): Petroleum geological studies such as stratigraphy, sedimentology, petrology and organic geochemistry were carried out in the Gyeongsang Supergroup, Junju area. Based on lithofacies and rock color, the sequence can be divided into seven formations which can be organized into two groups (Sindong Group: Nagdong, Hasandong and Jinju formations in ascending order; Hayang Group: Chilgog, Silla Conglomerate, Haman and Jindong formations). (author). 57 refs.

  14. Overview of EHN1

    CERN Multimedia

    1982-01-01

    The beams enter from the bottom of the photo. Starting from left (Jura side)three experiments lay upstream of the European Hybrid Spectrometer (EHS), NA20, NA25 (with a small HOlographic Bubble Chamber, HOBC) and NA24. The EHS houses NA21, NA22 and NA23 with the Rapid Cycling Bubble Chamber RCBC, NA26, NA27 with the HOlographic LExan Bubble Chamber, HOLEBC. Along the beam line most at the right (H8) lays the NA3 setup, while downstream one sees the assembly of the GAMS detector (blue) of the CERN/USSR experiment NA12. At the centre run the beam H2/E2 for the FRAMM experiments NA1 (now completed), NA7 and NA29, and the beam H6 for NA30 and NA11.

  15. Decommissioning of NPP A-1

    International Nuclear Information System (INIS)

    Anon

    2009-01-01

    In this presentation the Operation history of A1 NPP, Project 'Decommissioning of A1 NPP' - I stage, Project 'Decommissioning of A1 NPP ' - II stage and Next stages of Project 'Decommissioning of A1 NPP ' are discussed.

  16. HRIR/Nimbus-1 Level 1 Meteorological Radiation Data V001 (HRIRN1L1) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — HRIRN1L1 is the High Resolution Infrared Radiometer (HRIR) Nimbus-1 Level 1 Meteorological Radiance Data (NMRT) product and contains infrared radiances converted to...

  17. Many-particle interactions and rainbow effects in grazing scattering of Ar atoms on the Al(1 1 1), Ag(1 1 1) crystals

    Science.gov (United States)

    Babenko, P. Yu.; Meluzova, D. S.; Shergin, A. P.; Zinoviev, A. N.

    2017-09-01

    Computer simulation of rainbow and "ion focusing" effects taking place in scattering of Ar atoms on Al(1 1 1) and Ag(1 1 1) crystal surfaces have been performed. The trajectory calculation and vector summation of forces of the projectile atom interaction with crystal atoms have been shown to provide good fitting of the available experimental data. The thermal vibration amplitude for atoms located on the surface of crystals under study has been determined. A functional form of the potential has been proposed that fits well the experimental data.

  18. Closed expressions for $\\int_{0}^{1} t^{-1} log^{n-1}t log^{p}(1 - t) dt$

    CERN Document Server

    Kölbig, Kurt Siegfried

    1982-01-01

    Closed expressions for the integral integral /sub 0//sup 1/ t/sup -1/ log/sup n-1/t log/sup p/(1-t)dt, whose general form is given elsewhere, are listed for n=1(1)9, p=1(1)9. A formula is derived which allows an easy evaluation of these expressions by formula manipulation on a computer. The majority of the above expressions are given in a microfiche supplement to the paper.

  19. Bub1 positions Mad1 close to KNL1 MELT repeats to promote checkpoint signalling

    DEFF Research Database (Denmark)

    Zhang, Gang; Kruse, Thomas; López-Méndez, Blanca

    2017-01-01

    Proper segregation of chromosomes depends on a functional spindle assembly checkpoint (SAC) and requires kinetochore localization of the Bub1 and Mad1/Mad2 checkpoint proteins. Several aspects of Mad1/Mad2 kinetochore recruitment in human cells are unclear and in particular the underlying direct...... interactions. Here we show that conserved domain 1 (CD1) in human Bub1 binds directly to Mad1 and a phosphorylation site exists in CD1 that stimulates Mad1 binding and SAC signalling. Importantly, fusion of minimal kinetochore-targeting Bub1 fragments to Mad1 bypasses the need for CD1, revealing that the main...

  20. Raf-1 forms a stable complex with Mek1 and activates Mek1 by serine phosphorylation.

    OpenAIRE

    Huang, W; Alessandrini, A; Crews, C M; Erikson, R L

    1993-01-01

    Recombinant Mek1 and Raf-1 proteins produced in Sf9 cells undergo a tight association both in vivo and in vitro, which apparently does not depend on additional factors or the kinase activity of Mek1 or Raf-1. The complex can be disrupted by two polyclonal antibodies raised against Raf-1 peptides. Coinfection with Raf-1 activates Mek1 > 150-fold, and coinfection with Raf-1 and Mek1 activates Erk1 approximately 90-fold. The activation of Mek1 by Raf-1 involves only serine phosphorylation, which...

  1. Investigations on Collectin Liver 1

    DEFF Research Database (Denmark)

    Axelgaard, Esben; Jensen, Lisbeth; Dyrlund, Thomas Franck

    2013-01-01

    Collectins are pattern recognition molecules of the innate immune system showing binding to carbohydrate structures on microorganisms in a calcium-dependent manner. Recently, three novel collectins, collectin liver 1 (CL-L1), collectin kidney 1 (CL-K1 and CL-11), and collectin placenta 1 (CL-P1),...

  2. MUC1-C activates BMI1 in human cancer cells.

    Science.gov (United States)

    Hiraki, M; Maeda, T; Bouillez, A; Alam, M; Tagde, A; Hinohara, K; Suzuki, Y; Markert, T; Miyo, M; Komura, K; Ahmad, R; Rajabi, H; Kufe, D

    2017-05-18

    B-cell-specific Moloney murine leukemia virus integration site 1 (BMI1) is a component of the polycomb repressive complex 1 (PRC1) complex that is overexpressed in breast and other cancers, and promotes self-renewal of cancer stem-like cells. The oncogenic mucin 1 (MUC1) C-terminal (MUC1-C) subunit is similarly overexpressed in human carcinoma cells and has been linked to their self-renewal. There is no known relationship between MUC1-C and BMI1 in cancer. The present studies demonstrate that MUC1-C drives BMI1 transcription by a MYC-dependent mechanism in breast and other cancer cells. In addition, we show that MUC1-C blocks miR-200c-mediated downregulation of BMI1 expression. The functional significance of this MUC1-C→︀BMI1 pathway is supported by the demonstration that targeting MUC1-C suppresses BMI1-induced ubiquitylation of H2A and thereby derepresses homeobox HOXC5 and HOXC13 gene expression. Notably, our results further show that MUC1-C binds directly to BMI1 and promotes occupancy of BMI1 on the CDKN2A promoter. In concert with BMI1-induced repression of the p16 INK4a tumor suppressor, we found that targeting MUC1-C is associated with induction of p16 INK4a expression. In support of these results, analysis of three gene expresssion data sets demonstrated highly significant correlations between MUC1-C and BMI1 in breast cancers. These findings uncover a previously unrecognized role for MUC1-C in driving BMI1 expression and in directly interacting with this stem cell factor, linking MUC1-C with function of the PRC1 in epigenetic gene silencing.

  3. Crystalline alloys produced by mercury electrodeposition on Pt(1 1 1) electrode at room temperature

    Energy Technology Data Exchange (ETDEWEB)

    Wu Hangliang [Department of Chemistry, National Central University, No. 300 Jungda Road, Jungli 32054, Taiwan (China); Yau Shuehlin [Department of Chemistry, National Central University, No. 300 Jungda Road, Jungli 32054, Taiwan (China)], E-mail: shuehlinyau@yahoo.com.tw; Zei Mauscheng [Department of Physics, National Central University, No. 300 Jungda Road, Jungli 32054, Taiwan (China)

    2008-08-20

    In situ scanning tunneling microscopy (STM) and reflection high energy electron diffraction (RHEED) were used to characterize mercury film electrodeposited onto a Pt(1 1 1) electrode at room temperature. Depending on the amount of Hg deposit, two different growth modes were observed. At low Hg coverage, crystalline (0 0 0 1)Hg adlayer accompanied by 30 deg.-rotated (1 1 1)-Pt patches was found on Pt(1 1 1). Deposition of multilayer Hg resulted in layered PtHg{sub 2} and PtHg{sub 4} amalgams, which grew epitaxially by aligning their (2 0 1) and (11-bar0) planes, respectively, parallel to the Pt(1 1 1) substrate. The preference of these epitaxial relationships for the electrochemically formed Pt-Hg intermetallic compounds on Pt(1 1 1) could result from minimization of the surface energy.

  4. ptf1a+

    Science.gov (United States)

    Schmitner, Nicole; Kohno, Kenji; Meyer, Dirk

    2017-03-01

    The exocrine pancreas displays a significant capacity for regeneration and renewal. In humans and mammalian model systems, the partial loss of exocrine tissue, such as after acute pancreatitis or partial pancreatectomy induces rapid recovery via expansion of surviving acinar cells. In mouse it was further found that an almost complete removal of acinar cells initiates regeneration from a currently not well-defined progenitor pool. Here, we used the zebrafish as an alternative model to study cellular mechanisms of exocrine regeneration following an almost complete removal of acinar cells. We introduced and validated two novel transgenic approaches for genetically encoded conditional cell ablation in the zebrafish, either by caspase-8-induced apoptosis or by rendering cells sensitive to diphtheria toxin. By using the ela3l promoter for exocrine-specific expression, we show that both approaches allowed cell-type-specific removal of >95% of acinar tissue in larval and adult zebrafish without causing any signs of unspecific side effects. We find that zebrafish larvae are able to recover from a virtually complete acinar tissue ablation within 2 weeks. Using short-term lineage-tracing experiments and EdU incorporation assays, we exclude duct-associated Notch-responsive cells as the source of regeneration. Rather, a rare population of slowly dividing ela3l- negative cells expressing ptf1a and CPA was identified as the origin of the newly forming exocrine cells. Cells are actively maintained, as revealed by a constant number of these cells at different larval stages and after repeated cell ablation. These cells establish ela3l expression about 4-6 days after ablation without signs of increased proliferation in between. With onset of ela3l expression, cells initiate rapid proliferation, leading to fast expansion of the ela3l -positive population. Finally, we show that this proliferation is blocked by overexpression of the Wnt-signaling antagonist dkk1b In conclusion, we

  5. A comparative study on GM (1,1) and FRMGM (1,1) model in forecasting FBM KLCI

    Science.gov (United States)

    Ying, Sah Pei; Zakaria, Syerrina; Mutalib, Sharifah Sakinah Syed Abd

    2017-11-01

    FTSE Bursa Malaysia Kuala Lumpur Composite Index (FBM KLCI) is a group of indexes combined in a standardized way and is used to measure the Malaysia overall market across the time. Although composite index can give ideas about stock market to investors, it is hard to predict accurately because it is volatile and it is necessary to identify a best model to forecast FBM KLCI. The objective of this study is to determine the most accurate forecasting model between GM (1,1) model and Fourier Residual Modification GM (1,1) (FRMGM (1,1)) model to forecast FBM KLCI. In this study, the actual daily closing data of FBM KLCI was collected from January 1, 2016 to March 15, 2016. GM (1,1) model and FRMGM (1,1) model were used to build the grey model and to test forecasting power of both models. Mean Absolute Percentage Error (MAPE) was used as a measure to determine the best model. Forecasted value by FRMGM (1,1) model do not differ much than the actual value compare to GM (1,1) model for in-sample and out-sample data. Results from MAPE also show that FRMGM (1,1) model is lower than GM (1,1) model for in-sample and out-sample data. These results shown that FRMGM (1,1) model is better than GM (1,1) model to forecast FBM KLCI.

  6. Gangliosidosis generalizada tipo 1

    Directory of Open Access Journals (Sweden)

    Iván Hernández García

    Full Text Available La gangliosidosis generalizada tipo 1 es una enfermedad de acúmulo lisosomal producida por mutaciones en el gen de la enzima b-galactosidasa, caracterizada fundamentalmente por toma del sistema nervioso central, la visceromegalia, disostosis ósea y dimorfismo facial. Se presenta el caso de un lactante varón, hijo de padres no consanguíneos, de 5 meses de edad, Apgar 6/8 debido a hipoxia neonatal, con historia de múltiples ingresos por enfermedad diarreica e infecciones respiratorias. Es remitido a la Consulta de Genética Clínica por retardo del desarrollo psicomotor, macrocráneo y hepatomegalia, además de máculas hipercrómicas en piel. En el examen físico se encontraron evidencias de una posible afectación por enfermedad metabólica lisosomal. Entre las enfermedades a descartar estaban la galactosialidosis, de características clínicas similares, y la enfermedad de Morquio, con diferente presentación clínica pero idéntico defecto enzimático.

  7. Chlamydomonas reinhardtii Phosphoribulokinase 1

    Science.gov (United States)

    Roesler, Keith R.; Ogren, William L.

    1990-01-01

    The sequence and kinetic properties of phosphoribulokinase purified from Chlamydomonas reinhardtii were determined and compared with the spinach (Spinacea oleracea) enzyme. Chlamydomonas phosphoribulokinase was purified to apparent homogeneity, with a specific activity of 410 micromoles per minute per milligram. Polyclonal antibodies to the purified protein were used to isolate a Chlamydomonas cDNA clone, which, upon sequencing, was found to contain the entire coding region. The transit peptide cleavage site was determined by Edman analysis of the mature protein. The precursor protein consists of a 31 amino acid transit peptide and a 344 amino acid mature polypeptide. The mature polypeptide has a calculated molecular weight of 38.5 kilodaltons and a pl of 5.75. The Vmax of the purified enzyme was 465 micromoles per minute per milligram, with apparent Km values of 62 micromolar ATP and 56 micromolar ribulose 5-phosphate. Immunoblot analysis indicated antigenic similarity and a similar subunit size for the enzyme from five higher plant species and Chlamydomonas. Southern blot analysis of Chlamydomonas genomic DNA indicated the presence of a single phosphoribulokinase gene. Comparison of the mature proteins from Chlamydomonas and spinach revealed 86 amino acid differences in primary structure (25% of the total) without a major difference in kinetic properties. The transit peptides of the spinach and Chlamydomonas proteins possessed little sequence homology. Images Figure 1 Figure 2 Figure 4 PMID:16667433

  8. Quenches after LS1

    International Nuclear Information System (INIS)

    Verweij, A.P.

    2012-01-01

    In this paper I will give an overview of the different types of quenches that occur in the LHC, followed by an estimate of the number of quenches that we can expect after LS1. Beam-induced quenches and false triggering of the QPS will be the main cause of those quenches that cause a beam dump. Possibly in total up to 10-20 per year. After consolidation of the 13 kA joints, the approach for the BLM settings can be less conservative than in 2010-2012 in order to maximize beam time. This will cause some quenches but, anyhow, a beam.induced quench is not more risky than a quench provoked by false triggering. It is not easy to predict the number of BLM triggered beam dumps, needed to avoid magnet quenches, because it is not sure how to scale beam losses and UFO's from 3.5 TeV to 6.5 TeV, and it is not sure if the thresholds at 3.5 TeV are correct. Quench events will be much more massive (ex: RB quench at 6 kA → 2 MJ, RB quench at 11 kA → 6-20 MJ), and as a result cryo recuperation much longer. There will also be more ramp induced quenches after a FPA in other circuits due to higher ramp rates and smaller temperature margins (mutual coupling)

  9. Datura stramonium Agglutinin 1

    Science.gov (United States)

    Broekaert, Willem F.; Lambrechts, Diane; Verbelen, Jean-Pierre; Peumans, Willy J.

    1988-01-01

    The distribution of Datura stramonium agglutinin over different tissues of D. stramonium L. seeds was visualized by immunocytochemical techniques and quantified by agglutination assays. The lectin occurs predominantly in the outer seed tissues (seed coat and seed epidermis), where it is associated, at least in part, with the cell walls. Developing D. stramonium seeds secrete newly synthesized lectin polypeptides into the incubation medium, which confirms the extracellular location of the lectin. Imbibition of mature decoated seeds results in a rapid and highly specific release of lectin. Indeed, imbibition solutions contain almost exclusively the lectin together with a few other carbohydrate-binding proteins; this is indicative of the predominance of these proteins in the seed surface layer. The presence of important amounts of lectin in the outer tissues of the seed is consistent with a possible role in the mediation of cell-cell interactions. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 9 PMID:16665947

  10. ATLAS Data Challenge 1

    CERN Document Server

    DC1 TaskForce

    2003-01-01

    The ATLAS Collaboration at CERN is preparing for the data taking and analysis at LHC that will start in 2007. Therefore, in 2002 a series of Data Challenges (DC's) was started whose goals are the validation of the Computing Model, of the complete software suite, of the data model, and to ensure the correctness of the technical choices to be made. A major feature of the first Data Challenge (DC1) was the preparation and the deployment of the software required for the production of large event samples for the High Level Trigger and Physics communities, and the production of those large data samples as a worldwide distributed activity. It should be noted that it was not an option to "run everything at CERN" even if we had wanted to; the resources were not available at CERN to carry out the production on a reasonable time-scale. We were therefore faced with the great challenge of organising and then carrying out this large-scale production at a significant number of sites around the world. However, the benefits o...

  11. B1 Aerogels

    DEFF Research Database (Denmark)

    Duer, Karsten; Svendsen, Sv Aa Højgaard

    1996-01-01

    , engineering and architectural basis which will support the appropriate use of aerogels in windows, solar collectors and passive solar applications, with the aim of saving or producing thermal energy for use in buildings".This objective is in very good agreement with the general scope of task 18 but where Task...... of aerogel as a material for window applications3. Construction of an aerogel DGU and measurement of key performance parameters. The goal for the aerogel DGU was to reach a Total Solar Energy Transmittance above 0.75 and a U-value below 0.5 W/m²K. These are values that can not be simultaneously reached......The report summarizes the work that has been carried out within the project "B1 AEROGELS" as a part of the IEA SH&CP Task 18 "Advanced Glazing and Associated Materials For Solar And Building Applications".By providing at the same time thermal insulation and transparency the silica aerogel is a very...

  12. 26 CFR 1.970-1 - Export trade corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Export trade corporations. 1.970-1 Section 1... (CONTINUED) INCOME TAXES Export Trade Corporations § 1.970-1 Export trade corporations. (a) In general. Sections 970 through 972 provide in general that if a controlled foreign corporation is an export trade...

  13. 26 CFR 1.846-1 - Application of discount factors.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Application of discount factors. 1.846-1 Section... (CONTINUED) INCOME TAXES Other Insurance Companies § 1.846-1 Application of discount factors. (a) In general—(1) Rules. A separate series of discount factors are computed for, and applied, to undiscounted...

  14. 26 CFR 1.642(e)-1 - Depreciation and depletion.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Depreciation and depletion. 1.642(e)-1 Section 1... (CONTINUED) INCOME TAXES Estates, Trusts, and Beneficiaries § 1.642(e)-1 Depreciation and depletion. An estate or trust is allowed the deductions for depreciation and depletion, but only to the extent the...

  15. 1 CFR 6.1 - Index to daily issues.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Index to daily issues. 6.1 Section 6.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER THE FEDERAL REGISTER INDEXES AND ANCILLARIES § 6.1 Index to daily issues. Each daily issue of the Federal Register shall be appropriately indexed. ...

  16. Arfaptin-1 negatively regulates Arl1-mediated retrograde transport.

    Directory of Open Access Journals (Sweden)

    Lien-Hung Huang

    Full Text Available The small GTPase Arf-like protein 1 (Arl1 is well known for its role in intracellular vesicular transport at the trans-Golgi network (TGN. In this study, we used differential affinity chromatography combined with mass spectrometry to identify Arf-interacting protein 1b (arfaptin-1b as an Arl1-interacting protein and characterized a novel function for arfaptin-1 (including the arfaptin-1a and 1b isoforms in Arl1-mediated retrograde transport. Using a Shiga-toxin subunit B (STxB transportation assay, we demonstrated that knockdown of arfaptin-1 accelerated the retrograde transport of STxB from the endosome to the Golgi apparatus, whereas Arl1 knockdown inhibited STxB transport compared with control cells. Arfaptin-1 overexpression, but not an Arl1 binding-defective mutant (arfaptin-1b-F317A, consistently inhibited STxB transport. Exogenous arfaptin-1 expression did not interfere with the localization of the Arl1-interacting proteins golgin-97 and golgin-245 to the TGN and vice versa. Moreover, we found that the N-terminal region of arfaptin-1 was involved in the regulation of retrograde transport. Our results show that arfaptin-1 acts as a negative regulator in Arl1-mediated retrograde transport and suggest that different functional complexes containing Arl1 form in distinct microdomains and are responsible for different functions.

  17. The MAT1-1:MAT1-2 ratio of Sporothrix globosa isolates in Japan.

    Science.gov (United States)

    Kano, Rui; Tsui, Clement K-M; Hamelin, Richard C; Anzawa, Kazushi; Mochizuki, Takashi; Nishimoto, Katsutaro; Hiruma, Masataro; Kamata, Hiroshi; Hasegawa, Atsuhiko

    2015-02-01

    In order to understand the reproductive biology of pathogenic species in the Sporothrix schenckii complex, we characterized the partial mating type (MAT1-1) loci of Sporothrix schenckii, as well as the S. globosa MAT1-1-1 gene, which encoded 262 amino acid sequences. The data confirmed that the MAT1-1 locus of S. globosa was divergent from the MAT1-2 locus of the opposite mating type, suggesting that the fungus is heterothallic. To determine the mating type ratio of 20 isolates from Japanese patients, we analyzed the MAT loci by specific PCR amplification of MAT1-1-1 and MAT1-2-1 genes. The MAT1-1-1 was detected in 5 isolates but not in the other 15 isolates with the presence of MAT1-2-1. The MAT1-1:1-2 ratio of S. globosa isolates in Japan was estimated to be 1:3. Phylogenetic analysis indicated that the sequences of the MAT1-1-1 were identical among S. globosa isolates but different from S. schenckii and Ophiostoma montium.

  18. Shikonin regulates C-MYC and GLUT1 expression through the MST1-YAP1-TEAD1 axis

    Energy Technology Data Exchange (ETDEWEB)

    Vališ, Karel, E-mail: karel.valis@biomed.cas.cz [Laboratory of Structural Biology and Cell Signaling, Institute of Microbiology, v.v.i., The Czech Academy of Sciences, Prague (Czech Republic); Faculty of Science, Charles University, Prague (Czech Republic); Talacko, Pavel; Grobárová, Valéria [Laboratory of Structural Biology and Cell Signaling, Institute of Microbiology, v.v.i., The Czech Academy of Sciences, Prague (Czech Republic); Faculty of Science, Charles University, Prague (Czech Republic); Černý, Jan [Faculty of Science, Charles University, Prague (Czech Republic); Novák, Petr, E-mail: pnovak@biomed.cas.cz [Laboratory of Structural Biology and Cell Signaling, Institute of Microbiology, v.v.i., The Czech Academy of Sciences, Prague (Czech Republic); Faculty of Science, Charles University, Prague (Czech Republic)

    2016-12-10

    The general mechanism underlying the tumor suppressor activity of the Hippo signaling pathway remains unclear. In this study, we explore the molecular mechanisms connecting the Hippo signaling pathway with glucose metabolism. We have found that two key regulators of glycolysis, C-MYC and GLUT1, are targets of the Hippo signaling pathway in human leukemia cells. Our results revealed that activation of MST1 by the natural compound shikonin inhibited the expression of GLUT1 and C-MYC. Furthermore, RNAi experiments confirmed the regulation of GLUT1 and C-MYC expression via the MST1-YAP1-TEAD1 axis. Surprisingly, YAP1 was found to positively regulate C-MYC mRNA levels in complex with TEAD1, while it negatively regulates C-MYC levels in cooperation with MST1. Hence, YAP1 serves as a rheostat for C-MYC, which is regulated by MST1. In addition, depletion of MST1 stimulates lactate production, whereas the specific depletion of TEAD1 has an opposite effect. The inhibition of lactate production and cellular proliferation induced by shikonin also depends on the Hippo pathway activity. Finally, a bioinformatic analysis revealed conserved TEAD-binding motifs in the C-MYC and GLUT1 promoters providing another molecular data supporting our observations. In summary, regulation of glucose metabolism could serve as a new tumor suppressor mechanism orchestrated by the Hippo signaling pathway. - Highlights: • Shikonin inhibits C-MYC and GLUT1 expression in MST1 and YAP1 dependent manner. • YAP1-TEAD1 interaction activates C-MYC and GLUT1 expression. • MST1 in cooperation with YAP1 inhibits C-MYC and GLUT1 expression. • MST1-YAP1-TEAD1 axis regulates lactate production by leukemic cells. • MST1 and YAP1 proteins block proliferation of leukemic cells.

  19. Shikonin regulates C-MYC and GLUT1 expression through the MST1-YAP1-TEAD1 axis

    International Nuclear Information System (INIS)

    Vališ, Karel; Talacko, Pavel; Grobárová, Valéria; Černý, Jan; Novák, Petr

    2016-01-01

    The general mechanism underlying the tumor suppressor activity of the Hippo signaling pathway remains unclear. In this study, we explore the molecular mechanisms connecting the Hippo signaling pathway with glucose metabolism. We have found that two key regulators of glycolysis, C-MYC and GLUT1, are targets of the Hippo signaling pathway in human leukemia cells. Our results revealed that activation of MST1 by the natural compound shikonin inhibited the expression of GLUT1 and C-MYC. Furthermore, RNAi experiments confirmed the regulation of GLUT1 and C-MYC expression via the MST1-YAP1-TEAD1 axis. Surprisingly, YAP1 was found to positively regulate C-MYC mRNA levels in complex with TEAD1, while it negatively regulates C-MYC levels in cooperation with MST1. Hence, YAP1 serves as a rheostat for C-MYC, which is regulated by MST1. In addition, depletion of MST1 stimulates lactate production, whereas the specific depletion of TEAD1 has an opposite effect. The inhibition of lactate production and cellular proliferation induced by shikonin also depends on the Hippo pathway activity. Finally, a bioinformatic analysis revealed conserved TEAD-binding motifs in the C-MYC and GLUT1 promoters providing another molecular data supporting our observations. In summary, regulation of glucose metabolism could serve as a new tumor suppressor mechanism orchestrated by the Hippo signaling pathway. - Highlights: • Shikonin inhibits C-MYC and GLUT1 expression in MST1 and YAP1 dependent manner. • YAP1-TEAD1 interaction activates C-MYC and GLUT1 expression. • MST1 in cooperation with YAP1 inhibits C-MYC and GLUT1 expression. • MST1-YAP1-TEAD1 axis regulates lactate production by leukemic cells. • MST1 and YAP1 proteins block proliferation of leukemic cells.

  20. 1918 pandemic H1N1 DNA vaccine protects ferrets against 2007 H1N1 virus infection

    DEFF Research Database (Denmark)

    Bragstad, Karoline; Martel, Cyril Jean-Marie; Aasted, Bent

    of the H1N1 pandemic virus from 1918 induce protection in ferrets against infection with a H1N1 (A/New Caledonia/20/99(H1N1)) virus which was included in the conventional vaccine for the 2006-2007 season. The viruses are separated by a time interval of 89 years and differ by 21.2% in the HA1 protein...

  1. Inflammation Downregulates UCP1 Expression in Brown Adipocytes Potentially via SIRT1 and DBC1 Interaction

    Directory of Open Access Journals (Sweden)

    Mark K. Nøhr

    2017-05-01

    Full Text Available Brown adipose tissue thermogenesis at the cost of energy is not only important for the development of obesity, but also possesses great promise in anti-obesity treatment. Uncoupling protein 1 (UCP1 expression has been reported to be under control of the intracellular deacetylase SIRT1. Here, we investigated the effect and mechanism of inflammation and sirtuin-1 (SIRT1 activation on the induction of thermogenic genes in immortalized brown adipocytes incubated with LPS or IL1β and mice with elevated inflammatory tone. In vitro stimulation of brown adipocytes with dibutyryl cyclic adenosine monophosthate (dbcAMP reduced the expression of deleted in breast cancer-1 (Dbc1 (SIRT1 inhibitor and increased the Ucp1 expression. Silencing of SIRT1 attenuated dbcAMP induction of Ucp1. In contrast, IL1β increased the expression of Dbc1 and greatly reduced the induction of Ucp1. Similarly, in vivo studies revealed decreased expression of Ucp1 in brown adipose tissue (BAT in mice chronically infused with LPS. Resveratrol, a known SIRT1 activator, partly rescued the Ucp1 downregulation by inflammation in both the cell cultures and mice. Here, we describe how the expression of Ucp1 in BAT is controlled via SIRT1 and is reduced under inflammation and can be rescued by SIRT1 activation by resveratrol. We suggest the reduced UCP1 expression under inflammation is mediated by the increased expression of DBC1, which inhibits SIRT1 activity.

  2. 26 CFR 1.47-3 - Exceptions to the application of § 1.47-1.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Exceptions to the application of § 1.47-1. 1.47-3 Section 1.47-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY INCOME TAX INCOME TAXES Rules for Computing Credit for Investment in Certain Depreciable Property § 1.47-3...

  3. HIF-1α inhibits IDH-1 expression in osteosarcoma.

    Science.gov (United States)

    Liu, Deng-Cheng; Zheng, Xun; Zho, Yong; Yi, Wan-Rong; Li, Zong-Huan; Hu, Xiang; Yu, Ai-Xi

    2017-07-01

    Recently, hypoxia inducible factor-1 (HIF-1) was reported to be correlated with isocitrate dehydrogenase 1 (IDH-1) in several types of tumors. However, the expression and significance of HIF-1 and IDH-1 in osteosarcoma is still unknown. In the present study, the expression levels of IDH-1 and HIF-1α in 35 formalin-fixed paraffin-embedded sections from osteosarcoma patients were investigated by immunohistochemistry. The expression levels of IDH-1 and HIF-1α in human osteosarcoma cell lines (MG-63 and 143B) were further detected by western blotting under normal and hypoxic conditions. In addition, HIF-1α was downregulated via lentiviral vector‑mediated RNA interference (RNAi) in the MG-63 human osteosarcoma cell line. The results revealed that HIF-1α was negatively correlated with IDH-1 in the osteosarcoma tissues. Both in MG-63 and 143B cell lines, the expression of HIF-1α was increased while IDH-1 was decreased under a hypoxic condition compared to normal conditions. HIF-1α downregulation promoted IDH-1 expression in the MG-63 cell line under either normal or hypoxic conditions. In conclusion, our findings suggest that HIF-1α inhibits IDH-1 in osteosarcoma and consequently increases the incidence of osteosarcoma.

  4. MAN1B1 deficiency: an unexpected CDG-II.

    Directory of Open Access Journals (Sweden)

    Daisy Rymen

    Full Text Available Congenital disorders of glycosylation (CDG are a group of rare metabolic diseases, due to impaired protein and lipid glycosylation. In the present study, exome sequencing was used to identify MAN1B1 as the culprit gene in an unsolved CDG-II patient. Subsequently, 6 additional cases with MAN1B1-CDG were found. All individuals presented slight facial dysmorphism, psychomotor retardation and truncal obesity. Generally, MAN1B1 is believed to be an ER resident alpha-1,2-mannosidase acting as a key factor in glycoprotein quality control by targeting misfolded proteins for ER-associated degradation (ERAD. However, recent studies indicated a Golgi localization of the endogenous MAN1B1, suggesting a more complex role for MAN1B1 in quality control. We were able to confirm that MAN1B1 is indeed localized to the Golgi complex instead of the ER. Furthermore, we observed an altered Golgi morphology in all patients' cells, with marked dilatation and fragmentation. We hypothesize that part of the phenotype is associated to this Golgi disruption. In conclusion, we linked mutations in MAN1B1 to a Golgi glycosylation disorder. Additionally, our results support the recent findings on MAN1B1 localization. However, more work is needed to pinpoint the exact function of MAN1B1 in glycoprotein quality control, and to understand the pathophysiology of its deficiency.

  5. Transmission electron microscope study of the topotactic reaction of (0 0 1), (0 1 1) and (1 1 1) Ag films and Te

    Energy Technology Data Exchange (ETDEWEB)

    Safran, G.; Geszti, O.; Radnoczi, G

    2003-09-01

    The formation, structure and morphology of silver telluride was investigated in the reaction of (0 0 1), (0 1 1) and (1 1 1) single crystalline Ag films with vacuum deposited Te. Silver films 30-40 nm in thickness were deposited by thermal evaporation onto water- and chlorine-treated NaCl. Onto this silver 1-40 nm of tellurium were deposited at 100 and 200 deg. C. The Ag-Te reaction occurred during Te deposition. Accordingly, formation of the compound phase was investigated from the nucleation stage through complete tellurization on either side of the polymorphic phase transformation temperature (T{sub c}=150 deg. C). Transmission electron microscope and selected area electron diffraction showed that monoclinic silver telluride (Ag{sub 2}Te) of different morphology and texture was always formed. The orientation of silver and monoclinic phase upon differently oriented monocrystalline Ag films and at deposition temperatures around T{sub c} is discussed.

  6. Kinetics of transformation of 1,1,1-trichloroethane by Fe(II) in cement slurries

    International Nuclear Information System (INIS)

    Jung, Bahngmi; Batchelor, Bill

    2009-01-01

    This study examines the applicability of the iron-based degradative solidification/stabilization (DS/S-Fe(II)) process to 1,1,1-trichloroethane (1,1,1-TCA), which is one of common chlorinated aliphatic hydrocarbons (CAHs) of concern at contaminated sites. DS/S-Fe(II) combines contaminant degradation by Fe(II) and immobilization by the hydration reactions of Portland cement. The transformation of 1,1,1-TCA by Fe(II) in 10% Portland cement slurries was studied using a batch slurry reactor system. The effects of Fe(II) dose, pH, and initial concentration of 1,1,1-TCA on the kinetics of 1,1,1-TCA degradation were evaluated. Degradation of 1,1,1-TCA in cement slurries including Fe(II) was very rapid and could be described by a pseudo-first-order rate law. The half-lives for 1,1,1-TCA were measured between 0.4 and 5 h when Fe(II) dose ranged from 4.9 to 39.2 mM. The pseudo-first-order rate constant increased with pH to a maximum near pH 12.5. A saturation rate equation was able to predict degradation kinetics over a wide range of target organic concentrations and at higher Fe(II) doses. The major transformation product of 1,1,1-TCA in mixtures of Fe(II) and cement was 1,1-dichloroethane (1,1-DCA), which indicates that degradation occurred by a hydrogenolysis pathway. A small amount of ethane was observed. The conversion of 1,1,1-TCA to ethane was better described by a parallel reaction model than by a consecutive reaction model

  7. Splice variants of porcine PPHLN1 encoding periphilin-1

    DEFF Research Database (Denmark)

    Larsen, Knud Erik; Momeni, Jamal; Farajzadeh, Leila

    2017-01-01

    splice variants hereof. RT-PCR cloning using oligonucleotide primers derived from in silico sequences resulted in three PPHLN1 transcripts: a full-length mRNA and two transcript variant resulting in shorter proteins. The longest encoded periphilin-1, consisting of 373 amino acids, displays a high......The periphilin-1 protein is encoded by the PPHLN1 gene. Periphilin-1 is found in the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layer of epidermis. In the current study we report on the cloning and characterization of the porcine PPHLN1 cDNA and two...... homology to the human periphilin-1 protein coded by the transcript variant 2 (91%). A shorter transcript variant (PPHLN1Sp1) contains a 1065-codon ORF, which is consistent with that of the authentic PPHLN1, but lacks a region of 57 bp spanning exon 7. Hence, the encoded polypeptide periphilin-1Sp1 consists...

  8. Expression of a 1-aminocyclopropane-1-carboxylate (ACC) oxidase ...

    African Journals Online (AJOL)

    Expression of a 1-aminocyclopropane-1-carboxylate (ACC) oxidase gene in peach ( Prunus persica L.) fruit in response to treatment with carbon dioxide and 1-methylcyclopropene: possible role of ethylene.

  9. VOYAGER 1 SATURN MAGNETOMETER RESAMPLED DATA 1.92 SEC

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set includes Voyager 1 Saturn encounter magnetometer data that have been resampled at a 1.92 second sample rate. The data set is composed of 6 columns: 1)...

  10. VOYAGER 1 JUPITER MAGNETOMETER RESAMPLED DATA 1.92 SEC

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set includes Voyager 1 Jupiter encounter magnetometer data that have been resampled at a 1.92 second sample rate. The data set is composed of 6 columns: 1)...

  11. Intestinal and Hepatic Niemann-Pick C1-Like 1

    Directory of Open Access Journals (Sweden)

    Sung-Woo Park

    2013-08-01

    Full Text Available Polytopic transmembrane protein, Niemann-Pick C1-Like 1 (NPC1L1 is localized at the apical membrane of enterocytes and the canalicular membrane of hepatocytes. It mediates intestinal cholesterol absorption and prevents extensive loss of cholesterol by transporting biliary cholesterol into hepatocytes. NPC1L1 is a molecular target of ezetimibe, an agent for hypercholesterolemia. Recently, NPC1L1 inhibition has been shown to prevent metabolic disorders such as fatty liver disease, obesity, diabetes, and atherosclerosis. In this review, the identification and characterization of NPC1L1, NPC1L1-dependent cholesterol transport, the relationship with pathogenesis of metabolic disease and its newly introduced function for virus entry are discussed.

  12. 1 Ft. x 1 Ft. Supersonic Wind Tunnel, Bldg. 37

    Data.gov (United States)

    Federal Laboratory Consortium — The 1- by 1-Foot Supersonic Wind Tunnel (1x), located in the Engine Research Building, is one of the most active test facilities at the Glenn Research Center. Used...

  13. Checkpoint Functions of the BRCA1/BARD1 Tumor Suppressor

    National Research Council Canada - National Science Library

    Modi, Ami

    2007-01-01

    .... To study the function of mitotic BARD1 phosphorylation, I used an siRNA-mediated approach to knockdown endogenous BARD1 expression and then restore expression with siRNA-resistant exogenous forms of BARD1...

  14. First principles mechanistic study of borohydride oxidation over the Pt(1 1 1) surface

    International Nuclear Information System (INIS)

    Rostamikia, Gholamreza; Janik, Michael J.

    2010-01-01

    The mechanism of borohydride oxidation and the competing hydrolysis reaction are examined over Pt(1 1 1) using density functional theory (DFT) methods. Adsorption of BH 4 - over Au(1 1 1) and Pt(1 1 1) is examined. Adsorption over Pt(1 1 1) is dissociative and extremely exothermic at potentials of interest, leading to a high surface coverage of H * for which gaseous hydrogen evolution is competitive with oxidation. Elementary surface reactions oxidizing B-containing intermediates are favorable over Pt(1 1 1) at -0.85 V (SHE), consistent with experimental voltammetry results in the literature. The energetics of the initial adsorption step dictate the activity limitation of gold anodes and the selectivity limitation of platinum electrodes. This adsorption energy can be rapidly calculated with DFT methods, enabling screening of pure metals, alloys, poisons, and promoters to optimize borohydride oxidation catalyst design.

  15. Comparative capabilities of 1-phenylpropane-1-13C and 1-phenylbutane-1-13C toward the alkylbenzene automerization

    International Nuclear Information System (INIS)

    Roberts, R.M.; Gibson, T.L.; Abdel-Baset, M.B.

    1977-01-01

    1-Phenylbutane-1- 13 C failed to undergo rearrangement of the isotopic label from C-1 to C-2 of the side chain (automerization) when heated with AlCl 3 or AlBr 3 under conditions which produce complete equilibration of isotopic carbon between C-1 and C-2 in labeled 1-phenylpropane (n-propylbenzene). When equimolar mixtures of 1-phenylbutane-1- 13 C and 1-phenylpropane-1- 13 C were treated with AlCl 3 and AlBr 3 , neither hydrocarbon underwent automerization when the usual concentration of catalysts was used; with a much higher concentration of AlBr 3 , 1-phenylpropane-1- 13 C showed isotopic automerization but 1-phenylbutane-1- 13 C could not be recovered. Various compounds, known to be produced from 1-phenylbutane under the conditions of the reaction, were tested as potential inhibitors of the isotopic automerization. Di- and tri-n-butylbenzenes appeared to be the most likely candidates. The failure of 1-phenylbutane-1- 13 C to undergo isotopic automerization may be ascribed partly to alternative reactions which it undergoes but which are not available to 1-phenylpropane-1- 13 C. These alternative reactions are cyclialkylations to indan and indene derivatives via the secondary carbocation produced by hydride abstraction at the 3 position in the side chain of 1-phenylbutane. In accord with this explanation, significant amounts of indans and indenes have been identified among the products from 1-phenylbutane. A second factor in the failure of 1-phenylbutane-1- 13 C to undergo automerization is the lesser tendency of a 1,2-ethyl shift in an intermediate carbocation compared with a 1,2-methyl shift. This was demonstrated in the reaction of 1,2-diphenylbutane-2- 13 C with aluminum chloride, which gave only 8 to 10% isotopic rearrangement in recovered 1,2-diphenylbutane and the 1-phenylbutane produced from it

  16. YY1 positively regulates human UBIAD1 expression

    International Nuclear Information System (INIS)

    Funahashi, Nobuaki; Hirota, Yoshihisa; Nakagawa, Kimie; Sawada, Natumi; Watanabe, Masato; Suhara, Yoshitomo; Okano, Toshio

    2015-01-01

    Vitamin K is involved in bone formation and blood coagulation. Natural vitamin K compounds are composed of the plant form phylloquinone (vitamin K 1 ) and a series of bacterial menaquionones (MK-n; vitamin K 2 ). Menadione (vitamin K 3 ) is an artificial vitamin K compound. MK-4 contains 4-isoprenyl as a side group in the 2-methyl-1,4-naphthoquinone common structure and has various bioactivities. UbiA prenyltransferase domain containing 1 (UBIAD1 or TERE1) is the menaquinone-4 biosynthetic enzyme. UBIAD1 transcript expression significantly decreases in patients with prostate carcinoma and overexpressing UBIAD1 inhibits proliferation of a tumour cell line. UBIAD1 mRNA expression is ubiquitous in mouse tissues, and higher UBIAD1 mRNA expression levels are detected in the brain, heart, kidneys and pancreas. Several functions of UBIAD1 have been reported; however, regulation of the human UBIAD1 gene has not been elucidated. Here we report cloning and characterisation of the human UBIAD1 promoter. A 5′ rapid amplification of cDNA ends analysis revealed that the main transcriptional start site was 306 nucleotides upstream of the translation initiation codon. Deletion and mutation analyses revealed the functional importance of the YY1 consensus motif. Electrophoretic gel mobility shift and chromatin immunoprecipitation assays demonstrated that YY1 binds the UBIAD1 promoter in vitro and in vivo. In addition, YY1 small interfering RNA decreased endogenous UBIAD1 mRNA expression and UBIAD1 conversion activity. These results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter. - Highlights: • We cloned the human UBIAD1 promoter. • The functional importance of the YY1 motif was identified in the UBIAD1 promoter. • YY1 binds the UBIAD1 promoter in vitro and in vivo. • Knockdown of YY1 significantly decreased UBIAD1 expression. • YY1 up-regulates UBIAD1 conversion activity through the UBIAD1 promoter

  17. YY1 positively regulates human UBIAD1 expression

    Energy Technology Data Exchange (ETDEWEB)

    Funahashi, Nobuaki, E-mail: nfunahashi@ri.ncgm.go.jp [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Department of Metabolic Disorder, Diabetes Research Center, Research Institute, National Center for Global Health and Medicine, Tokyo (Japan); Hirota, Yoshihisa [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Faculty of Pharmaceutical Sciences, Suzuka University of Medical Science, Suzuka (Japan); Nakagawa, Kimie; Sawada, Natumi; Watanabe, Masato [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Suhara, Yoshitomo [Department of Bioscience and Engineering, Shibaura Institute of Technology, Saitama (Japan); Okano, Toshio [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan)

    2015-05-01

    Vitamin K is involved in bone formation and blood coagulation. Natural vitamin K compounds are composed of the plant form phylloquinone (vitamin K{sub 1}) and a series of bacterial menaquionones (MK-n; vitamin K{sub 2}). Menadione (vitamin K{sub 3}) is an artificial vitamin K compound. MK-4 contains 4-isoprenyl as a side group in the 2-methyl-1,4-naphthoquinone common structure and has various bioactivities. UbiA prenyltransferase domain containing 1 (UBIAD1 or TERE1) is the menaquinone-4 biosynthetic enzyme. UBIAD1 transcript expression significantly decreases in patients with prostate carcinoma and overexpressing UBIAD1 inhibits proliferation of a tumour cell line. UBIAD1 mRNA expression is ubiquitous in mouse tissues, and higher UBIAD1 mRNA expression levels are detected in the brain, heart, kidneys and pancreas. Several functions of UBIAD1 have been reported; however, regulation of the human UBIAD1 gene has not been elucidated. Here we report cloning and characterisation of the human UBIAD1 promoter. A 5′ rapid amplification of cDNA ends analysis revealed that the main transcriptional start site was 306 nucleotides upstream of the translation initiation codon. Deletion and mutation analyses revealed the functional importance of the YY1 consensus motif. Electrophoretic gel mobility shift and chromatin immunoprecipitation assays demonstrated that YY1 binds the UBIAD1 promoter in vitro and in vivo. In addition, YY1 small interfering RNA decreased endogenous UBIAD1 mRNA expression and UBIAD1 conversion activity. These results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter. - Highlights: • We cloned the human UBIAD1 promoter. • The functional importance of the YY1 motif was identified in the UBIAD1 promoter. • YY1 binds the UBIAD1 promoter in vitro and in vivo. • Knockdown of YY1 significantly decreased UBIAD1 expression. • YY1 up-regulates UBIAD1 conversion activity through the UBIAD1

  18. Protein: MPA1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA1 TLR signaling molecules Zc3h12a Mcpip, Mcpip1 Ribonuclease ZC3H12A MCP-induced pro...tein 1, Zinc finger CCCH domain-containing protein 12A 10090 Mus musculus 230738 Q5D1E7 Q5D1E7 19322177 ...

  19. Main: GT1CONSENSUS [PLACE

    Lifescience Database Archive (English)

    Full Text Available m of GT-1 may be achieved through direct interaction between TFIIA and GT-1; Binding of GT-1-like factors to the PR-1a promoter influ...ences the level of SA-inducible gene expression; GT-1; light; TATA; TFIIA; TBP; HR;

  20. Effects of human SAMHD1 polymorphisms on HIV-1 susceptibility

    International Nuclear Information System (INIS)

    White, Tommy E.; Brandariz-Nuñez, Alberto; Valle-Casuso, Jose Carlos; Knowlton, Caitlin; Kim, Baek; Sawyer, Sara L.; Diaz-Griffero, Felipe

    2014-01-01

    SAMHD1 is a human restriction factor that prevents efficient infection of macrophages, dendritic cells and resting CD4+ T cells by HIV-1. Here we explored the antiviral activity and biochemical properties of human SAMHD1 polymorphisms. Our studies focused on human SAMHD1 polymorphisms that were previously identified as evolving under positive selection for rapid amino acid replacement during primate speciation. The different human SAMHD1 polymorphisms were tested for their ability to block HIV-1, HIV-2 and equine infectious anemia virus (EIAV). All studied SAMHD1 variants block HIV-1, HIV-2 and EIAV infection when compared to wild type. We found that these variants did not lose their ability to oligomerize or to bind RNA. Furthermore, all tested variants were susceptible to degradation by Vpx, and localized to the nuclear compartment. We tested the ability of human SAMHD1 polymorphisms to decrease the dNTP cellular levels. In agreement, none of the different SAMHD1 variants lost their ability to reduce cellular levels of dNTPs. Finally, we found that none of the tested human SAMHD1 polymorphisms affected the ability of the protein to block LINE-1 retrotransposition. - Highlights: • Human SAMHD1 single-nucleotide polymorphisms block HIV-1 and HIV-2 infection. • SAMHD1 polymorphisms do not affect its ability to block LINE-1 retrotransposition. • SAMHD1 polymorphisms decrease the cellular levels of dNTPs

  1. Effects of human SAMHD1 polymorphisms on HIV-1 susceptibility

    Energy Technology Data Exchange (ETDEWEB)

    White, Tommy E.; Brandariz-Nuñez, Alberto; Valle-Casuso, Jose Carlos [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, 1301 Morris Park – Price Center 501, New York, NY 10461 (United States); Knowlton, Caitlin; Kim, Baek [Department of Microbiology and Immunology, University of Rochester School of Medicine and Dentistry, Rochester, NY 14642 (United States); Sawyer, Sara L. [Department of Molecular Biosciences, University of Texas at Austin, Austin, TX 78712 (United States); Diaz-Griffero, Felipe, E-mail: Felipe.Diaz-Griffero@einstein.yu.edu [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, 1301 Morris Park – Price Center 501, New York, NY 10461 (United States)

    2014-07-15

    SAMHD1 is a human restriction factor that prevents efficient infection of macrophages, dendritic cells and resting CD4+ T cells by HIV-1. Here we explored the antiviral activity and biochemical properties of human SAMHD1 polymorphisms. Our studies focused on human SAMHD1 polymorphisms that were previously identified as evolving under positive selection for rapid amino acid replacement during primate speciation. The different human SAMHD1 polymorphisms were tested for their ability to block HIV-1, HIV-2 and equine infectious anemia virus (EIAV). All studied SAMHD1 variants block HIV-1, HIV-2 and EIAV infection when compared to wild type. We found that these variants did not lose their ability to oligomerize or to bind RNA. Furthermore, all tested variants were susceptible to degradation by Vpx, and localized to the nuclear compartment. We tested the ability of human SAMHD1 polymorphisms to decrease the dNTP cellular levels. In agreement, none of the different SAMHD1 variants lost their ability to reduce cellular levels of dNTPs. Finally, we found that none of the tested human SAMHD1 polymorphisms affected the ability of the protein to block LINE-1 retrotransposition. - Highlights: • Human SAMHD1 single-nucleotide polymorphisms block HIV-1 and HIV-2 infection. • SAMHD1 polymorphisms do not affect its ability to block LINE-1 retrotransposition. • SAMHD1 polymorphisms decrease the cellular levels of dNTPs.

  2. Boyd Report 1

    International Nuclear Information System (INIS)

    Crow, A.J.

    2009-01-01

    Andrew Crow arrived at Lawrence Livermore National Laboratory with the intention of continuing work on the Complex Particle Kinetic (CPK) method developed D. Larson and D. Hewett. Andrew Crow had previously worked on duplicating the results of D. Hewett in his previous work. Since arrival, A. Crow has been working with D. Larson on a slightly different project. The current method, still under development, is a Particle in Cell (PIC) code with the following features: (1) all particles begin each timestep at a gridpoint; (2) particles are then advanced in time using a standard special advancement method. The exact method has not been decided upon, but there are many reliable methods from which to choose. (3) All particles within each cell undergo a simultaneous implicit collision step. This is the current area of focus. Currently, A. Crow is not aware of any method of performing implicit collisions over a large number of charged particles. Implicit methods for charged particle movement and electron-electron collisions, have been developed. The work of L. pareschi and G. Russo on the Time Relaxed Direct Simulation Monte Carlo method, also appears to be a good basis for implicit particle collisions. (4) Each individual particle will be divided into a set of particles with a Gaussian velocity distribution. This will collect some of the thermal effects created by the collisions. This algorithm has not been created. (5) Particles will be projected on to the grid points. Currently, a linear weighting technique is intended to be used, but has not settled upon. (6) Once on the gridpoints the particle number will be reduced using a set of quadrature points based on the third order velocity moments of the particles. The method proposed by R. Fox has been programmed and shown to conserve energy, momentum and mass to machine precision. In addition to reducing the number of particles this method will work to quiet the simulation it will behave as a higher order version of the

  3. GOTTCHA Database, Version 1

    Energy Technology Data Exchange (ETDEWEB)

    2015-08-03

    first reduced by performing a binary search of the boundary suffixes of the smaller set into the larger set, which defines the limits of the zipper-based intersection process. Rather than recording the actual k-mers of the intersection, another data structure of identical "shape" is created which consists of only bit vectors so that only a 1 or 0 will be stored in the location of the k-mer suffix that was found in the intersection. This reduces the amount of data generated and stored considerably.During the Subtraction phase, relevant intersection bitmasks are first unionized together to form a single bitmask which is then applied over the original genome to reveal only those regions of the genome that are unique. These regions are then exported to disk in FASTA format and used in the application of determining the constituents of an unknown metagenomic community.The DATABASE provided is the result of the algorithm described.

  4. GOTTCHA, Version 1

    Energy Technology Data Exchange (ETDEWEB)

    2015-08-03

    is first reduced by performing a binary search of the boundary suffixes of the smaller set into the larger set, which defines the limits of the zipper-based intersection process. Rather than recording the actual k-mers of the intersection, another data structure of identical "shape" is created which consists of only bit vectors so that only a 1 or 0 will be stored in the location of the k-mer suffix that was found in the intersection. This reduces the amount of data generated and stored considerably. During the Subtraction phase, relevant intersection bitmasks are first unionized together to form a single bitmask which is then applied over the original genome to reveal only those regions of the genome that are unique. These regions are then exported to disk in FASTA format and used in the application of determining the constituents of an unknown metagenomic community.

  5. Mib1 contributes to persistent directional cell migration by regulating the Ctnnd1-Rac1 pathway.

    Science.gov (United States)

    Mizoguchi, Takamasa; Ikeda, Shoko; Watanabe, Saori; Sugawara, Michiko; Itoh, Motoyuki

    2017-10-31

    Persistent directional cell migration is involved in animal development and diseases. The small GTPase Rac1 is involved in F-actin and focal adhesion dynamics. Local Rac1 activity is required for persistent directional migration, whereas global, hyperactivated Rac1 enhances random cell migration. Therefore, precise control of Rac1 activity is important for proper directional cell migration. However, the molecular mechanism underlying the regulation of Rac1 activity in persistent directional cell migration is not fully understood. Here, we show that the ubiquitin ligase mind bomb 1 (Mib1) is involved in persistent directional cell migration. We found that knockdown of MIB1 led to an increase in random cell migration in HeLa cells in a wound-closure assay. Furthermore, we explored novel Mib1 substrates for cell migration and found that Mib1 ubiquitinates Ctnnd1. Mib1-mediated ubiquitination of Ctnnd1 K547 attenuated Rac1 activation in cultured cells. In addition, we found that posterior lateral line primordium cells in the zebrafish mib1 ta52b mutant showed increased random migration and loss of directional F-actin-based protrusion formation. Knockdown of Ctnnd1 partially rescued posterior lateral line primordium cell migration defects in the mib1 ta52b mutant. Taken together, our data suggest that Mib1 plays an important role in cell migration and that persistent directional cell migration is regulated, at least in part, by the Mib1-Ctnnd1-Rac1 pathway. Published under the PNAS license.

  6. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  7. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    International Nuclear Information System (INIS)

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2014-01-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  8. AAS 227: Day 1

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    The mission was featured on the front pages of 450 newspapers worldwide on every single continent (including Antartica!)New Horizons reached the Moon in9 HOURSafter launch (compared to the ~3 days it took the Apollo missions)The mission controllers were aiming for a 100km window of space all the way from EarthThere was a window of ~400seconds which the probe had to arrive within the probe arrived90 seconds early! Putting tardy astronomers everywhere to shame.Charon was the only satellite of Pluto known at the time of the mission proposalThe canyon found on Charon is not only bigger than the Grand Canyon but bigger than Mariner Valley on Mars which is already4000 km (2500 mi) long and reaches depths of up to 7 km (4 mi)!Charons surface. Tectonic feature runs about 1500 km, around 10 km deep. Eat it, Mars. #aas227 pic.twitter.com/blewwJaXEn Danny Barringer (@HeavyFe_H) January 5, 2016The mountains ringing the Sputnik Planum (aka the heart of Pluto) are over 4km high and are snow capped with methane icePlutos mountain ranges. Means surface nitrogen layer is thin, probably water ice according to @AlanStern. #aas227 pic.twitter.com/0yyHZvpBOE Danny Barringer (@HeavyFe_H) January 5, 2016Plutos atmosphere has a dozendistincthaze layers but how they arecreated is a mystery#aas227 hazes on Pluto wow pic.twitter.com/VPx99ZhPj1 Lisa StorrieLombardi (@lisajsl) January 5, 2016Alan also spoke about the future of New Horizons there is a new mission proposal for a fly by of a Kuiper Belt object 2014MU69 in Jan 2019 which should give us a better understanding of this icy frontier at the edge ofthe Solar System. As a parting gift Alan playedthemost gorgeously detailed fly over video of Plutos surface that had all in the room melting into their flip flops. Its safe to say that the whole room is now Pluto-curious and wondering whether a change of discipline is in order!Press Conference: Black Holes and Exoplanets (by Susanna Kohler)This morning marked the first press conference of the meeting

  9. Transcriptional Auto-Regulation of RUNX1 P1 Promoter

    Science.gov (United States)

    Martinez, Milka; Hinojosa, Marcela; Trombly, Daniel; Morin, Violeta; Stein, Janet; Stein, Gary; Javed, Amjad; Gutierrez, Soraya E.

    2016-01-01

    RUNX1 a member of the family of runt related transcription factors (RUNX), is essential for hematopoiesis. The expression of RUNX1 gene is controlled by two promoters; the distal P1 promoter and the proximal P2 promoter. Several isoforms of RUNX1 mRNA are generated through the use of both promoters and alternative splicing. These isoforms not only differs in their temporal expression pattern but also exhibit differences in tissue specificity. The RUNX1 isoforms derived from P2 are expressed in a variety of tissues, but expression of P1-derived isoform is restricted to cells of hematopoietic lineage. However, the control of hematopoietic-cell specific expression is poorly understood. Here we report regulation of P1-derived RUNX1 mRNA by RUNX1 protein. In silico analysis of P1 promoter revealed presence of two evolutionary conserved RUNX motifs, 0.6kb upstream of the transcription start site, and three RUNX motifs within 170bp of the 5’UTR. Transcriptional contribution of these RUNX motifs was studied in myeloid and T-cells. RUNX1 genomic fragment containing all sites show very low basal activity in both cell types. Mutation or deletion of RUNX motifs in the UTR enhances basal activity of the RUNX1 promoter. Chromatin immunoprecipitation revealed that RUNX1 protein is recruited to these sites. Overexpression of RUNX1 in non-hematopoietic cells results in a dose dependent activation of the RUNX1 P1 promoter. We also demonstrate that RUNX1 protein regulates transcription of endogenous RUNX1 mRNA in T-cell. Finally we show that SCL transcription factor is recruited to regions containing RUNX motifs in the promoter and the UTR and regulates activity of the RUNX1 P1 promoter in vitro. Thus, multiple lines of evidence show that RUNX1 protein regulates its own gene transcription. PMID:26901859

  10. Transcriptional Auto-Regulation of RUNX1 P1 Promoter.

    Directory of Open Access Journals (Sweden)

    Milka Martinez

    Full Text Available RUNX1 a member of the family of runt related transcription factors (RUNX, is essential for hematopoiesis. The expression of RUNX1 gene is controlled by two promoters; the distal P1 promoter and the proximal P2 promoter. Several isoforms of RUNX1 mRNA are generated through the use of both promoters and alternative splicing. These isoforms not only differs in their temporal expression pattern but also exhibit differences in tissue specificity. The RUNX1 isoforms derived from P2 are expressed in a variety of tissues, but expression of P1-derived isoform is restricted to cells of hematopoietic lineage. However, the control of hematopoietic-cell specific expression is poorly understood. Here we report regulation of P1-derived RUNX1 mRNA by RUNX1 protein. In silico analysis of P1 promoter revealed presence of two evolutionary conserved RUNX motifs, 0.6kb upstream of the transcription start site, and three RUNX motifs within 170bp of the 5'UTR. Transcriptional contribution of these RUNX motifs was studied in myeloid and T-cells. RUNX1 genomic fragment containing all sites show very low basal activity in both cell types. Mutation or deletion of RUNX motifs in the UTR enhances basal activity of the RUNX1 promoter. Chromatin immunoprecipitation revealed that RUNX1 protein is recruited to these sites. Overexpression of RUNX1 in non-hematopoietic cells results in a dose dependent activation of the RUNX1 P1 promoter. We also demonstrate that RUNX1 protein regulates transcription of endogenous RUNX1 mRNA in T-cell. Finally we show that SCL transcription factor is recruited to regions containing RUNX motifs in the promoter and the UTR and regulates activity of the RUNX1 P1 promoter in vitro. Thus, multiple lines of evidence show that RUNX1 protein regulates its own gene transcription.

  11. (H1N1) Influenza in Saurashtra, India

    African Journals Online (AJOL)

    of India had issued guidelines regarding the segregation of. A (H1N1) influenza cases to facilitate laboratory testing, isolation, hospitalization, treatment with specific antiviral medicine. The guideline described three categories namely: (1) Category‑A, (2) Category‑B 1 and 2, (3) Category‑C.[12]. Patients of category A and B ...

  12. Tanzania Dental Journal - Vol 1, No 1 (1984)

    African Journals Online (AJOL)

    Tanzania Dental Journal - Vol 1, No 1 (1984). Journal Home > Archives > Vol 1, No 1 (1984). Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. DOWNLOAD FULL TEXT ...

  13. 26 CFR 1.1301-1 - Averaging of farm income.

    Science.gov (United States)

    2010-04-01

    ... January 1, 2003, rental income based on a share of a tenant's production determined under an unwritten... the Collection of Income Tax at Source on Wages (Federal income tax withholding), or the amount of net... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Averaging of farm income. 1.1301-1 Section 1...

  14. 26 CFR 1.514(g)-1 - Business lease indebtedness.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Business lease indebtedness. 1.514(g)-1 Section 1... Business lease indebtedness. (a) Definition. The term business lease indebtedness means, with respect to... amount of: (1) The indebtedness incurred by the lessor tax-exempt organization in acquiring or improving...

  15. HTML+RDFa 1.1, W3C Recommendation

    NARCIS (Netherlands)

    M. Sporny (Manu); S. McCarron (Shane); B. Adida (Ben); M. Birbeck (Mark); G. Kellogg (Gregg); I. Herman (Ivan); S. Pemberton (Steven)

    2013-01-01

    textabstractThis specification defines rules and guidelines for adapting the RDFa Core 1.1 and RDFa Lite 1.1 specifications for use in HTML5 and XHTML5. The rules defined in this specification not only apply to HTML5 documents in non-XML and XML mode, but also to HTML4 and XHTML documents

  16. Effect of 1-methylcyclopropene (1- MCP) treatment on antioxidant ...

    African Journals Online (AJOL)

    ajl2

    2013-02-13

    Feb 13, 2013 ... phospholipid catabolism in ripe watermelon (Citrullus lanatus) fruit: induction by ethylene and prophylactic effects of 1- methylcyclopropene. Postharvest Biol. Technol. 33:1-9. Massolo JF, Concellón A, Chaves AR, Vicente AR (2011). 1-. Methylcyclopropene (1-MCP) delays senescence, maintains quality.

  17. 26 CFR 1.613-1 - Percentage depletion; general rule.

    Science.gov (United States)

    2010-04-01

    ... TAX (CONTINUED) INCOME TAXES (CONTINUED) Natural Resources § 1.613-1 Percentage depletion; general rule. (a) In general. In the case of a taxpayer computing the deduction for depletion under section 611... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Percentage depletion; general rule. 1.613-1...

  18. Ghana Journal of Linguistics - Vol 1, No 1 (2012)

    African Journals Online (AJOL)

    Ghana Journal of Linguistics - Vol 1, No 1 (2012). Journal Home > Archives > Vol 1, No 1 (2012). Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. DOWNLOAD FULL TEXT ...

  19. 1,3- and 1,4-Substituted tetrazolium salts

    International Nuclear Information System (INIS)

    Voitekhovich, Sergei V; Gaponik, Pavel N; Ivashkevich, Oleg A

    2002-01-01

    The published data on the synthesis, physicochemical properties, structures and reactions of 1,3-(1,3,5)- and 1,4-(1,4,5)-substituted tetrazolium salts are systematised and generalised. Their applications as starting compounds in the preparative chemistry of heterocyclic derivatives and some other branches of science and technology are reviewed. The bibliography includes 122 references.

  20. 26 CFR 1.527-1 - Political organizations; generally.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Political organizations; generally. 1.527-1... TAX (CONTINUED) INCOME TAXES (CONTINUED) Farmers' Cooperatives § 1.527-1 Political organizations; generally. Section 527 provides that a political organization is considered an organization exempt from...