WorldWideScience

Sample records for basf-industriekernkraftwerk reaktor 1

  1. DESAIN KONSEPTUAL PERISAI RADIASI REAKTOR RRI-50

    Directory of Open Access Journals (Sweden)

    Amir Hamzah

    2015-06-01

    Full Text Available ABSTRAK DESAIN KONSEPTUAL PERISAI RADIASI REAKTOR RRI-50. Salah satu parameter yang harus dipenuhi dalam mendesain reaktor nuklir adalah desain perisai radiasi yang dapat menjamin keamanan dan keselamatan radiasi bagi pekerja dan masyarakat sekitar. Pada penelitian ini dilakukan desain perisai radiasi RRI-50 dengan elemen bakar berjenis U9Mo-Al berkerapatan tinggi dengan tipe pelat sebanyak 21 buah dan berdimensi seperti elemen bakar RSG-GAS tapi panjang aktifnya 70 cm. Konfigurasi teras terdiri dari 16 elemen bakar dan 4 elemen kendali serta 5 posisi iradiasi sehingga membentuk matriks 5 x 5. Tujuan dari penelitian ini adalah mendesain perisai radiasi dan menentukan distribusi laju dosis di daerah kerja dan di lingkungan reaktor RRI-50. Tahapan awal penelitian adalah perhitungan kuat sumber dan inventori bahan radioaktif teras reaktor dengan mensimulasikan operasi 50 MW selama 20 hari tiap siklus menggunakan program ORGEN2.1. Berdasarkan kuat sumber tersebut dan model yang dibuat menggunakan program VisEd, maka dilakukan analisis penentuan parameter perisai radiasi secara iteratif menggunakan program MCNPX. Pada tahap akhir, dilakukan analisis distribusi laju dosis di seluruh ruang di dalam dan di luar gedung reaktor juga menggunakan program MCNPX. Hasil yang diperoleh menunjukkan bahwa ketinggian permukaan air adalah 1000 cm dan kombinasi 90 cm beton berat dan 60 cm beton biasa dapat digunakan sebagai perisai biologi. Desain perisai tersebut mereduksi laju dosis menjadi 0,05 µSv/jam di Balai Operasi sementara di Balai Eksperimen dan di luar gedung reaktor menjadi 4,2 µSv/jam dan 0,03 µSv/jam pada saat reaktor beroperasi. Hasil penelitian juga menunjukkan pemasagan perisai tambahan setebal 280 cm berjarak 300 cm di depan tabung berkas neutron radial yang terbuka mereduksi laju dosis gamma dan neutron menjadi 3,3 µSv/jam dan 3,1x10-11 µSv/jam. Hasil-hasil penelitian ini menunjukkan bahwa desain perisai radiasi yang dibuat membuat reaktor

  2. OPTIMASI DESAIN TERMOHIDROLIKA TERAS DAN SISTEM PENDINGIN REAKTOR RISET INOVATIF DAYA TINGGI

    Directory of Open Access Journals (Sweden)

    Endiah Puji Hastuti

    2015-10-01

    Full Text Available ABSTRAK OPTIMASI DESAIN TERMOHIDROLIKA TERAS DAN SISTEM PENDINGIN REAKTOR RISET INOVATIF DAYA TINGGI. Implementasi reaktor inovasi telah diterapkan pada berbagai reaktor riset baru yang saat ini sedang dibangun.  Pada saat ini BATAN sedang merancang desain konseptual reaktor riset daya tinggi yang telah masuk pada tahap optimasi desain. Spesifikasi desain konseptual reaktor riset inovatif adalah reaktor tipe kolam berpendingin air dan reflektor D2O. Teras reaktor memiliki kisi 5x5 dengan 16 bahan bakar dan 4 batang kendali. Teras reaktor berada di dalam tabung berisi D2O yang berfungsi sebagai posisi iradiasi. Daya reaktor 50 MW didesain untuk membangkitkan fluks neutron termal sebesar 5x1014 n/cm2s. Teras reaktor berbentuk kompak dan menggunakan bahan bakar U9Mo-Al dengan tingkat muat uranium 7-9 gU/cm3. Desain termohidrolika yang mencakup pemodelan, perhitungan dan analisis kecukupan pendingin dibuat sinergi dengan desain fisika teras agar keselamatan reaktor terjamin. Makalah ini bertujuan menyampaikan hasil analisis perhitungan termohidrolika teras dan sistem reaktor riset inovatif pada kondisi tunak. Analisis dilakukan menggunakan program perhitungan yang telah tervalidasi, masing-masing adalah Caudvap, PARET-ANL, Fluent dan ChemCad 6.4.1. Hasil perhitungan menunjukkan bahwa pembangkitan panas yang tinggi dapat dipindahkan tanpa menyebabkan pendidihan dengan menerapkan desain teras reaktor bertekanan, di samping itu desain awal komponen utama sistem pembuangan panas yang terintegrasi telah dilakukan, sehingga konseptual desain termohidrolika RRI-50 dapat diselesaikan. Kata kunci : reaktor riset inovatif, Caudvap, PARET-ANL, Fluent, ChemCad 6.4.1.   ABSTRACT THERMALHYDRAULIC DESIGN AND COOLING SYSTEM OPTIMIZATION OF THE HIGH POWER INOVATIVE RESEARCH REACTOR. Reactor innovation has been implemented in a variety of new research reactors that currently are being built. At this time BATAN is designing a conceptual design of the high power

  3. DESAIN KONSEPTUAL TERAS REAKTOR RISET INOVATIF BERBAHAN BAKAR URANIUM MOLIBDENUM DARI ASPEK NEUTRONIK

    Directory of Open Access Journals (Sweden)

    Tukiran Surbakti

    2015-03-01

    Full Text Available Manfaat yang luas dari penggunaan reaktor riset membuat banyak negara membangun reaktor riset baru. Kecenderungan saat ini adalah reaktor tipe reaktor serbaguna (MPR dengan teras yang kompak untuk mendapatkan fluks neutron yang tinggi dengan daya yang relatif sedang atau rendah. Reaktor riset yang ada di Indonesia yang paling muda usianya sudah berumur 25 tahun. Oleh karena itu diperlukan desain reaktor riset baru sebagai alternatif, disebut reaktor riset inovatif (RRI, kelak pengganti reaktor riset yang sudah ada. Tujuan dari riset ini mendapatkan konfigurasi teras setimbang reaktor riset yang optimal dengan kriteria memiliki fluks neutron termal minimum sebesar 2,5x1014 n/cm2 s pada daya 20 MW (minimum, memiliki panjang operasi satu siklus lebih dari 40 hari dan penggunaan bahan bakar yang paling efisien. Desain neutronik dilakukan untuk bahan bakar baru U-9Mo-Al dengan kerapatan bervariasi dan jenis reflektor yang bervariasi. Desain dilakukan dengan paket program WIMSD-5B dan BATAN-FUEL. Hasil desain konseptual menyajikan 4 konfigurasi teras yaitu 5×5, 5×7, 6×5 dan 6×6. Hasil optimasi menunjukkan bahwa teras setimbang reaktor RRI dengan konfigurasi 5×5, tingkat muat 235U sebesar 450 g, reflektor berilium, fluks neutron termal maksimum di daerah reflektor sebesar 3,33×1014 neutron cm-2s-1 dan panjang siklus 57 hari merupakan desain teras reaktor riset inovatif yang paling optimal. Kata kunci: desain konseptual, bahan bakar uranium-molibdenum,berilium, D2O, WIMS, BATAN-FUEL   The multipurpose of research reactor utilization make many countries build the new research reactor. Trend of this reactor for this moment is multipurpose reactor type with a compact core to get high neutron flux at the low or medium level of power. The research newest reactor in Indonesia right now is already 25 year old. Therefore, it is needed to design a new research reactor, called innovative research reactor (IRR and then as an alternative to replace the old

  4. DESAIN TERAS ALTERNATIF UNTUK REAKTOR RISET INOVATIF (RRI DARI ASPEK NEUTRONIK

    Directory of Open Access Journals (Sweden)

    Iman Kuntoro

    2015-03-01

    Full Text Available Berdasarkan dokumen kriteria pengguna dan fungsi utamanya, Reaktor Riset Inovatif (RRI dipersyaratkan dapat menghasilkan fluks neutron termal maksimum 1×1015 neutron cm-2s-1. Hal ini diperlukan agar reaktor RRI dapat digunakan untuk target yang membutuhkan fluks neutron tinggi. Dalam penelitian sebelumnya diperoleh bahwa desain reaktor RRI tidak mungkin menghasilkan fluks neutron tersebut jika menggunakan bahan bakar seperti yang digunakan reaktor RSG-GAS. Hal ini diduga karena dimensinya terlalu besar, mengingat fluks neutron berbanding terbalik dengan volume teras. Tujuan penelitaian ini adalah untuk mendapatkan desain teras alternatif reaktor RRI yang memenuhi persyaratan fluks neutron termal tersebut. Alternatif bahan bakar yang dipilih adalah yang dipakai di reaktor JMTR (Japan Material Testing Reactor yang berdimensi lebih kecil dibanding reaktor RSG-GAS. Disamping itu tinggi aktif teras divariasi 70 cm dan 75 cm. Desain teras dilakukan dengan perangkat analaitik WIMS-D5B, Batan-FUEL dan Batan-3DIFF. Teras alternatif menggunakan konsep konfigurasi teras kompak 5×5 dengan 4 elemen kendali jenis follower. Berdasarkan hasil perhitungan ada 3 (tiga teras alternatif yang dapat memenuhi persyaratan tersebut, termasuk teras menggunakan bahan bakar reaktor RSG-GAS dengan menambah tinggi aktifnya menjadi 70 cm dari 60 cm. Dengan menganalisis seluruh aspek, keselamatan serta efisiensi dan efektivitas reaktor, maka teras alternatif dengan bahan bakar tipe JMTR dengan tinggi aktif 70 cm merupakan teras alternatif yang terbaik. Kata kunci: neutronik, teras kompak, reaktor riset inovatif, fluks neutron termal tinggi   Based on its User Requirement Document and main function, RRI shall be able to provide a maximum thermal neutron flux of 1×1015 neutron cm-2s-1. The reason is that the RRI reactor can serve targets requiring a high neutron flux. From the previous results it was obtained that RRI design using fuel of RSG-GAS type was not possible to

  5. ANALISIS KECELAKAAN REAKTOR AKIBAT KEGAGALAN SISTEM PEMBUANG PANAS PADA REAKTOR NUKLIR GENERASI IV

    Directory of Open Access Journals (Sweden)

    A. G. Abdullah

    2012-05-01

    Full Text Available Salah satu aspek terpenting dalam proses desain reaktor nuklir adalah aspek keselamatan reaktor. Sebelum membangun reaktor secara fisik, terlebih dahulu dibuat perencaaan perhitungan yang matang termasuk melakukan simulasi kinerja keselamatannya dalam menghadapi kemungkinan kecelakaan. Penelitian ini bertujuan untuk mengembangkan model simulasi kecelakaan Pembangkit Listrik Tenaga Nuklir (PLTN yang disebabkan  gagalnya sistem pembuang panas. Kecelakaan akibat gagalnya sistem pembuang panas dipicu oleh hilangnya kemampuan pendinginan dari pembangkit uap. Urutan kecelakaan ini diawali dengan hilangnya kemampuan reaktor untuk membuang panas dari loop pendingin sekunder. Selama kecelakaan, laju pembuangan panas mengalami penurunan sedangkan temperatur masukan pendingin mengalami peningkatan. Hasil simulasi memberikan gambaran bahwa reaktor dapat bertahan dari kecelakaan. Hasil analisis kecelakaan menunjukkan bahwa temperatur maksimum bahan bakar, selongsong dan pendingin memiliki batas keselamatan yang sangat besar.One of the most important aspects in nuclear reactor design process is the safety aspect. Advanced and accurate safety simulation must be performed before it can be built.  This research aims to develop a simulation model of Nuclear Power Plant (NPP accidents due to the loss of  heat sink system. Loss of heat sink accident was triggered by the loss of cooling capability of steam generators.  This  accident  sequence  began with the loss of the reactor’s ability to remove heat from the secondary cooling loop. During the accident, the heat dissipation rate decreased whereas the coolant inlet temperatures increased till a new equilibrium level. The analysis results of the accident showed that there are large safety margin to the maximum temperature of the fuel, cladding, and coolant.

  6. Fire modeling of the Heiss Dampf Reaktor containment

    Energy Technology Data Exchange (ETDEWEB)

    Nicolette, V.F. [Sandia National Labs., Albuquerque, NM (United States); Yang, K.T. [Notre Dame Univ., IN (United States)

    1995-09-01

    This report summarizes Sandia National Laboratories` participation in the fire modeling activities for the German Heiss Dampf Reaktor (HDR) containment building, under the sponsorship of the United States Nuclear Regulatory Commission. The purpose of this report is twofold: (1) to summarize Sandia`s participation in the HDR fire modeling efforts and (2) to summarize the results of the international fire modeling community involved in modeling the HDR fire tests. Additional comments, on the state of fire modeling and trends in the international fire modeling community are also included. It is noted that, although the trend internationally in fire modeling is toward the development of the more complex fire field models, each type of fire model has something to contribute to the understanding of fires in nuclear power plants.

  7. ANALISIS LAJU DOSIS NEUTRON REAKTOR PLTN PWR 1000 MWe MENGGUNAKAN PROGRAM MCNP

    Directory of Open Access Journals (Sweden)

    Amir Hamzah

    2015-03-01

    Full Text Available Dalam rangka menyongsong PLTN pertama di Indonesia, dilakukan kajian dan analisis berbagai aspek teknologi reaktor tersebut. Tujuan dari penelitian ini adalah menentukan laju dosis neutron di luar perisai biologik reaktor PLTN PWR 1000 MWe yang merupakan bagian dari kegiatan besar di atas. Data hasil analisis laju dosis radiasi pada posisi tertentu sangat dibutuhkan untuk menunjukkan tingkat paparan radiasi di posisi tersebut. Analisis laju dosis neutron ditentukan berdasarkan hasil analisis fluks dan spektrum neutron. Analisis fluks dan spektrum neutron di teras reaktor daya PWR 1000 Mwe dilakukan menggunakan program MCNP. Model perhitungan yang dilakukan meliputi 9 zona material yaitu, teras, air, selimut, air, tong, air, bejana tekan, beton dan lapisan udara luar. Penentuan distribusi fluks dan spektrum neutron dilakukan ke arah radial hingga di luar perisai beton dengan akurasi antara 10% hingga 30% dalam tiap kelompok energi yang jumlahnya 1 dan 50 kelompok. Hasil analisis laju dosis neutron di permukaan perisai biologik reaktor PLTN PWR 1000 MWe pada kondisi reaktor beroperasi daya penuh sudah di bawah nilai batas keselamatan. Maka dapat disimpulkan bahwa dari segi paparan radiasi neutron, penggunaan perisai radiasi beton setebal dua meter sudah memenuhi persyaratan keselamatan. Kata kunci: PLTN PWR, fluks neutron, perisai, laju dosis neutron, MCNP.   In order to meet the first nuclear power plant in Indonesia, it has been conducted a study and analysis of various aspects of reactor technology. The purpose of this study was to determine the neutron dose rates at the outside of biological shield of NPP PWR 1000 MWe reactor that is a part of the activities described above. The analysis data of radiation dose rate at a specific position is needed to show the level of radiation exposure in those positions. Analysis neutron dose rate is determined based on the results of the analysis of neutron flux. Analysis of flux and neutron spectrum in

  8. ANALISIS SEBARAN RADIONUKLIDA PADA KONDISI NORMAL UNTUK REAKTOR AEC 1000 MW

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2015-03-01

    Full Text Available Telah dilakukan analisis sebaran radionuklida pada reaktor daya Atomic Energy Agency (AEC 3568 MWTh, setara dengan 1000 Mwe untuk kondisi operasi normal. Analisis dilakukan untuk dua reaktor yang terpisah sejauh 500 m dan sudut 90o satu dengan yang lain. Langkah awal dalam melakukan analisis adalah menentukan suku sumber reaktor menggunakan program komputer ORIGEN2 dan EMERALD NORMAL. ORIGEN2 digunakan untuk menentukan inventori radionuklida yang terdapat di reaktor. Selanjutnya dengan dengan menggunakan program EMERALD NORMAL dihitung suku sumber yang sampai ke cerobong reaktor. Untuk menganalisis dosis yang diterima penduduk dilakukan dengan menggunakan program PC-CREAM. Perhitungan dilakukan untuk satu dan dua PLTN di calon tapak PLTN. Hasil yang diperoleh adalah sebaran radionuklida terbesar untuk satu PLTN pada jarak 1 km dan kearah zona 9 (191,25o dan untuk dua PLTN pada jarak 1 km dan kearah zona 10 (213,75o. Radionuklida yang sampai ke penduduk melalui dua alur yaitu alur makanan dan hirupan. Untuk alur makanan berasal dari radionuklida I-131, dan terbesar melalui alur produk susu sebesar 53,40 % untuk satu maupun dua PLTN . Untuk alur hirupan ranionuklida pemberi kontribusi paparan terbesar berasal dari Kr-85m sebesar 53,80 %. Dosis total terbesar yang diterima penduduk terdapat pada jarak 1 Km untuk bayi yaitu sebesar 4,10 μSi dan 11,26 μSi untuk satu dan dua PLTN. Hasil ini sangat kecil dibandingkan dengan batas dosis yang diijinkan oleh badan pengawas (BAPETEN untuk penduduk yaitu sebesar 1 mSi. Kata Kunci : Reaktor daya, komputer code, radionuklida, alur makanan, hirupan   Analysis for radionuclide dispersion for the Atomic Energy Agency (AEC 3568 MWth Power Reactor, equal to the 1000 MWe at normal condition has been done. Analysis was done for two piles that is separated by 500 m distance and angle of 90o one to other. Initial pace in doing the analysis is to determine reactors source term using ORIGEN2 and EMERALD NORMAL

  9. REAKTOR INNOVATIVE MOLTEN SALT (IMSR DENGAN SISTEM KESELAMATAN PASIF MENYELURUH

    Directory of Open Access Journals (Sweden)

    Andang Widiharto

    2015-04-01

    Full Text Available Pengembangan Teknologi Reaktor Nuklir pada masa mendatang mengarah pada peningkatan aspek keselamatan, peningkatan pendayagunaan bahan bakar, reduksi limbah radioaktif, ketahanan terhadap proliferasi bahan-bakar nuklir dan peningkatan aspek ekonomi. reaktor Innovative Molten Salt (IMSR adalah reaktor nuklir yang menggunakan bahan bakar cair berupa garam lebur fluoride (7LiF-ThF4-UF4-MaFx. Reaktor IMSR didesain sebagai reaktor pembiak termal, yaitu membiakkan U-233 dari Th-232. Hal ini untuk menjawab permasalahan sustainabilitas ketersedian sumber daya bahan bakar nuklir dan reduksi limbah radioaktif. Dalam aspek keselamatan, desain reaktor IMSR memiliki sifat inherent safe, yaitu koefisien umpan balik daya yang negatif serta memiliki fitur-fitur keselamatan pasif. Fitur-fitur keselamatan pasif terdiri dari sistem shutdown pasif, sistem pendinginan pasif pasca shutdown serta sistem pendinginan pasif untuk produk fisi. Kecelakaan yang berpotensi terjadi pada IMSR, yaitu kecelakaan kehilangan aliran bahan bakar, kecelakaan kehilangan aliran pendingin, kecelakaan kehilangan kemampuan pengambilan kalor serta kecelakaan kerusakan integritas sistem reaktor, dapat ditangani sepenuhnya secara pasif hingga mencapai kondisi shutdown selamat. Kata kunci: keselamatan pasif, inherent safe, IMSR   The next Nuclear Reactor Technology developments are directed to the increasing of the aspects of safety, fuel utility, radioactive waste reduction, proliferation retention and economy. Innovative Molten Salt Reactor (IMSR is a nuclear reactor design that uses fluoride molten salt (7LiF-ThF4-UF4-MaFx. IMSR is designed as a thermal breeder reactor, i.e. to produce U-233 from Th-232. This is the answer of natural nuclear fuel sustainability and radioactive waste problems. In term of safety aspect, IMSR design has inherent safe characteristics, i.e. negative power feedback coefficient, and passive safety features. The passive safety features are passive shutdown

  10. ANALISIS PENGENDALIAN DAYA REAKTOR PCMSR DENGAN LAJU ALIR PENDINGIN

    Directory of Open Access Journals (Sweden)

    Iqbal Syafin Noha

    2015-03-01

    Full Text Available Passive Compact Molten Salt Reactor (PCMSR merupakan pengembangan dari Molten Salt Reactor (MSR yang memiliki karakter berbeda dengan lima reaktor generasi IV lainnya, yaitu menggunakan bahan bakar leburan garam. Pada reaktor MSR, garam lebur tidak digunakan sebagai pendingin tetapi digunakan sebagai medium pembawa bahan bakar. Dengan fase bahan bakar yang berupa garam lebur LiF-BeF2-ThF4-UF4, maka dapat dilakukan pengendalian daya dengan mengatur laju aliran bahan bakar dan pendingin. Tujuan penelitian ini adalah untuk mengetahui pengaruh perubahan laju alir pendingin terhadap daya reaktor PCMSR. Analisis dilakukan dengan empat jenis masukan untuk perubahan laju alir pendingin, yaitu masukan step, ramp, eksponensial, dan sinusoidal. Untuk masukan step, laju alir pendingin dibuat berubah secara mendadak. Selanjutnya untuk masukan ramp dan eksponensal, perubahan laju alir masing-masing dibuat perlahan secara linear dan mengikuti fungsi eksponensial. Kemudian untuk masukan sinusoidal, laju alir berubah naik turun secara periodik dengan memvariasikan frekuensi dari perubahan laju alir tersebut. Hasil penelitian menunjukkan bahwa penurunan laju alir pendingin sebesar 50% dari laju pendingin sebelumnya, menyebabkan daya pada reaktor PCMSR turun sebesar 63% dari daya sebelumnya. Jika terjadi fluktuasi laju aliran pendingin, maka semakin cepat perubahan tersebut, maka respon daya yang diberikan semakin kecil. Pada frekuensi yang sangat cepat, daya reaktor menjadi konstan dan cenderung tidak memiliki respon terhadap laju aliran. Hal ini merupakan salah satu aspek keselamatan reaktor, karena reaktor tidak merespon perubahan yang terlalu cepat. Kemampuan reaktor mengatur daya menyesuaikan laju aliran pendingin merupakan aspek keselamatan lainnya. Kata kunci : PCMSR, pengendalian daya, laju alir pendingin, uji respon   Passive Compact Molten Salt Reactor (PCMSR is the development of Molten Salt Reactor (MSR which has different character from other five

  11. PENGARUH GEMPA PATAHAN LEMBANG TERHADAP FLEKSIBILITAS PIPA DAN KEGAGALAN NOZEL PERALATAN SISTEM PENDINGIN PRIMER REAKTOR TRIGA 2000 BANDUNG

    Directory of Open Access Journals (Sweden)

    H.P. Raharjo

    2012-02-01

    Full Text Available Gempa bumi di suatu instalasi nuklir dapat menyebabkan terjadinya kerusakan sistem peralatan karena adanya perubahan fleksibilitas pipa akibat beban berlebih pada sistem perpipaannya. Beban dari sistem perpipaan dapat membebani nozel peralatan seperti pompa, penukar panas, dll. Apabila beban tersebut terlalu besar dan melebihi beban yang diizinkan akan mengakibatkan kegagalan nozel peralatan. Penelitian ini menganalisis besarnya beban-beban yang terjadi di semua nozel  sistem pendingin primer Reaktor TRIGA 2000 Bandung. Analisis dilakukan dengan bantuan perangkat lunak Caesar II yang berbasis metode elemen hingga (finite element method. Acuan analisis yang digunakan adalah code ASME B31.1 yang mengatur tentang perancangan sistem perpipaan untuk sistem pembangkit daya (Power Piping. Hasil analisis menunjukkan bahwa gaya yang terjadi pada nozel masukan pompa arah aksial (FZ melebihi batas yang diijinkan. Oleh karena itu perlu dilakukan modifikasi terhadap jalur perpipaan sistem pendingin tersebut agar nozel tidak menerima gaya yang berlebih. Penyangga pipa titik(node 22 di jalur PriOut dilepas dan/atau dipindahkan pada nozel masukkan pompa. Perpipaan sistem pendingin primer reaktor TRIGA 2000 Bandung akan aman beroperasi jika terjadi gempa.yang berasal dari patahan Lembang Kata kunci : gempa bumi, patahan, perpipaan, reaktor, sistem pendingin

  12. ANALISIS DESAIN PROSES SISTEM PENDINGIN PADA REAKTOR RISET INOVATIF 50 MW

    Directory of Open Access Journals (Sweden)

    Sukmanto Dibyo

    2015-03-01

    Full Text Available Reaktor Riset Inovatif (RRI merupakan jenis MTR (Material Testing Reactor yang dipersiapkan ke depan sebagai desain reaktor baru. Daya RRI telah ditetapkan dari perhitungan neutronik dan termohidrolika teras yaitu 50 MW termal. Reaktor bertekanan 8 kgf/cm2 dan laju aliran massa pendingin primer 900 kg/s. Tantangan yang penting dalam menindak lanjuti desain reaktor ini adalah analisis desain pada sistem pendingin. Makalah ini bertujuan untuk menganalisis desain proses sistem pendingin utama reaktor RRI daya 50 MW (RRI-50 dengan menggunakan program Chemcad 6.1.4. Dalam analisis ini dilakukan perhitungan neraca massa dan energi (mass/energy balances pada sistem pendingin primer dan sekunder sebagai pendingin utama. Masing-masing sistem pendingin tersebut terdiri dari 2 jalur beroperasi secara paralel dan 1 jalur redundansi. Disamping itu untuk desain termal unit komponen telah dianalisis dengan program RELAP5, frenchcreek dan Metoda Analitik. Hasil analisis yang diperoleh adalah desain diagram sistem pendingin yang mencakup data parameter entalpi, temperatur, tekanan dan laju aliran massa pendingin untuk masing-masing jalur. Adapun hasil desain unit komponen utama pada RRI-50 adalah tangki tunda dengan volume 51,5 m3, 2 unit pompa sentrifugal dan 1 unit pompa cadangan pada pendingin primer daya 141 kW/pompa dan pendingin sekunder daya 206 kW/pompa, 2 unit penukar panas tipe shell-tube dengan koefisien termal overall 1377 W/m2.oC dan 4 unit menara pendingin yang mampu melepaskan panas ke udara dengan desain temperatur approach 5,0 oC dan temperatur range 9,0 oC. Desain sistem pendingin reaktor RRI-50 ini telah menetapkan parameter operasi sistem pendingin yaitu temperatur, tekanan dan laju aliran massa pendingin dengan mempertimbangkan tuntutan aspek keselamatan teras reaktor sehingga desain temperatur maksimum pendingin masuk ke teras 44,5 oC. Kata kunci : RRI 50 MW, desain sistem pendingin, program Chemcad 6.1.4   Innovative Research Reactor RRI

  13. PENGARUH DAYA DAN DURASI OPERASI REAKTOR TERHADAP KONSENTRASI 3H DAN 14C DI AIR SISTEM PENDINGIN PRIMER REAKTOR RSG-GAS

    Directory of Open Access Journals (Sweden)

    Pande Made Udiyani

    2015-03-01

    Full Text Available Telah dilakukan penelitian terhadap pengaruh daya dan durasi operasi reaktor terhadap konsentrasi 3H dan 14C dalam air sistem pendingin primer reaktor RSG-GAS. Keberadaan nuklida 3H dan 14C di dalam air sistem pendingin primer reaktor RSG-GAS merupakan hasil produk fisi dan aktivasi. Nuklida radioaktif ini mempunyai potensi bahaya radiasi interna dan eksterna, karena mempunyai umur paro yang panjang yaitu 12,26 tahun untuk 3H dan 5568 tahun untuk 14C, sehingga mempunyai dampak radiologis yang sangat berarti. Analisis dan pengukuran contoh cuplikan air pendingin primer dilakukan dengan menggunakan alat LSC (Liquid Scintillation Counter. Tujuan dari penelitian ini adalah mengetahui pengaruh daya dan durasi operasi reaktor terhadap konsentrasi nuklida 3H dan 14C dalam air sistem pendingin primer, korelasi konsentrasi kedua nuklida dengan komponen sistem reaktor yang berkaitan dengan penuaan komponen, dan estimasi penerimaan radiasi terhadap pekerja radiasi di reaktor RSG-GAS dalam kaitan dengan keselamatan daerah kerja dan keselamatan personil. Hasil penelitian menunjukkan bahwa besarnya konsentrasi 3H dan 14C di air sistem pendingin primer reaktor RSG-GAS sebanding dengan daya yang dibangkitkan dan durasi operasi reaktor. Pertambahan konsentrasi 3H dan 14C di kolam reaktor RSG-GAS yang pesat setelah lima tahun pertama operasi reaktor diperkirakan karena intensitas pengoperasian reaktor yang tinggi, dan adanya proses akumulasi nuklida yang mempunyai umur paro yang panjang. Hasil penelitian ini dapat dimanfaatkan untuk mengkaji keselamatan operasi reaktor, keselamatan personil, keselamatan kerja, dan proses penuaan reaktor. Kata kunci : air pendingin primer, 3H, 14C, reaktor RSG-GAS   The influence of reactor power and operation duration on concentration of 3H and 14C in primary coolant water system RSG-GAS reactor has been studied. The existence of nuclides 3H and 14C in primary coolant system RSG-GAS reactor is a result of fission product and

  14. KINETIKA REAKSI OKSIDASI KATALITIK FERO SULFAT DARI LIMBAH BESI DALAM REAKTOR LULUHAN

    Directory of Open Access Journals (Sweden)

    Hary Sulistyo

    2012-02-01

    Full Text Available Limbah besi yang berupa serbuk direaksikan dengan asam sulfat membentuk larutan fero sulfat. Larutan fero sulfat dapat dioksidasi menjadi feri sulfat. Oksidasi dijalankan dalam reaktor drift pada tekanan dan suhu tetap. Percobaan dilakukan pada kisaran suhu 323K sampai 353K dan konsentrasi katalisator dari 1,7 sampai 6,7 g/L, waktu reaksi 150 menit pada tekanan atmosferis. Nilai konversi tertinggi fero sulfat menjadi feri sulfat yang diperoleh 39,5%. Nilai koefisien perpindahan massa gas ke cairan dan cairan ke permukaan padatan berturut-turut 37,18 cm/s dan 180 cm/s. Hubungan antara konstante kecepatan reaksi permukaan dengan suhu dapat dinyatakan dalam bentuk persamaan Arrhenius, k = 2,8092x107exp(-8794/RT. Hasil penelitian yang diperoleh sesuai dengan data di pustaka dan kinetika reaksi ditentukan oleh gabungan antara perpindahan massa gas ke cairan dan reaksi pada permukaan katalisator. 

  15. STUDI DESAIN DOWN SCALE TERAS REAKTOR DAN BAHAN BAKAR PLTN JENIS PEBBLE BED MODULAR REACTOR – HTR 100 MWe

    Directory of Open Access Journals (Sweden)

    Slamet Parmanto

    2015-04-01

    Full Text Available Telah dilakukan penelitian terhadap teras reaktor Pebble Bed Modular Reactor (PBMR dengan daya 100 Mwe berbahan bakar UO2. Reaktor ini menggunakan moderator grafit dan helium sebagai pendingin. Studi down scale dilakukan tanpa mengubah geometri teras maupun geometri bahan bakar. Parameter yang dianalisis adalah kritikalitas teras, reaktivitas lebih, koefisien reaktivitas temperatur bahan bakar, moderator dan pendingin serta nilai ekonomis bahan bakar. Dari penelitian ini diharapkan diperoleh desain bahan bakar yang bernilai ekonomis dan memiliki fitur keselamatan melekat. Penelitian dilakukan dengan menggunakan program SRAC 2003. Hasil yang diperoleh adalah desain bahan bakar UO2 berbentuk pebble dengan pengkayaan 10% U235 dan 90 ppm racun dapat bakar Gd2O3. Nilai faktor multipilkasi effektif keff pada beginning of life (BOL adalah 1,01115 dan menjadi 1,00588 setelah 2658 hari operasi reaktor (EOL. Koefisien reaktivitas temperatur total diperoleh sebesar - 3,25900E-05 ∆k/k/K saat BOL dan -1,10615E-04 ∆k/k/K saat end of life (EOL. Reaktor ini memenuhi karakteristik keselamatan melekat ditandai dengan nilai koefisien reaktivitas temperatur yang negatif. Kata kunci: PBMR, desain bahan bakar, faktor multipilkasi effektif, reaktivitas lebih, koefisien reaktivitas temperatur.   Research of Pebble Bed Modular Reactor (PBMR 100 MWe which used UO2 fuel has been done. This reactor uses graphite as moderator and helium as coolant. Down scale studies performed without changing the core and fuel geometry. The parameter being analyzed were core criticality, excess reactivity, fuel, moderator, coolant temperature reactivity coefficient, and fuel economy. This research is expected to obtain the design that has fuel economy and inherent safety features. In this research, we have employed SRAC 2003 code. The calculation show that the UO2 pebble fuel design with 10% enrichment of U235 and 90 ppm burnable poison of Gd2O3 results in the effective multiplication

  16. OPTIMASI GEOMETRI TERAS REAKTOR DAN KOMPOSISI BAHAN BAKAR BERBENTUK BOLA PADA DESAIN HIGH TEMPERATURE FAST REACTOR (HTFR

    Directory of Open Access Journals (Sweden)

    Agustina Mega

    2015-04-01

    Full Text Available Telah dilakukan desain High Temperature Fast Reactor (HTFR tipe pebble dengan bahan bakar uranium plutonium nitrida berpendingin Pb-Bi. Parameter yang dianalisis adalah kritikalitas teras, koefisien reaktivitas temperatur bahan bakar, koefisien reaktivitas void pendingin dan kemampuan breeding reaktor. Perhitungan dilakukan dengan paket program SRAC2K3. Dari penelitian ini diharapkan diperoleh desain teras berumur lama dan memiliki fitur keselamatan melekat. Dari penelitian ini diperoleh desain reaktor dengan diameter 520 cm dan tinggi 480 cm. Bahan bakar berbentuk pebble dengan 63 % UN-37 % PuN pada zona core dan 95,5 % UN-4,5 % PuN pada zona blanket. Reaktor tidak kritis setelah kurang lebih 800 hari dan keff pada BoL 1,078223 dan keff setelah 800 hari adalah 0,986379. Dari penelitian ini diperoleh koefisien reaktivitas temperatur bahan bakar sebesar -2,190014E-05 pada saat BoL dan -1,390773E-05 setelah 800 hari serta koefisien reaktivitas void pendingin sebesar -2,160402E-04/% void pada saat BoL dan setelah 800 hari sebesar -2,942364E-03/% void. Reaktor merupakan jenis fast breeder ditandai dengan naiknya densitas plutonium 239. Kata kunci : desain, teras, HTFR, keselamatan, umur, koefisien reaktivitas.   Design of pebble bed type High Temperature Fast Reactor (HTFR with uranium plutonium nitride fuel and Pb-Bi cooled has been done. The parameters being analyzed were core criticality, fuel temperature coefficient, void coefficient and reactor breeding ability. Calculation was done by using SRAC2K3 computer code. This research is expected to obtaine the design with long life core and inherent safety features. This research obtained core design with a diameter of 520 cm and 480 cm core high. Shaped pebble fuel bed with the 63 % UN-37 % PUN on core zone and 95.5 % UN-4.5 % Pu on blanket zone and keff value is 1.078223 with approximately 800 day of core life. The fuel temperature coefficient is -2.190014E-05 at BOL and is 1.390773E-05 at EOL and

  17. ANALISIS DISTRIBUSI KECEPATAN PENDINGIN DALAM ELEMEN BAKAR TIPE PELAT MENGGUNAKAN METODE CFD UNTUK REAKTOR RISET RSG-GAS

    Directory of Open Access Journals (Sweden)

    Muhammad Subekti

    2015-03-01

    Full Text Available Eksperimen pengukuran distribusi kecepatan pendingin dalam subkanal elemen bakar reaktor riset RSG-GAS sulit dilakukan karena lebar celah yang sangat kecil dan terletak di dalam elemen bakar. Oleh karena itu diperlukan perhitungan untuk memprediksi distribusi kecepatan pendingin dalam subkanal untuk mengkonfirmasi bahwa keberadaan handle tidak merusak distribusi kecepatan pendingin masuk ke dalam setiap subkanal. Perhitungan ini memerlukan metode CFD yang memperhatikan interior 3 dimensi. Perhitungan distribusi kecepatan pendingin dalam subkanal juga belum pernah dilakukan. Tujuan penelitian ini adalah melakukan investigasi distribusi kecepatan pendingin elemen bakar tipe pelat menggunakan metode CFD 3 dimensi untuk reaktor riset RSG-GAS. Penelitian ini juga sangat diperlukan sebagai bagian dari pengembangan desain termohidrolika elemen bakar untuk reaktor riset inovatif. Pemodelan menggunakan ½ model dalam perangkat lunak Gambit dan perhitungan menggunakan persamaan Turbulen dalam perangkat lunak FLUENT 6.3. Hasil perhitungan kecepatan pendingin tiga dimensi dalam subkanal menggunakan metode CFD lebih rendah sekitar 4,06% dari pada hasil perhitungan satu dimensi karena perhitungan satu dimensi mengabaikan keberadaan handle. Kata kunci: Aliran pendingin, elemen bakar, reaktor riset, kondisi tunak, CFD   The measurement experiment for coolant-velocity distribution in the subchannel of fuel element of RSG-GAS research reactor is difficult to be carried out due to too narrow channel and subchannel placed inside the fuel element. Hence, the calculation is required to predict the coolant-velocity distribution inside subchannel to confirm that the handle presence does not ruin the velocity distribution into every subchannel. This calculation utilizes CFD method, which respect to 3-dimension interior. Moreover, the calculation of coolant-velocity distribution inside subchannel was not ever carried out. The research object is to investigate the

  18. INVESTIGASI KARAKTERISTIK TERMOHIDROLIKA TERAS REAKTOR DAYA KECIL DENGAN PENDINGINAN SIRKULASI ALAM MENGGUNAKAN RELAP5

    Directory of Open Access Journals (Sweden)

    Susyadi Susyadi

    2016-02-01

    Full Text Available ABSTRAK INVESTIGASI KARAKTERISTIK TERMOHIDROLIKA TERAS REAKTOR DAYA KECIL DENGAN PENDINGINAN SIRKULASI ALAM MENGGUNAKAN RELAP5. Reaktor modular daya-kecil (small modular reactor, SMR memiliki prospek tinggi untuk dibangun di Indonesia. Keluaran dayanya yang relatif kecil dan disainnya yang kompak serta dapat dikonstruksi secara modular memberikan keunggulan fleksibilitas pembangunan yang lebih baik dibanding reaktor konvensional berdaya besar. Disain sistem reaktor kategori ini sangat bervariasi, salah satu diantaranya adalah jenis reaktor air tekan (pressurized water reactor, PWR yang menerapkan sirkulasi alamiah pada sistem pendingin primernya. Selain itu reaktor ini juga memiliki teras (core lebih pendek dibanding PWR konvensional. Dari kedua perbedaan tersebut maka terdapat kemungkinan perbedaan pola perpindahan panas yang dapat berimplikasi terhadap keselamatan secara keseluruhan. Oleh karena itu, pada penelitian ini dilakukan investigasi terhadap karakteristik termohidrolika teras reaktor tersebut khususnya karakteristik temperatur fluida dan bahan bakar serta laju alir fluidanya. Tujuannya adalah untuk mengetahui perbedaan marjin keselamatan temperatur teras reaktor bila dibanding dengan PWR konvensional. Investigasi dilakukan dengan menggunakan program RELAP5, dimana secara parsial teras reaktor dimodelkan menggunakan model-model generik yang ada pada program dan dilakukan beberapa perhitungan kondisi tunak. Hasil perhitungan menunjukkan bahwa saat beroperasi pada daya nominalnya, reaktor modular ini memiliki margin temperatur pendidihan sebesar 2K lebih baik dibanding reaktor konvensional. Selain itu, keunggulan marjin keselamatan reaktor modular daya-kecil ini juga ditunjukkan dari naiknya laju alir mengikuti kenaikan dayanya yang berarti memiliki sifat keselamatan yang melekat (inherent safety. Kata kunci: reaktor modular daya-kecil, PWR, sirkulasi alam, RELAP5, termohidrolika   ABSTRACT INVESTIGATION ON CORE THERMAL HYDRAULIC

  19. PENINGKATAN KINERJA SISTEM KESELAMATAN PASIF PADA REAKTOR NUKLIR DENGAN PENAMBAHAN KOMPONEN RVACS

    Directory of Open Access Journals (Sweden)

    A. G. Abdullah

    2014-07-01

    Full Text Available Kelengkapan sistem keselamatan pasif dan inheren pada reaktor lanjut merupakan prasyarat utama. Makalah ini mengeksplorasi hasil desain konseptual sistem pembuang sisa panas pada pusat listrik tenaga nuklir berjenis Very High-Temperature Reactor. Tujuan riset ini untuk merancang sistem pembuang sisa panas pusat listrik tenaga nuklir yang terdapat pada dinding reaktor. Studi kinerja Reactor Vessel Auxliary Cooling System (RVACS dilakukan pada dua jenis pendingin yaitu Timbal-Bismut dan Liquid Salt. Panas dari dinding reaktor dihapus melalui sirkulasi alamiah pada keadaan tunak. Analisis melibatkan sistem perpindahan panas secara radiasi, konduksi dan konveksi alami. Perhitungan perpindahan panas dilakukan pada elemen reaktor vessel, dinding luar guard vessel, dan pelat pemisah. Hasil analisis kecelakaan menunjukkan kedua jenis sistem pendingin reaktor dan sistem pasif sisa pembuangan panas cukup menghapus sisa panas hasil peluruhan dengan sirkulasi alami.ABSTRACTCompleteness of passive safety systems and inherent in advanced reactors is a major prerequisite. This paper explores the results of a conceptual design of the heat removal system at the nuclear power plant (NPP type Very High-Temperature Reactor. The purpose of this research was to design the reactor vessel auxiliary cooling system (RVACS of NPP located within the reactor walls. The RVACS performance study was conducted on two types of coolant: Lead-Bismuth and Liquid Salt. Heat was removed from the reactor vessel through the natural circulation in the steady state. Analyses of heat transfer systems involved radiation, conduction and natural convection. Heat transfer calculations were performed on the reactor vessel, guard vessel, and perforated plate. The results from the accident analysis showed that both types, the reactor coolant system and the passive residual heat removal system, adequately remove remaining heat of the decay by a natural circulation.

  20. VERIFIKASI PAKET PROGRAM MVP-II DAN SRAC2006 PADA KASUS TERAS REAKTOR VERA BENCHMARK.

    Directory of Open Access Journals (Sweden)

    Jati Susilo

    2015-03-01

    Full Text Available Dalam penelitian ini dilakukan verifikasi perhitungan benchmark VERA pada kasus Zero Power Physical Test (ZPPT teras reaktor Watts Bar 1. Reaktor tersebut merupakan jenis PWR kelas 1000 MWe yang didesain oleh Westinghouse, tersusun dari 193 perangkat bahan bakar 17×17 dengan 3 jenis pengkayaan UO2 yaitu 2,1wt%, 2,619wt% dan 3,1wt%. Perhitungan nilai k-eff dan distribusi faktor daya dilakukan pada siklus operasi pertama teras dengan kondisi beginning of cycle (BOC dan hot zero power (HZP. Posisi batang kendali dibedakan menjadi uncontrolled (semua batang kendali berada di luar teras, dan controlled (batang kendali Bank D didalam teras. Paket program komputer yang digunakan dalam perhitungan adalah MVP-II dan SRAC2006 modul CITATION dengan data pustaka tampang lintang ENDF/B-VII.0. Hasil perhitungan menunjukkan bahwa perbedaan nilai k-eff teras pada kondisi controlled dan uncontrolled antara referensi dengan MVP-II (-0,07% dan -0,014% dan SRAC2006 (0,92% dan 0,99% sangat kecil atau masih dibawah 1%. Perbedaan faktor daya maksimum teras pada kondisi controlled dan uncontrolled dengan referensi dengan MVP-II adalah 0,38% dan 1,53%, sedangkan dengan SRAC2006 adalah 1,13% dan -2,45%. Dapat dikatakan bahwa kedua paket program komputer menunjukkan hasil perhitungan yang sesuai dengan nilai referensi. Dalam hal penentuan kekritisan teras, maka hasil perhitungan MVP-II lebih konservatif dibandingkan dengan SRAC2006. Kata kunci : MVP-II, SRAC2006, PWR, VERA   In this research, verification calculation for VERA core physics benchmark on the Zero Power Physical Test (ZPPT of the nuclear reactor Watts Bar 1. The reactor is a 1000 MWe class of PWR designed by Westinghouse, arranged from 193 unit of 17×17 fuel assembly consisting 3 type enrichment of UO2 that are 2.1wt%, 2.619wt% and 3.1wt%. Core power factor distribution and k-eff calculation has been done for the first cycle operation of the core at beginning of cycle (BOC and hot zero power (HZP. In this

  1. Pengembangan Reaktor Fotokatalitik Rotating Drum untuk Pengolahan Air Limbah Industri Tekstil

    Directory of Open Access Journals (Sweden)

    Cholid Syahroni

    2015-11-01

    Full Text Available Reaksi oksidasi fotokatalitik memiliki potensi untuk mendegradasi senyawa organik hingga tingkat mineralisasi, sehingga tidak meninggalkan residu (sludge. Penelitian ini bertujuan membuat reaktor fotokatalitik rotating drum dan mengaplikasikan pada industri tekstil. Langkah percobaan meliputi pembuatan katalis TiO2 secara anodizing serta karakterisasi dengan XRD dan SEM, pembuatan reaktor fotokatalitik  rotating drum dan uji coba degradasi air limbah industri tekstil. Proses anodizing dilakukan dengan bias potensial sebesar 40 volt selama 2 jam menggunakan elektrolit etilen glikol yang mengandung amonium fluorida dan air. Uji karakterisasi secara XRD dan SEM menunjukkan bahwa struktur kristal TiO2 adalah anatase dengan ukuran kristalit 8–19 nm. Bentuk kristal nanotube, dengan diameter 30–110 nm. Hasil uji coba menunjukkan bahwa  degradasi secara fotokatalitik dengan penambahan H2O2 0,15% terhadap air limbah bisa menurunkan COD 72,12% dalam waktu 2 jam. 

  2. Penentuan Konversi CO Yang Menjadi Metanol Pada Metanol Reaktor Di PT. Kaltim Metanol Industri

    OpenAIRE

    Marduansyah, Muhammad

    2015-01-01

    Telah dilakukan penelitian tentang penentuan konversi CO yang menjadi metanol pada reaktor metanol, di PT. Kaltim Metanol Industri dimana dalam penelitian ini digunakan data laju alir dan komposisi gas yang didapat dari control room. Dari perhitungan yang dilakukan maka didapat hasil konversi CO pada tanggal 25 februari 2013 yaitu 74,93%. Selain itu juga didapat hasil data perhitungan yang sebelumnya telah dilakukan yaitu 61,21% pada 12 november 2012; 68,53% pada 13 april 2012; 66,89% pada 14...

  3. STUDI KARAKTERISTIK PEMBENTUKAN UAP DALAM PEMBANGKIT UAP HELIKAL PADA REAKTOR MODULAR DAYA KECIL

    Directory of Open Access Journals (Sweden)

    Susyadi Susyadi

    2015-06-01

    Full Text Available Reaktor modular daya kecil (SMR sangat cocok untuk  dibangun Indonesia, terutama pada lokasi-lokasi dengan kapasitas jaringan listrik yang rendah sehingga investigasi lebih jauh tentang reaktor ini sangat diperlukan. Umumnya SMR memiliki bentuk pembangkit uap yang kompak dan terintegrasi di dalam bejana tekan. Disain tersebut menyebabkan perbedaan pendekatan dalam memproduksi uap dibandingkan reaktor nuklir konvensional yang menggunakan pembangkit uap tabung-u terbalik. Oleh karena itu tujuan dari penelitian ini adalah untuk mengetahui karakteristik uap dan pola pembentukkannya di dalam pembangkit uap tipe helikal yang banyak digunakan oleh SMR. Metoda yang dipakai adalah dengan melakukan pemodelan dan perhitungan numerik menggunakan program RELAP5. Dalam pemodelan, aliran air umpan  bertekanan dan temperatur rendah dimasukkan ke dalam tabung helikal sementara aliran fluida bertekanan dan temperatur tinggi, yang mewakili pendingin sistem primer reaktor, berada di sisi luar tabung. Hasil perhitungan menunjukkan bahwa uap yang dihasilkan oleh pembangkit uap helikal bersifat lewat jenuh yakni sekitar 25 K di atas titik jenuhnya. Hal ini memberikan keunggulan komparatif dari segi disain dan operasional pada SMR dibanding reaktor konvensional karena uap lewat jenuh yang dihasilkan dapat mengurangi kerugian turbin dan sekaligus meningkatkan efisiensi termodinamika. Kata kunci: pembangkit uap helikal, SMR, PWR, uap lewat jenuh, RELAP5   Small modular reactor (SMR is very suitable to be deployed in Indonesia especially for locations having low electrical grid capacity, so  further investigation on the characteritic of this reactor is needed. In general SMR has a compact and integrated-to-vessel steam generator design. This design implies different approach in producing steam as compared to conventional nuclear power plant  having inverted u-tube steam generator. For that reason, this research is intended to investigate the steam characteristic and

  4. PERHITUNGAN SUHU ELEMEN BAKAR REAKTOR TRIGA 2000 DALAM TABUNG SIPPING TEST MENGGUNAKAN CFD

    Directory of Open Access Journals (Sweden)

    K.A. Sudjatmi

    2015-03-01

    Full Text Available Telah dihitung suhu elemen bakar pada perangkat sipping test reaktor TRIGA 2000 Bandung. Perhitungan perlu dilakukan untuk memastikan bahwa suhu elemen bakar masih dibawah atau pada batas suhu elemen bakar yang diizinkan pada saat reaktor beroperasi, sehingga dapat dipastikan bahwa pada pelaksanaan pengujian dengan menggunakan perangkat ini, suhu masih dalam batas keselamatan. Perhitungan dilakukan dengan membuat model tabung sipping test berisi elemen bakar yang dikelilingi oleh 9 buah elemen bakar, sesuai dengan posisi tabung sipping test di teras reaktor, dengan menggunakan GAMBIT. Dimensi model disesuaikan dengan dimensi tabung dan elemen bakar dalam teras reaktor TRIGA 2000 Bandung. Pengoperasian sipping test untuk tiap elemen bakar dilakukan selama 30 menit pada daya 300 kW. Perhitungan dilakukan dengan menggunakan perangkat lunak Computational Fluid Dynamics (CFD dan sebagai inputan disesuaikan dengan parameter reaktor TRIGA 2000. Simulasi dilakukan pada pengoperasian dari 30, 60, 90, 120 150, 180 sampai 210 menit. Hasil perhitungan menunjukan bahwa suhu pusat bahan bakar dalam tabung sipping test sebesar 236,06 oC, sedangkan suhu dinding elemen bakar adalah sebesar 87,58 oC. Suhu maksimum pusat bahan bakar reaktor TRIGA 2000 pada operasi normal adalah 650 oC, dan tidak diizinkan terjadinya pendidihan di dalam teras reaktor. Jadi dapat disimpulkan bahwa pengoperasian perangkat sipping test masih sangat aman karena suhu bahan bakar berada dibawah batasan suhu bahan bakar yang diizinkan pada kondisi operasi normal demikian juga suhu dinding elemen bakar masih dibawah suhu didih air. Kata kunci: sipping test, TRIGA, elemen bakar, CFD   It has been calculated the fuel element temperature in the sipping test of Bandung TRIGA 2000 reactor. The calculation needs to be done to ascertain that the fuel element temperatures are below or at the limit of the allowable temperature fuel elements during reactor operation, ensuring that the

  5. ANALISIS PENGARUH IRADIASI FLUENS NEUTRON CEPAT TERHADAP BERILIUM REFLEKTOR REAKTOR RSG-GAS

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2015-04-01

    Full Text Available Telah dilakukan analisis iradiasi fluens neutron cepat terhadap berilium reflektor reaktor RSG-GAS. Analisis dilakukan dengan cara melakukan pengukuran fluks neutron di posisi berilium elemen dan berilium blok yang berfungsi sebagai reflector. Selanjutnya dilakukan perhitungan untuk menentukan apakah ada pengaruh fluens neutron selama berilium berada di teras reaktor. Selain cara tersebut dilakukan pula visualisasi untuk memastikan ada tidaknya deformasi pada berilium akibat iradiasi. Hasil pengukuran fluks dan fluens neutron cepat maksimal pada daya 200 kW untuk berilium elemen posisi E-2 sebesar 2,30E+07 n/cm2s dan 4,19E+17 n/cm2, J-8 sebesar 3,70E+07 n/cm2s dan 6,74E+17 n/cm2. Hasil pengukutan pada posisi B-3 sebesar 2,19E+12 n/cm2s dan 3,99E+22 n/cm2, G-10 sebesar 2,12E+12 n/cm2s dan 3,86E+22 n/cm2, serta berilium blok posisi (5-6 sebesar 5,02E+07 n/cm2s dan 9,15E+17 n/cm2, (C-D sebesar 2,32E+07 n/cm2s dan 4,23E+17 n/cm2. Deformasi yang diperoleh untuk berilium elemen (∆L/L posisi E-2 sebesar 1,12E-08, J-8 sebesar 1,84E-08, B-3 sebesar 1,60E-03, posisi G-10 sebesar 1,55E-03, sedangkan pada berilium blok di posisi 5-6 sebesar 2,52E-08 dan C-D sebesar 1,13E-08. Dari hasil ini disimpulkan tidak terjadi deformasi pada berilium elemen dan berilium blok. Hasil ini dibuktikan pula dari pengamatan visual, dimana tidak terlihat adanya deformasi pada berilium tersebut. Kata kunci : fluks, fluens, berilium elemen, berilium blok   Analysis of influence fast neutron fluence irradiated to the RSG-GAS beryllium reflector have been done. Methods of analysis was carried out by measuring fluxs neutron in beryllium element and block positio that function as reflector. The calculation done for determination it is there any influence of neutron as long as beryllium in the core. Bisede that, visualization done to make sure it there is any deformation at beryllium as efect of irradiation. Fluxs and fluences of beryllium element measurement result in 200 k

  6. ANALISIS DAN PENGUKURAN PARAMETER REAKTOR KARTINI UNTUK PENERAPAN METODE K0-NAA

    Directory of Open Access Journals (Sweden)

    Sri Murniasih

    2015-03-01

    Full Text Available Metode k0-NAA merupakan metode analisis yang banyak digunakan dengan berbagai keunggulan. Dalam penerapan metode k0-NAA diperlukan nilai parameter reaktor (f dan α, maka tujuan penelitian ini adalah akan dilakukan pengukuran nilai parameter f dan α di fasilitas Lazy Susan reaktor Kartini. Metode yang digunakan meliputi metode Cd-ratio dan triple bare. Telah diukur nilai parameter tersebut pada tiga lubang iradiasi di fasilitas Lazy Susan. Diperoleh perbedaan hasil pengukuran nilai parameter yang signifikan pada setiap lubang iradiasi, nilai ƒ berkisar 13,713 - 22,128 dan α berkisar -0,060 – 0,068. Hasil pengukuran f dan α dengan metode Cd-ratio, memberikan nilai yang lebih stabil dibandingkan metode triple bare. Nilai f dan α yang diperoleh dapat dijadikan basis data pada penerapan metode k0-NAA untuk analisis sampel di laboratorium AAN – PSTA. Kata kunci: parameter reaktor, reaktor Kartini, k0-NAA, fluks neutron   The k0-NAA method is an analysis method that widely used by many of the advantages. In the application of k0-NAA method needed valuea of reactor parameters (f and α, then the purpose of the research would be conducted meaasurement parameter values f and α in the Lazy Susan Kartini reactor facilities. The methods used include Cd-ratio and triple bare methods. The parameter value has been measured in three channels in the irradiation facilities Lazy Susan. Differences of measurement results obtained parameter values are significant in each channel irradiation, the value of ƒ ranged from 13.713 to 22.128 and the value of α ranged from -0.060 – 0.068. The results of measurements for the f and α with the Cd-ratio method, providing more stable value than the triple bare method. The value of f and α obtained can be used a database for the application of k0-NAA method for sample analysis in the laboratory NAA – CAST. Keywords: reactor parameter, Kartini reactor, k0-NAA, neutron flux

  7. PERFORMA OKSIDASI METAN PADA REAKTOR KONTINYU DENGAN PENINGKATAN KETEBALAN LAPISAN BIOCOVER LANDFILL

    Directory of Open Access Journals (Sweden)

    Opy Kurniasari

    2013-11-01

    methane through the form of methanol metabolite. ABSTRAKPenanganan sampah kota di Indonesia pada umumnya dilakukan pada tempat pemrosesan akhir sampah (TPA, yang sebagian besar dilakukan dengan cara pengurugan (landfilling yang cenderung bersifat anaerob (tidak ada oksigen. Cara pengurugan ini biasanya dioperasikan lapis perlapis sehingga memungkinkan terjadinya proses anaerob. Pada kondisi ini dipastikan biogas, yaitu gas metana (CH4 dan CO2, akan muncul. Metana adalah gas rumah kaca dengan potensi pemanasan global lebih besar dari CO2, dan dapat mengabsorpsi radiasi infra merah 23 kali lebih efisien dari CO2 pada periode lebih dari 100 tahun. Salah satu cara yang dapat dilakukan untuk mengurangi gas metana dari landfill yang lepas ke alam adalah dengan mengoksidasinya dengan memanfaatkan material penutup landfill (biocover sebagai media mikroorganisma pengoksidasi metana. Aplikasi kompos sebagai material penutup landfill merupakan pendekatan dengan biaya rendah untuk mereduksi emisi gas dari landfill sehingga cocok untuk negara berkembang. Biocover yang digunakan pada penelitian ini adalah kompos landfill mining, yaitu kompos yang terdegradasi secara alami di landfill. Tujuan penelitian ini adalah mengevaluasi kemampuan biocover kompos landfill mining dalam mengoksidasi metana pada ketebalan lapisan tertentu dengan kondisi aliran kontinyu. Tiga buah reaktor kolom yang digunakan terbuat dari flexy glass berukuran tinggi 70 cm dan diameter 15 cm. Gas metana dialirkan dari bawah reaktor secara kontinyu dengan laju alir 5 ml/menit. Kolom diisi dengan biocover kompos landfill mining dengan ketebalan lapisan 5, 25, 35 dan 60 cm. Hasil percobaan menunjukkan bahwa semakin tebal lapisan biocover, semakin tinggi efisiensi oksidasi metana. Efisiensi oksidasi yang diperoleh pada setiap ketebalan lapisan 15, 25, 35 dan 60 cm adalah masing-masing 56,43%, 63,69%, 74,58% dan 80,03%, dengan laju oksidasi 0,287 mol m-2 d-1 dan fraksi oksidasi 97%. Hasil oksidasi yang diperoleh tersebut

  8. PENENTUAN KANDUNGAN UNSUR PADA INSTALASI PENGOLAHAN AIR LIMBAH (IPAL RSUP DR. SOERADJI TIRTONEGORO KLATEN DENGAN METODE ANALISIS AKTIVASI NEUTRON REAKTOR KARTINI

    Directory of Open Access Journals (Sweden)

    - Niati

    2012-01-01

    Full Text Available Limbah cair hasil aktivasi manusia misalnya di Rumah Sakit harus diolah terlebih dahulu sebelum dialirkan ke lingkungan. Pengolahan limbah cair ini dilakukan untuk mengantisipasi adanya suatu hal yang berbahaya atau tidak aman bagi lingkungan. Permasalahan yang dikaji adalah dengan mengetahui jenis unsur dan kadarnya apakah melebihi dari batas kadar baku mutu limbah dan air minum. Metode  Analisis Aktivasi Neutron (AAN untuk analisis kualitatif yaitu mengetahui jenis unsur dan analisis kuantitatif yaitu menghitung kadar dari jenis unsur tersebut. Sampel limbah cair diaktivasi menggunakan sumber neutron dari Reaktor Kartini, kemudian dicacah menggunakan Spektrometri-γ, barulah analisis kualitatif dan kuantitatif dapat dilakukan. Hasil penelitian sampel air sumur dan limbah cair RS secara kualitatif terdapat jenis unsur dengan waktu peluruhan pendek seperti : Fe, Cl, dan Al dan waktu peluruhan panjang terdapat jenis unsur Br dan Na. Secara kuantitatif untuk waktu peluruhan pendek dengan evaporasi kadar Cl antara (0,0849-3,01E-06 ppm, kadar Al antara (2,3197-3,9841E-07 ppm; tanpa evaporasi kadar Cl antara (0,65785-2,3197E-07 ppm, kadar Al antara (2,5113-2,7761E-09 ppm. Untuk waktu peluruhan panjang dengan evaporasi kadar Br antara (0,069846-1,9147E-04 ppm, kadar Na antara (0,8058-3,2544E-05 ppm; tanpa evaporasi kadar Br 5,031E-06 ppm, kadar Na antara (6,7857-8,3285E-07 ppm. Dari hasil penelitian tersebut dapat disimpulkan bahwa waktu peluruhan dan perbedaan perlakuan sampel mengakibatkan jenis unsur dan kadar unsur yang dihasilkan juga berbeda-beda. Berdasarkan penghitungan kadar jenis unsur dan setelah dibandingkan dengan kadar baku mutu limbah dan mutu air maka limbah cair RSUP Dr. Soeradji Tirtonegoro Klaten dalam batas aman apabila dibuang ke lingkungan dan air sumur tersebut juga aman untuk dikonsumsi. Kata kunci : Instalasi Pengolahan Air Limbah (IPAL, AAN, Reaktor Kartini

  9. Disain Sistem Pemantauan Lingkungan Untuk Evaluasi Lepasan Radionuklida dari Subsistem pada Kecelakaan Reaktor Daya PWR

    Directory of Open Access Journals (Sweden)

    Sri Kuntjoro

    2013-03-01

    Full Text Available PLTN. (Pembangkit Listrik Tenaga Nuklir sebagai sumber energi baru dipilih sebagai alternatif, karena memiliki berbagai kelebihan yaitu ramah lingkungan, pasokan bahan bakar yang tidak bergantung musim, serta harganya yang dapat bersaing dengan pembangkit listrik yang lain. Namun demikian, adanya keraguan sebagian masyarakat tentang keselamatan radiasi PLTN, maka pemerintah harus bisa meyakinkan tentang operasi PLTN yang aman dan selamat. Penelitian tentang disain sistem pemantauan lingkungan untuk evaluasi lepasan radionuklida dari subsistem reaktor dan lingkungan akibat terjadinya kecelakaan pada reaktor daya telah dilakukan. Penelitian dilakukan dengan melakukan perhitungan sebaran radionuklida ke subsistem dan lingkungan serta membuat sistim monitoring radiasi di lingkungan. Sistem monitoring lingkungan terdiri dari system pencacah radiasi, sistem peringatan dini, sistem pengukuran meteorologi, sistem GPS dan system GIS. Sistem pencacah radiasi digunakan untuk mencatat data radiasi, sistem pengukuran meteorologi digunakan untuk mencatat data arah dan kecepatan angin, sedangkan sistem GPS digunakan untuk menentukan data posisi pengukuran. Data tersebut kemudian dikirimkan ke system akuisisi data untuk ditransmisikan ke pusat kendali. Pengumpulan dan pengiriman data dilakukan melalui SMS menggunakan perangkat modem yang ditempatkan di ruang kendali. Ruang kendali menerima data dari berbagai tempat pengukuran. Dalam hal ini ruang kendali memiliki fungsi sebagai SMS gateway. Sistem ini dapat memvisualisasi untuk lokasi pengukuran yang berbeda. Selanjutnya, data posisi dan data radiasi diintegrasikan dengan peta digital. Integrasi sistem tersebut kemudian divisualisasikan dalam personal komputer. Untuk posisi pengukuran terlihat langsung di peta dan untuk data radiasi ditampilkan di monitor dengan tanda lingkaran merah atau hijau yang digunakan sebagai pemonitor batas aman radiasi. Bila tanda lingkaran berwarna merah maka akan menyalakan alarm di

  10. PEMODELAN KOLIMATOR DI RADIAL BEAM PORT REAKTOR KARTINI UNTUK BORON NEUTRON CAPTURE THERAPY

    Directory of Open Access Journals (Sweden)

    Bemby Yulio Vallenry

    2015-03-01

    Full Text Available Salah satu metode terapi kanker adalah Boron Neutron Capture Therapy (BNCT. BNCT memanfaatkan tangkapan neutron oleh 10B yang terendapkan pada sel kanker. Keunggulan BNCT dibandingkan dengan terapi radiasi lainnya adalah tingkat selektivitas yang tinggi karena tingkatannya adalah sel. Pada penelitian ini dilakukan pemodelan kolimator di radial beamport reaktor Kartini sebagai dasar pemilihan material dan manufature kolimator sebagai sumber neutron untuk BNCT. Pemodelan ini dilakukan dengan simulasi menggunakan perangkat lunak Monte Carlo N-Particle versi 5 (MCNP 5. MCNP 5 adalah suatu paket program untuk memodelkan sekaligus menghitung masalah transpor partikel dengan mengikuti sejarah hidup neutron semenjak lahir, bertranspor pada bahan hingga akhirnya hilang karena mengalami reaksi penyerapan atau keluar dari sistem. Pemodelan ini menggunakan variasi material dan ukurannya agar menghasilkan nilai dari tiap parameter-parameter yang sesuai dengan rekomendasi I International Atomic Energy Agency (IAEA untuk BNCT, yaitu fluks neutron epitermal (Фepi > 9 n.cm-2.s-1, rasio antara laju dosis neutron cepat dan fluks neutron epitermal (Ḋf/Фepi 0,7. Berdasarkan hasil optimasi dari pemodelan ini, material dan ukuran penyusun kolimator yang didapatkan yaitu 0,75 cm Ni sebagai dinding kolimator, 22 cm Al sebagai moderator dan 4,5 cm Bi sebagai perisai gamma. Keluaran berkas radiasi yang dihasilkan dari pemodelan kolimator radial beamport yaitu Фepi = 5,25 x 106 n.cm-2s-1, Ḋf/Фepi =1,17 x 10-13 Gy.cm2.n-1, Ḋγ/Фepi = 1,70 x 10-12 Gy.cm2.n-1, Фth/Фepi = 1,51 dan J/Фepi = 0,731. Berdasarkan penelitian ini, hasil optimasi 5 parameter sebagai persyaratan kolimator untuk BNCT yang keluar dari radial beam port tidak sepenuhnya memenuhi kriteria yang direkomendasikan oleh IAEA sehingga perlu dilakukan penelitian lebih lanjut agar tercapainya persyaratan IAEA. Kata kunci: BNCT, radial beamport, MCNP 5, kolimator   One of the cancer therapy methods is

  11. ANALISIS MODEL TERAS 3-DIMENSI UNTUK EVALUASI PARAMETER KRITIKALITAS REAKTOR PWR MAJU KELAS 1000 MW

    Directory of Open Access Journals (Sweden)

    Tagor Malem Sembiring

    2015-04-01

    Full Text Available Setelah kejadian Fukushima, penggunaan sistem keselamatan pasif menjadi persyaratan yang penting untuk PLTN. PLTN jenis PWR maju kelas 1000 yang didesain oleh Westinghouse, AP1000, memiliki fitur keselamatan pasif disamping sederhana dan modular. Sebelum memilih suatu PLTN, maka perlu dilakukan suatu evaluasi terhadap parameter desainnya. Salah satu parameter yang penting dalam keselamatan adalah kritikalitas teras. Permasalahan pokok dalam mengevaluasi parameter kritikalitas teras AP1000 tidak adanya data komposisi material SS304 dan H2O di daerah reflektor dan diameter penyerap SS304. Dengan demikian tujuan penelitian ini adalah mendapatkan model teras 3-dimensi AP1000 dan siap diaplikasikan dalam evaluasi parameter kritikalitas teras. Hasil perhitungan menunjukkan bahwa komposisi terbaik SS304 dan H2O di reflektor teras bagian atas dan bawah masing-masing 50 vol%, sedangkan diameter penyerap SS304 adalah 0,960 cm. Evaluasi konsentrasi boron kritis menunjukkan perbedaan yang signifikan dengan nilai desain. Meskipun penyebab utama dari perbedaan ini belum diketahui, akan tetapi dapat dibuktikan bahwa konsentrasi boron kritis sangat sensitif dengan densitas UO2. Untuk reaktivitas padam, reaktor AP1000 memiliki margin subkritikalitas teras yang besar untuk satu siklus operasi. Dengan demikian teras yang diusulkan dapat digunakan sebagai acuan untuk evaluasi parameter teras lainnya atau perangkat analitis lainnya dalam rangka mengevaluasi desain reaktor AP1000. Kata kunci: AP1000, kritikalitas, konsentrasi boron kritis, reaktivitas padam   After the Fukushima accident, the use of passive safety system becomes an important requirement for the nuclear power plant (NPP. The advanced PWR NPP with 1000 MW (electric class, designed by Westinghouse, AP1000, a reactor with the passive safety features as well as simple and modular. Before selecting a nuclear power plant, there should be an evaluation of the design parameter. One important parameter in

  12. Pembuatan Biodiesel Dari Minyak Kelapa Sawit Dengan Menggunakan Katalis Berpromotor Ganda Berpenyangga γ-Alumina (CaO/KI/γ-Al2O3 Dalam Reaktor Fluidized Bed

    Directory of Open Access Journals (Sweden)

    Sunu R Puspitaningati

    2013-09-01

    Full Text Available Biodiesel merupakan salah satu energi alternatif pengganti bahan bakar fosil dari hasil reaksi transesterifikasi minyak nabati dengan metanol. Proses pembuatan biodiesel selama ini menggunakan katalis homogen NaOH atau KOH yang memiliki kelemahan terbentuknya produk samping berupa sabun dan rumitnya pemisahan produk biodiesel dengan katalis. Maka dari itu, mulai dikembangkan penggunaan katalis heterogen untuk menggantikan penggunaan katalis homogen. Penelitian ini mengembangkan katalis CaO/KIγ-Al2O3­. Pembuatan katalis melalui metode presipitasi CaO pada γ-Al2O3 serta asam asetat sebagai larutan precursor selama 3 jam lalu impregnasi KI selama 3 jam. Kemudian, dioven selama 12 jam pada suhu 110oC dan dikalsinasi pada suhu 650oC selama 4,5 jam. Katalis yang diperoleh digunakan untuk membantu proses transesterifikasi biodiesel dengan variable massa katalis, rasio molar minyak dan metanol, dan suhu. Dari hasil penelitian didapatkan bahwa biodiesel dapat diproduksi melalui reaksi transesterifikasi menggunakan katalis CaO/KI/γ-Al2O3­ dalam reaktor fluidized bed. Kemurnian tertinggi dari biodiesel yang didapatkan yaitu sebesar 99,17%. Yield dan konversi tertinggi sebesar 97,19% dan 96,89%  didapatkan pada penggunaan massa katalis 16 gram dan rasio molar minyak dan metanol 1 : 36 serta kondisi operasi suhu 225oC dan laju alir umpan 6 ml/menit (waktu tinggal 8 jam memiliki densitas sebesar 0,853 gr/ml serta viskositas sebesar 5,53 mm2/s (cSt.

  13. Theory of nuclear reactors. Vol. 1. Theorie der Kernreaktoren. Bd. 1. Der stationaere Reaktor

    Energy Technology Data Exchange (ETDEWEB)

    Emendoerfer, D.; Hoecker, K.H.

    1982-01-01

    An introduction is given to the elements of reactor physics and reactor calculation which refers to practice from the present point of view. It is demonstrated to the reader how the reactor characteristics relevant to construction can be calculated from atomic factors by means of neutron transport and diffusion theory; these reactor characteristics are: multiplication factor, power density distribution, burn-up, plutonium build-up, xenon vibrations, short-time behaviour. The interaction between thermo- and fluid-dynamic processes is important for this calculation. On grounds of didactics the crucial point of this book is the establishment and calculation of simple models which give a clear description of all important characteristics of the events. Attempts for more exact simulation by computer are dealt with including typical solutions.

  14. APLIKASI TEKNIK AAN DI REAKTOR RSG-GAS PADA PENENTUAN UNSUR ESENSIAL DAN TOKSIK DI DALAM IKAN DAN PAKAN IKAN

    Directory of Open Access Journals (Sweden)

    Saeful Yusuf

    2015-03-01

    Full Text Available Pada makalah ini diuraikan tentang aplikasi teknik AAN (Analisis Aktivasi Neutron dalam penentuan konsentrasi unsur-unsur esensial dan cemaran yang terkandung di dalam beberapa spesies ikan dan pakan ikan. Unsur-unsur esensial yang terkandung dalam pakan ikan buatan juga dianalisis untuk mengetahui pengaruhnya terhadap ikan. Penentuan unsur menggunakan teknik AAN dengan metode perbandingan dan metode k0-AAN. Sampel diiradiasi di reaktor RSG-GAS yang memiliki fluks neutron thermal 5 x 1013 n.cm-2.s-1 pada daya 15 MW. Hasil penelitian menunjukkan bahwa 12 unsur di dalam 11 spesies ikan air laut dan air tawar telah ditentukan yaitu As, Br, Cr, Co, Cs, Fe, Hg, K, Na, Rb, Se and Zn. Konsentrasi cemaran As didalam ikan laut sudah melampaui batas maksimum 1 mg/kg, sedangkan konsentrasi cemaran Hg masih dibawah batas maksimum 0,5 mg/kg, baik untuk ikan laut maupun ikan air tawar. Unsur K dan Na merupakan unsur makroesensial sedangkan unsur Cr, Co, Fe, Se and Zn adalah termasuk unsur mikroesensial. Secara umum ditunjukkan bahwa kandungan mineral didalam ikan laut lebih tinggi konsentrasinya dibandingkan ikan air tawar. Br, Cs dan Rb merupakan unsur-unsur non esensial yang teridentifikasi dalam semua ikan yang dianalisis. Penelitian terhadap pakan ikan air tawar menunjukkan bahwa semua unsur yang teridentifikasi juga terdapat di dalam ikan laut dan ikan air tawar. Hal ini menunjukkan bahwa pakan ikan berkontribusi terhadap konsentrasi unsur di dalam ikan air tawar. Kata kunci : Analisis aktivasi neutron, unsur esensial, unsur cemaran, ikan, pakan ikan   This paper reported on the application of NAA (Neutron Activation Analysis Technique in the determination of the concentration of the essential and toxic elements in some species of fish and fish feed. Determination of elements using instrumental NAA technique with comparison and k0-INAA methods. Samples were irradiated in the RSG-GAS which has a thermal neutron flux  5.0E +13 ncm-2s-1. The results

  15. PENGARUH KONSENTRASI ZrO2 TERHADAP KORELASI PERPINDAHAN PANAS NANOFLUIDA AIR-ZrO2 UNTUK PENDINGIN REAKTOR

    Directory of Open Access Journals (Sweden)

    K.A. Sudjatmi

    2015-03-01

    Full Text Available Sejalan dengan perkembangan konsep keselamatan pasif pada sistem keselamatan PLTN, maka sistem perpindahan panas konveksi alam memegang peranan penting. Pemakaian nanofluid sebagai fluida pendingin pada sistem keselamatan nuklir dapat digunakan pada Sistem Pendingin Teras Darurat dan Sistem Pendingin Pengungkung Luar Reaktor. Beberapa peneliti telah melakukan studi desain konseptual aplikasi nanofluid untuk meningkatkan keselamatan AP1000 dan sistem pendingin teras darurat pada reaktor daya eksperimen. Penerapan nanofluida juga mulai dikembangkan melalui hasil penelitian perpindahan panas konveksi alamiah pada sub-buluh dengan nanofluida sebagai fluida kerjanya sangat dibutuhkan. Penelitian ini bertujuan untuk menentukan pengaruh perubahan konsentrasi ZrO2 terhadap korelasi perpindahan panas konveksi alamiah dengan pendekatan eksperimental. Data eksperimental yang diperoleh digunakan untuk mengembangkan korelasi umum empirik perpindahan panas konveksi alamiah. Metode penelitian dengan menggunakan alat uji sub-buluh vertikal dengan geometri segitiga dan segiempat menggunakan air dan nanofluida air-ZrO2 sebagai fluida kerjanya. Konsentrasi nanopartikel dalam larutan yang digunakan sebesar 0,05 %, 0,10% dan 0,15 % dalam persen berat. Hasil penelitian menunjukan bahwa untuk bilangan Rayleigh yang sama, kemampuan pemindahan kalor oleh nanofluida air-ZrO2 lebih baik dari pada pemindahan kalor oleh air. Namun peningkatan konsentrasi nanofluida tidak selalu mendapatkan kemampuan pemindahan kalor yang lebih baik. Kata kunci: nanofluida air-ZrO2, konveksi alamiah, sub-buluh segitiga, sub-buluh segi segiempat   In line with the development of the passive safety concept for the safety systems of nuclear power plants, the natural convection heat transfer system plays an important role. The nanofluid as coolant fluid on nuclear safety system can be used in Emergency core cooling system and in reactor coolant system confinement. Several researchers have

  16. PENGGUNAAN TEKNOLOGI REAKTOR MICROBIAL FUEL CELLS (MFCs DALAM PENGOLAHAN LIMBAH CAIR INDUSTRI TAHU UNTUK MENGHASILKAN ENERGI LISTRIK

    Directory of Open Access Journals (Sweden)

    Purwono

    2015-09-01

    Full Text Available Microbial Fuel Cells (MFCs adalah bioreaktor yang mengubah energi kimia dari senyawa organik menjadi energi listrik melalui reaksi katalitik mikroorganisme dalam kondisi anaerob. Tujuan dari penelitian ini adalah mengetahui pengaruh variasi media terlekat (attached growth media dan variasi konsentrasi COD awal terhadap efisiensi penyisihan konsentrasi COD dan energi listrik yang dihasilkan. Reaktor MFCs didesain dalam betuk dual-chamber yang dihubungkan menggunakan jembatan garam. Kerikil dan bioball digunakan sebagi variasi media lekat pada kompartemen anoda dan konsentrasi limbah awal divariasikan dari 0%, 25%, 50%, dan 100% dari konsentrasi COD limbah cair industri tahu asli dengan cara melakukan pengenceran.Hasil penelitian menunjukkan bahwa media lekat kerikil dengan konsentrasi 50% menghasilkan arus listrik rata-rata tertinggi 7,25 µA dan energi listrik sebesar 179,54 mWh. Voltase dan enegi listrik pada kedua variasi tersebut semakin hari semakin enurun. Variasi konsentrasi 25%, 50%, dan 100% menghasilkan enurunan nilai effisiensi penyisihan COD masing-masing 41,41%; 39,90% dan 18,26%.Pada variasi 100% menghasilkan energi listrik lebih rendah dari pada 50%. Kemungkinan hal ini karena adanya senyawa sulfida yang berperan sebagai akseptor elektron. Pembentukan senyawa sulfida ditandai dengan terbentuknya warna hitam pada substrat. Efisiensi coulombic (εC akibat perbedaan media lekat dan variasi konsentrasi berada pada kisaran 0,001-0,035%. Rendahnya εC kemungkinan karena adanya produkproduk fermentasi dan biofilm pada elektroda anoda yang menghambat transfer elektron menuju elektroda anoda seperti biomassa, bahan organik terlarut, gas H2 dan gas CH4.

  17. Pembuatan Biodiesel Dari Minyak Kelapa Sawit RBD Dengan Menggunakan Katalis Berpromotor Ganda Berpenyangga γ-Alumina (CaO/MgO/ γ-Al2O3 Dalam Reaktor Fluidized Bed

    Directory of Open Access Journals (Sweden)

    Niar Kurnia Julianti

    2014-09-01

    Full Text Available Biodiesel merupakan salah satu energi alternatif pengganti bahan bakar fosil dari hasil reaksi transesterifikasi minyak nabati dengan metanol. Proses pembuatan biodiesel selama ini menggunakan katalis homogen NaOH atau KOH yang memiliki kelemahan terbentuknya produk samping berupa sabun dan rumitnya pemisahan produk biodiesel dengan katalis. Maka dari itu, mulai dikembangkan katalis heterogen. Penelitian ini mengembangkan katalis berpromotor ganda berpenyangga y-alumina (CaO/MgO/y-Al2O3 dalam reaktor fluidized bed. Pembuatan katalis melalui metode presipitasi CaO dan MgO pada y-Al2O3 serta asam asetat sebagai larutan precursor. Kemudian, katalis dioven selama 12 jam pada suhu 110C dan dikalsinasi pada suhu 700 C selama 5 jam. Katalis yang diperoleh digunakan untuk proses transesterifikasi dengan ratio molar minyak metanol 1:36; variabel massa katalis 4, 7, 10, 13, 16 gram; laju alir reaktan 4, 7, 10, 13, 16 ml/menit; dan suhu 125, 150, 175, 200, 225 C. Dimana yield dan % konversi terbaik dari penelitian diperoleh sebesar 0,642 gr biodiesel/gr minyak dan 63,975% pada massa katalis 16 gram, suhu 225 C dan laju alir reaktan 4 ml/menit.

  18. Reactor for biological elimination of poorly degradable hydrocarbons by adjustment of substrate-specific retention times; Reaktor zur biologischen Eliminierung schwer abbaubarer Kohlenwasserstoffe durch Einstellung substratspezifischer Verweilzeiten

    Energy Technology Data Exchange (ETDEWEB)

    Brambach, R.

    1997-11-01

    Industrial waste water cleaning increasingly makes use of biological processes based on immobilized biomass, in order to ensure the aimed elimination of toxic substances. A novel, efficient reactor technique was developed, by which dangerous, poorly degradable dissolved hydrocarbons are selectively retained in the bioreactor thanks to an integrated membrane, while other substances are quickly discharged from the system via the effluent. With a synthetic waste water, this selective retention method achieved substrate-specific retention times which were five to fifty times higher than those of a merely hydrodynamically operated reactor system. In addition, the decoupling of high reactor and low effluent concentrations results in a higher biochemical activity in the reactor in comparison with conventional process techniques. (orig.) [Deutsch] In der industriellen Abwasserreinigung werden verstaerkt Bioverfahrenstechniken mit immobilisierter Biomasse eingesetzt, um eine gezielte Eliminierung gefaehrlicher Stoffe durchzufuehren. - Hierzu wurde eine neuartige leistungsfaehige Reaktortechnik entwickelt, die mittels einer im Bioreaktor integrierten Membran gefaehrliche, schwer abbaubare geloeste Kohlenwasserstoffe selektiv im Bioreaktor zurueckhaelt, waehrend andere Stoffe das System schnell ueber den Ablauf verlassen. Durch den stoffselektiven Rueckhalt wurden an einem synthetischen Abwasser substratspezifische Verweilzeiten erzielt, die um den Faktor 5 bis 50 ueber denen eines rein hydrodynamisch bestimmten Reaktorsystems liegen. Darueber hinaus wird aufgrund der Entkopplung von hoher Reaktor- und niedriger Ablaufkonzentration eine im Vergleich zu herkoemmlichen Verfahrenstechniken hoehere biochemische Aktivitaet im Reaktor erzielt. (orig.)

  19. UNJUK KERJA REAKTOR PLASMA DIELECTRIC BARRIER DISCHARGE UNTUK PRODUKSI BIODIESEL DARI MINYAK KELAPA SAWIT

    Directory of Open Access Journals (Sweden)

    Ardian Dwi Yudhistira

    2013-10-01

    Full Text Available Biodiesel is one of alternative renewable energy source to substitute diesel fuel. Various biodiesel productionprocesses through transesterification reaction with a variety of catalysts have been developed by previousresearcher. This process still has the disadvantage of a long reaction time, and high energy need. DielectricBarrier Discharge (DBD plasma electro-catalysis may become a solution to overcome the drawbacks in theconventional transesterification process. This process only needs a short time reaction and low energy process.The purpose of this study was to assess the performance of DBD plasma rector in making biodiesel such as: theeffect of high voltage electric value, electrodes gap, mole ratio of methanol / oil, and reaction time. TheResearch method was using GC-MS (Gas Cromatography-Mass Spectrofotometry and FTIR (FourierTransform Infrared Spectrofotometry and then it will be analysed the change of chemical bond betweenreactant and product. So, the reaction mechanism can be predicted. Biodiesel is produced using methanol andpalm oil as reactants and DBD plasma used as reactor in batch system. Then, reactants contacted by highvoltage electric. From the results of this research can be concluded that the reaction mechanism occurs in theprocess is the reaction mechanism of cracking, the higher of electric voltage and the longer of reaction time leadto increasing of product yield. The more of mole ratio of methanol / oil and widening the gap between theelectrodes lead to decreased product yield. From this research, product yield maksimum is 89,8% in the variableof rasio mol metanol/palm oil 3:1, voltage 10 kV, electrode gap 1,5 cm, and reaction time 30 seconds.

  20. DOLOČANJE REGULACIJSKIH PARAMETROV REAKCIJSKEGA SISTEMA RC1

    OpenAIRE

    Tompa, Saša

    2014-01-01

    V diplomskem delu opisujemo določanje vrednosti regulacijskih parametrov reakcijskega kalorimetra RC1e Mettler Toledo in reaktorskega sistema EasyMax 102 Mettler Toledo. Parametre smo določali z metodo po Ziegler-ju in Nichols-u. Ta metoda temelji na regulacijskem sistemu brez povratne zanke. Vrednosti za povratno zanko smo izračunali z Excelovim diagramom, s katerim smo izračunali P in I regulacijska parametra. Reaktor RC1e smo uporabili za poskuse z večjimi volumni, medtem ko EasyMax za tis...

  1. The upgrade and conversion of the ET-RR-1 research reactor using plate type fuel elements

    Energy Technology Data Exchange (ETDEWEB)

    Ashoub, N. [Reactor Physics Dept., Nuclear Research Center, Atomic Energy Authority, Cairo (Egypt); Saleh, H.G. [Faculty of Girls for Arts and Education, Ain-Shams Univ., Cairo (Egypt)

    2001-11-01

    The ET-RR-1 research reactor has been operated at 2 MW since 1961 using EK-10 fuel elements with 10% enriched uranium. The reactor has been used for nuclear applied research and isotope production. In order to upgrade the reactor power to a reasonable limit facing up-to-date uses, core conversion by a new type of fuel element available is necessary. Two fuel elements in plate type are suggested in this study to be used in the ET-RR-1 reactor core rather than the utilized ones. The first element has a dimension of 8 x 8 x 50 cm and consists of 19.7% enriched uranium, which is typical for that utilized in the ET-RR-2 reactor, but with a different length. The other element is proposed with a dimension of 7 x 7 x 50 cm and has the same uranium enrichment. To accomplish safety requirements for these fuel elements, thermal-hydraulic evaluation has been carried out using the PARET code. To reach a core conversion of the ET-RR-1 reactor with the above two types of fuel elements, neutronic calculations have been performed using WIMSD4, DIXY2 and EREBUS codes. Some important nuclear parameters needed in the physical design of the reactor were calculated and included in this study. (orig.) [German] Der ET-RR-1 Forschungsreaktor wird seit 1961 unter Verwendung von EK-10 Brennelementen mit einer Leistung von 2 MW betrieben. Der Reaktor wird in der angewandten Forschung und zur Isotopenherstellung eingesetzt. Um die Reaktorleistung im Hinblick auf eine zeitgemaesse Nutzung der Anlage in einem vernuenftigen Mass zu erhoehen, ist eine Umwandlung des Kerns durch Verwendung neuartiger Brennelemente noetig. In der vorliegenden Untersuchung wird vorgeschlagen, anstelle der z. Z. verwendeten Elemente zwei neue, plattenfoermige Brennelemente zu verwenden. Das erste Element hat eine Groesse von 8 x 8 x 50 cm und besteht aus 19,7% angereichertem Uran, was den im ET-RR-2 Reaktor verwendeten Elementen entspricht, allerdings mit einer anderen Groesse. Das zweite Element hat die gleiche

  2. PEMBUATAN BAHAN BAKU SPREADS KAYA KAROTEN DARI MINYAK SAWIT MERAH MELALUI INTERESTERIFIKASI ENZIMATIK MENGGUNAKAN REAKTOR BATCH [Preparation of Red Palm Oil Based-Spreads Stock Rich in Carotene Through Enzymatic Interesterification in Batch-type Reactor

    Directory of Open Access Journals (Sweden)

    Nur Wulandari1,2

    2012-12-01

    Full Text Available Enzymatic interesterification of red palm oil (a mixture of red palm olein/RPO and red palm stearin/RPS in 1:1 weight ratio and coconut oil (CNO blends of varying proportions using a non-specific immobilized Candida antartica lipase (Novozyme 435 was studied for the preparation of spread stock. The interesterification reaction was held in a batch-type reactor. Two substrate blends were chosen for the production of spread stock i.e. 77.5:22,5 and 82.5:17.5 (RPO/RPS:CNO, by weight through enzymatic interesterification in three different reaction times (2, 4, and 6 hours. The interesterification reactions were conducted at 60°C, 200 rpm agitation speed and 10% of Novozyme 435. The interesterified products were evaluated for their physical characteristics (slip melting point or SMP and solid fat content or SFC and chemical characteristics (carotene retention, moisture content, and free fatty acid/FFA content. All of the interesterified products had lower SFC and SMP as compared to the initial blends. The SMP and SFC increased in longer reaction times. The SMP ranged from 30.8°C to 34.9°C. The carotene retention ranged from 74.80% to 81.08%, while the moisture content and FFA content increased in longer reaction times. The interesterified products had desirable physical properties for possible use as a spread stock rich in carotene.

  3. Official announcement of recommendations issued by the RSK (Reactor Safety Commission) and the SSK (Radiation Protection Commission). As of 11 October 1994; Bekanntmachung von Empfehlungen der Reaktor-Sicherheitskommission und der Strahlenschutzkommission. Vom 11. Oktober 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-23

    The RSK and the SSK have found satisfactory evidence that the planned surface and underground facilities and equipment of the repository fulfill the safety requirements given, and that the planned operations for emplacement and storage can be performed with due safety. RSK and SSK put emphasis on the fact that the specific types and volumes of the radioactive wastes envisaged for storage at this site will not create a hazardous situation at any place of the entire repository as a result of temperatures, pressures or radioactivity concentrations developing during emplacement or storage, so that the repository`s hazardous potential is assessed to be very low, both in the operational phase and during the post-sealing phase. The RSK and SSK approve of the submitted safety concept for specified normal operation, as well as the submitted regime of preventive measures for protection from accidents, and the results of the accident analyses performed. Engineered and other radiation protection measures provided for specified normal operation are found to guarantee protection of the personnel, the local population and the environment. Calculated radiation doses are below the limits given in section 44, sub-section 1, and sections 45 and 49 of the Radiation Protection Ordinance (StrlSchV). The calculations submitted for emergency-induced radioactivity levels show compliance with the maximum acceptable doses laid down in section 28, sub-sec. 3 StrlSchV. The review of data submitted concerning the longterm safety of the site and the calculation approaches for determining individual doses by way of model calculations for radionuclide migration from the storage site to the biosphere are approved of by the commissions, who found evidence that the waste stored will not create hazardous radiation levels in a post-sealing operation phase extending over a period of 10.000 years. (orig./HP) [Deutsch] RSK und die SSK haben sich davon ueberzeugt, dass alle geplanten ueber- und

  4. SAFIRA. Sub-project B 1.3: Development of coupled in-situ reactors and optimisation of the geochemical processes in the discharge of different in situ reactor sytems. Final report; SAFIRA. Teilprojekt B 1.3: Entwicklung von gekoppelten in situ-Reaktoren und Optimierung der geochemischen Prozesse im Abstrom von verschiedenen in situ-Reaktor-Systemen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Dahmke, A.; Schaefer, D.; Koeber, R.; Plagentz, V.

    2002-12-01

    The Bitterfeld ground water is contaminated with many different pollutants over a large area. Long-term measures like reactive barriers for purification are required. However, groundwater contaminated with multiple contaminants cannot be purified by a single reactive material; for this reason, the effectivity of combinations of different reactive materials was investigated. Of the combinations investigated, reducing iron and activated carbon connected in series was the most effective: The iron will remove the reducible chlorinated hydrocarbons, while the rest of the contaminants are adsorbed to the activated carbon. Iron and ORC was another interesting option, but the combination of iron and activated carbon was found to be the most favourable option. Until a better method is available, it is recommended to connect iron and activated carbon in parallel for removing contaminant mixtures. Directly behind reactive iron barriers (also when combined with activated carbon), the limiting values of the Freshwater Ordinance for Fe(II) and pH are exceeded. Directly behind ORC reactors, the limiting values for Mg and pH are exceeded. Investigations in the outflow of these reactive materials showed that the high pH values are buffered by contact with the aquifer material to values typical of aquifers, which usually are below the limiting values of the Freshwater Ordinance. However, as the buffer capacity of the soil is exhausted, a zone with a higher pH starts to grow in the aquifer. The growth of this zone depends on the pH and on the aquifer material. Especially in soils as found at Bitterfeld, with a high concentration of organic matter, we find long-term desorption of pollutants from the aquifer materials which will burden the purified water leaving the water treatment system and prohibit its utilization. [German] Der Grundwasserleiter im Raum Bitterfeld ist grossraeumig mit vielen verschiedenen Substanzen kontaminiert. Aufgrund der grossraeumigen Erstreckung kommen nur langfristig kostenguenstige passive Massnahmen wie reaktive Barrieren zur Sanierung in Frage. Grundwasser, das mit mehreren und unterschiedlich reagierenden Stoffen kontaminiert ist, kann jedoch nicht mit Hilfe eines einzelnen reaktiven Materials gereinigt werden, daher wurde die Effektivitaet von Kombinationen unterschiedlicher reaktiver Materialien zur Sanierung untersucht. Von den untersuchten Kombinationen erwies sich die Hintereinanderschaltung von reduzierendem Eisen und Aktivkohle als besonders effektiv. Reduzierbare chlorierte Kohlenwasserstoffe werden im Eisen entfernt, die verbleibenden Kontaminanten adsorbieren auf der Aktivkohle. Auch die Hintereinanderschaltung von Eisen und Sauerstoff abgebenden ORC, in denen ein aerober mikrobieller Abbau statt findet, ist zur Entfernung von Mischkontaminationen geeignet. Eine Kostenschaetzung zeigt, dass die Kombination von Eisen und Aktivkohle in Abhaengigkeit von der Zusammensetzung der Kontamination guenstiger als Aktivkohle allein sein kann und generell guenstiger als die Kombination von Eisen und ORC ist. Ohne ein guenstigeres Verfahren zum Einbringen von Sauerstoff in den Aquifer wird die Hintereinanderschaltung von Eisen und Aktivkohle zur Sanierung von Mischkontaminationen empfohlen. Im direkten Abstrom von reaktiven Eisenbarrieren (auch in Kombination mit Aktivkohle) sind die Grenzwerte fuer Fe(II) und pH entsprechend der Trinkwasserverordnung ueberschritten. Im Abstrom von ORC-Reaktoren werden die zulaessigen Werte fuer Mg und pH ueberschritten. Untersuchungen im Abstrom dieser reaktiven Materialien zeigen, dass die hohen pH-Werte durch den Kontakt mit dem Aquifermaterial auf Aquifer-typische Werte gepuffert werden, die ueblicherweise unter den Grenzwerten der Trinkwasserverordnung liegen. Mit Erschoepfen der Pufferkapazitaet des Bodens breitet sich jedoch eine Zone mit erhoehtem pH-Wert im Aquifer aus. Die Geschwindigkeit dieser Ausbreitung haengt vom pH-Wert und dem Aquifermaterial ab. Gerade fuer sehr Organik reiche Boeden wie in Bitterfeld wird auch eine lange anhaltende Desorption von Schadstoffen a

  5. SAFIRA. Sub-project B 1.3: Development of coupled in-situ reactors and optimisation of the geochemical processes in the discharge of different in situ reactor sytems. Final report; SAFIRA. Teilprojekt B 1.3: Entwicklung von gekoppelten in situ-Reaktoren und Optimierung der geochemischen Prozesse im Abstrom von verschiedenen in situ-Reaktor-Systemen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Dahmke, A.; Schaefer, D.; Koeber, R.; Plagentz, V.

    2002-12-01

    The Bitterfeld ground water is contaminated with many different pollutants over a large area. Long-term measures like reactive barriers for purification are required. However, groundwater contaminated with multiple contaminants cannot be purified by a single reactive material; for this reason, the effectivity of combinations of different reactive materials was investigated. Of the combinations investigated, reducing iron and activated carbon connected in series was the most effective: The iron will remove the reducible chlorinated hydrocarbons, while the rest of the contaminants are adsorbed to the activated carbon. Iron and ORC was another interesting option, but the combination of iron and activated carbon was found to be the most favourable option. Until a better method is available, it is recommended to connect iron and activated carbon in parallel for removing contaminant mixtures. Directly behind reactive iron barriers (also when combined with activated carbon), the limiting values of the Freshwater Ordinance for Fe(II) and pH are exceeded. Directly behind ORC reactors, the limiting values for Mg and pH are exceeded. Investigations in the outflow of these reactive materials showed that the high pH values are buffered by contact with the aquifer material to values typical of aquifers, which usually are below the limiting values of the Freshwater Ordinance. However, as the buffer capacity of the soil is exhausted, a zone with a higher pH starts to grow in the aquifer. The growth of this zone depends on the pH and on the aquifer material. Especially in soils as found at Bitterfeld, with a high concentration of organic matter, we find long-term desorption of pollutants from the aquifer materials which will burden the purified water leaving the water treatment system and prohibit its utilization. [German] Der Grundwasserleiter im Raum Bitterfeld ist grossraeumig mit vielen verschiedenen Substanzen kontaminiert. Aufgrund der grossraeumigen Erstreckung kommen nur langfristig kostenguenstige passive Massnahmen wie reaktive Barrieren zur Sanierung in Frage. Grundwasser, das mit mehreren und unterschiedlich reagierenden Stoffen kontaminiert ist, kann jedoch nicht mit Hilfe eines einzelnen reaktiven Materials gereinigt werden, daher wurde die Effektivitaet von Kombinationen unterschiedlicher reaktiver Materialien zur Sanierung untersucht. Von den untersuchten Kombinationen erwies sich die Hintereinanderschaltung von reduzierendem Eisen und Aktivkohle als besonders effektiv. Reduzierbare chlorierte Kohlenwasserstoffe werden im Eisen entfernt, die verbleibenden Kontaminanten adsorbieren auf der Aktivkohle. Auch die Hintereinanderschaltung von Eisen und Sauerstoff abgebenden ORC, in denen ein aerober mikrobieller Abbau statt findet, ist zur Entfernung von Mischkontaminationen geeignet. Eine Kostenschaetzung zeigt, dass die Kombination von Eisen und Aktivkohle in Abhaengigkeit von der Zusammensetzung der Kontamination guenstiger als Aktivkohle allein sein kann und generell guenstiger als die Kombination von Eisen und ORC ist. Ohne ein guenstigeres Verfahren zum Einbringen von Sauerstoff in den Aquifer wird die Hintereinanderschaltung von Eisen und Aktivkohle zur Sanierung von Mischkontaminationen empfohlen. Im direkten Abstrom von reaktiven Eisenbarrieren (auch in Kombination mit Aktivkohle) sind die Grenzwerte fuer Fe(II) und pH entsprechend der Trinkwasserverordnung ueberschritten. Im Abstrom von ORC-Reaktoren werden die zulaessigen Werte fuer Mg und pH ueberschritten. Untersuchungen im Abstrom dieser reaktiven Materialien zeigen, dass die hohen pH-Werte durch den Kontakt mit dem Aquifermaterial auf Aquifer-typische Werte gepuffert werden, die ueblicherweise unter den Grenzwerten der Trinkwasserverordnung liegen. Mit Erschoepfen der Pufferkapazitaet des Bodens breitet sich jedoch eine Zone mit erhoehtem pH-Wert im Aquifer aus. Die Geschwindigkeit dieser Ausbreitung haengt vom pH-Wert und dem Aquifermaterial ab. Gerade fuer sehr Organik reiche Boeden wie in Bitterfeld wird auch eine lange anhaltende Desorption von Schadstoffen aus dem Aquifermaterial beobachtet, durch die das saubere Wasser, das die Sanierungsanlage verlaesst, wieder mit Schadstoffen beladen wird, was zu einer anhaltenden Nutzungseinschraenkung fuehrt. (orig.)

  6. Validation of CESAR Thermal-hydraulic Module of ASTEC V1.2 Code on BETHSY Experiments

    Science.gov (United States)

    Tregoures, Nicolas; Bandini, Giacomino; Foucher, Laurent; Fleurot, Joëlle; Meloni, Paride

    The ASTEC V1 system code is being jointly developed by the French Institut de Radioprotection et Sûreté Nucléaire (IRSN) and the German Gesellschaft für Anlagen und ReaktorSicherheit (GRS) to address severe accident sequences in a nuclear power plant. Thermal-hydraulics in primary and secondary system is addressed by the CESAR module. The aim of this paper is to present the validation of the CESAR module, from the ASTEC V1.2 version, on the basis of well instrumented and qualified integral experiments carried out in the BETHSY facility (CEA, France), which simulates a French 900 MWe PWR reactor. Three tests have been thoroughly investigated with CESAR: the loss of coolant 9.1b test (OECD ISP N° 27), the loss of feedwater 5.2e test, and the multiple steam generator tube rupture 4.3b test. In the present paper, the results of the code for the three analyzed tests are presented in comparison with the experimental data. The thermal-hydraulic behavior of the BETHSY facility during the transient phase is well reproduced by CESAR: the occurrence of major events and the time evolution of main thermal-hydraulic parameters of both primary and secondary circuits are well predicted.

  7. Analisis dan Optimasi Desain Sistem Reaktor Gas Temperatur Tinggi RGTT200K dan RGTT200KT

    Directory of Open Access Journals (Sweden)

    Mohammad Dhandhang Purwadi

    2013-03-01

    dengan penyelesaian persamaan aljabar linier dari model RGTT200K dan RGTT200KT. Dari analisis dan optimasi ini dihasilkan desain konseptual sistem RGTT200K dan RGTT200KT dengan spesifikasi thermal-flow teras sama, dan peningkatan EUF dari 63% menjadi 80,14% (untuk RGTT200K dan dari 63,6% menjadi 78,02% (untuk RGTT200KT.

  8. Perancangan dan Simulasi MRAC untui Proses Pengendalian Temperatur pada Continuous Stirred Tank Reactor (CSTR

    Directory of Open Access Journals (Sweden)

    Amelia Sylvia

    2014-03-01

    Full Text Available Temperatur merupakan salah satu variabel proses dasar yang dikendalikan untuk menjaga suhu cairan di dalam reaktor. Model Reference Adaptive Controller (MRAC dengan MIT rule dipilih untuk mencapai spesifikasi respon yang diinginkan pada CSTR. Beban yang bervariasi berupa debit aliran likuid yang masuk ke dalam reaktor dapat menyebabkan perubahan parameter yang mempengaruhi perubahan temperatur output produk pada CSTR. Sebuah simulasi dilakukan dengan menggunakan MATLAB dan hasilnya dianalisa. Respon plant dapat melakukan adaptasi parameter – parameter kontrolernya cukup baik pada nilai gain adaptasi dengan rentang 0.00000010000 sampai 0.00000000001. Waktu yang dibutuhkan untuk mengatasi beban yang bervariasi berupa debit aliran yang masuk ke dalam reaktor dengan nilai yang maksimal (1.5 m^3/min menghasilkan respon plant lebih cepat 42 detik dari pada debit aliran masuk dengan nilai yang nominal (1 m^3/min 63 detik dan minimal (0.5 m^3/min 75 detik.

  9. Development of a continuous process for microbial elimination of 1,2 dichloropropane in contaminated water; Entwicklung eines kontinuierlichen Verfahrens zur mikrobiellen Elimination von 1,2-Dichlorpropan in kontaminierten Waessern

    Energy Technology Data Exchange (ETDEWEB)

    Hauck, R.

    2000-07-01

    methanogenes and sulfate reducing bacteria resulted in a slower but continued DCP degradation. Due to these results molecular hydrogen was spiked to the reactor whereby an increase of DCP degradation could be achieved. The applied culture showed a high dechlorination potential towards different aliphatic and aromatic chloroorganics, so that an application of the presented technique for groundwater treatment is principally suitable. (orig.) [German] Fuer die Untersuchungen zum biologischen Abbau von 1,2-Dichlorpropan (DCP) wurden sowohl aerobe als auch anaerobe batch- und kontinuierliche Reaktorversuche mit Mischkulturen durchgefuehrt. Fuer die aeroben Versuche wurde eine Mischkultur aus einem mit chlororganischen Stoffen belasteten Grundwasser angereichert und batch-Versuche zur Bestimmung der Cosubstratbeduerfnisse durchgefuehrt. Hierbei konnte jedoch kein wiederholter DCP-Abbau etabliert werden. Fuer die Realisierung des anaeroben DCP-Abbaus wurde eine Mischkultur aus Sedimenten der Saale angereichert. Im sedimenthaltigen batch-Versuch wurde die quantitative Bildung von Propen ermittelt, wobei auch geringe Mengen 1- und 2-Monochlorpropan waehrend des Abbaus nachgewiesen werden konnten. Die Mischkultur aus der Saale wurde auf Polyurethanschaumstoff-Wuerfel immobilisiert und in einem kontinuierlichen Wirbelbettreaktor etabliert. In batch- und Reaktorversuchen wurden unterschiedliche Elektronendonoren eingesetzt, wobei sich Methanol mit einer maximalen DCP-Eliminationsrate von 65 mg/(l x d) als das den Abbau am besten unterstuetzende Einzelsubstrat erwies. Die maximal im Reaktor erreichbaren Eliminationsraten von 90 mg/(l x d) bei einer Verweilzeit von 24 h und DCP-Zulaufkonzentrationen von 100 mg/l wurden mit einer Elektronendonorkombination aus Methanol und Acetat erzielt. Die Charakterisierung der Population durch molekularbiologische Analysen ergab, dass sich im Laufe des Reaktorbetriebs eine Spezies mit hoher 16S rRNA-Sequenzhomologie zu Dehalobacter restricuts in der

  10. Svar til: Hvorfor bryder robotter sammen i Tjernobyl-reaktor? (Ingeniøren, lørdag d. 17 nov. 2007)

    DEFF Research Database (Denmark)

    Morgen, Per

    2007-01-01

    stråling i form af partikler eller gamma- og røntgenstråling ioniserer på deres vej igennem siliciummet de atomer, som de møder på deres vej. Derved dannes der inde i chippen løse elektroner og huller, som kan frembringe falske elektroniske signaler i den. Hvis man er uheldig, ændrer disse signaler...

  11. The vegetation as sink and biochemical reactor for airborne pollutants. Final report; Die Vegetation als Senke und biochemischer Reaktor fuer luftgetragene Schadstoffe. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Weissflog, L.; Wenzel, K.D. [UFZ - Umweltforschungszentrum Leipzig-Halle GmbH, Leipzig (Germany). Sektion Chemische Oekotoxikologie

    1997-06-30

    The present project involved extensive studies on the air pollution situation and interactions between organic as well as inorganic air pollutant levels and the vegetation in three east German states. Seven monitoring sites with different emission profiles were selected in Saxony-Anhalt, one typically polluted site in Saxony, and two less polluted sites in Mecklenburg-Western Pomerania. The following emitter types were found to exhibit consistent pollutant patterns: landfills receiving chloroorganic special wastes; hard-coal-fuelled firing installations; commercial charcoal plants; industry; industry - car traffic - domestic fuel combustion; car traffic. [Deutsch] Im Verlauf der Projektarbeiten wurden an sieben durch unterschiedliche Emittententypen belasteten Standorten in Sachsen-Anhalt, einem typisch belasteten Standort in Sachsen und an zwei weniger belasteten Standorten in Mecklenburg/Vorpommern umfangreiche Untersuchungen zur Immissionssituation und der Wechselwirkung der luftgetragenen anorganischen und organischen Schadstofffracht mit der Vegetation durchgefuehrt. Dabei konnten fuer folgende Emittenten charakteristische Schadstoffmuster ermittelt werden: - Deponien mit chlororganischem Sondermuell - Feuerungsanlagen fuer Steinkohle - Gewerbliche Anlagen zur Herstellung von Holzkohle - Industrie - Industrie/Kfz-Verkehr/Hausbrand - Kfz-Verkehr. (orig.)

  12. DESAIN TERAS PLTN JENIS PEBBLE BED MODULAR REACTOR (PBMR MENGGUNAKAN PAKET PROGRAM MCNP-5 PADA KONDISI BEGINNING OF LIFE

    Directory of Open Access Journals (Sweden)

    Ralind Re Marla

    2015-03-01

    Full Text Available Telah dilakukan desain teras Pembangkit Listrik Tenaga Nuklir (PLTN untuk jenis Pebble Bed Modular Reactor (PBMR dengan daya 70 MWe untuk keperluan proses smelter pada keadaan beginning of life (BOL. Analisis ini bertujuan untuk mengetahui persen pengkayaan, distribusi suhu dan nilai keselamatan dengan koefisien reaktivitas teras yang negatif pada reaktor jenis PBMR apabila daya reaktor 70 MWe. Analisis menggunakan program Monte Carlo N-Particle-5 (MCNP5 dan dari hasil analisis ini diharapkan dapat memenuhi syarat dalam mendukung program percepatan pembangunan kelistrikan batubara 10.000 MWe khususnya untuk proses smelter, yang tersebar merata di wilayah Indonesia. Hasil penelitian menunjukkan bahwa, faktor perlipatan efektif (k-eff Reaktor jenis PBMR daya 70 MWe mengalami kondisi kritis pada pengkayaan 5,626 % dengan nilai faktor perlipatan efektif 1,00031±0,00087 dan nilai koefisien reaktivitas suhu pada -10,0006 pcm/K. Dari hasil analisis daat disimpulkan bahwa reaktor jenis PBMR daya 70 MWe adalah aman.   ABSTRACT The core design of Nuclear Power Plant for Pebble Bed Modular Reactor (PBMR type with 70 MWe capacity power in Beginning of Life (BOL has been performed. The aim of this analysis, to know percent enrichment, temperature distribution and safety value by negative temperature coefficient at type PBMR if reactor power become lower equal to 70 MWe. This analysis was expected become one part of overview project development the power plant with 10.000 MWe of total capacity, spread evenly in territory of Indonesia especially to support of smelter industries. The results showed that, effective multiplication factor (keff with power 70 MWe critical condition at enrichment 5,626 %is 1,00031±0,00087, based on enrichment result, a value of the temperature coefficient reactivity is - 10,0006 pcm/K. Based on the results of these studies, it can beconcluded that the PBMR 70 MWe design is theoritically safe.

  13. Studio 1:1

    Index Scriptorium Estoniae

    2011-01-01

    Projekteerimis- ja disainistuudiost STUDIO 1:1 (Eindhoven), mis tegeleb avaliku ruumi loomise ja selle kasutamise kujundamisega. Projektidest "Linnulinn - linn lindude segakogukonna jaoks" ja ICT kogemuskeskus "De Verdieping"

  14. ???????????? ?????? ?????????????????? ???????? 1,2,3-???????? ?? 1?-?????????, ????????? ????????? ??????????????? ??????

    OpenAIRE

    2008-01-01

    ?????????? ?????????? ??????????? ? ???????? ??????? ??????? ????? ???????? 1,2,3-???????? ?? ?????????, ??? ??????????? ?? ???????????? ??????? ??????????????? ??????. ????????? ???? ???????????? ??????? ??????????????? ????(???????)?????? ?? ??????????????? ??????. ?????????? ???????? ??????? ? ?????? ???????? ????? ?????? ???????????????? ???? ?? ?????? ?????????????. ??????????? ???? ???????? ??????? ??????????????? ????(???????)?????? ? ??????????????????? ??-????????? ?????? ?????? (R1C...

  15. STUDI MODEL ALIRAN FLUIDA DAN PERPINDAHAN PANAS PADA PBMR.

    Directory of Open Access Journals (Sweden)

    Achmad Fatich Al-Qodri

    2013-11-01

    Full Text Available Reaktor tipe Pebble bed merupakan opsi yang menjanjikan untuk teknologi reaktor generasi mendatang dan memiliki potensi untuk memberikan pembangkitan listrik dengan efisiensi tinggi dan murah.Perpindahan panas reaktor ini menghadapi kendala akibat kompleksitas yang berkaitan dengan desain aliran panas.Dengan demikian, untuk mensimulasikan secara baik aliran dan perpindahan panas reaktor modular pebble bed ini memerlukan suatu model perpindahan panas yang berhubungan dengan radiasi serta konveksi dan konduksi panas.Dalam studi ini, suatu model dengan kemampuan untuk mensimulasikan aliran fluida dan perpindahan panas dalam teras reaktor modular pebble bed telah dikembangkan.Model ini diterapkan pada suatu personal computer (PC yang menggunakan program komputer Matlab r2008a Versi 7.1.Beberapa parameter penting aliran fluida dan perpindahan panas telah dipelajari, termasuk penurunan tekanan (pressure drop di teras reaktor, koefisien perpindahan panas, bilangan Nusselt, dan konduktivitas panas efektif pebble bahan bakar. Hasil yang diperoleh dari percobaan simulasi menunjukkan adanya suatu tekanan yang merata pada arah radial untuk suatu rasio diameter teras terhadap elemen bakar (D/d > 20 dan koefisien perpindahan panas meningkat seiring dengan peningkatan temperatur dan laju alir massa pendingin. Model ini dapat menjelaskan secara memadai fenomena aliran panas dan perpindahan panas dan kehilangan tekanan melalui friksi dalam PBMR tipe pebble bed.Kata kunci: Aliran fluida, perpindahan panas, PBMR, packed bed, penurunan tekananAbstractThe pebble bed type high temperature gas cooled nuclear reactor is a promising option for next generation reactor technology and has the potential to provide high efficiency and cost effective electricity generation. The reactor unit heat transfer poses a challenge due to the complexity associated with the thermalflow design. Therefore to reliably simulate the flow and heat transport of the pebble bed modular reactor

  16. Development of a methodology for safety classification on a non-reactor nuclear facility illustrated using an specific example; Entwicklung einer Methodik zur Sicherheitsklassifizierung fuer eine kerntechnische Anlage ohne Reaktor an einem spezifischen Beispiel

    Energy Technology Data Exchange (ETDEWEB)

    Scheuermann, F.; Lehradt, O.; Traichel, A. [NUKEM Technologies Engineering Services GmbH, Alzenau (Germany)

    2015-07-01

    To realize the safety of personnel and environment systems and components of nuclear facilities are classified according to their potential danger into safety classes. Based on this classification different demands on the manufacturing quality result. The objective of this work is to present the standardized method developed by NUKEM Technologies Engineering Services for the categorization into the safety classes restricted to Non-reactor nuclear facilities (NRNF). Exemplary the methodology is used on the complex Russian normative system (four safety classes). For NRNF only the lower two safety classes are relevant. The classification into the lowest safety class 4 is accordingly if the maximum resulting dose following from clean-up actions in case of incidents/accidents remains below 20 mSv and the volume activity restrictions of set in NRB-99/2009 are met. The methodology is illustrated using an example. In short the methodology consists of: - Determination of the working time to remove consequences of incidents, - Calculation of the dose resulting from direct radiation and due to inhalation during these works. The application of this methodology avoids over-conservative approaches. As a result some previously higher classified equipment can be classified into the lower safety class.

  17. Evaluation of chemical phenomena that could have an effect on the performance of recirculation strainers in a Ringhals PWR; Bedoemning av kemiska fenomen med betydelse foer silfunktionen i Ringhals PWR-reaktorer

    Energy Technology Data Exchange (ETDEWEB)

    Liljenzin, Jan-Olov [Liljenzins data och kemikonsult, Goeteborg (Sweden)

    2005-01-15

    An evaluation has been made of the various chemical phenomena that could have an effect on the performance of recirculation strainers after a LOCA in a PWR. Values of pH and concentrations in the water at the bottom of the containment have been calculated as functions of time and temperature for a postulated LOCA. The behaviour of glass wool insulation, its dissolution, and precipitation of amorphous silic acid have been evaluated. Also the corrosion of galvanized surfaces has been considered. Dissolution of zinc by hot boric acid solution can lead to a later precipitation of amorphous zinc hydroxide or phosphate when pH increases and temperature drops. Also a possible growth of microorganisms is discussed. A rough classification of the various phenomena possible along a simplified time scale yields the following conclusions: Hours after the beginning of the LOCA: Precipitation of zinc hydroxide and/or phosphate. Dissolution of glass wool giving rise to an increasing concentration of silic acid in the water. Days after the beginning of the LOCA: Continued dissolution of glass wool and increasing concentration of silica in the water. Perhaps a precipitation of phosphates or carbonates of the metal ions released during dissolution of glass wool. Weeks after the beginning of the LOCA: Continued slow dissolution of glass wool leading to a risk of precipitation of amorphous silica. Perhaps a precipitation of phosphates or carbonates of the metal ions released during dissolution of glass wool. Initial growth of microorganisms in the water and on surfaces after mutations and adaptation to the existing environment. Months after the beginning of the LOCA: Continued slow dissolution of glass wool leading to a risk of precipitation of amorphous silica. Perhaps a precipitation of phosphates or carbonates of the metal ions released during dissolution of glass wool. Continued growth of adapted microorganisms.

  18. The development of fast reactors - Effects on the Swedish system of management of spent fuel; Utveckling av snabba reaktorer - Paaverkan paa det svenska systemet foer hantering av anvaent braensle

    Energy Technology Data Exchange (ETDEWEB)

    Hans Forsstroem, Hans [SKB International AB, Stockholm (Sweden)

    2013-09-15

    Since the start of the nuclear power era studies have been performed of how to utilise the uranium energy resource in the most effective way. Only about one percent of the energy potential of uranium is utilised in the light water reactors of today. To improve the utilization other types of reactors are needed. With fast reactors theoretically 50-100 times more energy can be extracted from the uranium. This will require reprocessing of the uranium and multiple recycling of the plutonium. Plutonium and uranium can also be recycled in light water reactors, but this will only improve the uranium utilisation by about 20 %. Recycling of plutonium on a routine basis is presently only done in France. The development of fast reactors has been going on since the end of the 1940ies. During the 1970ies the planning was that a large number of fast reactors and their associated fuel cycle facilities would be in operation by the year 2000. The development has, however, for different reasons been much slower than planned. The general assessment today is that fast reactor, if they will be realised, will hardly give an important contribution to energy production until after 2050. Nuclear power production has instead been dominated by light water reactors similar to the ones in use in Sweden. Light water reactors are believed to continue to dominate during the next decades. To start a fast reactor system plutonium (or highly enriched uranium) will be needed. Such plutonium is contained in spent nuclear fuel from light water reactors. This raises the question: Should the spent nuclear fuel be stored so that the potential energy resource in the fuel can be used in the future instead of disposing of it as a waste? The answer to this question will depend on when the material will be useful, i.e. when fast reactors have been introduced on a large scale. It will also depend on the demand for plutonium at this time, i.e. will plutonium be a scarce redundant resource at this point of time. In this context it should be considered that fast reactors will generate their own plutonium, as breeder reactors. Plutonium from other reactors will thus only be needed for the first years of operation. To provide a basis for the answer to the question if the Swedish spent fuel is a resource or a waste this report provides an overview of the present development status for fast reactors and their potential for large scale commercial use. It further describes the impact on the Swedish system for management of spent nuclear fuel if the fuel were to be reprocessed and the uranium and plutonium reused as fuel for fast reactors or for the present reactors.

  19. NPP Grafenrheinfeld. No thank you. Questions and answers concerning the oldest operating crack susceptible reactor in the federal republic; AKW Grafenrheinfeld. Nein danke. Fragen und Antworten zum aeltesten noch laufenden und rissanfaelligsten Reaktor der Republik

    Energy Technology Data Exchange (ETDEWEB)

    Darge, Tobias

    2014-03-15

    The brochure discusses questions on the NPP Grafenrheinfeld. concerning the following issues: reactor type, operating company, nuclear fuel, licensing, radioactive waste management, susceptibility to damage, stress test results, critical arguments concerning the reactor pressure vessel steel and the containment, cracks in the primary circuit, safety in case of an aircraft crash, possibility of a severe accident, consequences of a severe accident, medical emergency plan, public information for an emergency case, shutdown at the end of 2015, necessity of a new power plant for energy security?.

  20. Juba teine "1+1 = 1"

    Index Scriptorium Estoniae

    2004-01-01

    15. III Okupatsioonimuuseumis toimuva "1+1=1" teise ürituse kavast. Presentatsioonide õhtu keskendub konkreetse ruumikogemuse vahendamisele kunstis (helis, slaidi-installatsioonis, tänava-aktsioonis, skulptuuris, videos, filmis). Esinevad Cevdet Erek, Andres Lõo, Andres Kurg (arhitektuur ja interjöörid Marko Raadi filmis "Agent Sinikael") jt.

  1. KINETIKA HIDRODESULFURISASI DIBENZOTHIOPHENE (HDS DBT MENGGUNAKAN KATALIS NiMo/γ-Al2O3

    Directory of Open Access Journals (Sweden)

    Subagjo Subagjo

    2014-12-01

    Full Text Available Evaluasi kinetika reaksi hidrodesulfurisasi (HDS dibenzothiophene dan simulasi nafta hydrotreater yang berada di PT. PERTAMINA Refinery Unit II Dumai menggunakan katalis NiMo/Al2O3 hasil pengembangan telah dilakukan. Kinetika reaksi HDS DBT dilakukan dalan sistem reaktor batch dengan variasi temperatur 280-320oC dan tekanan 30 bar. Data kinetika diolah dengan persamaan hukum pangkat (law power dan persamaan kinetik mekanistik (Langmuir Hinshelwood, LH. Berdasarkan model hukum pangkat, kinetika HDS DBT menggunakan NiMo/Al2O3 hasil pengembangan merupakan  orde satu  terhadap DBT dengan konstanta Arhenius  sebesar 165633 detik-1 dan energi aktivasi 69017 J/mol (16,56 kkal/mol. Model LH yang cocok untuk reaksi HDS DBT menggunakan NiMo/Al2O3 hasil pengembangan adalah model LH yang mengilustrasikan adanya kompetisi antara reaktan DBT dan H2 pada tipe pusat aktif yang sama, dengan DBT teradsorb secara kuat sedangkan H2 teradsorpsi secara lemah. Energi aktifasi dan konstanta Arhenius berdasarkan model LH ini ini berturut-turut adalah 81409 J/mol (19,34 kkal/mol dan 1658133 s-1. Dengan menggunakan persamaan laju reaksi hukum pangkat, model memberikan hasil konversi sulfur yang sama dengan hasil keluaran reaktor nafta hydrotreater RU II-Dumai, yaitu mencapai 98%.

  2. Analysis of changes in the chemical composition of the blast furnace coke at high temperatures

    Directory of Open Access Journals (Sweden)

    A. Konstanciak

    2012-12-01

    Full Text Available Purpose: The main purpose of this paper was to analyze the behavior of coke in the blast furnace. The analysis of changes in chemical composition of coke due to impact of inert gas and air at different temperatures was made. The impact of the application of the thermoabrasion coefficient on the porosity of coke was also analyzed.Design/methodology/approach: By applying the Computer Thermochemical Database of the TERMO system (REAKTOR1 and REAKTOR3 three groups of substances can be distinguished. The chemical composition of blast furnace coke and the results of calculations of changes of chemical composition of coke heat treated under certain conditions were compared. The structural studies of these materials were presented.Findings: The results of the analysis of ash produced from one of Polish cokes was taken for consideration. This is not the average composition of Polish coke ashes, nevertheless it is representative of most commonly occurring chemical compositions.Practical implications: Thanks to the thermochemical calculations it is possible to predict ash composition after the treatment in a blast furnace. Those information was crucial and had an actual impact on determining the coke quality.Originality/value: Presentation of the analytical methods which, according to author, can be very useful to evaluate and identify the heat treatment for blast furnaces cokes. The research pursued represents part of a larger project carried out within the framework of Department Extraction and Recycling of Metals, Czestochowa University of Technology.

  3. Prediksi Potensi Pencemaran Pengolahan Sampah dengan Metode Gasifikasi Fluidized Bed (Studi Kasus: TPA Benowo, Surabaya

    Directory of Open Access Journals (Sweden)

    Lailatun Nikmah

    2013-03-01

    Full Text Available Sistem pengelolaan sampah di TPA Benowo masih bersistem open dumping dan belum memperhatikan dampak pencemaran terhadap lingkungan. Kuantitas sampah yang masuk ke TPA sebesar 461.705,782 ton pada tahun 2012. Kuantitas sampah diperkirakan meningkat sebanding dengan pertumbuhan penduduk, sehingga dibutuhkan skenario pengolahan sampah yang ramah lingkungan. Skenario pengolahan sampah yang akan dikaji adalah gasifikasi  fluidized bed. Potensi pencemaran gasifikasi  fluidized bed akan dikaji menggunakan metode Life Cycle Assessment (LCA dengan software SimaPro versi 7.1. Satu ton sampah pada studi ini ditentukan sebagai satu fungsi unit. Data input Life Cycle Inventory (LCI meliputi jumlah sampah yang masuk ke reaktor gasifikasi dan energi yang dibutuhkan pada proses gasifikasi berdasarkan pendekatan efisiensi reaktor gasifikasi. Penentuan nilai Life Cycle Impact Assesment (LCIA meliputi Global Warming Potential (GWP dan asidifikasi menggunakan metode Environmental Product Declarations (EPD 2008. Besar dampak dinyatakan dalam faktor emisi yang ekivalen. Kesimpulan pada penelitian ini menunjukkan bahwa skenario pengolahan sampah dengan metode gasifikasi fluidized bed memberikan dampak GWP sebesar 1067,8 kg CO2/fu pada fase start-up dan 875 kg CO2/fu pada fase energy recovery serta asidifikasi sebesar 5,93 kg SO2/fu pada fase start-up dan 4,81 kg SO2/fu pada fase energy recovery.

  4. GLP-1

    DEFF Research Database (Denmark)

    Aaboe, Kasper; Krarup, Thure; Madsbad, Sten

    2008-01-01

    Glucagon-like peptide 1 (GLP-1) is a gut-derived incretin hormone with the potential to change diabetes. The physiological effects of GLP-1 are multiple, and many seem to ameliorate the different conditions defining the diverse physiopathology seen in type 2 diabetes. In animal studies, GLP-1...... and endothelial dysfunction. Enhancing incretin action for therapeutic use includes GLP-1 receptor agonists resistant to degradation (incretin mimetics) and dipeptidyl peptidase (DPP)-4 inhibitors. In clinical trials with type 2 diabetic patients on various oral antidiabetic regimes, both treatment modalities...

  5. TRPML1.

    Science.gov (United States)

    Colletti, Grace A; Kiselyov, Kirill

    2011-01-01

    TRPML1 (or mucolipin 1) is the first member of the TRP family of ion channels that was found to function in the lower portions of the endocytic pathway. Mutations in the gene coding for TRPML1 (MCOLN1) cause the lysosomal storage disease mucolipidosis type IV (MLIV). TRPML1 localization in the lysosomes and the similarity of mucolipidosis type IV phenotype to lysosomal storage diseases whose origin has been directly linked to lysosomal dysfunction, suggest that TRPML1 activity drives some vitally important processes within the endocytic machinery. The specific aspect(s) of TRPML1 activity that make it indispensable for the proper function of the endocytic pathway as well as the specific aspect(s) of the endocytic activity that depend on TRPML1 are currently being discussed. Among the candidates are: membrane fusion within the lower portion of the endocytic pathway possibly mediated by Ca(2+) release through TRPML1, or regulation of lysosomal ion homeostasis (pH or Fe content) by TRPML1. In addition to delineating the mechanisms of MLIV pathogenesis, identifying the role of TRPML1 in the endocytic pathway will lead to important developments in our understanding of the endocytic pathway and, due to the neurodegenerative nature of MLIV, of the integrative function of the cell. Moreover, molecular modulators of TRPML1 function may lead to novel approaches to modulating biological processes that depend on the endocytic pathway such as growth factor signaling. The present review will focus on the recent developments in identifying the TRPML1 function.

  6. TRPV1.

    Science.gov (United States)

    Bevan, Stuart; Quallo, Talisia; Andersson, David A

    2014-01-01

    TRPV1 is a well-characterised channel expressed by a subset of peripheral sensory neurons involved in pain sensation and also at a number of other neuronal and non-neuronal sites in the mammalian body. Functionally, TRPV1 acts as a sensor for noxious heat (greater than ~42 °C). It can also be activated by some endogenous lipid-derived molecules, acidic solutions (pH pungent chemicals and food ingredients such as capsaicin, as well as by toxins such as resiniferatoxin and vanillotoxins. Structurally, TRPV1 subunits have six transmembrane (TM) domains with intracellular N- (containing 6 ankyrin-like repeats) and C-termini and a pore region between TM5 and TM6 containing sites that are important for channel activation and ion selectivity. The N- and C- termini have residues and regions that are sites for phosphorylation/dephosphorylation and PI(4,5)P2 binding, which regulate TRPV1 sensitivity and membrane insertion. The channel has several interacting proteins, some of which (e.g. AKAP79/150) are important for TRPV1 phosphorylation. Four TRPV1 subunits form a non-selective, outwardly rectifying ion channel permeable to monovalent and divalent cations with a single-channel conductance of 50-100 pS. TRPV1 channel kinetics reveal multiple open and closed states, and several models for channel activation by voltage, ligand binding and temperature have been proposed. Studies with TRPV1 agonists and antagonists and Trpv1 (-/-) mice have suggested a role for TRPV1 in pain, thermoregulation and osmoregulation, as well as in cough and overactive bladder. TRPV1 antagonists have advanced to clinical trials where findings of drug-induced hyperthermia and loss of heat sensitivity have raised questions about the viability of this therapeutic approach.

  7. TRPA1.

    Science.gov (United States)

    García-Añoveros, J; Nagata, K

    2007-01-01

    The TRPA1 protein has up to 18 N-terminal and presumed cytoplasmic ankyrin repeats followed by the six membrane spanning and single pore-loop domains characteristic of all TRPs. In mice, TRPA1 is almost exclusively expressed in nociceptive neurons of peripheral ganglia and in all the mechanosensory epithelia of inner ear. In nociceptive neurons, TRPA1 mediates the response to the proalgesic bradykinin as well as the response to pungent irritants found in mustards and garlic, and probably also to those found in cinnamon and tear gas. The channel properties of TRPA1 are discussed and compared to those of sensory transducers. TRPA1 is well conserved across the animal kingdom, with likely orthologs from human to nematode, which suggest an ancestral role for this channel, probably in sensation.

  8. 1+1 Gaudin Model

    Directory of Open Access Journals (Sweden)

    Andrei V. Zotov

    2011-07-01

    Full Text Available We study 1+1 field-generalizations of the rational and elliptic Gaudin models. For sl(N case we introduce equations of motion and L-A pair with spectral parameter on the Riemann sphere and elliptic curve. In sl(2 case we study the equations in detail and find the corresponding Hamiltonian densities. The n-site model describes n interacting Landau-Lifshitz models of magnets. The interaction depends on position of the sites (marked points on the curve. We also analyze the 2-site case in its own right and describe its relation to the principal chiral model. We emphasize that 1+1 version impose a restriction on a choice of flows on the level of the corresponding 0+1 classical mechanics.

  9. 1+1 Gaudin Model

    CERN Document Server

    Zotov, A

    2010-01-01

    We study 1+1 field-generalizations of the rational and elliptic Gaudin models. For sl(N) case we introduce equations of motion and L-A pair with spectral parameter on the Riemann sphere and elliptic cure. In sl(2) case we study the equations in details and find the corresponding Hamiltonian densities. The n-site model describes n interacting Landau-Lifshitz models of magnets. The interaction depends on position of the sites (marked points on the curve). We also analyze the 2-site case in its own right and describe its relation to the principle chiral model. We emphasize that 1+1 version impose a restriction on a choice of flows on the level of the corresponding 0+1 classical mechanics.

  10. Shootin1

    DEFF Research Database (Denmark)

    Toriyama, Michinori; Shimada, Tadayuki; Kim, Ki Bum;

    2006-01-01

    Neurons have the remarkable ability to polarize even in symmetrical in vitro environments. Although recent studies have shown that asymmetric intracellular signals can induce neuronal polarization, it remains unclear how these polarized signals are organized without asymmetric cues. We describe...... a novel protein, named shootin1, that became up-regulated during polarization of hippocampal neurons and began fluctuating accumulation among multiple neurites. Eventually, shootin1 accumulated asymmetrically in a single neurite, which led to axon induction for polarization. Disturbing the asymmetric...... to the growth cones and diffused back to the soma; inhibiting this transport prevented its asymmetric accumulation in neurons. We propose that shootin1 is involved in the generation of internal asymmetric signals required for neuronal polarization....

  11. Danida1

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    1996-01-01

    At the request of Danish Ministry of Foreign Affairs, Department TSA.4, electrical testing of possibly damaged cables has been evaluated. This matter concerns three different types of cable, which are10 km 30(36) kV XLPE armoured submarine power cable, 1-phase15 km 30(36) kV XLPE armoured...... underground power cable, 1-phase20 km 10(12) kV XLPE armoured underground power cable, 3-phase.The possible damage of said cables took place during shipment from Denmark to Bangladesh....

  12. Pentacene on Au(111), Ag(111) and Cu(111): From physisorption to chemisorption

    Science.gov (United States)

    Lu, Meng-Chao; Wang, Rong-Bin; Yang, Ao; Duhm, Steffen

    2016-03-01

    We measured the electronic and the molecular surface structure of pentacene deposited on the (111)-surfaces of coinage metals by means of ultraviolet photoelectron spectroscopy (UPS) and low-energy electron diffraction (LEED). Pentacene is almost flat-lying in monolayers on all three substrates and highly ordered on Au(111) and on Cu(111). On Ag(111), however, weak chemisorption leads to almost disordered monolayers, both, at room temperature and at 78 K. On Cu(111) pentacene is strongly chemisorbed and the lowest unoccupied molecular orbital becomes observable in UPS by a charge transfer from the substrate. On Ag(111) and Cu(111) multilayers adopt a tilted orientation and a high degree of crystallinity. On Au(111), most likely, also in multilayers the molecular short and long axes are parallel to the substrate, leading to a distinctively different electronic structure than on Ag(111) and Cu(111). Overall, it could be demonstrated that the substrate not only determines the geometric and electronic characteristics of molecular monolayer films but also plays a crucial role for multilayer film growth.

  13. ASC-1

    DEFF Research Database (Denmark)

    Jakimoski, Goce; Khajuria, Samant

    2011-01-01

    The goal of the modes of operation for authenticated encryption is to achieve faster encryption and message authentication by performing both the encryption and the message authentication in a single pass as opposed to the traditional encrypt-then-mac approach, which requires two passes. Unfortun......The goal of the modes of operation for authenticated encryption is to achieve faster encryption and message authentication by performing both the encryption and the message authentication in a single pass as opposed to the traditional encrypt-then-mac approach, which requires two passes...... uses leak extraction from diÆerent AES rounds to compute the key material that is XOR-ed with the message to compute the ciphertext. Unlike LEX, the ASC-1 operates in a CFB fashion to compute an authentication tag over the encrypted message. We argue that ASC-1 is secure by reducingits (IND-CCA , INT...

  14. Bibliographie1

    OpenAIRE

    2015-01-01

    I. OUVRAGES GÉNÉRAUX A. Droit français B. Droit africain 1°. Droits des pays d’Afrique 2°. Droit de l’O.H.A.D.A. C. Droit comparé en général II. OUVRAGES SPÉCIAUX, THÈSES ET MONOGRAPHIES A. Droit français B. Droit africain 1°. Droits des pays d’Afrique 2°. Droit de l’O.H.A.D.A. C. Droit comparé en général III. RÉPERTOIRES ET OUVRAGES PRATIQUES A. Droit français B. Droit africain C. Droit comparé en général IV. OUVRAGES DE MÉTHODOLOGIE V. ARTICLES ET CHRONIQUES A. Droit français B. Droit afric...

  15. Mercury(1)

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    1.Mercury is the planet closest to the sun.It is thefastest moving planet.And it is the second smallestplanet in our solar system. 2.Mercury is very difficult to see.Its orbit isbetween us and the sun.So,we have to look toward thebright light of the sun to see it.The sunlight usuallyhides Mercury.When we can see it,it appears as a fuzzyball.

  16. Fengyinzhan 1

    Institute of Scientific and Technical Information of China (English)

    1994-01-01

    Fengyinzhan 1 is a late season indica rice variety with moderate sensitivity to photoperiod. It was from the cross of Qingfengzhan, which is a disease resistant, photopetiod sensitive, late season indica rice variety, and Yinsizhan, which is a photoperiod insensitive, early season indica riCe variety with tenerness and good quality. Its plant area in Guangdong was 33 ha in 1991 and 4,400 ha in 1992.

  17. Protoexist1

    Science.gov (United States)

    Copete, Antonio; Allen, B.; Hong, J.; Grindlay, J.; Gehrels, N.; Barthelmy, S.; Baker, R.; Apple, J.; Benson, C.; Garson, T.; Krawczynski, H.; McLean, R.; Cook, R.

    2009-01-01

    The ProtoEXIST1 mission, a pathfinder for the EXIST high energy telescope (HET), is slated for a spring 2009 flight out of Ft. Sumner, NM. The ProtoEXIST payload consists of two coded aperture telescopes, each with a 10^ 10^deg field of view and an angular resolution of approximately 10'. One telescope will be outfitted with passive Pb/Sn/Cu rear and side shielding while the other will utilize a rear active CsI anti-coincidence shield and passive side shielding for comparison of background rejection efficiency. The detector plane of each telescope consists of a 8 times 8 large tiled array of 2.04 cm times 2.04 cm CZT detectors, each with thickness of 0.5 cm and a pixilated anode consisting of 2.5 mm pixels. Each detector is read out utilizing the Caltech RADNET ASIC. In total the detector plane of a single telescope measures 16 cm times 16 cm and is sensitive over an energy range of 10 keV up to 500 keV, with an energy resolution of 3.1 keV FWHM at 59 keV. The ProtoEXIST1 flight will validate the use of tiled CZT arrays in flight and pave the way for ProtoEXIST2 which will demonstrate the use of a tiled array of CZT detectors with 0.6 mm pixels.

  18. Main: TEF1BOXATA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available TEF1BOXATA1 S000311 7-Sep-2000 (last modified) seki tef1 box found in the Arabidops... translational apparatus; EF-1alpha; A1; tef1 box; Arabidopsis (Arabidopsis thaliana) ACAGGGGCATAATGGTAATTTAAA ...

  19. Study on the potential of a solar furnace gasifier; Potentialstudie fuer einen Sonnenofenvergaser

    Energy Technology Data Exchange (ETDEWEB)

    Kubiak, H.; Jagnow, H.J.; Papamichalis, A. [DTM-Gesellschaft fuer Forschung und Pruefung mbH, Essen (Germany)

    1997-12-31

    This study attempts to determine the potential of a solar furnace gasifier on the basis of whether direct irradiation with concentrated sunlight produces sufficient reaction heat. In phase 1 of the present multi-stage development project the study concentrates on the elaboration of a concept for a small-scale gasifier with a throughput of 1 kg biomass / h. It delineates problem areas which still pose an obstacle to the final detail planning of the reactor and require a minimal-cost solution. (orig./MM) [Deutsch] In dieser Potentialstudie wird geprueft, inwieweit durch Direkteinkopplung hochkonzentrierter Solarstrahlung in einen Vergasungsreaktor die erforderliche Reaktionswaerme bereitgestellt werden kann. Die Untersuchungen konzentrieren sich in der Phase 1 des mehrstufigen Entwicklungsvorhabens auf die Erstellung des Konzeptengineerings fuer eine Kleinvergasungsapparatur mit einem Durchsatz von 1 kg/h Biomasse. Dabei werden die Problembereiche herausgearbeitet, die einer zuverlaessigen Detailplanung des Reaktors noch entgegenstehen und einer moeglichst oekonomischen Loesung zugefuehrt werden muessen. (orig./MM)

  20. R+D works for the further development of high temperature reactors. (1) Captive bearing experiments for active magnetic bearings. (2) Captive bearing test for HTR blowers. Final report 1.10.1983 - 31.3.1991; F+E-Arbeiten fuer die Weiterentwicklung von Hochtemperaturreaktoren. (1) Fanglagerversuche fuer aktive Magnetlager. (2) Fanglagertest fuer HTR-Geblaese. Abschlussbericht. 1.10.1983 - 31.3.1991

    Energy Technology Data Exchange (ETDEWEB)

    1991-03-14

    When using active magnetic bearings as blower shaft bearings, blower motors and bearings must be protected against mechanical damage in case of faults (example: total electrical supply failure due to the supply cables breaking). So-called captive bearings are provided, in order to be able to shut the blowers down safely in such faults. These captive bearings are roller bearings which are additionally fitted in the area of the blower shaft bearings, to prevent mechanical contact between the blower rotor and stator. As there was little experience available for the given boundary conditions, such as - speed, - acceleration, - bearing load, - bearing dimensions, - ambient conditions, appropriate development and tests had to be carried out. It was important to determine suitable captive bearings and the necessary ambient conditions, which will make it possible to support the failures of the magnetic bearings to be expected in 40 years` operation of the reactor without damage and to meet the requirements of the captive bearings. (orig./GL). [Deutsch] Beim Einsatz von aktiven Magnetlagern als Geblaesewellenlagerung sind Geblaesemotor und -lager vor mechanischer Schaedigung im Stoerfall (Beispiel: totaler Stromausfall durch Bruch der Versorgungskabel) zu schuetzen. Um bei derartigen Stoerfaellen die Geblaese sicher abfahren zu koennen, werden sogenannte Fanglager vorgesehen. Diese Fanglager sind Waelzlager, die im Bereich der Geblaesewellenlagerung zusaetzlich angebracht werden, um einen mechanischen Kontakt zwischen Geblaesemotor und -stator zu verhindern. Da fuer die vorgegebenen Randbedingungen, wie - Drehzahl, - Beschleunigung, - Lagerbelastung, - Lagerabmessungen, Umgebungsbedingungen nur geringe Erfahrungen vorlagen, mussten entsprechende Entwicklungen und Versuche durchgefuehrt werden. Hierbei galt es, geeignete Fanglager und die erforderlichen Umgebungsbedingungen zu ermitteln, die es ermoeglichen, die in 40 Betriebsjahren des Reaktors zu erwartenden Ausfaelle der

  1. Main: TGA1ANTPR1A [PLACE

    Lifescience Database Archive (English)

    Full Text Available TGA1ANTPR1A S000247 16-Feb-2001 (last modified) seki TGA1a binding site in tobacco ...(N.t.) PR1a gene; as-1-like sequence; Contains two TGACG elements reminiscent of activation sequence-1 (as-1...); See other as-1-like sequences; TGA1a is preferentially expressed in root tip meristems; TGA1a may contrib...ute to the expression of GST isoenzymes, especially in root tip meristems; TGA1a;... as-1; PR1a; xenobiotic stress; root; tip; meristem; tobacco (Nicotiana tabacum) CGTCATCGAGATGACG ...

  2. Main: L1DCPAL1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1DCPAL1 S000504 15-September-2006 (last modified) kehi L1 element, found in PAL1 p...romoter in carrot (Daucus carota), is a protoplastization (dilution) responsive element; L1 contains Box L-l...ike sequence (ACCTACCC); see also S000492 (BOXL CORE of DC PAL1); L1 Daucus carota (carrot) ATTCACCTACCC ...

  3. 18 CFR 1b.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Definitions. 1b.1 Section 1b.1 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY GENERAL RULES RULES RELATING TO INVESTIGATIONS § 1b.1 Definitions. For purposes of this part—...

  4. Main: 1OM1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1OM1 トウモロコシ Corn Zea mays L. Casein Kinase Ii, Alpha Chain Name=Ack2; Zea Mays Mole...ELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENSRTRA corn_1OM1.jpg ...

  5. Main: 1FK1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1FK1 トウモロコシ Corn Zea mays L. Nonspecific Lipid-Transfer Protein Precursor Zea Mays ...RGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN corn_1FK1.jpg ...

  6. Main: L1BOXATPDF1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1BOXATPDF1 S000386 05-November-2005 (last modified) kehi L1 box found in promoter ...of Arabidopsis thaliana (A.t.) PROTODERMAL FACTOR1 (PDF1) gene; Located between -134 and -127; Involved in L...ding motif (Wang et al., 2004); HDZip IV; See also S000371; PDF1; L1 box; L1 layer-specific expression; Shoo

  7. Containment of 0 and 1 in 1(, )

    Indian Academy of Sciences (India)

    Mohsen Alimohammady

    2004-05-01

    Suppose 1(, ) is the space of all absolutely 1-summing operators between two Banach spaces and . We show that if has a copy of 0, then 1(, ) will have a copy of 0, and under some conditions if has a copy of 1 then 1(, ) would have a complemented copy of 1.

  8. 26 CFR 1.535-1 - Definition.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Definition. 1.535-1 Section 1.535-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.535-1 Definition. (a)...

  9. Main: MNF1ZMPPC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MNF1ZMPPC1 S000251 11-Oct-1999 (last modified) kehi MNF1 binding site in maize (Z.m....) Ppc1 (phosphoenolpyruvate carboxylase) gene promoter; Involved in light induction; MNF1; Ppc1; light; leaf; shoot; maize (Zea mays) GTGCCCTT ...

  10. 45 CFR 1220.1-1 - Introduction.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Introduction. 1220.1-1 Section 1220.1-1 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE PAYMENT OF VOLUNTEER LEGAL EXPENSES General § 1220.1-1 Introduction. Section 419 of the Domestic...

  11. 26 CFR 1.72-1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Introduction. 1.72-1 Section 1.72-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Items Specifically Included in Gross Income § 1.72-1 Introduction. (a)...

  12. 26 CFR 1.581-1 - Banks.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Banks. 1.581-1 Section 1.581-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Banking Institutions § 1.581-1 Banks. (a) In order to be a bank as defined in section 581,...

  13. Main: 1UD1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1UD1 大豆 Soybean Glycine max (L.) Merrill Glycinin G1 Precursor [Contains: Glycinin ...A1a Subunit; Glycinin Bx De Subunit]. Name=Gy1; Glycine Max Molecule: Glycinin G1; Chain: A, B, C; Synonym:

  14. Main: SB1NPABC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SB1NPABC1 S000435 27-Jan-2004 (last modified) kehi Sclareol box1 (SB1) found at -82...7 of a plasma membrane ATP binding cassette (ABC) transporter gene (NpABC1) in N. plumbaginifolia; Mutation ...in SB3 completely abolished sclareolide-mediated expression; See S ; scalareol; diterpene; ABC; transporter; Nicotiana plumbaginifolia (tobacco); CACTAACACAAAGTAA ...

  15. Main: CCA1ATLHCB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CCA1ATLHCB1 S000149 10-May-1998 (last modified) kehi CCA1 binding site; CCA1 protei...n (myb-related transcription factor) interact with two imperfect repeats of AAMAATCT in Lhcb1*3 gene of Arab

  16. Reference: SITE1SORPS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SITE1SORPS1 Villain P, Clabault G, Mache R, Zhou DX S1F binding site is related to ...but different from the light-responsive GT-1 binding site and differentially represses the spinach rps1 prom

  17. 1 CFR 3.1 - Information services.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Information services. 3.1 Section 3.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER GENERAL SERVICES TO THE PUBLIC § 3.1 Information services. Except in cases where the time required would be excessive, information concerning...

  18. DESAIN KONSEP TANGKI PENAMPUNG BAHAN BAKAR PASSIVE COMPACT MOLTEN SALT REACTOR

    Directory of Open Access Journals (Sweden)

    A. Hadiwinata

    2015-04-01

    Full Text Available Passive Compact Molten Salt Reactor (PCMSR merupakan pengembangan dari reaktor MSR. Desain reaktor PCMSR membutuhkan tempat khusus penampung sementara bahan bakar pada saat terjadi insiden, misalnya kecelakaan yang menyebabkan peningkatan suhu bahan bakar. Tangki penampung bahan bakar tersusun dari 3 bagian yang saling terhubung yaitu bagian penampung cairan bahan bakar, cerobong (chimney, dan penukar kalor. Dalam penelitian ini, tangki dimodelkan secara lump dan dilakukan variasi daya awal reaktor dan ketinggian cerobong. Syarat batas model ditetapkan suhu bahan bakar maksimum 1400 °C, yang didasarkan pada titik didih larutan garam LiF-BeF2-ThF4-UF4. Analisis dilakukan dengan cara menghitung rugi tekanan total dan transfer kalor untuk variasi daya awal antara 1800-3000 MWth dan ketinggian cerobong antara 1-10 m. Hasil penelitian menunjukan semakin besar daya reaktor, maka tinggi tangki penampung bahan bakar dan tinggi alat penukar kalor yang dibutuhkan akan semakin besar, tejadi kenaikan suhu fluida pendingin dan suhu udara pendingin, dan menyebabkan kenaikan laju aliran masa fluida pendingin, sedangkan laju aliran masa udara menurun. Peningkatan ketinggian cerobong menyebabkan ketinggian tangki penampung bahan bakar dan ketinggian alat penukar kalor semakin menurun, penurunan suhu fluida pendingin, tetapi suhu udara meningkat, dan menyebabkan peningkatan laju aliran masa fluida pendingin, tetapi laju aliran masa udara akan semakin menurun. Kata kunci: PCMSR, cerobong, alat penukar kalor, variasi daya.   The Passsive Compact Molten Salat Reactor (PCMSR reactor is developed from MSR reactor. The PCMSR reactor design requires special place to temporarily storage for reactor fuel when incident occurs, such as when there is an accident which caused the temperature of the fuel increases. The tank consist of three interconnected parts, the reservoir liquid fuel, chimney, and the heat exchanger. In this research, the tank system is modeled based on

  19. NEUTRONICS ANALYSIS ON MINI TEST FUEL IN THE RSG-GAS CORE

    Directory of Open Access Journals (Sweden)

    Tukiran Surbakti

    2016-03-01

    Full Text Available Abstract NEUTRONICS ANALYSIS ON MINI TEST FUEL IN THE RSG-GAS CORE. Research of UMo fuel for research reactor has been developing  right now. The fuel of  research reactor used is uranium low enrichment with high density. For supporting the development of fuel, an assessment of mini fuel in the RSG-GAS core was performed. The mini fuel are U7Mo-Al and U6Zr-Al with densitis of 7.0gU/cc and 5.2 gU/cc, respectively. The size of both fuel are the same namely 630x70.75x1.30 mm were inserted to the 3 plates of dummy fuel. Before being irradiated in the core, a calculation for safety analysis  from neutronics and thermohydrolics aspects were required. However, in this paper will discuss safety analysis of the U7Mo-Al and U6Zr-Al mini fuels from neutronic point of view.  The calculation was done using WIMSD-5B and Batan-3DIFF code. The result showed that both of the mini fuels could be irradiated in the RSG-GAS core with burn up less than 70 % within 12 cycles of operation without over limiting the safety margin. Power density of U7Mo-Al mini fuel bigger than U6Zr-Al fuel.   Key words: mini fuel, neutronics analysis, reactor core, safety analysis   Abstrak ANALISIS NEUTRONIK ELEMEN BAKAR UJI MINI DI TERAS RSG-GAS. Penelitian tentang bahan bakar UMo untuk reaktor riset terus berkembang saat ini. Bahan bakar reaktor riset yang digunakan adalah uranium pengkayaan rendah namun densitas tinggi.  Untuk mendukung pengembangan bahan bakar dilakukan uji elemen bakar mini di teras reakror RSG-GAS dengan tujuan menentukan jumlah siklus di dalam teras sehingga tercapai fraksi bakar maksimum. Bahan bakar yang diuji adalah U7Mo-Al dengan densitas 7,0 gU/cc dan U6Zr-Al densitas 5,2 gU/cc. Ukuran kedua bahan bakar uji tersebut adalah sama 630x70,75x1,30 mm dimasukkan masing masing kedalam 3 pelat dummy bahan bakar. Sebelum diiradiasi ke dalam teras reaktor maka perlu dilakukan perhitungan keselamatan baik secara neutronik maupun termohidrolik. Dalam makalah ini

  20. ANALISIS TERMAL-ALIRAN KISI BAHAN BAKAR BOLA TERAS RGTT200K DENGAN FLUENT

    Directory of Open Access Journals (Sweden)

    Mohammad Dhandhang Purwadi

    2015-03-01

    Full Text Available Sejalan dengan Perpres No.5/2010, PTRKN-BATAN mengembangkan dua varian desain konseptual reaktor daya maju kogenerasi, yaitu RGTT200K dan RGTT200KT. Energi termal pada kedua sistem reaktor ini dipasok oleh teras reaktor berbahan bakar bola dengan daya termal 200 MWt. Komposisi geometri dan struktur teras didesain agar dapat menghasilkan keluaran pendingin gas helium bertemperatur 950OC sehingga dapat digunakan untuk produksi hidrogen dan atau unit industri proses lainnya secara kogeneratif. Luaran gas helium bertemperatur sangat tinggi ini akan menimbulkan tegangan termal pada bola bahan bakar yang mengancam integritas sistem pengungkungan produk fisi di dalamnya. Oleh karena itu perlu dilakukan analisis termal-aliran untuk mengetahui distribusi temperatur dan aliran pendingin gas helium dalam kisi bahan bakar bola. Salah satu cara terbaik untuk melakukan analisis termal-aliran adalah dengan pemodelan tiga dimensi menggunakan perangkat lunak komputasi dinamika fluida (computational fluid dynamics yang teruji. Dalam penelitian ini digunakan perangkat lunak FLUENT 6.3. Analisis termal aliran pada kisi bola bahan bakar dilakukan dengan memodelkan dinamika fluida pendingin dengan perpindahan panas kombinasi tiga moda, konduksi, konveksi dan radiasi, serta mempertimbangkan adanya turbulensi aliran gas. Model Discret Ordinate dan Reynolds-Averaged Navier-Stokes (RANS masing-masing digunakan dalam perhitungan perpindahan panas radiasi dan turbulensi. Dari distribusi temperatur bola bahan bakar hasil pemodelan CFD dengan aliran turbulen pada pendinginnya diketahui bahwa temperatur maksimum bahan bakar bola mencapai 1036,1OC. Temperatur setinggi ini masih jauh dari temperatur yang dapat menyebabkan kegagalan pengungkungan produksi fisi, yaitu 1600OC. Kata kunci: pemodelan pendinginan, model kisi kubus sederhana, reaktor kogenerasi, RGTT, komputasi dinamika fluida   In accordance to the Presidential Regulation No.5/2010, PTRKN-BATAN develops two variants

  1. Angle-resolved photoemission study of Ag(1 1 1)

    Science.gov (United States)

    Edamoto, K.; Miyazaki, E.; Shimokoshi, K.; Kato, H.

    1990-01-01

    The (1 1 1) face of Ag has been studied by angle-resolved photoemission spectroscopy utilizing synchrotron radiation as the excitation source (25 FIRO method. The peak positions thus determined are used to map the dispersion curves along the lang1 1 1rang (Γ-L) direction. The results show general agreement with calculated band structure, so far as the energy levels and symmetries are concerned. However, it is found that the density of state effect is dominant in the spectra obtained in the present photon energy region. The emission from the Ag 5s, p bands is observed to be broadened due to the indirect transition process.

  2. Main: JASE1ATOPR1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available JASE1ATOPR1 S000388 20-Feb-2002 (last modified) uchi JASE1found in promoter of Arab...ed in up-regulation by both senescence and JA; OPR1; senescence; Jasmonic acid; JASE1; JASE2; leaf; Arabidopsis thaliana CGTCAATGAA ... ...idopsis thaliana 12-oxo-phytodienoic acid-10,11-reductase (OPR1) gene; Located between -179 and -170; Involv

  3. Highly selective and potent agonists of sphingosine-1-phosphate 1 (S1P1) receptor.

    Science.gov (United States)

    Vachal, Petr; Toth, Leslie M; Hale, Jeffrey J; Yan, Lin; Mills, Sander G; Chrebet, Gary L; Koehane, Carol A; Hajdu, Richard; Milligan, James A; Rosenbach, Mark J; Mandala, Suzanne

    2006-07-15

    Novel series of sphingosine-1-phosphate (S1P) receptor agonists were developed through a systematic SAR aimed to achieve high selectivity for a single member of the S1P family of receptors, S1P1. The optimized structure represents a highly S1P1-selective and efficacious agonist: S1P1/S1P2, S1P1/S1P3, S1P1/S1P4>10,000-fold, S1P1/S1P5>600-fold, while EC50 (S1P1) <0.2 nM. In vivo experiments are consistent with S1P1 receptor agonism alone being sufficient for achieving desired lymphocyte-lowering effect.

  4. APE1/Ref-1: versatility in progress.

    Science.gov (United States)

    Jeon, Byeong Hwa; Irani, Kaikobad

    2009-03-01

    Apurinic/apyrimidinic endonuclease1/redox factor-1 (APE1/Ref-1) is a multifunctional protein involved in base excision DNA repair and in transcriptional regulation of gene expression. Over the past decade and a half, knowledge of the biological functions, interactions, mechanisms of action, and regulation of the protein APE1/Ref-1 has grown exponentially. The multifunctional nature of APE1/Ref-1 is uncovering and has been extensively studied in the cellular response against oxidative stress. Recent evidence shows a biological role of APE1/Ref-1 can be modulated by the different post-translational modification. Because of APE1/Ref-1 importance to genomic stability and cell survival, APE1/Ref-1 is focused as the leading therapeutic target molecule for the oxidative stress condition or pathologic conditions such as cancer. This forum, dedicated to APE1/Ref-1, provides ample testimony that even though we have learned a great deal about APE1/Ref-1 over the past 15-plus years, our knowledge still constitutes the tip of the iceberg when it comes to understanding this versatile protein.

  5. KINERJA KATALIS Ag/Al2O3 UNTUK REDUKSI NOx

    Directory of Open Access Journals (Sweden)

    Rakhman Sarwono

    2012-02-01

    Full Text Available NOx merupakan hasil samping dari suatu reaksi pembakaran. NOx merupakan gas yang beracun sangat berbahaya terhadap kesehatan manusia dan hewan bila terhirup pada waktu bernafas. Untuk mengurangi kadar NOx pada gas buang, banyak penelitian diarahkan pada reduksi NOx dengan katalis secara selektif dengan hidrokarbon dan oksigen berlebihan. Katalis yang digunakan adalah katalis alumina (Al2O3 yang didapat dari katalis komersial (AlO1-7 dan katalis hasil sintesa (ALOA. Katalis Ag/Al2O3 didapat dengan memasukkan logam Ag ke dalam alumina (Al2O3 dengan cara impregnasi dengan larutan perak nitrat. Katalis diuji aktifitasnya pada reaktor fixed bed yang diluarnya terdapat pemanas yang bisa diatur suhunya. Reaktan seperti gas NO, C2H4  dan oksigen dimasukkan kedalam reaktor dengan laju yang ditentukan. Hasil reaksi dianalisa dengan gas chromatography dan dicatat pada recorder, selanjutnya bisa ditentukan kuantitas dan prosentase konversinya. Katalis alumina  ALOA mempunyai kemampuan mereduksi NO dengan konversi  sekitar 40-45% gas NO menjadi N2. Loading logam perak (Ag kedalam Al2O3 sebesar 2-3% berat menambah daya reduksi NO menjadi sekitar 45-50% pada suhu 500oC. Pada umpan NO + C2H4  + O2  reaksi reduksi terjadi pada suhu 300oC, sedangkan pada umpan NO + C2H4   (tanpa oksigen reaksi reduksi baru terjadi pada suhu 450oC, dengan demikian adanya oksigen sangat berperan dalam proses reduksi NOx. Reaksi peruraian C2H4 menjadi COx berkebalikan dengan kinerja katalis pada proses reduksi NOx

  6. Superconformal SU(1,1|n) mechanics

    CERN Document Server

    Galajinsky, Anton

    2016-01-01

    Recent years have seen an upsurge of interest in dynamical realizations of the superconformal group SU(1,1|2) in mechanics. Remarking that SU(1,1|2) is a particular member of a chain of supergroups SU(1,1|n) parametrized by an integer n, here we begin a systematic study of SU(1,1|n) multi-particle mechanics. A representation of the superconformal algebra su(1,1|n) is constructed on the phase space spanned by m copies of the (1,2n,2n-1) supermultiplet. We show that the dynamics is governed by two prepotentials V and F, and the Witten-Dijkgraaf-Verlinde-Verlinde equation for F shows up as a consequence of a more general fourth-order equation. All solutions to the latter in terms of root systems reveal decoupled models only. An extension of the dynamical content of the (1,2n,2n-1) supermultiplet by angular variables in a way similar to the SU(1,1|2) case is problematic.

  7. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1970-01-01

    The reaction of dipotassium 2-nitroethylene-1,1-dithiolate (III) with α-halogeno aldehydes or ketones leads to derivatives of 3-nitro-thiophene-2-thiols. These reactions proceed by an acid catalyzed cyclization of the initially formed 1-(acylmethylthio)-2-nitroethylene-1-thiolates (IV). The infra...

  8. Superconformal SU(1, 1|n) mechanics

    Science.gov (United States)

    Galajinsky, Anton; Lechtenfeld, Olaf

    2016-09-01

    Recent years have seen an upsurge of interest in dynamical realizations of the superconformal group SU(1, 1|2) in mechanics. Remarking that SU(1, 1|2) is a particular member of a chain of supergroups SU(1, 1| n) parametrized by an integer n, here we begin a systematic study of SU(1, 1| n) multi-particle mechanics. A representation of the superconformal algebra su(1, 1| n) is constructed on the phase space spanned by m copies of the (1, 2 n, 2 n-1) supermultiplet. We show that the dynamics is governed by two prepotentials V and F, and the Witten-Dijkgraaf-Verlinde-Verlinde equation for F shows up as a consequence of a more general fourth-order equation. All solutions to the latter in terms of root systems reveal decoupled models only. An extension of the dynamical content of the (1, 2 n, 2 n-1) supermultiplet by angular variables in a way similar to the SU(1, 1|2) case is problematic.

  9. Main: SITE1SORPS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SITE1SORPS1 S000211 11-May-2006 (last modified) kehi Site 1 in the spinach (S.o.) r...er; Related to GT elements; For a compilation of related GT elements and factors, see Villain et al. (1996); See S000215 (S1FSOR

  10. Adsorption and hydrogenation of CO on Pd( 1 1 1 ) and Rh( 1 1 1 ) modified by subsurface vanadium

    Science.gov (United States)

    Klötzer, Bernhard; Unterberger, Werner; Hayek, Konrad

    2003-06-01

    On Pd(1 1 1) and Rh(1 1 1) a subsurface alloy of V atoms located mainly in the second metal layer is formed by vapor deposition of V at elevated temperatures. The topmost layer consists exclusively of Pd or Rh atoms in √3×√3 R30° geometry. Neither reversible adsorption of CO under UHV conditions nor hydrogenation of CO at atmospheric pressure lead to surface segregation of V compounds. Numerical simulation and threshold temperature programmed desorption analysis of CO TPD series obtained from the clean and V modified samples showed that the presence of subsurface V significantly reduces the desorption energy of molecular CO over a wide coverage range and changes the coverage-dependence of the desorption energy. The presence of subsurface V atoms promotes CO hydrogenation on both Pd(1 1 1) and Rh(1 1 1). The enhanced catalytic activity is interpreted in view of the reduced CO desorption energies and of surface roughening induced by subsurface alloy growth.

  11. Main: 1TE1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1TE1 小麦 Bread Wheat Triticum aestivum Xylanase Inhibitor Protein I Precursor. Name=...Xipi; Triticum Aestivum Molecule: Xylanase Inhibitor Protein I; Chain: A; Synonym: Xip-1; Molecule: Endo-1,4-Xylanase; Chain...: B; Synonym: Gh11; Engineered: Yes Hydrolase Inhibitor/Hydrolase 3.2.1.8 (Endo-1,4-Xylanase...rand, P.Manzanares, H.J.Gilbert, N.Juge, A.Roussel The Dual Nature Of The Wheat Xylanase Protein Inhibitor X

  12. XBZ1, XBJ1 Intelligent Transformer Substation

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    After conducting in-depth studies on and making improvements to the operational conditions of the current transformer substation, the advanced technology of the XBZ1 intelligent transformer substation and XBJ1 pre-installed transformer

  13. Adamkus : EU might be willing to negotiate on postponing Ignalina reactor closure

    Index Scriptorium Estoniae

    2008-01-01

    President Valdas Adamkus teatas võimalusest, et EL alustab arutelu Ignalina tuumaelektrijaama sulgemise edasilükkamisest. Uue jaama valmimise aeg pole teada ning praegune reaktor on tänu rootslaste abile turvaline

  14. Põhja-Korea lubas taas jätta tuumaplaanid / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2007-01-01

    Pekingis toimunud kuuepoolsete desarmeerimiskõneluste tulemusena on Põhja-Korea nõus andma ülevaate riigi tuumarajatistest ning alustama nende likvideerimist. 14. juulil suleti Yongbyoni tuumakeskuse reaktor. Lisa: Tuumavaidlus

  15. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1972-01-01

    A series of thieno[3,2-e]-3,4-dihydro-1,2,3-triazin-4-ones (V) and thieno[3,4-e]-3,4-dihydro-1,2,3-triazin-4-ones (VI) were prepared by diazotation of 3-aminothiophene-2-carboxamides (III) and 4-amino-thiophene-3-carboxamides (IV), respectively, both obtained by cyclization of 2-cyanoethylene-1,1...

  16. Main: GARE1OSREP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available GARE1OSREP1 S000419 28-November-2004 (last modified) kehi Gibberellin-responsive element (GARE...) found in the promoter region of a cystein proteinase (REP-1) gene in rice; See S000020; aleurone; GARE; gibberellin; seed; Oryza sativa (rice) TAACAGA ...

  17. Reference: SB1NPABC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SB1NPABC1 Grec S, Vanham D, de Ribaucourt J, Purnelle B, Boutry P. Identification o...f regulatory sequence elements within the transcription promoter region of NpABC1, a gene encoding a plant ABC

  18. Reference: MNF1ZMPPC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MNF1ZMPPC1 Morishima A Identification of preferred binding sites of a light-inducib...le DNA-binding factor (MNF1) within 5'-upstream sequence of C4-type phosphoenolpyruvate carboxylase gene in maize Plant Mol Biol 38:633-646 (1998) PubMed: 9747808; ...

  19. Reference: L1DCPAL1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1DCPAL1 Takeda J, Ito Y, Maeda K, Ozeki Y. Assignment of UVB-responsive cis-elemen...anine ammonia-lyase gene (gDcPAL1). Photochem Photobiol. 76:232-238 (2002). PubMed: 12194222 ...

  20. Main: ELRE1PCPAL1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available light response elements (LRE) found in the parsley (P.c.) phenylalanine ammonia-lyase (PAL-1) gene promoter... See S000307; phenylalanine ammonia-lyase (PAL); UV; elicitor; light; leaf; shoot; parsley (Petroselinum crispum) CTCCAACAAACCCCTTC ... ...ELRE1PCPAL1 S000306 10-Feb-2000 (last modified) seki One of two elicitor (ELRE) and

  1. Cuba vs H1N1 Influenza

    Directory of Open Access Journals (Sweden)

    Gail Reed

    2011-04-01

    Full Text Available El Comité Editorial de MediSur agradece a Gail Reed, editora de Medicc Review la autorización expresa, para reproducir el artículo titulado “Cuba vs H1N1 Influenza”. Este trabajo resume el esfuerzo realizado por todos los organismos en Cuba y en especial el Ministerio de Salud Pública en la lucha para disminuir los efectos de la influenza H1N1 en la población. El artículo original se puede encontrar en: Reed G. Faceoff: Cuba vs H1N1 Influenza. MEDICC Review. 2010; 12(1:6-12. Disponible en: http://www.medicc.org/mediccreview/index.php?issue=11

  2. PENGARUH NILAI BAKAR TERHADAP INTEGRITAS KELONGSONG ELEMEN BAKAR TRIGA 2000

    OpenAIRE

    K.A. Sudjatmi

    2015-01-01

    Bentuk elemen bakar reaktor TRIGA Bandung adalah silinder padat yang merupakan campuran homogen paduan uranium dan zirkonium hidrida. Pada saat reaktor beroperasi, suhu elemen bakar akan bertambah, akibatnya akan menaikan tekanan gas-gas yang ada di dalam kelongsong elemen bakar. Tekanan gas yang timbul dalam kelongsong elemen bakar merupakan penjumlahan tiga komponen tekanan yaitu tekanan akibat udara yang terperangkap antara kelongsong dengan bahan bakar, tekanan oleh gas hasil fisi yang te...

  3. Modifikasi Mekanisme Koufopanos pada Kinetika Reaksi Pirolisis Ampas Tebu (Bagasse)

    OpenAIRE

    Erawati, Emi; Sediawan, Wahyudi Budi; Mulyono, Panut

    2014-01-01

    Ampas tebu merupakan produk samping dari ekstraksi gula. Ampas tebu yang dihasilkan di pabrik gula sekitar 13% dari tebu yang digiling. Tujuan penelitian ini adalah menentukan energi aktivasi dan pre-exponential factor pada persamaan kinetika reaksi pirolisis ampas tebu. Pirolisis dilakukan dalam reaktor yang terbuat dari pipa besi jenis 5737 dengan diameter 7,62 cm dan panjang 37 cm. Reaktor ini dimasukkan ke dalam furnace yang berdiameter 15,24 cm dan panjang 40 cm. Seratus lima puluh...

  4. Prism. Volume 1, Number 1, December 2009

    Science.gov (United States)

    2009-12-01

    Susan B. Epstein , U.S. Embassy in Iraq (Washington, DC: CRS, October 24, 2006), figure 1. 18 The “clear-hold-build” approach to counterinsurgency is...staff of other agencies, such as the Coast Guard, Central Intelligence Agency, and National Security Agency. See Edward F. Bruner, “Military Forces...Reconstruction Roles, ed. Joseph Cerami and Jay Boggs (Carlisle, PA: Strategic Studies Institute, 2007). 102 | leSSoNS leaRNed PRISM 1, no. 1 10

  5. Construction of HEK293 cells stably expressing wild-type organic anion transporting polypeptide 1B1 (OATP1B1*1a) and variant OATP1B1*1b and OATP1B1*15.

    Science.gov (United States)

    Chen, M; Qu, B X; Chen, X L; Hu, H H; Jiang, H D; Yu, L S; Zhou, Q; Zeng, S

    2016-06-01

    A transgenic cell line stably expressing the human organic anion transporting polypeptide (OATP1B1) was established. Human Embryonic Kidney 293 (HEK293) cell line stably expressing OATP1B1*1a sequence was amplified through PCR with the extracted total RNA as templates from human liver, then subcloned into the plasmid pMD19-T and verified by sequencing. OATP1B1*1b/OATP1B1*15 mutant sequences were obtained by site-directed mutation PCR with pMD19-T/ OATP1B1*1a as templates. The plasmids pcDNA3.1(+)/OATP1B1*1a, *1b and *15 were constructed and transfected into HEK293 cell line using Lipofectamine 2000 transfection reagent. Several stable transfected clones were obtained after selection with G418. Using rosuvastatin as a probe substrate of OATP1B1, the intracellular rosuvastatin accumulation in HEK293 and HEK-OATP1B1*1a, *1b and *15 monoclone cells were validated by a ultra-performance liquid chromatography-tandem mass spectrometry. OATP1B1 mRNA and protein expression were detected by RT-PCR and Western blot, respectively. The results from RT-PCR, rosuvastatin uptake and Western blot assay indicated that human OATP1B1 was highly expressed in transfected cells compared with controls. The HEK-293 cell lines stably expressing human OATP1B1-wild and variant (HEK-OATP1B1, *1b and *15) are potential models to study drug transport in vitro.

  6. Efek Durasi Pencahayaan Pada Sistem HRAR Untuk Menurunkan Kandungan Minyak Solar Dalam Air Limbah

    Directory of Open Access Journals (Sweden)

    Dian Puspitasari

    2014-09-01

    Full Text Available Kandungan minyak di dalam air limbah industri perminyakan umumnya bersifat toksik terhadap mikroorganisme dan mengganggu proses pengolahan secara biologis. Sistem HRAR diperkirakan dapat mengatasi hambatan tersebut melalui proses fotosintesis untuk menghasilkan oksigen yang dibutuhkan mikroorganisme dalam mendegradasi senyawa hidrokarbon. Penelitian ini bertujuan mengkaji pengaruh perpanjangan waktu pencahayaan pada kemampuan HRAR dalam menurunkan kandungan minyak di dalam limbah. Variabel yang digunakan pada penelitian ini adalah variasi durasi pencahayaan dan variasi penambahan volume minyak solar yang ditambahkan ke dalam reaktor. Variasi durasi pencahayaan yang digunakan adalah pencahayaan selama 12 jam dan pencahayaan selama 24 jam. Sedangkan penambahan volume minyak solar ke dalam masing-masing reaktor adalah sebesar 346 ppm, 519 ppm dan 692 ppm. Hasil yang didapatkan dari penelitian ini adalah durasi pencahayaan selama 12 jam memiliki efek yang lebih baik terhadap penurunan konsentrasi minyak dibandingkan pencahayaan selama 24 jam. Hal ini dapat terlihat dari baiknya pertumbuhan alga dan bakteri di dalam reaktor serta tingginya penurunan konsentrasi minyak solar di dalamnya. Penurunan konsentrasi minyak solar terbaik terdapat pada reaktor dengan penambahan minyak solar sebesar 346 ppm. Pada reaktor dengan durasi pencahayaan selama 12 jam terjadi penurunan konsentrasi minyak sebesar 78,4%. Sedangkan penurunan kandungan minyak solar pada reaktor dengan durasi pencahayaan selama 24 jam adalah sebesar 73,9%.

  7. 36 CFR 1.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... § 1.1 Purpose. (a) The regulations in this chapter provide for the proper use, management, government... purposes of units of the National Park System: to conserve scenery, natural and historic objects, and wildlife, and to provide for the enjoyment of those resources in a manner that will leave them...

  8. ME1/1 Cathode Strip Chambers

    CERN Document Server

    Erchov, Yu V; Kamenev, Alexey; Karjavin, Vladimir; Khabarov, Serguei; Moissenz, P V; Moissenz, K P; Movchan, Sergey; Perelygin, Victor; Vassiliev, S E; Zarubin, Anatoli; Tchekhovski, V A

    2008-01-01

    The 76 innermost ME1/1 cathode strip chambers (CSC) of the CMS Experiment were designed and produced in Dubna. The chambers have been installed in the detector and commissioning has been completed. This paper describes the design of the CSCs, their main mechanical parameters and read-out electronics, and the results of tests with cosmic-ray muons.

  9. 26 CFR 1.1275-1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... for the exception in section 1275(a)(1)(B)(i) only in cases where the life contingency under the... surrender option—(i) Impact on life contingency. The availability of a cash surrender option can... described in section 1275(a)(1)(B)(i). (5) Minimum payout provision—(i) Impact on life contingency....

  10. General Relativity in (1 + 1) Dimensions

    Science.gov (United States)

    Boozer, A. D.

    2008-01-01

    We describe a theory of gravity in (1 + 1) dimensions that can be thought of as a toy model of general relativity. The theory should be a useful pedagogical tool, because it is mathematically much simpler than general relativity but shares much of the same conceptual structure; in particular, it gives a simple illustration of how gravity arises…

  11. Ciencias 1. (Science 1). [Student's Workbook].

    Science.gov (United States)

    Raposo, Lucilia

    Ciencias 1 is the first in a series of science books designed for elementary Portuguese-speaking students. The book contains five sections divided into 43 lessons. The five sections are (1) Matter, (2) The Human Body, (3) Weather, (4) Solids, Liquids, and Gases, and (5) Living Things. Pictorial presentations and picture exercises are included for…

  12. Antiviral Prophylaxis and H1N1

    Centers for Disease Control (CDC) Podcasts

    2011-07-14

    Dr. Richard Pebody, a consultant epidemiologist at the Health Protection Agency in London, UK, discusses the use of antiviral post-exposure prophylaxis and pandemic H1N1.  Created: 7/14/2011 by National Center for Emerging Zoonotic and Infectious Diseases (NCEZID).   Date Released: 7/18/2011.

  13. Main: BOXCPSAS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available BOXCPSAS1 S000226 10-May-1998 (last modified) kehi Box C in pea (P.s.) asparagine synthetase (AS...1) gene; Found at -45; AS1 is negatively regulated by light; Box C binds with nuclear proteins, which was... competed by a putative repressor element RE1 (see S000195); BOX C; AS; AS1; pea (Pisum sativum) CTCCCAC ...

  14. Reference: EECCRCAH1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available EECCRCAH1 Yoshioka S, Taniguchi F, Miura K, Inoue T, Yamano T, Fukuzawa H. The nove...l Myb transcription factor LCR1 regulates the CO2-responsive gene Cah1, encoding a periplasmic carbonic anhy

  15. Main: AMMORESIVDCRNIA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMMORESIVDCRNIA1 S000375 31-Jul-2001 (last modified) uchi Motif (IVD) found in the Chlamydomonas (C.R.) Nia...1 gene promoter; Located between -51 and -42; Involved in Nia1 transcription repress

  16. Conductors and Newforms for (1,1)

    Indian Academy of Sciences (India)

    Joshua Lansky; A Raghuram

    2004-11-01

    Let be a non-Archimedean local field whose residue characteristic is odd. In this paper we develop a theory of newforms for (1,1)(), building on previous work on $SL_2(F)$. This theory is analogous to the results of Casselman for $GL_2(F)$ and Jacquet, Piatetski-Shapiro, and Shalika for $GL_n(F)$. To a representation π of (1,1)(), we attach an integer () called the conductor of , which depends only on the -packet containing . A newform is a vector in which is essentially fixed by a congruence subgroup of level ()$. We show that our newforms are always test vectors for some standard Whittaker functionals, and, in doing so, we give various explicit formulae for newforms.

  17. User Manual for Whisper-1.1

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Forrest B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rising, Michael Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Alwin, Jennifer Louise [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-26

    Whisper is a statistical analysis package developed in 2014 to support nuclear criticality safety (NCS) validation [1-3]. It uses the sensitivity profile data for an application as computed by MCNP6 [4-6] along with covariance files [7,8] for the nuclear data to determine a baseline upper-subcritical-limit (USL) for the application. Whisper version 1.0 was first developed and used at LANL in 2014 [3]. During 2015- 2016, Whisper was updated to version 1.1 and is to be included with the upcoming release of MCNP6.2. This document describes the user input and options for running whisper-1.1, including 2 perl utility scripts that simplify ordinary NCS work, whisper_mcnp.pl and whisper_usl.pl. For many detailed references on the theory, applications, nuclear data & covariances, SQA, verification-validation, adjointbased methods for sensitivity-uncertainty analysis, and more – see the Whisper – NCS Validation section of the MCNP Reference Collection at mcnp.lanl.gov. There are currently over 50 Whisper reference documents available.

  18. Fluconazole–malonic acid (1/1

    Directory of Open Access Journals (Sweden)

    Nina Lah

    2013-03-01

    Full Text Available Co-crystallizaton of the antifungal drug fluconazole [2-(2,4-difluorophenyl-1,3-bis(1H-1,2,4-triazol-1-ylpropan-2-ol] with malonic acid in acetonitrile solution resulted in the formation of the title 1:1 co-crystal, C13H12F2N6O·C3H4O4. The geometry around the central fluconazole atom is distorted tetrahedral. The dihedral angles between the triazole rings and the fluorinated phenyl ring are 30.64 (7 and 61.91 (5°. In the crystal, the basic packing motif may be envisioned as a cyclic aggregate formed of two fluconazole molecules linked by two malonic acid molecules through O—H...N and O—H...O hydrogen bonds. Such aggregates are further connected into (001 layers by further O—H...N hydrogen bonds. The structure also features weak non-classical C—H...O and C—H...N interactions.

  19. [Glucose transporter type 1 (GLUT-1) deficiency].

    Science.gov (United States)

    Cano, A; Ticus, I; Chabrol, B

    2008-11-01

    Impaired glucose transport across the blood brain barrier results in glucose transporter type 1 (GLUT-1) deficiency syndrome, first described in 1991. It is characterized by infantile seizures refractory to anticonvulsive treatments, microcephaly, delays in mental and motor development, spasticity, ataxia, dysarthria and other paroxysmal neurologic phenomena, often occurring prior to meals. Affected infants are normal at birth following an uneventful pregnancy and delivery. Seizures usually begin between the age of one and four months and can be preceded by apneic episodes or abnormal eyes movements. Patients with atypical presentations such as mental retardation and intermittent ataxia without seizures, or movement disorders characterized by choreoathetosis and dystonia, have also been described. Glucose is the principal fuel source for the brain and GLUT-1 is the only vehicle by which glucose enters the brain. In case of GLUT-1 deficiency, the risk of clinical manifestations is increased in infancy and childhood, when the brain glucose demand is maximal. The hallmark of the disease is a low glucose concentration in the cerebrospinal fluid in a presence of normoglycemia (cerebrospinal fluid/blood glucose ratio less than 0.4). The GLUT-1 defect can be confirmed by molecular analysis of the SCL2A1 gene or in erythrocytes by glucose uptake studies and GLUT-1 immunoreactivity. Several heterozygous mutations, with a majority of de novo mutations, resulting in GLUT-1 haploinsufficiency, have been described. Cases with an autosomal dominant transmission have been established and adults can exhibit symptoms of this deficiency. Ketogenic diet is an effective treatment of epileptic manifestations as ketone bodies serve as an alternative fuel for the developing brain. However, this diet is not effective on cognitive impairment and other treatments are being evaluated. The physiopathology of this disorder is partially unclear and its understanding could explain the clinical

  20. GLP-1 Receptor Agonists

    Science.gov (United States)

    ... in Balance › GLP-1 Receptor Agonists Fact Sheet GLP-1 Receptor Agonists May, 2012 Download PDFs English Espanol Editors Silvio ... are too high or too low. What are GLP-1 receptor agonist medicines? GLP-1 receptor agonist medicines, also called ...

  1. Main: ZDNAFORMINGATCAB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ZDNAFORMINGATCAB1 S000321 13-August-2005 (last modified) kehi Z-DNA-forming sequenc...t redundantly to induce Z-box containing promoters in white light; cab1; light; Z-DNA; leaf; shoot; HY5; COP1; LRE; Z-box; ZBF1; Z-box binding factor; Arabidopsis thaliana ATACGTGT ...

  2. Cold Sores (HSV-1)

    Science.gov (United States)

    ... A Week of Healthy Breakfasts Shyness Cold Sores (HSV-1) KidsHealth > For Teens > Cold Sores (HSV-1) A A A What's in this article? ... or around a person's lips, are caused by herpes simplex virus-1 (HSV-1) . But they don't ...

  3. Application of ultrasonic array transducers and robotics for external inspection of reactor pressure vessels - practical experience from refuelling operations at the Kruemmel NPP in 2000; Einsatz von Ultraschall-Gruppenstrahlerprueftechniken und neuer Robotik bei der Aussenpruefung von Reaktor-Druckbehaeltern - Einsatzerfahrungen im Kernkraftwerk Kruemmel im Brennelementwechsel 2000

    Energy Technology Data Exchange (ETDEWEB)

    Eggers, H.; Hein, E.; Zwahr, B. [Hamburgische Electricitaets-Werke AG, Hamburg (Germany). Abt. Oeffentlichkeitsarbeit; Rathgeb, W.; Schirner, G. [Siemens NDT, Erlangen (Germany)

    2000-07-01

    The performance of a novel testing robot of Siemens NDT and novel testing techniques for inspection of a welded joint for longitudinal and transverse defects is described in great detail. (orig./CB) [German] Im Rahmen einer Pruefgeraetelieferung ist HEW und Siemens NDT uebereingekommen, die gesamte Prueftechnik fuer die Siedewasseraussenpruefung effizienter zu gestalten. Ziel war, mit einem voellig neuen Pruefroboter und neuer Prueftechnik eine Schweissnaht in einem Prueflauf vollstaendig auf Laengs- und Querfehler zu pruefen. Dabei sollten die Umbaumassnahmen zwischen den einzelnen Pruefbereichen, wie den Rundnaehten und den Stutzeneinschweissnaehten, sowie der Stutzenkante entfallen. Die Prueftechnik wurde auf eine moderne Gruppenstrahlerprueftechnik umgestellt. Die dabei erreichbare Pruefdichte sollte zumindest so, wie mit herkoemmlichen Pruefsystemen oder dichter sein. Grundlegende Untersuchungen wurden zur Tandemtechnik angestellt, um mit einer modifizierten Tandemtechnik, bestehend aus zwei Gruppenstrahlerpruefkoepfen, die Wanddicke des SWR-Reaktordruckbehaelters mit maximal fuenf Tandemzonen zu pruefen. (orig.)

  4. Development of an improved methodology for the determination of the neutron load of the pressure vessel steel of WWER-1000 type reactors. Final report; Entwicklung einer fortgeschrittenen Methodik zur Bestimmung der Neutronenbelastung des Druckbehaeltermaterials vom Reaktor des Typs WWER-1000. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Barz, H.U.; Boehmer, B.; Konheiser, J.; Stephan, I.

    1998-05-01

    The investigations, reported on here, are aimed at the theoretical and experimental determination of the neutron exposure of the VVER-1000 reactors Balakovo-3 and Rovno-3. The overall approach, partially developed and at least improved in the frame of this project, comprises the pure calculation part, the gamma spectrometric analysis of neutron activation detectors and the comparison of experimental and theoretical results using the spectrum adjustment procedure. The approach is not restricted to neutron embrittlement but can be applied to neutron fluence problems in general. (orig./GL) [Deutsch] In diesem Projekt wurden fuer die WWER-1000 Reaktoren Balakovo-3 und Rovno-3 die Parameter der Neutronenbelastung experimentell und theoretisch bestimmt. Der vorliegende Bericht beschreibt das methodische Vorgehen, welches aus dem reinen Berechnungsteil, der gammaspektrometrischen Analyse der Ativierungsdetektoren und dem Vergleich der gemessenen und berechneten Werte einschliesslich der Spektrumsjustierung besteht. Dieses Instrumentarium, welches allgemein bei der Bestimmung der Neutronenfluenz anwendbar ist, wurde im Projektzeitraum weiter verbessert. (orig./GL)

  5. Main: ACGTROOT1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACGTROOT1 S000016 31-Jul-2001 (last modified) uchi ACGT motif related to root expre...ssion; Gene: synthetic; perfect palindromic sequence (PA) containing G-box-related sequence; transacting fac...tor: TAF-1 ?; Binding of SGBF-1 (a Soybean G-box binding bZIP transcription factor) to ABRE is enhanced by SCOF-1 (a zinc finger pro...tein ); Transcription of SCOF-1 is induced by low temperature and ABA; ro

  6. The Analysis of HTTP/1.1%HTTP/1.1的分析

    Institute of Scientific and Technical Information of China (English)

    徐健; 王涛

    2004-01-01

    HTTP是互联网中使用得最为广泛的传输协议之一,最新版HTTP/1.1是对HTTP/1.0的改进,提高了浏览速度,增强了安全性等.基于此,笔者对HTTP/1.1的信息进行了详细分析,并简单介绍了MIME编码.

  7. Discoidin Domain Receptor 1

    Science.gov (United States)

    Song, Sunmi; Shackel, Nicholas A.; Wang, Xin M.; Ajami, Katerina; McCaughan, Geoffrey W.; Gorrell, Mark D.

    2011-01-01

    Discoidin domain receptor 1 (DDR1) is a receptor tyrosine kinase that binds and is activated by collagens. Transcriptional profiling of cirrhosis in human liver using a DNA array and quantitative PCR detected elevated mRNA expression of DDR1 compared with that in nondiseased liver. The present study characterized DDR1 expression in cirrhotic and nondiseased human liver and examined the cellular effects of DDR1 expression. mRNA expression of all five isoforms of DDR1 was detected in human liver, whereas DDR1a demonstrated differential expression in liver with hepatitis C virus and primary biliary cirrhosis compared with nondiseased liver. In addition, immunoblot analysis detected shed fragments of DDR1 more readily in cirrhotic liver than in nondiseased liver. Inasmuch as DDR1 is subject to protease-mediated cleavage after prolonged interaction with collagen, this differential expression may indicate more intense activation of DDR1 protein in cirrhotic compared with nondiseased liver. In situ hybridization and immunofluorescence localized intense DDR1 mRNA and protein expression to epithelial cells including hepatocytes at the portal-parenchymal interface and the luminal aspect of the biliary epithelium. Overexpression of DDR1a altered hepatocyte behavior including increased adhesion and less migration on extracelular matrix substrates. DDR1a regulated extracellular expression of matrix metalloproteinases 1 and 2. These data elucidate DDR1 function pertinent to cirrhosis and indicate the importance of epithelial cell–collagen interactions in chronic liver injury. PMID:21356365

  8. Entanglement Tsunami in (1+1)-Dimensions

    CERN Document Server

    Leichenauer, Stefan

    2015-01-01

    We study the time dependence of the entanglement entropy of disjoint intervals following a global quantum quench in (1+1)-dimensional CFTs at large-$c$ with a sparse spectrum. The result agrees with a holographic calculation but differs from the free field theory answer. In particular, a simple model of free quasiparticle propagation is not adequate for CFTs with a holographic dual. We elaborate on the entanglement tsunami proposal of Liu and Suh and show how it can be used to reproduce the holographic answer.

  9. 1.1.Physical method of diganosis.

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    930209 Glinical and radiological diagnosis ofrenal osteodystrophy.CHEN Zhigang (陈志刚),et al.Dept Radiol,1st Affili Hosp,XianMed Univ,710061.Chin J Radiol 1992;26(1):726—729.The authors reported the radiological findingsin 42 cases of renal osteodystrophy as comparedwith 103 cases of chronic renal failure withoutbone changes.The results showed that renalosteodystrophy was closely related to age,sexand duration of renopathy (P<0.05).The au-thors suggested that osteosclerosis was a char-

  10. Survey of ortho-H2D+ (1(1,0)-1(1,1)) in dense cloud cores

    NARCIS (Netherlands)

    Caselli, P.; Vastel, C.; Ceccarelli, C.; van der Tak, F. F. S.; Crapsi, A.; Bacmann, A.

    2008-01-01

    Aims. We present a survey of the ortho-H2D+ (1(1,0)-1(1,1)) line toward a sample of 10 starless cores and 6 protostellar cores, carried out at the Caltech Submillimeter Observatory. The high diagnostic power of this line is revealed for the study of the chemistry, and the evolutionary and dynamical

  11. 44 CFR 1.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... Manual No. 1140.1, “The Formulation, Drafting, Clearance, and Publication of Federal Register Documents... and procedures incorporate those provisions of section 4 of the Administrative Procedure Act (APA) (5 U.S.C. 553) which FEMA will follow. This part and internal FEMA Manuals implement Executive...

  12. Main: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ory Sequence) found in maize and Arabidopsis ferritin genes (Fer1); IDRS is responsible for transcriptional ...IDRSZMFER1 S000445 04-August-2006 (last modified) kehi IDRS (Iron-Dependent Regulat...repression of ZmFer1 gene under low iron supply conditions; S=C/G; K=G/T; IDRS is not involved in the Fe-reg...ulated expression of the AtAPX1 gene (Fourcroy et al., 2004); iron; ferritin; APX1; AtFer1; Fer; Zea mays (maize); Arabidopsis thaliana; CACGAGSCCKCCAC ...

  13. Porcine SLITRK1

    DEFF Research Database (Denmark)

    Larsen, Knud Erik; Momeni, Jamal; Farajzadeh, Leila

    2014-01-01

    The membrane protein SLITRK1 functions as a developmentally regulated stimulator of neurite outgrowth and variants in this gene have been implicated in Tourette syndrome. In the current study we have cloned and characterized the porcine SLITRK1 gene. The genomic organization of SLITRK1 lacks...... introns, as does its human and mouse counterparts. RT-PCR cloning revealed two SLITRK1 transcripts: a full-length mRNA and a transcript variant that results in a truncated protein. The encoded SLITRK1 protein, consisting of 695 amino acids, displays a very high homology to human SLITRK1 (99%). The porcine...

  14. Data of evolutionary structure change: 1CERQ-1GD1O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CERQ-1GD1O 1CER 1GD1 Q O -MKVGINGFGRIGRQVFRILHSRG-VEVALINDLTDNKT...> VAL CA 439 ALA CA 385 LEU CA 456 1GD...1 O 1GD1O VAL CA 371 LYS CA 388 VAL CA 474 1GD...1 O 1GD1O TMVIDGKMVKV

  15. CO adsorption on PdGa(1 0 0), (1 1 1) and (1{sup ¯}1{sup ¯}1{sup ¯}) surfaces: A DFT study

    Energy Technology Data Exchange (ETDEWEB)

    Bechthold, P.; Ardhengi, J.S.; Juan, A., E-mail: cajuan@uns.edu.ar; González, E.A.; Jasen, P.V.

    2014-10-01

    Graphical abstract: - Highlights: • CO adsorption is top on Pd sites for all surfaces. • Our results agree with TDS peak at 210 K for PdGa (1{sup ¯}1{sup ¯}1{sup ¯}) attributed to CO-Pd bond. • Pd-CO bond is formed at expenses of metal-metal bond. No Ga-CO interaction is found. • A back-donation for all surfaces was detected. After adsorption Pd PDOS shift towards lower energies. • IR frequencies for the C-O adsorbed presents a red shift compared to gas phase. - Abstract: CO adsorption on (1 0 0), (1 1 1) and (1{sup ¯}1{sup ¯}1{sup ¯}) planes is analyzed using density functional theory (DFT) calculations. Changes in the electronic structure of these surfaces and CO bond after adsorption are also addressed here. CO is located on Pd atop geometry with a tilted configuration of 7.8° in the (1 0 0) plane, while in the (1 1 1) and (1{sup ¯}1{sup ¯}1{sup ¯}) are perpendicular to the surface. No direct interaction of CO with Ga is detected. The overlap population (OP) of Pd-Pd and Pd-Ga bond decreases as the new Pd-CO bond is formed. In all cases, the C-O bond length changes less than 1% compared to the vacuum but its strength decrease about 50% as determined by the changes in the OP. The effect of CO is limited to its first Pd neighbor. Analysis of orbital interaction reveals that Pd-CO bond mainly involves s-s and s-p orbitals with less participation of Pd 4d orbitals. Computed CO vibration frequencies after adsorption shows a red shift from vacuum towards 1972.9, 1990.4 and 1988.6 cm{sup −1} on (1 0 0), (1 1 1) and (1{sup ¯}1{sup ¯}1{sup ¯}) planes respectively, following the same trend that experimental data on the PdGa intermetallic compound.

  16. Reference: MYCATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MYCATERD1 Simpson SD, Nakashima K, Narusaka Y, Seki M, Shinozaki K, Yamaguchi-Shino...zaki K. Two different novel cis-acting elements of erd1, a clpA homologous Arabidopsis gene function in indu

  17. Reference: ACGTATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACGTATERD1 Simpson SD, Nakashima K, Narusaka Y, Seki M, Shinozaki K, Yamaguchi-Shin...ozaki K. Two different novel cis-acting elements of erd1, a clpA homologous Arabidopsis gene function in ind

  18. Reference: ABRELATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABRELATERD1 Simpson SD, Nakashima K, Narusaka Y, Seki M, Shinozaki K, Yamaguchi-Shi...nozaki K. Two different novel cis-acting elements of erd1, a clpA homologous Arabidopsis gene function in in

  19. Main: MYCATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MYCATERD1 S000413 29-November-2004 (last modified) kehi MYC recognition sequence (f...rom -466 to -461) necessary for expression of erd1 (early responsive to dehydration) in dehydrated Arabidops

  20. Reference: EECCRCAH1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available EECCRCAH1 Kucho K, Yoshioka S, Taniguchi F, Ohyama K, Fukuzawa H. Cis-acting elemen...ts and DNA-binding proteins involved in CO2-responsive transcriptional activation of Cah1 encoding a periplasmic ca

  1. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available IDRSZMFER1 Arnaud N, Murgia I, Boucherez J, Briat JF, Cellier F, Gaymard F. An iron...-induced nitric oxide burst precedes ubiquitin-dependent protein degradation for arabidospsis atfer1 ferritin gene expre

  2. Reference: SRENTTTO1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SRENTTTO1 Takeda S, Sugimoto K, Otsuki H, Hirochika H A 13-bp cis-regulatory elemen...t in the LTR promoter of the tobacco retrotransposon Tto1 is involved in responsiveness to tissue culture, w

  3. A1C test

    Science.gov (United States)

    HbA1C test; Glycated hemoglobin test; Glycosylated hemoglobin test; Hemoglobin glycosylated test; Glycohemoglobin test ... have recently eaten does not affect the A1C test, so you do not need to fast to ...

  4. Vitamin B1

    Science.gov (United States)

    ... Prize Alfred Nobel's Life and Work Teachers' Questionnaire Vitamin B1 - About The Chicken Farm educational game and ... the game window. Reading: "Christian Eijkman, Beriberi and Vitamin B1" - Who was Eijkman and why did he ...

  5. Antagonism between Cry1Ac1 and Cyt1A1 toxins of bacillus thuringiensis

    Science.gov (United States)

    del Rincon-Castro MC; Barajas-Huerta; Ibarra

    1999-05-01

    Most strains of the insecticidal bacterium Bacillus thuringiensis have a combination of different protoxins in their parasporal crystals. Some of the combinations clearly interact synergistically, like the toxins present in B. thuringiensis subsp. israelensis. In this paper we describe a novel joint activity of toxins from different strains of B. thuringiensis. In vitro bioassays in which we used pure, trypsin-activated Cry1Ac1 proteins from B. thuringiensis subsp. kurstaki, Cyt1A1 from B. thuringiensis subsp. israelensis, and Trichoplusia ni BTI-Tn5B1-4 cells revealed contrasting susceptibility characteristics. The 50% lethal concentrations (LC50s) were estimated to be 4,967 of Cry1Ac1 per ml of medium and 11.69 ng of Cyt1A1 per ml of medium. When mixtures of these toxins in different proportions were assayed, eight different LC50s were obtained. All of these LC50s were significantly higher than the expected LC50s of the mixtures. In addition, a series of bioassays were performed with late first-instar larvae of the cabbage looper and pure Cry1Ac1 and Cyt1A1 crystals, as well as two different combinations of the two toxins. The estimated mean LC50 of Cry1Ac1 was 2.46 ng/cm2 of diet, while Cyt1A1 crystals exhibited no toxicity, even at very high concentrations. The estimated mean LC50s of Cry1Ac1 crystals were 15.69 and 19.05 ng per cm2 of diet when these crystals were mixed with 100 and 1,000 ng of Cyt1A1 crystals per cm2 of diet, respectively. These results indicate that there is clear antagonism between the two toxins both in vitro and in vivo. Other joint-action analyses corroborated these results. Although this is the second report of antagonism between B. thuringiensis toxins, our evidence is the first evidence of antagonism between toxins from different subspecies of B. thuringiensis (B. thuringiensis subsp. kurstaki and B. thuringiensis subsp. israelensis) detected both in vivo and in vitro. Some possible explanations for this relationship are discussed.

  6. ORCID implementation in Invenio 1.1

    CERN Document Server

    CERN. Geneva

    2017-01-01

    We present an extension to the Invenio 1.1 software for semi-automatically harvesting ORCID IDs of users and allowing them to upload publications to their respective ORCID profile. This extension was created in the context of the Join2 initiative, however, it can easily be adapted to other Invenio instances because it is only loosely coupled with Invenio itself. It opens its own local webserver to handle the additional endpoints, and calls Invenio API functions and command line programs to interact with the database. We also present a recommended workflow for successfully harvesting ORCID ID in an institution. The implementation is realised in well-documented Python 2.6 and Go and will be published as Free Software.

  7. Materials Science Research Rack-1 (MSRR-1)

    Science.gov (United States)

    2001-01-01

    This scale model depicts the Materials Science Research Rack-1 (MSRR-1) being developed by NASA's Marshall Space Flight Center and the European Space Agency (ESA) for placement in the Destiny laboratory module aboard the International Space Station. The rack is part of the plarned Materials Science Research Facility (MSRF) and is expected to include two furnace module inserts, a Quench Module Insert (being developed by NASA's Marshall Space Flight Center) to study directional solidification in rapidly cooled alloys and a Diffusion Module Insert (being developed by the European Space Agency) to study crystal growth, and a transparent furnace (being developed by NASA's Space Product Development program). Multi-user equipment in the rack is being developed under the auspices of NASA's Office of Biological and Physical Research (OBPR) and ESA. Key elements are labeled in other images (0101754, 0101829, 0101830, and TBD). This image is from a digital still camera; higher resolution is not available.

  8. BACE1 modulates gating of KCNQ1 (Kv7.1) and cardiac delayed rectifier KCNQ1/KCNE1 (IKs).

    Science.gov (United States)

    Agsten, Marianne; Hessler, Sabine; Lehnert, Sandra; Volk, Tilmann; Rittger, Andrea; Hartmann, Stephanie; Raab, Christian; Kim, Doo Yeon; Groemer, Teja W; Schwake, Michael; Alzheimer, Christian; Huth, Tobias

    2015-12-01

    KCNQ1 (Kv7.1) proteins form a homotetrameric channel, which produces a voltage-dependent K(+) current. Co-assembly of KCNQ1 with the auxiliary β-subunit KCNE1 strongly up-regulates this current. In cardiac myocytes, KCNQ1/E1 complexes are thought to give rise to the delayed rectifier current IKs, which contributes to cardiac action potential repolarization. We report here that the type I membrane protein BACE1 (β-site APP-cleaving enzyme 1), which is best known for its detrimental role in Alzheimer's disease, but is also, as reported here, present in cardiac myocytes, serves as a novel interaction partner of KCNQ1. Using HEK293T cells as heterologous expression system to study the electrophysiological effects of BACE1 and KCNE1 on KCNQ1 in different combinations, our main findings were the following: (1) BACE1 slowed the inactivation of KCNQ1 current producing an increased initial response to depolarizing voltage steps. (2) Activation kinetics of KCNQ1/E1 currents were significantly slowed in the presence of co-expressed BACE1. (3) BACE1 impaired reconstituted cardiac IKs when cardiac action potentials were used as voltage commands, but interestingly augmented the IKs of ATP-deprived cells, suggesting that the effect of BACE1 depends on the metabolic state of the cell. (4) The electrophysiological effects of BACE1 on KCNQ1 reported here were independent of its enzymatic activity, as they were preserved when the proteolytically inactive variant BACE1 D289N was co-transfected in lieu of BACE1 or when BACE1-expressing cells were treated with the BACE1-inhibiting compound C3. (5) Co-immunoprecipitation and fluorescence recovery after photobleaching (FRAP) supported our hypothesis that BACE1 modifies the biophysical properties of IKs by physically interacting with KCNQ1 in a β-subunit-like fashion. Strongly underscoring the functional significance of this interaction, we detected BACE1 in human iPSC-derived cardiomyocytes and murine cardiac tissue and observed

  9. Main: GAREHVAMY1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available GAREHVAMY1 S000038 17-May-1998 (last modified) kehi GARE (gibberellic acid responsi...ve element) of barley (H.v.) alpha-amylase gene (Amy 1/6-4); GA3; gibberellic acid; GA; GA3; amylase; Amy1/6-4; GARE; barley (Hordeum vulgare) GGCCGATAACAAACTCCGGCC ...

  10. Main: AMMORESIIUDCRNIA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMMORESIIUDCRNIA1 S000374 31-Jul-2001 (last modified) uchi Motifs (IIU and IID) fou...nd in the Chlamydomonas (C.R.) Nia1 gene promoter; Involved in ammonium-response; Located between -231 and -...219 and also between -76 and -65; Involved in Nia1 transcription activation; W=T/A; nitrate reductase; ammonium response; Chlamydomonas reinhardtii GGWAGGGT ...

  11. Main: AMMORESVDCRNIA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMMORESVDCRNIA1 S000376 31-Jul-2001 (last modified) uchi Motif (VD) found in the Ch...lamydomonas (C.R.) Nia1 gene promoter; Located between -33 and -8; Involved in Nia1 transcription activation; nitrate reductase; amm

  12. Main: WBOXHVISO1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available WBOXHVISO1 S000442 28-Jan-2004 (last modified) kehi SUSIBA2 bind to W-box element i...n barley iso1 (encoding isoamylase1) promoter; sugar; SURE; patatin; WRKY; isoamylase; SUSIBA2; Hordeum vulgare (barley) TGACT ...

  13. Main: ABRELATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABRELATERD1 S000414 01-August-2006 (last modified) kehi ABRE-like sequence (from -1...99 to -195) required for etiolation-induced expression of erd1 (early responsive to dehydration) in Arabidopsis; ABRE; etiolation; erd; Arabidopsis thaliana ACGTG ...

  14. Main: EECCRCAH1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available EECCRCAH1 S000494 24-April-2006 (last modified) kehi EEC; Consensus motif of the tw...o enhancer elements, EE-1 and EE-2, both found in the promoter region of the Chlamydomonas Cah1 (encoding a periplasmic ca

  15. Main: BOXBPSAS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available BOXBPSAS1 S000225 17-May-1998 (last modified) kehi Box B in pea (P.s.) asparagine synthetase (AS...1) gene; Found at -61; AS1 is negatively regulated by light; Box B binds with nuclear proteins; BOX B; AS; AS

  16. Main: RSEPVGRP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available RSEPVGRP1 S000099 13-Feb-2001 (last modified) kehi RSE (root-specific element) of bean (P.v.) GRP...1.8 gene; consensus sequence;See also S000288 and S000289; root; GRP1.8; bean (Phaseolus vulgaris) CAACTTTCATAT ...

  17. Psychoneuroimmunology and HIV-1.

    Science.gov (United States)

    Antoni, Michael H.; And Others

    1990-01-01

    Presents evidence describing benefits of behavioral interventions such as aerobic exercise training on both psychological and immunological functioning among high risk human immunodeficiency virus-Type 1 (HIV-1) seronegative and very early stage seropositive homosexual men. HIV-1 infection is cast as chronic disease for which early…

  18. Melaminium nitrate–melamine–water (1/1/1

    Directory of Open Access Journals (Sweden)

    Farook Adam

    2010-11-01

    Full Text Available In the crystal structure of the title salt, C3H7N6+·NO3−·C3H6N6·H2O, the asymmetric unit consists of two neutral melamine (1,3,5-triazine-2,4,6-triamine molecules, two melaminium cations, two nitrate anions and two solvent water molecules. One of the nitrate anions is disordered over two sets of positions, with a refined occupancy ratio of 0.909 (3:0.091 (3. The cations and neutral molecules are approximately planar, with maximum deviations of 0.018 (2, 0.024 (2, 0.019 (2 and 0.007 (2 Å for each, respectively. In the crystal structure, melaminium cations and netural melamine molecules self-assemble via N—H...N hydrogen bonds to form a supramolecular hexagonal-shaped motif. In addition, the nitrate anions and water molecules are connected by N—H...O hydrogen bonds to form a three-dimensional network.

  19. Polymorphisms in CYP1B1, GSTM1, GSTT1 and GSTP1, and susceptibility to breast cancer.

    Science.gov (United States)

    Van Emburgh, Beth O; Hu, Jennifer J; Levine, Edward A; Mosley, Libyadda J; Perrier, Nancy D; Freimanis, Rita I; Allen, Glenn O; Rubin, Peter; Sherrill, Gary B; Shaw, Cindy S; Carey, Lisa A; Sawyer, Lynda R; Miller, Mark Steven

    2008-05-01

    Polymorphisms in the cytochrome P450 1B1 (CYP1B1) and glutathione S-transferase (GST) drug metabolic enzymes, which are responsible for metabolic activation/detoxification of estrogen and environmental carcinogens, were analyzed for their association with breast cancer risk in 541 cases and 635 controls from a North Carolina population. Each polymorphism, altering the catalytic function of their respective enzymes, was analyzed in Caucasian and African-American women. As reported in previous studies, individual polymorphisms did not significantly impact breast cancer risk in either Caucasian or African-American women. However, African-American women exhibited a trend towards a protective effect when they had at least one CYP1B1 119S allele (OR=0.53; 95% CI=0.20-1.40) and increased risk for those women harboring at least one CYP1B1 432V allele (OR=5.52; 95% CI=0.50-61.37). Stratified analyses demonstrated significant interactions in younger (age CYP1B1 119SS genotype (OR=3.09; 95% CI=1.22-7.84) and younger African-American women with the GSTT1 null genotype (OR=4.07; 95% CI=1.12-14.80). A notable trend was also found in Caucasian women with a history of smoking and at least one valine allele at GSTP1 114 (OR=2.12; 95% CI=1.02-4.41). In Caucasian women, the combined GSTP1 105IV/VV and CYP1B1 119AA genotypes resulted in a near 2-fold increase in risk (OR=1.96; 95% CI=1.04-3.72) and the three way combination of GSTP1 105IV/VV, CYP1B1 119AS/SS and GSTT1 null genotypes resulted in an almost 4-fold increase in risk (OR=3.97; 95% CI=1.27-12.40). These results suggest the importance of estrogen/carcinogen metabolic enzymes in the etiology of breast cancer, especially in women before the age of 60, as well as preventative measures such as smoking cessation.

  20. 1-Methylpiperazine-1,4-diium dipicrate

    Directory of Open Access Journals (Sweden)

    Grzegorz Dutkiewicz

    2011-02-01

    Full Text Available In the crystal structure of the title compound [systematic name: 1-methylpiperazine-1,4-diium bis(2,4,6-trinitrophenolate], C5H14N22+·2C6H2N3O7−, the ionic components are connected by relatively strong N—H...O hydrogen bonds into centrosymmetric six-membered conglomerates, which comprise two dications and four anions. Besides Coulombic interactions, only weak C—H...O interactions and some stacking between picrates (separation between the planes of ca. 3.4 Å but only a small overlapping can be identified between these `building blocks' of the crystal structure. The piperazine ring adopts a chair conformation with the methyl substituent in the equatorial position. In the picrate anions, the twist angles of the nitro groups depend on their positions relative to the phenolate O atom: it is much smaller for the NO2 groups para to the C—O− group [15.23 (9and 3.92 (14°] than for the groups in the ortho positions [28.76 (13–39.84 (11°].

  1. X-1 in flight

    Science.gov (United States)

    1947-01-01

    The Bell Aircraft Corporation X-1-1 (#46-062) in flight. The shock wave pattern in the exhaust plume is visible. The X-1 series aircraft were air-launched from a modified Boeing B-29 or a B-50 Superfortress bombers. The X-1-1 was painted a bright orange by Bell Aircraft. It was thought that the aircraft would be more visable to those doing the tracking during a flight. When NACA received the airplanes they were painted white, which was an easier color to find in the skies over Muroc Air Field in California. This particular craft was nicknamed 'Glamorous Glennis' by Chuck Yeager in honor of his wife, and is now on permanent display in the Smithsonian Institution's National Air and Space Museum in Washington, DC. There were five versions of the Bell X-1 rocket-powered research aircraft that flew at the NACA High-Speed Flight Research Station, Edwards, California. The bullet-shaped X-1 aircraft were built by Bell Aircraft Corporation, Buffalo, N.Y. for the U.S. Army Air Forces (after 1947, U.S. Air Force) and the National Advisory Committee for Aeronautics (NACA). The X-1 Program was originally designated the XS-1 for EXperimental Sonic. The X-1's mission was to investigate the transonic speed range (speeds from just below to just above the speed of sound) and, if possible, to break the 'sound barrier.' Three different X-1s were built and designated: X-1-1, X-1-2 (later modified to become the X-1E), and X-1-3. The basic X-1 aircraft were flown by a large number of different pilots from 1946 to 1951. The X-1 Program not only proved that humans could go beyond the speed of sound, it reinforced the understanding that technological barriers could be overcome. The X-1s pioneered many structural and aerodynamic advances including extremely thin, yet extremely strong wing sections; supersonic fuselage configurations; control system requirements; powerplant compatibility; and cockpit environments. The X-1 aircraft were the first transonic-capable aircraft to use an all

  2. Equine herpesvirus 1 myeloencephalopathy.

    Science.gov (United States)

    Pusterla, Nicola; Hussey, Gisela Soboll

    2014-12-01

    Equine myeloencephalopathy (EHM), an uncommon manifestation of equine herpesvirus 1 (EHV-1) infection, can cause devastating losses on individual farms, boarding stables, veterinary hospitals, and show and racing venues. An improved understanding of EHM has emerged from experimental studies and from data collected during field outbreaks at riding schools, racetracks, horse shows, and veterinary hospitals throughout North America and Europe. These outbreaks have highlighted the contagious nature of EHV-1 and have prompted a reevaluation of diagnostic procedures, treatment modalities, preventative measures, and biosecurity protocols for this disease. This article focuses on recent data related to the cause, epidemiology, pathogenesis, immunity, diagnosis, treatment, and prevention of EHV-1 infection with emphasis on EHM.

  3. Tetrahydroindolizinone NK1 antagonists.

    Science.gov (United States)

    Bao, Jianming; Lu, Huagang; Morriello, Gregori J; Carlson, Emma J; Wheeldon, Alan; Chicchi, Gary G; Kurtz, Marc M; Tsao, Kwei-Lan C; Zheng, Song; Tong, Xinchun; Mills, Sander G; DeVita, Robert J

    2010-04-01

    A new class of potent NK(1) receptor antagonists with a tetrahydroindolizinone core has been identified. This series of compounds demonstrated improved functional activities as compared to previously identified 5,5-fused pyrrolidine lead structures. SAR at the 7-position of the tetrahydroindolizinone core is discussed in detail. A number of compounds displayed high NK(1) receptor occupancy at both 1 h and 24 h in a gerbil foot tapping model. Compound 40 has high NK(1) binding affinity, good selectivity for other NK receptors and promising in vivo properties. It also has clean P(450) inhibition and hPXR induction profiles.

  4. 1-(Trifluoromethyl)vinyllithium

    OpenAIRE

    Chang, Shuh-Kuen

    2009-01-01

    InChI = 1S/C3H2F3.Li/c1-2-3(4,5)6;/h1H2; InChIKey = YDBNXCHLLXTABG-UHFFFAOYSA-N (reagent used as a versatile vinylation component) Physical Data: thermally unstable; decomposes quickly at temperatures above −78 °C. Solubility: soluble in diethyl ether, pentane, and THF. Form Supplied in: not available commercially. Preparative Method: prepared from the reaction of commercially available 2-bromo-3,3,3-trifluoropropene with n-, sec-, or tert-butyllithium in diethyl ether at −1...

  5. X-1 on display

    Science.gov (United States)

    1949-01-01

    A Bell Aircraft Corporation X-1 series aircraft on display at an Open House at NACA Muroc Flight Test Unit or High-Speed Flight Research Station hangar on South Base of Edwards Air Force Base, California. (The precise date of the photo is uncertain, but it is probably before 1948.) The instrumentation that was carried aboard the aircraft to gather data is on display. The aircraft data was recorded on oscillograph film that was read, calibrated, and converted into meaningful parameters for the engineers to evaluate from each research flight. In the background of the photo are several early U.S. jets. These include several Lockheed P-80 Shooting Stars, which were used as chase planes on X-1 flights; two Bell P-59 Airacomets, the first U.S. jet pursuit aircraft (fighter in later parlance); and a prototype Republic XP-84 Thunderjet. There were five versions of the Bell X-1 rocket-powered research aircraft that flew at the NACA High-Speed Flight Research Station, Edwards, California. The bullet-shaped X-1 aircraft were built by Bell Aircraft Corporation, Buffalo, N.Y. for the U.S. Army Air Forces (after 1947, U.S. Air Force) and the National Advisory Committee for Aeronautics (NACA). The X-1 Program was originally designated the XS-1 for eXperimental Sonic. The X-1's mission was to investigate the transonic speed range (speeds from just below to just above the speed of sound) and, if possible, to break the 'sound barrier.' Three different X-1s were built and designated: X-1-1, X-1-2 (later modified to become the X-1E), and X-1-3. The basic X-1 aircraft were flown by a large number of different pilots from 1946 to 1951. The X-1 Program not only proved that humans could go beyond the speed of sound, it reinforced the understanding that technological barriers could be overcome. The X-1s pioneered many structural and aerodynamic advances including extremely thin, yet extremely strong wing sections; supersonic fuselage configurations; control system requirements; powerplant

  6. 2009 H1N1 Influenza 2009 H1N1 Influenza

    Directory of Open Access Journals (Sweden)

    Seth J. Sullivan, MD; Robert M. Jacobson, MD; Walter R. Dowdle, PhD; and Gregory A. Poland

    2011-04-01

    Full Text Available Within 2 months of its discovery last spring, a novel influenza A (H1N1 virus, currently referred to as 2009 H1N1, caused the first influenza pandemic in decades. The virus has caused disproportionate disease among young people with early reports of virulence similar to that of seasonal influenza. This clinical review provides an update encompassing the virology, epidemiology, clinical manifestations, diagnosis, treatment, and prevention of the 2009 H1N1 virus. Because information about this virus, its prevention,and treatment are rapidly evolving, readers are advised to seek additional information. We performed a literature search of PubMed using the following keywords: H1N1, influenza, vaccine, pregnancy, children, treatment, epidemiology, and review. Studies were selected for inclusion in this review on the basis of their relevance. Recent studies and articles were preferred.

    El Editor de este número especial agradece la autorización expresa, mediante comunicación escrita en nuestro poder, de los autores del trabajo “2009 H1N1 Influenza”, así como de los editores de la revista Mayo Clinic Proceedings, para su reproducción, como publicación secundaria en Medisur, artículo de revisión seleccionado por nosotros, que resume buena parte de los nuevos conocimientos adquiridos a partir de la literatura médica reciente relacionada con esta pandemia, durante el año 2009.

    De este modo, el artículo que a continuación de reproduce para los lectores de Medisur, está basado íntegramente en el estudio previamente publicado como: Sullivan SJ, Jacobson RM, Dowdle WR, Poland GA. 2009 H1N1 Influenza. Mayo Clin Proc. 2010;85(1:64-76.

    A continuación el resumen:

    Within 2 months of its discovery last spring, a novel influenza A (H1N1 virus, currently referred to as 2009 H1N1, caused the first influenza pandemic in decades. The virus has caused disproportionate disease among young people with early reports of virulence similar

  7. Main: CAREOSREP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CAREOSREP1 S000421 28-November-2004 (last modified) kehi CAREs (CAACTC regulatory e...lements) found in the promoter region of a cystein proteinase (REP-1) gene in rice; aleurone; GARE; gibberellin; seed; Oryza sativa (rice) CAACTC ...

  8. Excavation of LSS1

    CERN Multimedia

    1972-01-01

    Excavation of the long straight-section LSS1 by an Alpine boring machine. View of the connection chamber, in the background, the roofs of the enlarged sections (8.5 m and 6 m). On the right, the access tunnel to PP1.

  9. Main: ACGTATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACGTATERD1 S000415 03-Jun-2003 (last modified) kehi ACGT sequence (from -155 to -15...2) required for etiolation-induced expression of erd1 (early responsive to dehydration) in Arabidopsis; ACGT; etiolation; erd; Arabidopsis thaliana ACGT ...

  10. Diabetes Type 1

    Science.gov (United States)

    Diabetes means your blood glucose, or blood sugar, levels are too high. With type 1 diabetes, your pancreas does not make insulin. Insulin is ... kidneys, nerves, and gums and teeth. Type 1 diabetes happens most often in children and young adults ...

  11. The No.1 Priority

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    At the beginning of each year, the Central Committee of theCommunist Party of China and the State Council jointly release thefirst document of the year, dubbed the No. 1 Document. The issuediscussed in the No. 1 Document is, of course, the most important to

  12. The No.1 Priority

    Institute of Scientific and Technical Information of China (English)

    YU SHUJUN

    2010-01-01

    @@ At the beginning of each year, the Central Committee of the Communist Party of China and the State Council jointly release the first document of the year, dubbed the No.1 Document. The issue discussed in the No.1 Document is, of course, the most important to the current economic and social development of the country.

  13. Anguillid herpesvirus 1 transcriptome

    NARCIS (Netherlands)

    Beurden, van S.J.; Gatherer, D.; Kerr, K.; Galbraith, J.; Herzyk, P.; Peeters, B.P.H.; Rottier, P.J.M.; Engelsma, M.Y.; Davidson, A.J.

    2012-01-01

    We used deep sequencing of poly(A) RNA to characterize the transcriptome of an economically important eel virus, anguillid herpesvirus 1 (AngHV1), at a stage during the lytic life cycle when infectious virus was being produced. In contrast to the transcription of mammalian herpesviruses, the overall

  14. Moschos' 1. Idyl

    DEFF Research Database (Denmark)

    Nielsen, Thomas Heine

    2009-01-01

    genudgivelse med indledning af Simon meislings oversættelse fra 1824 af Moschos' 1. idyl, Den bortløbne eros. Udgivelsesdato: 2009......genudgivelse med indledning af Simon meislings oversættelse fra 1824 af Moschos' 1. idyl, Den bortløbne eros. Udgivelsesdato: 2009...

  15. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available IDRSZMFER1 Fourcroy P, Vansuyt G, Kushnir S, Inze D, Briat JF. Iron-regulated expre...ssion of a cytosolic ascorbate peroxidase encoded by the APX1 gene in Arabidopsis seedlings. Plant Physiol. 134: 605-613 (2004). . PubMed: 14739345 ...

  16. Singularities around w=-1

    CERN Document Server

    Fernández-Jambrina, L

    2015-01-01

    In this talk we would like to analyse the appearance of singularities in FLRW cosmological models which evolve close to w=-1, where w is the barotropic index of the universe. We relate small terms in cosmological time around w=-1 with the correspondent scale factor of the universe and check for the formation of singularities.

  17. A Distributed Tier-1

    DEFF Research Database (Denmark)

    Fischer, Lars; Grønager, Michael; Kleist, Josva

    2008-01-01

    The Tier-1 facility operated by the Nordic DataGrid Facility (NDGF) differs significantly from other Tier-1s in several aspects: firstly, it is not located at one or a few premises, but instead is distributed throughout the Nordic countries; secondly, it is not under the governance of a single or...

  18. Reference: ACGTROOT1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACGTROOT1 Kim JC, Lee SH, Cheong YH, Yoo CM, Lee SI, Chun HJ, Yun DJ, Hong JC, Lee ...SY, Lim CO, Cho MJ A novel cold-inducible zinc finger protein from soybean, SCOF-1, enhances cold tolerance in transgenic plants Plant J 25: 247-259 (2001) PubMed: 11208017; ...

  19. Reference: BOXBPSAS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available BOXBPSAS1 Ngai N, Tsai FY, Coruzzi G Light-induced transcriptional repression of the pea AS1 gene: identific...ation of cis-elements and transfactors Plant J 12:1021-1234 (1997) PubMed: 9418044; ...

  20. Reference: BOXCPSAS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available BOXCPSAS1 Ngai N, Tsai FY, Coruzzi G Light-induced transcriptional repression of the pea AS1 gene: identific...ation of cis-elements and transfactors Plant J 12:1021-1234 (1997) PubMed: 9418044; ...

  1. Reference: MYBCOREATCYCB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available haracterization of cis-acting element involved in cell cycle phase-independent activation of Arath;CycB1;1 transcription and identifi...cation of putative regulatory proteins. Plant Mol Biol. 50:111-127 (2002). PubMed: 12139003 ...

  2. PD-1 Blockers.

    Science.gov (United States)

    Wolchok, Jedd D

    2015-08-27

    Nivolumab and pembrolizumab are monoclonal antibodies that block the programmed death-1 receptor (PD-1, CD279), resulting in dis-inhibition of tumor-specific immune responses. Both are recently approved for use in the treatment of metastatic melanoma, and nivolumab as well for non-small cell lung cancer.

  3. Main: CACTFTPPCA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CACTFTPPCA1 S000449 19-August-2004 (last modified) kehi Tetranucleotide (CACT) is a...ion of the phosphoenolpyruvate carboxylase (ppcA1) of the C4 dicot F. trinervia; Y=T/C; mesohpyll; CACT; Flaveria trinervia YACT ...

  4. T(1,1,t+1,t,1)和T(1,1,t+2,t,1)的色唯一性%Chromatic Uniqueness of T(1,1,t+1,t,1)and T(1,1,t+2,t,1)

    Institute of Scientific and Technical Information of China (English)

    毛建树; 刘儒英

    2009-01-01

    In this paper,let h(G,x)denote adjoining polynomial of graph G,and β(G)denote the minimum negative real roots of h(G,,x),we prove that T(1,1,t+1,t,1)andT(1,1,t+2,t,1)with t≥3 are chromatically unique.%h(G,x)表示图G的伴随多项式,β(G)表示h(G,x)的最小负实根.证明了当t≥3时,T(1,1,t+1,t,1)和T(1,1,t+2,t,1)的补图的色唯一性.

  5. A Note on Indefinite Equation1/x+1/y+1/z +1/w+1/xyzw=0%关于不定方程1/x+1/y+1/z +1/w+1/xyzw=0的一点注记

    Institute of Scientific and Technical Information of China (English)

    管训贵

    2010-01-01

    利用初等方法研究了不定方程1/x+1/y+1/xyzw=1/z+1/w以及1/x+1/y+1/z=1/w+1/xyzw的正整数解问题,分别给出了它们的全部正整数解的公式:(x,y,z,w)=(n+k,n(n+k)-d/k,n2(n+k)2-n(n+k)d-k/kd,n)其中n,k,d为正整数,满足d|n2(n+k)2-k),d<n(n+k)-k,k|(n2-d) ;以及 (x,y,z,w)=(n+k,n(n+k)+d/k,n2(n+k)2+n(n+k)d-k/kd,n),其中n,k,d为正整数,满足 d|(n2(n+k)2-k) ,d<n2(n+k)2-k,k|(n2+d).

  6. Main: 1W1S [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1S トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...SVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1S.jpg ...

  7. Main: 1W1Q [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1Q トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...SSVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1Q.jpg ...

  8. Main: 1W1R [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1R トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...LLFSSVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1R.jpg ...

  9. Main: 1W1O [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1O トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...SSVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1O.jpg ...

  10. Data of evolutionary structure change: 1B1GA-1CLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1GA-1CLMA 1B1G 1CLM A A KSPEELKGIFEKYAAK-EGDPNQLSKEELKLLLQTEFPS...-- LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSL-----GQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFK...SN CA 464 1CLM A 1CLMA...dbChain> 1CLMA LQDMINEVDADGN HHHHHH 2 1CLM A 1CLMA

  11. Data of evolutionary structure change: 1DTGA-1B1XA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DTGA-1B1XA 1DTG 1B1X A A ---KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVAC...VVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKD...ndex>0 1DTG A 1DTGA A 1DTGA CQLCP-----GCGCS 2 1DTG A 1DTGA

  12. Data of evolutionary structure change: 1BU1A-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1A-1OOTA 1BU1 1OOT A A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW.../line> 1OOT A 1OOTA -19.135000228881836 0.26499998569488525 29.607999801635742 ...0.7739999890327454 0.5450000166893005 0.3240000009536743 tion> 1.8553839921951...in> 1OOT A 1OOTA WTGRV--NGREG

  13. Data of evolutionary structure change: 1BU1B-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1B-1OOTA 1BU1 1OOT B A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW... 1OOT A 1OOTA -18.01099967956543 29.775999069213867 13.968000411987305 ...381469727 -0.722000002861023 -0.6259999871253967 tion> 1.83514404296875...1OOT A 1OOTA WTGRV--NGREG

  14. TELECOM 1 multiservices network

    Science.gov (United States)

    Lombard, D.; Ramat, P.; Rancy, F.

    The main objectives of the TELECOM 1 French domestic satellite project are to set up a business communication network which is to carry a wide range of digital services including data, voice, and pictures between a number of small earth stations located on the subscribers' premises. The parallel development of terrestrial specialized services networks has enabled the fitting of the TELECOM 1 network with high interworking capabilities with these networks. It has also allowed TELECOM 1 to be designed as the basis of the Future Integrated Services Digital Network. The TELECOM 1 network consists of the terrestrial network, the satellite network, and the maintenance network. Various elements which include the terrestrial network; the satellite network, and its modulation, TDMA frame and terminals; the System Management Center; the signalling system; and the demand assignment operation which are involved in the operation of the multiservices network are presented. The TELECOM 1 network evolution until 1990 through the rapid development of the ISDN is discussed.

  15. Type 1 Tyrosinaemia

    LENUS (Irish Health Repository)

    Mannion, MA

    2016-06-01

    Tyrosinaemia type 1 (TYR1, OMIM# 276700) is a rare autosomal recessive disease that results from an enzyme defect that leads to a deficiency in fumarylacetoacetase (FAH)1. We present 3 cases of TYR1 in the Irish population over a 9 year period, the only cases known to have been diagnosed in Ireland since 1989. The common presenting symptom was hypoglycaemia and the diagnosis was made by the identification of the pathognomonic biomarker succinylacetone on urine organic acid analysis. We discuss the clinical presentation, biochemical and genetic results including one novel mutation. We also highlight the importance of early initiation of Nitisinone (NTBC), which reduces the complications of TYR1 and the incidence of liver transplantation in this population2.

  16. THERMAL-HYDRAULIC ANALYSIS OF SMR WITH NATURALLY CIRCULATING PRIMARY SYSTEM DURING LOSS OF FEED WATER ACCIDENT

    Directory of Open Access Journals (Sweden)

    Susyadi Susyadi

    2016-09-01

    ABSTRAK Reaktor daya kecil modular (SMR memiliki beberapa keunggulan dibanding reaktor daya besar konvensional. Dengan disain yang lebih sederhana dan terintegrasi, penerapan hukum alamiah untuk sistem keselamatannya dan biaya modal yang rendah, reaktor ini sangat cocok untuk dibangun di Indonesia. Salah satunya disain SMR yang sedang dikembangkan menerapkan gaya penggerak alami untuk sistim pendingin primernya. Dengan disain seperti itu, adalah sangat penting untuk memahami implikasinya terhadap aspek keselamatan pada seluruh kondisi operasi. Salah satu yang perlu diinvestigasi adalah kecelakaan kehilangan air umpan (LoFW. Pada studi ini, dilakukan analisis kinerja thermal hidrolik SMR yang menggunakan sistim pendinginan primer sirkulasi alam saat kecelakaan LoFW. Tujuannya adalah untuk menginvestigasi karakteristik aliran sistem primer saat kecelakaan LoFW dan untuk memastikan apakah aliran sirkulasi alam cukup untuk memindahkan panas dari teras guna menjaga kondisi tetap aman selama kecelakaan tersebut. Metoda yang digunakan adalah dengan merepresentasikan sistem reaktor ke dalam model-model generik program RELAP5 dan melakukan simulasi numerik. Hasil perhitungan menunjukkan bahwa setelah kejadian pemicu dan trip reaktor, pada sisi primer laju alirnya berfluktuasi secara signifikan dan temperatur pendinginnya menurun secara bertahap sedangkan  pada sisi sekunder kondisi uap berubah menjadi uap jenuh. Laju alir turun dari ~711 kg/detik menjadi ~263 kg/detik sebelum kembali naik lagi pada t=~46 detik. Saat laju alir di titik terendah, temperatur pusat bahan bakar dan fluida pendingin adalah sekitar  ~565 K dan  ~554 K, yang menujukkan bahwa temperatur bahan bakar masih jauh di bawah batas disain dan temperatur fluidanya juga berada di bawah titik saturasi. Keadaan ini menunjukkan bahwa saat transien kedua parameter utama termohidrolik reaktor tetap dalam kondisi yang dapat diterima sehingga dapat disimpulkan  bahwa saat  kecelakaan kehilangan air umpan, SMR

  17. Open Praxis, volumen 1 issue 1

    Directory of Open Access Journals (Sweden)

    Editor Open Praxis

    2007-01-01

    Full Text Available Table of Contents - A Study on the Importance of Fostering Trust in a Distance Learning Community Sónia Sousa, David Lamas & Brian Hudson (1-10 - Teacher Upgrading through Distance Education in a South African Context C. G. Kruger & Prof. E. J. Spamer (11-19 - An Investigation into Delivery of On-Line Courses within an Early Childhood Teacher Education Distance Programme in New Zealand Susan E. Smart (20-29 - Transnational Online Project Management Curriculum Model for Engineering Students Enrique Benimeli Bofarull, Anke Muendler, Peter Haber (30-39 - China Rural Distance Education and Construction of the New Countryside Li Fanghong & Zeng Yichun (40-46 - E-Learning in Japan: Steam Locomotive on Shinkansen Ali E. Ozkul, Ph.D. & Kumiko Aoki, Ph.D.  (47-55 - Widening Access to Higher Education: Open and Distance Learning in Higher Education Setting in Indonesia Paulina Pannen (56-65 - Research and Development of a Costing Toolkit for Distance, Flexible and ICT-Based Education for Teacher Development in Africa Frank R J Banks (66-75 - Fostering E-Learning in Medical Education: The Eurovacc Team Experience Guilherme Andrade Marson, Nathalie Debard, Jean-Pierre Kraehenbuhl, Pascal Py, Yan Cornneille, Laurent Richard, Alain Meystre (76-86 - Program Upgrading Teachers in Education Irene Hardy de Gómez (87-95 - ICT based learning strategies for Educating nomads Yogesh Kulkarni & Dr. Madhav Gaikwad (96-102 - Information and Communication Technology and Distance Education in Brazil Marta de Campos Maia & Fernando de Souza Meirelles (103-112 - ICDE’s interview with Susan D’Antoni, UNESCO International Institute for Educational Planning (IIEP (113-117 - ICDE Task Force Open Educational Resources – Inquiry Results (118-125 - 22nd ICDE – World Conference on Distance Education: Facts and figures (126-131

  18. The Paracaspase MALT1.

    Science.gov (United States)

    Hachmann, Janna; Salvesen, Guy S

    2016-03-01

    The human paracaspase MALT1 is a caspase homolog that plays a central role in NF-κB signaling. Over the past few years it has become clear that this is due to a combination of its scaffolding and proteolytic function. Knockout mice and mice expressing a catalytically dead variant of the protease have provided valuable information. This review aims to provide an overview of recent developments regarding the enzymatic mechanism and specificity of MALT1, its substrates discovered to date, different mouse models, as well as the role of MALT1 in NF-κB signaling downstream of a variety of different receptors.

  19. ATG16L1

    DEFF Research Database (Denmark)

    Salem, Mohammad; Ammitzboell, Mette; Nys, Kris;

    2015-01-01

    Genetic variations in the autophagic pathway influence genetic predispositions to Crohn disease. Autophagy, the major lysosomal pathway for degrading and recycling cytoplasmic material, constitutes an important homeostatic cellular process. Of interest, single-nucleotide polymorphisms in ATG16L1...... (autophagy-related 16-like 1 [S. cerevisiae]), a key component in the autophagic response to invading pathogens, have been associated with an increased risk of developing Crohn disease. The most common and well-studied genetic variant of ATG16L1 (rs2241880; leading to a T300A conversion) exhibits a strong...

  20. Polymer Blends. Volume 1

    Science.gov (United States)

    1992-05-01

    PBI/ ULTEM NEAT RESIN MOLDING EVALUATIONS 18 2.1.3 85/15 PBI/ ULTEM COMPOSITE EVALUATIONS 22 2.1.4 FIRST GENERATION SUMMARY 26 2.2 IMPROVED PBI/"BEST...PBI 37 2.2.4 85/15 eCPBI-2/ ULTEM NEAT RESIN EVALUATIONS 42 2.2.5 SECOND GENERATION SUMMARY 45 2.3 IMPROVED PBI/6F POLYIMIDE BLENDS: THIRD GENERATION...PYROMELLITIC DIANHYDRIDE 100 A1.2 REVIEW AND RISK ANALYSIS 105 iv FIGURES FIGURE PAGE # I HIGH PERFORMANCE POLYMER BLENDS PLAN 6 2 PBI/ ULTEM SEPARATION

  1. Epos Epic 1

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Epic 1书架音箱是Epos新推出的产品,Epic 1的设计十分重视每一个细节。在单元方面,Epic 1所使用的软球顶高音单元和中低音单元都是Epos全新开发的产品。其中,高音单元在设计时运用了CAD仿真软件进行辅助设计,从而保证了单元的品质。

  2. Linac 1, inner structure

    CERN Multimedia

    1968-01-01

    This photo shows the inner structure of Linac 1. As injector to the PS, and later to the Booster, Linac 1 accelerated protons to 50 MeV, but it has also accelerated heavier ions. Fitted with a 520 keV RFQ pre-injector (instead of the original Cockcroft-Walton generator), it delivered protons and heavy ions to LEAR, from 1982 to 1992. After 33 years of faithful service, Linac 1 was dismantled in 1992 to make room for Linac 3 (Pb ions).

  3. Struktur von ABCE1

    OpenAIRE

    Karcher, Annette

    2007-01-01

    ABCE1 ist ein Mitglied der ATP Binding Cassette (ABC) Superfamilie. ABC Proteine binden und hydrolysieren ATP und verändern dabei ihre Konformation. Dadurch können sie mechanochemische Arbeit leisten. Durch drei zusätzliche Domänen unterscheidet sich ABCE1 von allen bislang bekannten und charakterisierten Mitgliedern dieser Familie. Neben den ATP-bindenden Regionen enthält ABCE1 eine cysteinreiche, N-terminale Domäne, welche zwei Eisen-Schwefel-Cluster bindet. Diese Domäne hat hohe s...

  4. Main: MARABOX1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MARABOX1 S000063 13-Feb-2001 (last modified) kehi A-box found in SAR(scaffold attac...hment region; or matrix attachment region, MAR); MAR; SAR; matrix; A-box; scaffold; Drosophila; fly; AATAAAYAAA ...

  5. Mark 1 Test Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Mark I Test Facility is a state-of-the-art space environment simulation test chamber for full-scale space systems testing. A $1.5M dollar upgrade in fiscal year...

  6. Reference: CACTFTPPCA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CACTFTPPCA1 Gowik U, Burscheidt J, Akyildiz M, Schlue U, Koczor M, Streubel M, West...he promoter of the C4 phosphoenolpyruvate carboxylase gene. Plant Cell. 16:1077-1090(2004) PubMed: 15100398 ...

  7. Contaminant Candidate List 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — CCL 1 is a list of contaminants that are currently not subject to any proposed or promulgated national primary drinking water regulations, that are known or...

  8. Reference: CAREOSREP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CAREOSREP1 Sutoh K, Yamauchi D. Two cis-acting elements necessary and sufficient for gibberellin-upre...gulated proteinase expression in rice seeds Plant J. 34:635-645 (2003) PubMed: 12787245; ...

  9. Chapter 1: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2009-01-18

    This report describes analysis undertaken by EERE to better understand the extent to which the technologies and market improvements funded by its fiscal year (FY) 2006 Budget Request1 will make energy more affordable, cleaner, and more reliable.

  10. Class 1 Areas

    Data.gov (United States)

    U.S. Environmental Protection Agency — A "Class 1" area is a geographic area recognized by the EPA as being of the highest environmental quality and requiring maximum protection. Class I areas are areas...

  11. Main: PYRIMIDINEBOXHVEPB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available PYRIMIDINEBOXHVEPB1 S000298 10-Feb-2000 (last modified) seki Pyrimidine box found i... induction; See S000297, S000259; EPB; cysteine proteinase; GA; ABA; GARE; pyrimidine box; seed; aleurone; barley (Hordeum vulgare) TTTTTTCC ...

  12. Reference: PYRIMIDINEBOXHVEPB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available PYRIMIDINEBOXHVEPB1 Cercos M, Gomez-Cadenas A, Ho THD Hormonal regulation of a cyst...dinated gene expression regulated by gibberellins and abscisic acid Plant J 19: 107-118 (1999) PubMed: 10476058 ...

  13. Alpha-1 Antitrypsin Deficiency

    Science.gov (United States)

    ... by blood tests showing the low levels of alpha-1 antitrypsin and abnormal liver tests. Other tests such as ultrasound imaging or tests using specialized X-ray techniques may be necessary. A liver biopsy may ...

  14. Type 1 Diabetes Facts

    Science.gov (United States)

    ... and environmental triggers are involved. Its onset has nothing to do with diet or lifestyle. There is nothing you can do to prevent T1D, and—at present—nothing you can do to get rid of it. ...

  15. Main: ARE1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ARE1 S000022 16-Jan-1998 (last modified) kehi ARE (antioxidant response element); antioxidant... response element of rat glutathione S-transferase Ya subunit, and rat NAD(P)H:quinone reductase genes; antioxidant

  16. Technology in L1

    DEFF Research Database (Denmark)

    Elf, Nikolaj Frydensbjerg; Hanghøj, Thorkild; Skaar, Håvard

    2015-01-01

    In recent decades, several Scandinavian research projects have had an explicit focus on how technology intervenes in L1 (or so-called Mother Tongue Education) practices in Swedish, Norwegian and Danish educational contexts, and how this may impact on understanding of the subject. There is currently...... of empirical stud-ies, what characterizes the research field?; and 3) for discussion, which broader implications does the review suggest for a rethinking of L1 in terms of practice and research? Introducing the notion of educa-tional boundary objects, a theoretical framework is developed, which suggests four...... metaphors for un-derstanding technology within L1: as a tool, as media, as socialization, and as literacy practices. These are found useful for analyzing and comparing both theoretical perspectives and empirical research on L1. A key finding of the study is that, although the included research...

  17. Main: ABADESI1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABADESI1 S000007 10-Feb-2000 (last modified) seki Responsive to ABA and desiccation...; Motif I of rice rab16A-D (initially called rab-21); Expressed in seeds late during embryogenesis; Induced

  18. Type 1 diabetes

    DEFF Research Database (Denmark)

    Green, Anders; Kyvik, Kirsten Ohm

    2001-01-01

    Prediction of Type 1 diabetes at individual level is relevant for any possible intervention before clinical disease develops. Currently available markers of Type 1 diabetes include genetic specificities and immune markers, in addition to a positive family history. This chapter reviews the measures...... and methods of importance in predicting Type 1 diabetes. Based on numerical examples it is demonstrated that available markers have a low level of performance, even when combined. Even so, combined marker information may allow for the identification of the large majority of the general population who...... is at very low disease risk. The impact at population level of predicting Type 1 diabetes varies between societies because the performance of markers depends on levels of disease risk and distribution of markers within a population. The incorporation of the influence of non-genetic etiological factors may...

  19. Probability 1/e

    Science.gov (United States)

    Koo, Reginald; Jones, Martin L.

    2011-01-01

    Quite a number of interesting problems in probability feature an event with probability equal to 1/e. This article discusses three such problems and attempts to explain why this probability occurs with such frequency.

  20. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

  1. Data of evolutionary structure change: 1COBB-1F1GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1COBB-1F1GD 1COB 1F1G B D ATKAVCVLKGDGPVQGTIHFEAKG--DTVVVTGSITGLTE-GDHGFHVHQFGD...NTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLAC...GVIGIAK -VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGN...VKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN ...pdbID>1F1G D 1F1GD FEQASESEPTTV

  2. Data of evolutionary structure change: 1BU1D-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1D-1OOTA 1BU1 1OOT D A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW...14> 1OOT A 1OOTA...tryChain> -21.645000457763672 -6.38100004196167 51.89799880981445 ...76022339 -0.7429999709129333 -0.09000000357627869 tion> 1.78559505939483641OOT A 1OOTA WTGRV--NGREG

  3. Interleukin-1 in malnutrition.

    OpenAIRE

    1986-01-01

    The effect of malnutrition on the in vitro production of interleukin-1 by lipopolysaccharide stimulated circulating monocytes has been investigated in children suffering from kwashiorkor and marasmus. The interleukin-1 activity was significantly lower in children with severe malnutrition. Furthermore, macrophages from children with kwashiorkor produced factors that suppressed mouse thymocyte proliferation. These observations show a significant impairment of macrophage function and provide a m...

  4. Pesticidrester 1. kvartal 2015

    DEFF Research Database (Denmark)

    Andersen, Jens Hinge; Jensen, Bodil Hamborg

    Resultaterne af den danske pesticidkontrol fra Fødevarestyrelsen og DTU Fødevareinstituttet fra 1. kvartal 2015 viser, at ingen af de påviste sprøjterester udgør en sundhedsmæssig risiko.......Resultaterne af den danske pesticidkontrol fra Fødevarestyrelsen og DTU Fødevareinstituttet fra 1. kvartal 2015 viser, at ingen af de påviste sprøjterester udgør en sundhedsmæssig risiko....

  5. External Ballistics. Part 1

    Science.gov (United States)

    1978-07-11

    in -Cable I.1I. LCC 78107109 A6 i laklE 7.1. 2-. rpa 5 8 15 30 60 75 90 120 140 180 L M 556 890 668 3336 6721 8 008 144 155 20016 gay : Al). dey. Eage...unerator and the deo.minator cf the rigbt side cf tk$ Fteceding/revious equality on COSM +16 (v +cooy+ 6) cos + ifter integration let u* bave IB A O , g

  6. Symmetrization Selection Rules, 1

    CERN Document Server

    Page, P R

    1996-01-01

    We introduce a category of strong and electromagnetic interaction selection rules for the two-body connected decay and production of exotic J^{PC} = 0^{+-}, 1^{-+}, 2^{+-}, 3^{-+}, ... hybrid and four-quark mesons. The rules arise from symmetrization in states in addition to Bose symmetry and CP invariance. Examples include various decays to \\eta'\\eta, \\eta\\pi, \\eta'\\pi and four-quark interpretations of a 1^{-+} signal.

  7. Wozu AT1-Rezeptorantagonisten?

    Directory of Open Access Journals (Sweden)

    Berent R

    2000-01-01

    Full Text Available ACE-Hemmer sind nun seit fast 20 Jahren im klinischen Einsatz. Ihre Effektivität in der Behandlung der arteriellen Hypertonie, der Herzinsuffizienz und bei nephrologischen Erkrankungen wurde durch eine große Zahl an randomisierten, prospektiven Studien belegt. Zusätzlich ist das Nebenwirkungsprofil (inklusive seltener Nebenwirkungen dieser Substanzklasse durch die langjährige Anwendung gut dokumentiert. Unter einer AT1-Rezeptorantagonistentherapie konnte bislang eindeutig gezeigt werden, daß das Auftreten von Nebenwirkungen, im speziellen des Reizhustens, deutlich seltener ist und im Placebobereich liegt, was die Compliance der Patienten sicherlich erhöht. Klinisch finden sich allerdings kaum Unterschiede in der Hämodynamik bei der Einnahme von ACE-Hemmern oder AT1-Rezeptorantagonisten. AT1-Rezeptorantagonisten blockieren sicherlich effektiver die AT1-rezeptorvermittelte Vasokonstriktion, währenddessen sich die ACE-Hemmerwirkung aus einer partiellen Abnahme der Angiotensin-II-Bildung und der Akkumulation von Bradykinin zusammensetzt. Aufgrund der derzeitigen Datenlage kann der AT1-Rezeptorantagonist nicht als Alternative zum ACE-Hemmer empfohlen werden, außer ein Absetzen des ACE-Hemmers ist wegen Nebenwirkungen notwendig. Auch die Kombinationstherapie, AT1-Rezeptorantagonist plus ACE-Hemmer, stellt zum jetzigen Zeitpunkt noch keine etablierte Therapie dar.

  8. aflatoxina b1

    Directory of Open Access Journals (Sweden)

    A. Valdivia

    2004-01-01

    Full Text Available Con el objetivo de probar que la suplementación dietética de ácido elágico (AE o N-Acetilcisteína (NAC en pollos de engorda, atenúa los efectos de una intoxicación aguda por la aflatoxina B1 (AFB1, se intoxicaron con AFB1 pura, tres grupos de diez pollos cada uno (3.0 mb/kg pc, IP. Otros tres grupos recibieron solamente el vehículo (aceite de maíz 2.0 ml/kg pc, IP. Cuatro días antes se administró un alimento testigo, o bien, la misma dieta adicionada con AE (2.5 g/kg o NAC (200 mg/kg pc/6 h. A las 24 horas de la administración de AFB1, se cuantificaron las concentraciones hepáticas de glutatión (GSH, de actividad enzimática específica de la transferasa de glutatión (GST, alanina aminotransferasa, aspartato aminotransferasa y de proteínas hepáticas totales. Los resultados mostraron que NAC atenúa el impacto negativo de la AFB1 sobre el crecimiento corporal y al igual que AE, incrementa la GST y revierte parcialmente los efectos de AFB1 sobre GSH, lo cual sugiere que ambas sustancias pudieran conferir un efecto protector de las aves

  9. (4R-4-[(1R-1,2-Dihydroxyethyl]-1-[(1R-1-phenylethyl]pyrrolidin-2-one

    Directory of Open Access Journals (Sweden)

    Peter D. W. Boyd

    2008-09-01

    Full Text Available The title compound, C14H19NO3, was obtained as one of the two isomers of a Sharpless asymmetric dihydroxylation reaction of (1S-1-[(1R-1-phenylethyl]-4-vinylpyrrolidin-2-one. The absolute stereochemistry of this isomer was determined from the known stereochemistry (R at the bridge C atom between the phenyl and pyrrolidine rings. The molecules form one-dimensional tapes along the b axis via hydrogen bonding between the carbonyl O atom and the alcohol groups of neighbouring molecules. These assemble into sheets via interdigitative stacking of the phenyl rings and C—H...O interactions.

  10. 26 CFR 1.1377-1 - Pro rata share.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Pro rata share. 1.1377-1 Section 1.1377-1...) INCOME TAXES Small Business Corporations and Their Shareholders § 1.1377-1 Pro rata share. (a) Computation of pro rata shares—(1) In general. For purposes of subchapter S of chapter 1 of the...

  11. 26 CFR 1.666(a)-1 - Amount allocated.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Amount allocated. 1.666(a)-1 Section 1.666(a)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED... January 1, 1969 § 1.666(a)-1 Amount allocated. (a)(1) If a trust other than a foreign trust created by a...

  12. 26 CFR 1.23-1 - Residential energy credit.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Residential energy credit. 1.23-1 Section 1.23-1... Rates During A Taxable Year § 1.23-1 Residential energy credit. (a) General rule. Section 23 or former section 44C provides a residential energy credit against the tax imposed by chapter 1 of the...

  13. 26 CFR 1.771-1 - Effective date.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Effective date. 1.771-1 Section 1.771-1 Internal... TAXES Effective Date for Subchapter K, Chapter 1 of the Code § 1.771-1 Effective date. (a) General rule.... Certain provisions of section 771 apply after specific dates in 1954, as follows: (1) Adoption of...

  14. 26 CFR 1.11-1 - Tax on corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Tax on corporations. 1.11-1 Section 1.11-1... Corporations § 1.11-1 Tax on corporations. (a) Every corporation, foreign or domestic, is liable to the tax imposed under section 11 except (1) corporations specifically excepted under such section from such...

  15. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  16. Main: 1E1F [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1F トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...QRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1F.jpg ...

  17. A Quantum Monte Carlo Study on Mixed-Spin Chains of 1/2-1/2-1-1 and 3/2-3/2 -1-1

    Institute of Scientific and Technical Information of China (English)

    XU Zhao-Xin; ZHANG Jun; YING He-Ping

    2003-01-01

    The ground-state and thermodynamic properties of quantum mixed-spin chains of1/2-1/2-1-1and 3/2-3/2-1-1are investigated by a quantum Monte Carlo simulation with the loop-cluster algorithm. For 1/2-1/2-1-1 chain, we find it has two phases separated by an energy-gap vanishing point in the ground-state. For 3/2-3/2-1-1 chain, the numerical results show two energy-gap vanishing points isolated by different phases in its ground-state. Our calculations indicate that all these ground state phases can be understood by means of valence-bond-solid picture, and the thermodynamic behavior at finite temperatures is continuous as a function of parameterα=J2/J1.

  18. IUPHAR Review 1

    DEFF Research Database (Denmark)

    Harmar, Anthony J; Fahrenkrug, Jan; Gozes, Illana;

    2012-01-01

    (GHRH). VIP and PACAP exert their actions through three G protein-coupled receptors (GPCRs) - PAC(1) , VPAC(1) and VPAC(2) - belonging to class B (also referred to as class II, or secretin receptor-like GPCRs). This family comprises receptors for all peptides structurally related to VIP and PACAP...... in the control of circadian rhythms, learning and memory, anxiety and responses to stress and brain injury. Recent genetic studies also implicate the VPAC(2) receptor in susceptibility to schizophrenia and the PAC(1) receptor in post-traumatic stress disorder. In the periphery, VIP and PACAP play important roles...... the existing nomenclature for these receptors and reviews our current understanding of their structure, pharmacology and functions and their likely physiological roles in health and disease. More detailed information has been incorporated into newly revised pages in the IUPHAR database (http://iuphar-db.org/DATABASE/FamilyMenuForward?family...

  19. Data of evolutionary structure change: 1BU1F-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1F-1OOTA 1BU1 1OOT F A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEES---GEWW...4> 1OOT A 1OOTA ...in> -2.4820001125335693 10.661999702453613 46.814998626708984 ...8 -0.6930000185966492 -0.30300000309944153 tion> 2.081804037094116 A 1OOTA WTGRV--NGREG

  20. Data of evolutionary structure change: 1BU1C-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1C-1OOTA 1BU1 1OOT C A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEES---GEWW...> 1OOT A 1OOTA -34.0260009765625 9.805000305175781 9.982999801635742 ti...x> -0.800000011920929 -0.42399999499320984 tion> 2.0220730304718018 4...bID> A 1OOTA WTGRV--NGREG

  1. BIOTECHNOLOGY BIOPRODUCTS "HEALING-1"

    Directory of Open Access Journals (Sweden)

    S. I. Artiukhova

    2014-01-01

    Full Text Available Summary. The article presents data on the development of technology and qualitative research, bio-products «Healing-1». One of the promising directions in food biotechnology is the development of new integrated starter-based consortia of microorganisms, which have higher activity compared with cultures prepared using pure cultures. So it was interesting studies on the development of new biotechnology and bio-based microbial consortium of lactic acid bacteria. Based on the analysis of biotechnological properties of native cultures created a new consortium of microorganisms containing lactic acid streptococci and bacilli, allowing the maximum extent possible to implement the physiological, biochemical and technological potential of microorganisms. Scientifically substantiated and experimentally developed a new biotechnology production of bioproducts «Healing-1», obtained on the basis of microbial consortium with broad spectrum antimicrobial activity. Experimentally investigated quality parameters of organic food «Healing-1» using a new microbial consortium as freshly prepared and during storage. Found that antagonistic activity of microflora bio «Healing-1» with respect to pathogenic and conditionally pathogenic bacteria, as well as its resistance to substances in the gastrointestinal tract of man is more pronounced compared to bioproducts obtained using a separate starter, members of the microbial consortium. It should be noted a more pronounced synthesis of exopolysaccharides in bioproduct «Healing-1», which leads to increased viscosity of the system and improves the consistency of bio. New bioproducts have good organoleptic characteristics and contain a high number of viable cells of lactic acid bacteria. High stability and survival of lactic acid bacteria during storage. In the study of attacked proteins bioproducts digestive proteinases «in vitro» found that the fermentation of milk microbial consortium increases the digestibility

  2. Preparation of 1,1'-dinitro-3,3'-azo-1,2,4-triazole. [1,1'-dinitro-3,3'-azo-1,2,4-triazole

    Science.gov (United States)

    Lee, K.Y.

    1985-03-05

    A new high density composition of matter, 1,1'-dinitro-3,3'-azo-1,2,4-triazole, has been synthesized using inexpensive, commonly available compounds. This compound has been found to be an explosive, and its use as a propellant is anticipated. 1 fig., 1 tab.

  3. Microelectronic systems 1 checkbook

    CERN Document Server

    Vears, R E

    2013-01-01

    Microelectronic Systems 1 Checkbook provides coverage of the Business and Technician Education Council level 1 unit in Microelectronic Systems. However, it can be regarded as a basic textbook in microelectronic systems for a much wider range of studies. Each topic considered in the text is presented in a way that assumes the reader has little prior knowledge of electronics. The aim of the book is to provide an introduction to the concept of systems, to differentiate analogue and digital systems, and to describe the nature of microprocessor-controlled systems. An introduction to programming is

  4. 1Q84

    Institute of Scientific and Technical Information of China (English)

    谈墨者

    2011-01-01

    1Q84年——我就这么来称呼这个新世界吧。不管喜欢还是不喜欢,目前我已经置身于这"1Q84年"。我必须尽快适应这个带着问号的世界,像被放进陌生森林中的动物一样,为了生存下去,得尽快了解并顺应这里的规则。

  5. CYP7B1

    DEFF Research Database (Denmark)

    Roos, P; Svenstrup, K; Danielsen, E R

    2014-01-01

    UNLABELLED: The SPG5A subtype of Hereditary Spastic Paraplegia (HSP) is a rare autosomal recessive neurodegenerative disorder caused by mutations in the CYP7B1 gene, which encodes a steroid cytochrome P450 7α-hydroxylase. This enzyme provides the primary metabolic route for neurosteroids. Clinica......UNLABELLED: The SPG5A subtype of Hereditary Spastic Paraplegia (HSP) is a rare autosomal recessive neurodegenerative disorder caused by mutations in the CYP7B1 gene, which encodes a steroid cytochrome P450 7α-hydroxylase. This enzyme provides the primary metabolic route for neurosteroids...

  6. AAU-BOT1

    DEFF Research Database (Denmark)

    Svendsen, Mads Sølver; Helbo, Jan; Hansen, Michael Rygaard;

    2009-01-01

    This paper describes the development of the humanoid robot AAU-BOT1. The purpose of the robot is to investigate human-like walking and in this connection, test prosthetic limbs. AAU-BOT1 has been designed with modularity in mind making it possible to replace, e.g. the lower leg to test transfemoral...... at Aalborg University and supported by the Department of Health Sciences and Technology (HST). To further reduce the cost, the robot uses off-the-shelf hardware which also reduced the time from idea to practical implementation. The result is a low-cost humanoid robot fully assembled and equipped with sensors...

  7. Green syntheses, v.1

    CERN Document Server

    Tundo, Pietro

    2014-01-01

    Introduction to the Green Syntheses SeriesPietro Tundo and John AndraosApplication of Material Efficiency Metrics to Assess Reaction Greenness-Illustrative Case Studies from Organic SynthesesJohn AndraosReaction 1: Synthesis of 3-Benzyl-5-Methyleneoxazolidin-2-one from N-Benzylprop-2-yn-1-Amine and CO2Qing-Wen Song and Liang-Nian HeReaction 2: Synthesis of the 5-Membered Cyclic Carbonates from Epoxides and CO2Qing-Wen Song, Liang-Nian HePart I: Green Methods for the Epoxidation of

  8. Adsorption of water on TiN (1 0 0), (1 1 0) and (1 1 1) surfaces: A first-principles study

    Science.gov (United States)

    Sanyal, Suchismita; Waghmare, Umesh V.; Ruud, James A.

    2011-05-01

    We use first-principles density functional theory-based calculations in the analysis of the interaction of H 2O with (1 0 0), (1 1 0) and (1 1 1) surfaces of TiN, and develop understanding in terms of surface energies, polarity of the surface and chemistry of the cation, through comparison with H 2O adsorption on ZrN. While water molecule physisorbs preferentially at Ti site of (1 0 0) and (1 1 1) surfaces, it adsorbs dissociatively on (1 1 0) surface of TiN with binding stronger than almost 1.32 eV/molecule. Our analysis reveals the following general trends: (a) surfaces with higher energies typically lead to stronger adsorption, (b) dissociative adsorption of H 2O necessarily occurs on a charge neutral high energy surface and (c) lower symmetry of the (1 1 0) plane results in many configurations of comparable stability, as opposed to the higher symmetry (1 0 0) and (1 1 1) surfaces, which also consistently explain the results of H 2O adsorption on MgO available in literature. Finally, weaker adsorption of H 2O on TiN than on ZrN can be rationalized in terms of greater chemical stability of Ti arising from its ability to be in mixed valence.

  9. Krigsfanger under 1. Verdenskrig

    DEFF Research Database (Denmark)

    Krabbe Meyer, Mette Kia

    2016-01-01

    Hvem er de små uniformerede mænd, der stavrer ud af skovbrynet? Nogle med krykker, andre med sygeplejersker eller nydeligt klædte kvinder under armen? Det er krigsfanger, der under 1. Verdenskrig, blev sendt til Danmark for at blive restitueret. Krigsfangelejrene skulle understøtte Danmarks statu...

  10. Editorial 9 (1

    Directory of Open Access Journals (Sweden)

    Jana Dlouhá

    2014-05-01

    [1] A further issue which will be comprised of regional sustainability case studies (working title "Social learning processes for regional sustainable development", see here is still under preparation. Shorter examples of regional development highlighting the roles of its actors are welcome to be included in non-research sections or into the related database.

  11. Reference: ARE1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ARE1 Rushmore TH, Morton MR, Pickett CB The antioxidant responsive element. Activation by oxidative stre...ss and identification of the DNA consensus sequence required for functional activity. J Biol Chem 266:11632-11639 (1991) PubMed: 1646813; ...

  12. Main: POLASIG1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available POLASIG1 S000080 18-November-2005 (last modified) kehi PolyA signal; poly A signal ...found in legA gene of pea, rice alpha-amylase; -10 to -30 in the case of animal genes. Near upstream element

  13. county_1m

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — This is a raster grid dataset (1-Meter Resolution) of the ground points derived from the acquired LiDAR. The Light Detection and Ranging (LiDAR) DEM dataset is a...

  14. Reference: POLASIG1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available POLASIG1 Loke JC, Stahlberg EA, Strenski DG, Haas BJ, Wood PC, Li QQ. Compilation o...f mRNA polyadenylation signals in Arabidopsis revealed a new signal element and potential secondary structures. Plant Physiol. 138: 1457-1468. (2005) in silico PubMed: 15965016 ...

  15. 1,3-Dinitrosoimidazolidine

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2012-08-01

    Full Text Available The title compound, C3H6N4O2, exhibits partial disorder with the refined occupancy ratios of the two components being 0.582 (5:0.418 (5. In the major component, the nitroso groups have a relative syn spatial arrangement [O=N...N=O pseudo-torsion angle = 1.1 (4°], whereas the other component has an anti disposition [177.6 (1°]. The N—N=O moieties are almost coplanar with a dihedral angle of 5.3 (3°, while in the minor occupied set of atoms, this angle is 8 (1°. In both components, the imidazolidine ring adopts a twisted conformation on the C—C bond and the crystal structure shows the strain of this ring according to the N—CH2—CH2—N torsion angles [25.9 (5 and −23.8 (7°]. In the crystal, molecules are linked by weak C—H...O hydrogen bonds.

  16. Frameworks in CS1

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak; Caspersen, Michael Edelgaard

    2002-01-01

    In this paper we argue that introducing object-oriented frameworks as subject already in the CS1 curriculum is important if we are to train the programmers of tomorrow to become just as much software reusers as software producers. We present a simple, graphical, framework that we have successfully...

  17. Unit 1: Labour Law

    OpenAIRE

    Montoya Medina, David

    2014-01-01

    Versión en inglés de la Lección 1ª y de materiales complementarios (diapositivas Pwp y cuestionario) de la asignatura Derecho del Trabajo I del Grado en Derecho. Concepto de Derecho del Trabajo y factores de aparición histórica del Derecho del Trabajo.

  18. Parcelhusatlas 1.0

    DEFF Research Database (Denmark)

    2016-01-01

    Parcelhusatlas 1.0 er et interaktivt GIS-kort i form af en web-app, der kan tilgås fra forskellige platforme. Kortet rummer data om Danmarks parcelhuse, aggregeret på sogneniveau. Referenceåret er 2013. Atlasset rummer forskellige temaer indenfor byggedata, socio-økonomiske data og energiforhold...

  19. Reference: RSEPVGRP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ter, domain A of the 35S promoter and the 35S^2 promoter. Transgenic Res 4:388-396 (1995) PubMed: 7581519; ... ...RSEPVGRP1 Elmayan T, Tepfer M Evaluation in tobacco of the organ specificity and strength of the rol D promo

  20. 26 CFR 1.402A-1 - Designated Roth Accounts.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Designated Roth Accounts. 1.402A-1 Section 1... (CONTINUED) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.402A-1 Designated Roth Accounts. Q-1. What is a designated Roth account? A-1. A designated Roth account is a separate account under...

  1. 38 CFR 1.664-1.666 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false 1.664-1.666 Section 1.664-1.666 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS GENERAL PROVISIONS Inventions by Employees of Department of Veterans Affairs §§ 1.664-1.666 Administrative Control of...

  2. 2009 H1N1 Flu Vaccine Facts

    Science.gov (United States)

    ... please turn Javascript on. Feature: Flu 2009 H1N1 Flu Vaccine Facts Past Issues / Fall 2009 Table of Contents ... the H1N1 flu vaccine. 1 The 2009 H1N1 flu vaccine is safe and well tested. Clinical trials conducted ...

  3. 26 CFR 1.74-1 - Prizes and awards.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Prizes and awards. 1.74-1 Section 1.74-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Items Specifically Included in Gross Income § 1.74-1 Prizes and awards. (a) Inclusion in gross income. (1) Section...

  4. 26 CFR 1.475(g)-1 - Effective dates.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 6 2010-04-01 2010-04-01 false Effective dates. 1.475(g)-1 Section 1.475(g)-1...) INCOME TAXES Inventories § 1.475(g)-1 Effective dates. (a)-(b) (c) Section 1.475(a)-3 (concerning... to apply to the security solely because of the effective dates in this paragraph (d) (rather...

  5. 26 CFR 1.362-1 - Basis to corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Basis to corporations. 1.362-1 Section 1.362-1...) INCOME TAXES Effects on Corporation § 1.362-1 Basis to corporations. (a) In general. Section 362 provides, as a general rule, that if property was acquired on or after June 22, 1954, by a corporation (1)...

  6. Maritza East 1 presentation

    Energy Technology Data Exchange (ETDEWEB)

    Crespi, M.; Haillet, J.-M.; Casier, F. [ALSTOM Power (Italy). Enviornmental Control Systems

    2007-07-01

    The paper describes the project to develop a 670 MW gross and 600 MW net lignite-fired power plant, the AES-3C Maritza East 1, to be realised adjacent to the site of the existing Maritza East 1 power plant. The site is 40 kilometres south-east of Stara Zagora and 250 km south-east of Sofia, Bulgaria. The project will be more efficient and have lower emissions of sulphur dioxide per MW of electricity generated than the existing Maritza East 1 facility. The facility will have low NOx emissions, an electrostatic precipitator to control the emissions of particular matter and a flue gas desulfurization system to control emissions of sulphur dioxide. The AES 3-C Maritza East 1 plant meets all emissions criteria as defined by the Bulgarian Government, the EU and all other relevant authorities unlike the plants at Maritza East 2 and 1 which will either have to retrofit abatement technology in the next few years or face the prospect of limited hours operation and eventual closure after 2008. The new facility will have zero discharge of waste water. Condenser cooling will be provided by a natural draught cooling tower fed in part by process waters. This recycling of water for the cooling tower will significantly reduce the amount of water withdrawn from the lake. In addition, cooling tower blowdown and other potential facility discharges will be used within the wet limestone flue gas desulfurization system. ALSTOM has paid careful attention to all the different aspects involved: minimisation of environmental impact for both air, water and soil by applying state of the art technologies in all the different areas of the project and, at the same time, delivering an economically profitable installation. 2 ills.

  7. 26 CFR 1.1081-1 - Terms used.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Terms used. 1.1081-1 Section 1.1081-1 Internal... TAXES Exchanges in Obedience to S.e.c. Orders § 1.1081-1 Terms used. The following terms, when used in... or securities. Any other term used in this section and §§ 1.1081-2 to 1.1083-1, inclusive, which...

  8. Protein expression of CYP1A1, CYP1B1, ALDH1A1, and ALDH2 in young patients with oral squamous cell carcinoma.

    Science.gov (United States)

    Kaminagakura, E; Caris, A; Coutinho-Camillo, C; Soares, F A; Takahama-Júnior, A; Kowalski, L P

    2016-06-01

    The purpose of this study was to evaluate the expression of the enzymes involved in the biotransformation of tobacco and alcohol. A study group of 41 young patients (≤40 years old) with oral squamous cell carcinoma (OSCC) was compared to 59 control subjects (≥50 years old) with tumours of similar clinical stages and topographies. The immunohistochemical expression of CYP1A1, CYP1B1, ALDH1A1, and ALDH2 was evaluated using the tissue microarray technique. There was a predominance of males, smokers, and alcohol drinkers in both groups. Most tumours were located in the tongue (43.9% vs. 50.8%), were well-differentiated (63.4% vs. 56.6%), and were in clinical stages III or IV (80.5% vs. 78.0%). No difference was observed in the expression of CYP1A1, ALDH1A1, or ALDH2 between the two groups. CYP1A1 and ALDH2 protein expression had no influence on the prognosis. The immunoexpression of CYP1B1 was significantly higher in the control group than in the young group (PCYP1B1 overexpression vs. protein underexpression (64% vs. 25%; PCYP1B1. Further studies involving other genes and proteins are necessary to complement the results of this research.

  9. Epitaxial growth of Bi thin films on Ge(1 1 1)

    Energy Technology Data Exchange (ETDEWEB)

    Hatta, Shinichiro, E-mail: hatta@kuchem.kyoto-u.ac.jp [Department of Chemistry, Graduate School of Science, Kyoto University, Kyoto 606-8502 (Japan); JST CREST, Saitama 332-0012 (Japan); Ohtsubo, Yoshiyuki; Miyamoto, Sanae; Okuyama, Hiroshi [Department of Chemistry, Graduate School of Science, Kyoto University, Kyoto 606-8502 (Japan); Aruga, Tetsuya, E-mail: aruga@kuchem.kyoto-u.ac.jp [Department of Chemistry, Graduate School of Science, Kyoto University, Kyoto 606-8502 (Japan); JST CREST, Saitama 332-0012 (Japan)

    2009-11-30

    We investigated Bi thin film growth on Ge(1 1 1) by using low-energy electron diffraction (LEED) and scanning tunneling microscopy (STM). In the submonolayer regime, adsorbed Bi atoms form patches of the (2x1) structure. However, the structure does not grow to a long-range order. Following the formation of a (1x1) monolayer (ML) film, two-dimensional (1 1 0)-orientated Bi islands grow. The film orientation changes from (1 1 0) to (1 1 1) at 6-10 ML. The (1 1 0)-oriented Bi film shows a six-domain LEED pattern with missing spots, associated with a glide-line symmetry. The hexagonal (1 1 1) film at 14 ML has a lattice constant 2% smaller than bulk Bi(1 1 1).

  10. Crystalline 1H-1,2,3-triazol-5-ylidenes

    Energy Technology Data Exchange (ETDEWEB)

    Bertrand, Guy; Gulsado-Barrios, Gregorio; Bouffard, Jean; Donnadieu, Bruno

    2016-08-02

    The present invention provides novel and stable crystalline 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of making 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes. The present invention also provides methods of using 1H-1,2,3 triazolium carbenes and metal complexes of 1H-1,2,3 triazolium carbenes in catalytic reactions.

  11. Lifetime measurements in sup 1 sup 1 sup 3 In

    CERN Document Server

    Ivascu, M; Cata-Danil, G; Cata-Danil, I; Marginean, N; Ur, C A; Lobach, Yu N

    2003-01-01

    The lifetimes of seven low spin excited states of sup 1 sup 1 sup 3 In have been measured with the Doppler shift attenuation method in the sup 1 sup 1 sup 3 Cd (p,n gamma) reaction at 4.4 and 4.1 MeV incident energy. The structure of this nucleus is discussed by following the systematics of the excited states in sup 1 sup 1 sup 1 sup , sup 1 sup 1 sup 3 sup , sup 1 sup 1 sup 5 In, and in the framework of interacting boson-fermion calculation. (authors)

  12. Main: S1FBOXSORPS1L21 [PLACE

    Lifescience Database Archive (English)

    Full Text Available S1FBOXSORPS1L21 S000223 10-May-1998 (last modified) kehi S1F box conserved both in ...e element; Might play a role in downregulating RPS1 and RPL21 promoter activity (Lagrange et al., 1993); See S000211 (SITE1SOR...PS1), S000215 (S1FSORPL21); S1F; S1F box; S1F-box; S1; plastid protein; RPS1; RPL21; leaf; negative; spinach (Spinacia oleracea) ATGGTA ...

  13. Accurate identification of UDP-glucuronosyltransferase 1A1 (UGT1A1) inhibitors using UGT1A1-overexpressing HeLa cells.

    Science.gov (United States)

    Sun, Hua; Zhou, Xiaotong; Wu, Baojian

    2015-01-01

    1. UDP-glucuronosyltransferase 1A1 (UGT1A1) plays an irreplaceable role in detoxification of bilirubin and many drugs (e.g., SN-38). Here we aimed to explore the potential of UGT1A1-overexpressing HeLa cells (or HeLa1A1 cells) as a tool to accurately identify UGT1A1 inhibitors. 2. Determination of glucuronidation rates (β-estradiol and SN-38 as the substrates) was performed using HeLa1A1 cells and uridine diphosphoglucuronic acid (UDPGA)-supplemented cDNA expressed UGT1A1 enzyme (or microsomes). The inhibitory effects (IC50 values) of 20 structurally diverse compounds on the UGT1A1 activity were determined using HeLa1A1 cells and microsomal incubations. 3. In HeLa1A1 cells, the IC50 values for inhibition of β-estradiol glucuronidation by the tested compounds ranged from 0.33 to 94.6 µM. In the microsomal incubations, the IC50 values ranged from 0.47 to 155 µM. It was found that the IC50 values of all test compounds derived from the cells were well consistent with those from the microsomes (deviated by less than two-fold). Further, the IC50 values from the cells were strongly correlated with those from microsomes (r = 0.944, p HeLa cells were an appropriate tool to accurately depict the inhibition profiles of chemicals against UGT1A1.

  14. FLOAT Project - Task 1

    DEFF Research Database (Denmark)

    Marchalot, Tanguy; Kofoed, Jens Peter; Sørensen, Eigil V.

    The objective of the FLOAT project is to study the reliability of high-performance fibre-reinforced concrete, also known as Compact Reinforced Composite (CRC), for the floats of wave energy converters. In order to reach commercial breakthrough, wave energy converters need to achieve a lower price.......com, 2011). CRC floats could be a very cost-effective technology with enhanced loading capacity and environmental resistance, and very low maintenance requirements, affecting directly the final energy price. The project involves DEXA Wave Energy Ltd, Wave Star A/S, Aalborg University and Hi-Con A....../S. It is divided in 4 tasks: Task 1: Preliminary float design and economic considerations Task 2: Material characteristics Task 3: Preliminary experiences Task 4: The importance for wave energy The present report covers Task 1....

  15. 1-t-motifs

    CERN Document Server

    Taelman, Lenny

    2009-01-01

    We show that the module of rational points on an abelian t-module E is canonically isomorphic with the module Ext^1(M_E, K[t]) of extensions of the trivial t-motif K[t] by the t-motif M_E associated with E. This generalizes prior results of Anderson and Thakur and of Papanikolas and Ramachandran. In case E is uniformizable then we show that this extension module is canonically isomorphic with the corresponding extension module of Pink-Hodge structures. This situation is formally very similar to Deligne's theory of 1-motifs and we have tried to build up the theory in a way that makes this analogy as clear as possible.

  16. ION-1 technical manual

    Energy Technology Data Exchange (ETDEWEB)

    Halbig, J.K.; Caine, J.C.

    1985-07-01

    The portable gamma-ray and neutron detector electronics (ION-1) gives a digital readout of the current-mode response produced by gamma rays in an ion chamber and of amplification and scaling of pulses received from a neutron detector. The primary application is the measurement of gamma-ray and neutron activity of irradiated reactor fuels stored at a reactor or at a storage pond away from a reactor. ION-1 is the first such instrument to use a design that allows communication of procedures, response, and results between instrument and inspector. It prompts the inspector through procedures, carries out programmed measurement steps, calculates results and error estimates, and performs internal diagnostic checks. This Technical Manual describes adjustment procedures and limited technical information that enable the inspector to troubleshoot at the board level. 5 figs., 10 tabs.

  17. B1 Aerogels

    DEFF Research Database (Denmark)

    Duer, Karsten; Svendsen, Sv Aa Højgaard

    1996-01-01

    , engineering and architectural basis which will support the appropriate use of aerogels in windows, solar collectors and passive solar applications, with the aim of saving or producing thermal energy for use in buildings".This objective is in very good agreement with the general scope of task 18 but where Task......The report summarizes the work that has been carried out within the project "B1 AEROGELS" as a part of the IEA SH&CP Task 18 "Advanced Glazing and Associated Materials For Solar And Building Applications".By providing at the same time thermal insulation and transparency the silica aerogel is a very...... of aerogel as a material for window applications. It was not a part of the project to make a further development of the aerogel material.The project was carried out in three main steps:1. Collection of information on aerogel production methods2. Measurements and evaluation of optical and thermal properties...

  18. BIOTECHNOLOGY BIOPRODUCTS "HEALING-1"

    OpenAIRE

    S. I. Artiukhova; T. T. Tolstoguzova

    2014-01-01

    Summary. The article presents data on the development of technology and qualitative research, bio-products «Healing-1». One of the promising directions in food biotechnology is the development of new integrated starter-based consortia of microorganisms, which have higher activity compared with cultures prepared using pure cultures. So it was interesting studies on the development of new biotechnology and bio-based microbial consortium of lactic acid bacteria. Based on the analysis of biotechn...

  19. Main: CCAATBOX1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available 5'-non-coding regions of eukaryotic genes; CCAAT box found in the promoter of heat shock protein genes; Loca...CCAATBOX1 S000030 04-January-2007 (last modified) kehi Common sequence found in the...ted immediately upstream from the most distal HSE of the promoter; CCAAT box act cooperatively with HSEs to... increase the hs promoter activity; HSE (Heat shock element); CCAAT box; eukaryotes; Glycine max (Soybean) CCAAT ...

  20. Main: AACACOREOSGLUB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AACACOREOSGLUB1 S000353 16-Feb-2001 (last modified) seki Core of AACA motifs found ...in rice (O.s.) glutelin genes, involved in controlling the endosperm-specific expression; AACA is also close...m-specific enhancement to the truncated -90 CaMV 35S promoter; See also S000045, ...S000181, S000276; glutelin; AACA; GCN4; seed; endosperm; rice (Oryza sativa) AACAAAC ...

  1. Chapter 1: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2009-01-18

    The Office of Energy Efficiency and Renewable Energy (EERE) develops–and encourages consumers and business to adopt–technologies that improve energy efficiency and increase the use of renewable energy. This report describes analysis undertaken by EERE to better understand the extent to which the technologies and market improvements funded by its FY 2004 Budget Request1 will make energy more affordable, cleaner, and more reliable.

  2. UOA1: Hardware Manual

    Energy Technology Data Exchange (ETDEWEB)

    Wolfers, G.; Sanchez, E.

    2012-07-01

    The UOA1 is a versatile printed circuit board which can be configured to accommodate up to four analogue signal channels of either electrical to optical or optical to electrical converters. A charge-balance voltage to frequency technique is used for the conversion. The board can be adapted to different electrical input or output range and the full scale frequency can be adjusted to provide the best accuracy-to bandwidth compromise for each application. (Author)

  3. PETROLOGY (1)IGNEOUS PETROLOGY

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>20082204 Cong Feng(Institute of Geochem- istry,Chinese Academy of Sciences,Guiyang 550002,China);Tang Hongfeng Geochem- istry and Tectonic Setting of Devonian Rhyo- lites in Southern Altay,Xinjiang,Northwest China(Geotectonica et Metallogenia,ISSN 1001—1552,CN44—1595/P,31(3),2007, p.359—364,6 illus.,1 table,17 refs.) Key words:rhyolites,Altai Mountains

  4. Applied N=1 Supergravity

    Science.gov (United States)

    Nath, Pran

    A review of recent developments in the applications of N=1 Supergravity to the construction of unified models of elementary particle interactions is given. Couplings of N=1 Supergravity with matter consisting of an arbitrary set of l handed multiplets and a gauge multiplet are discussed. General formulation of spontaneous symmetry breaking and the criteria for breaking of internal symmetry and of local supersymmetry are described. Construction of specific Supergrvity GUT models, the gauge heirarchy in GUT models and a deduction of the low energy effective potential are discussed. The phenomena of SU(2)XU(1) electro-weak gauge invariance breakdown by Supergravity in tree models and by radiative corrections using renormalization group methods are described. Model independent formulations of low energy physics which encompass tree and the renormalization group methods of breaking SU(2)XU(1), but also allow more general scenarios are discussed. The particle content of Supergravity unified theories at low energy is given which includes predictions, for a class of supergravity models, of light gauge fermins, i.e. of a charged Dirac fermion, the Wino, with a mass below the W boson mass and a neutral fermion, the Zino, below the mass of the Z boson mass. "Direct" gaugino masses arising from loops for the photino and the gluino, (which are massless at the tree level) are exhibited. Decays of the W and Z into photino. Vino, and Zino modes and their branching ratios into various channels are given. Experimental signals for the supersymmetrie decays are discussed and some prominent signatures such as decays into one and two jets with unbalanced energy and momentum are pointed out. The current status of the ρ-parameter, including supergravity GUT effects is given. Other experimental consequences of supergravity unified theories are also discussed.

  5. SHAPE-PRESERVING BIVARIATE POLYNOMIAL APPROXIMATION IN C([-1,1]×[-1,1])

    Institute of Scientific and Technical Information of China (English)

    Sorin G. Gal

    2002-01-01

    In this paper we construct bivariate polynomials attached to a bivariate function, that approximate with Jackson-type rate involving a bivariate Ditzian-Totik ω2-modulus of smoothness and preserve some natural kinds of bivariate monotonicity and convexity of function.The result extends that in univariate case-of D. Leviatan in [5-6], improves that in bivariate case of the author in [3] and in some special cases, that in bivariate case of G. Anastassiou in [1].

  6. Association between CYP1A1m1 gene polymorphism and primary open-angle glaucoma.

    Science.gov (United States)

    Costa, N B; Silva, C T X; Frare, A B; Silva, R E; Moura, K K V O

    2014-12-04

    The CYP1A1 gene is related to the generation of secondary metabolites that are capable of inducing DNA damage. The CYP1A1m1 polymorphism has been examined in many studies, and is located in a region near loci that have been linked to glaucoma, including the locus GLC1I. As a result, this polymorphism has been related to several diseases that are influenced by exposure to xenobiotic as well as primary open-angle glaucoma. We compared the prevalence of the CYP1A1m1 polymorphism in 152 Brazilian patients, 100 patients with primary open-angle glaucoma, and 52 normal controls using restriction fragment length polymorphism analysis. The frequency of the homozygous wild-type (w1/w1) CYP1A1 gene among patients with primary open-angle glaucoma (N = 100) was 16%, for genotype w1/m1, the frequency was 77%, and for m1/m1 it was 7%. Among the control group (N = 52), the frequency of the homozygous wild-type (w1/w1) CYP1A1 gene was 54%, the frequency of w1/m1 was 46%, and the frequency of m1/m1 was 0%. The presence of the CYP1A1m1 polymorphism may interfere with xenobiotic metabolism and exacerbate direct or indirect damage to the optic nerve. These CYP1A1m1 polymorphisms may be risk factors for primary open-angle glaucoma.

  7. Point 1 Updates

    CERN Multimedia

    Inigo-Golfin, J.

    The ATLAS experimental area is located in Point 1, just across the main CERN entrance, in the commune of Meyrin. There people are ever so busy to finish the different infrastructures for ATLAS. Not only has Civil Engineering finished the construction of the USA15 technical cavern, but the excavation of the main UX15 cavern has resumed below the machine tunnel, after a brief halt to allow the construction of the UJ-caverns for the power converters of the LHC machine. The excavation work should end in August 2002. The UX15 hand-over to ATLAS is expected in April 2003. On the surface civil engineering is starting to complete the last two surface buildings (SDX1 and SH1), once the services (cooling pipes, ventilation ducts and the largest item, the lift modules and its lift of course) in the shaft PX15 have been completed. But the civil engineering is not all. A lot more is under way. The site installation of the steel structures in the caverns is to begin in Autumn, along with all the cooling pipes, airconditi...

  8. Indico 1.0

    CERN Document Server

    Lopez, J B Gonzalez; Baron, T; Ferreira, P; Kolobara, B; Pugh, M A; Resco, A; Trzaskoma, J P

    2014-01-01

    Indico has evolved into the main event organization software, room booking tool and collaboration hub for CERN. The growth in its usage has only accelerated during the past 9 years, and today Indico holds more that 215,000 events and 1,100,000 files. The growth was also substantial in terms of functionalities and improvements. In the last year alone, Indico has matured considerably in 3 key areas: enhanced usability, optimized performance and additional features, especially those related to meeting collaboration. Along the course of 2012, much activity has centred around consolidating all this effort and investment into 'version 1.0', recently released in 2013.Version 1.0 brings along new features, such as the Microsoft Exchange calendar synchronization for participants, many new and clean interfaces (badges and poster generation, list of contributions, abstracts, etc) and so forth. But most importantly, it brings a message: Indico is now stable, consolidated and mature after more than 10 years of non-stop de...

  9. AMF 1 Site Science

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Mark Alan [Rutgers Univ., New Brunswick, NJ (United States)

    2016-08-18

    This report documents progress on DOE Grant# DE-FG02-08ER64531 funded by the Department of Energy’s Atmospheric Systems Research (ASR) program covering the period between its inception in 2008 and its conclusion in 2014. The Atmospheric Radiation Measurement (ARM) Program’s Mobile Facility #1 (AMF#1) is a collection of state-of-the art atmospheric sensing systems including remote and in situ instrumentation designed to characterize the atmospheric column above and in the immediate vicinity of the deployment location. The grant discussed in this report funded the activities of the AMF#1 Site Scientist Team. Broad responsibilities of this team included examining new deployment sites and recommending instrument deployment configurations; data quality control during the early stages of deployments and for certain instruments through the course of the deployment; scientific outreach in the host country or location (particularly international deployments); scientific research oriented toward basic questions about cloud physics and radiation transfer in the deployment region; and training of Ph.D. students to conduct future research relevant to the Atmospheric Systems Research (ASR) program.

  10. Protein: MPA1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA1 TLR signaling molecules Nlrp3 Cias1, Mmig1, Nalp3, Pypaf1 NACHT, LRR and PYD d...n-associated-inducible protein 1, PYRIN-containing APAF1-like protein 1 10090 Mus musculus 216799 Q8R4B8 Q8R4B8 20007575 ...

  11. Main: 1H1Y [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1H1Y イネ Rice Oryza sativa L. D-Ribulose-5-Phosphate 3-Epimerase Oryza Sativa Molecu...V. 326 127 2003 3-Epimerase, Oxidative Pentose Phosphate Pathway, Isomerase SWS:Q9SE42,Q9SE42|EMBL; AF189365; AAF01048.1; -.|PDB; 1H...1Y; X-ray; A/B=1-228.|PDB; 1H1Z; X-ray; A/B=1-228.|Gramene; Q9SE42; -.|GO; GO:001685...ELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQNKS rice_1H1Y.jpg ...

  12. Analysis list: Whsc1l1 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Whsc1l1 Blood + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Whsc1l1.1....tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Whsc1l1.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Whsc1...l1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Whsc1l1.Blood.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Blood.gml ...

  13. Galangal pungent component, 1'-acetoxychavicol acetate, activates TRPA1.

    Science.gov (United States)

    Narukawa, Masataka; Koizumi, Kanako; Iwasaki, Yusaku; Kubota, Kikue; Watanabe, Tatsuo

    2010-01-01

    We investigated the activation of transient receptor potential cation channel (TRP) subfamily V, member 1 (TRPV1) and TRP subfamily A, member 1 (TRPA1) by 1'-acetoxychavicol acetate (ACA), the main pungent component in galangal. ACA did not activate TRPV1-expressing human embryonic kidney (HEK) cells, but strongly activated TRPA1-expressing HEK cells. ACA was more potent than allyl isothiocyanate, the typical TRPA1 agonist.

  14. Universal graphs at $\\aleph_{\\omega_1+1}$

    OpenAIRE

    Davis, Jacob

    2016-01-01

    Starting from a supercompact cardinal we build a model in which $2^{\\aleph_{\\omega_1}}=2^{\\aleph_{\\omega_1+1}}=\\aleph_{\\omega_1+3}$ but there is a jointly universal family of size $\\aleph_{\\omega_1+2}$ of graphs on $\\aleph_{\\omega_1+1}$. The same technique will work for any uncountable cardinal in place of $\\omega_1$.

  15. Survey of ortho-H2D+(1_{1,0}-1_{1,1}) in dense cloud cores

    CERN Document Server

    Caselli, Paola; Ceccarelli, Cecilia; van der Tak, Floris; Crapsi, Antonio; Bacmann, Aurore

    2008-01-01

    We present a survey of the ortho-H2D+(1_{1,0}-1_{1,1}) line toward a sample of 10 starless cores and 6 protostellar cores, carried out at the Caltech Submillimeter Observatory. The high diagnostic power of this line is revealed for the study of the chemistry, and the evolutionary and dynamical status of low-mass dense cores. The line is detected in 7 starless cores and in 4 protostellar cores. N(ortho-H2D+) ranges between 2 and 40x10^{12} cm^{-2} in starless cores and between 2 and 9x10^{12} cm^{-2} in protostellar cores. The brightest lines are detected toward the densest and most centrally concentrated starless cores, where the CO depletion factor and the deuterium fractionation are also largest. The large scatter observed in plots of N(ortho-H2D+) vs. the observed deuterium fractionation and vs. the CO depletion factor is likely to be due to variations in the ortho-to-para (o/p) ratio of H2D+ from >0.5 for T_{kin} < 10 K gas in pre-stellar cores to ~0.03 (consistent with T_{kin} ~15 K for protostellar c...

  16. 26 CFR 1.514(e)-1 - Allocation rules.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Allocation rules. 1.514(e)-1 Section 1.514(e)-1... Allocation rules. Where only a portion of property is debt-financed property, proper allocation of the basis...)(iii) of § 1.514(b)-1 for illustrations of proper allocation....

  17. 26 CFR 1.471-1 - Need for inventories.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 6 2010-04-01 2010-04-01 false Need for inventories. 1.471-1 Section 1.471-1...) INCOME TAXES Inventories § 1.471-1 Need for inventories. In order to reflect taxable income correctly, inventories at the beginning and end of each taxable year are necessary in every case in which the...

  18. 26 CFR 1.531-1 - Imposition of tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Imposition of tax. 1.531-1 Section 1.531-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.531-1 Imposition...

  19. 26 CFR 1.536-1 - Short taxable years.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Short taxable years. 1.536-1 Section 1.536-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.536-1 Short...

  20. 26 CFR 1.282-1.300 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false 1.282-1.300 Section 1.282-1.300 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Terminal Railroad Corporations and Their Shareholders §§ 1.282-1.300...

  1. 26 CFR 1.666(a)-1A - Amount allocated.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Amount allocated. 1.666(a)-1A Section 1.666(a... Before January 1, 1969 § 1.666(a)-1A Amount allocated. (a) In general. In the case of a trust that is... that may accumulate income or that distribute corpus), section 666(a) prescribes rules for...

  2. 26 CFR 1.1493-1 - Definition of foreign trust.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Definition of foreign trust. 1.1493-1 Section 1... (CONTINUED) INCOME TAXES Tax on Transfers to Avoid Income Tax § 1.1493-1 Definition of foreign trust. For taxable years beginning before January 1, 1967, a trust is to be considered a “foreign trust” within...

  3. 26 CFR 1.584-1 - Common trust funds.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Common trust funds. 1.584-1 Section 1.584-1...) INCOME TAXES (CONTINUED) Banking Institutions § 1.584-1 Common trust funds. (a) Method of taxation. A common trust fund maintained by a bank is not subject to taxation under this chapter and is...

  4. 26 CFR 1.1311(a)-1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Introduction. 1.1311(a)-1 Section 1.1311(a)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Readjustment of Tax Between Years and Special Limitations § 1.1311(a)-1 Introduction....

  5. 26 CFR 1.166-1 - Bad debts.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Bad debts. 1.166-1 Section 1.166-1 Internal... TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.166-1 Bad debts. (a... shall be allowed in respect of bad debts owed to the taxpayer. For this purpose, bad debts...

  6. 26 CFR 1.803-1 - Life insurance reserves.

    Science.gov (United States)

    2010-04-01

    ... liability is computed, life, health, or accident contingencies. (d) In any case where reserves are claimed... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Life insurance reserves. 1.803-1 Section 1.803-1...) INCOME TAXES Life Insurance Companies § 1.803-1 Life insurance reserves. (a) The term “life...

  7. 26 CFR 1.73-1 - Services of child.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Services of child. 1.73-1 Section 1.73-1...) INCOME TAXES (CONTINUED) Items Specifically Included in Gross Income § 1.73-1 Services of child. (a) Compensation for personal services of a child shall, regardless of the provisions of State law relating to...

  8. 26 CFR 1.149(g)-1 - Hedge bonds.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Hedge bonds. 1.149(g)-1 Section 1.149(g)-1...) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.149(g)-1 Hedge bonds... of replacement proceeds (other than amounts in a bona fide debt service fund or a reasonably...

  9. 26 CFR 1.6109-1 - Identifying numbers.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Identifying numbers. 1.6109-1 Section 1.6109-1...) INCOME TAXES Miscellaneous Provisions § 1.6109-1 Identifying numbers. (a) Information to be furnished after April 15, 1974. For provisions concerning the requesting and furnishing of identifying...

  10. 26 CFR 1.269B-1 - Stapled foreign corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Stapled foreign corporations. 1.269B-1 Section 1... (CONTINUED) INCOME TAXES Items Not Deductible § 1.269B-1 Stapled foreign corporations. (a) Treatment as a domestic corporation—(1) General rule. Except as otherwise provided, if a foreign corporation is a...

  11. 26 CFR 1.1002-1 - Sales or exchanges.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Sales or exchanges. 1.1002-1 Section 1.1002-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Determination of Amount of and Recognition of Gain Or Loss § 1.1002-1 Sales or exchanges....

  12. 26 CFR 1.737-1 - Recognition of precontribution gain.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Recognition of precontribution gain. 1.737-1 Section 1.737-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Distributions by A Partnership § 1.737-1 Recognition of...

  13. Electron phonon coupling in a sodium monolayer on Cu(1 1 1)

    Science.gov (United States)

    Eremeev, S. V.; Sklyadneva, I. Yu.; Echenique, P. M.; Borisova, S. D.; Benedek, G.; Rusina, G. G.; Chulkov, E. V.

    2007-09-01

    We present calculation results for electron-phonon (e-ph) coupling in one monolayer (ML) of Na on the Cu(1 1 1) surface. We show that the e-p coupling parameter λ decreases compared to that for clean Cu(1 1 1) due to the significant decrease of the Na vertical vibrational mode contribution to the Eliashberg function in the 1 ML Na/Cu(1 1 1) system. The corresponding phonon induced lifetime broadening Γe-ph of a quantum-well state at low temperature decreases by 30% compared to that on clean Cu(1 1 1).

  14. Analysis list: Nr1d1 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d1 Adipocyte,Cardiovascular,Liver,Neural + mm9 http://dbarchive.biosciencedbc.jp.../kyushu-u/mm9/target/Nr1d1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.5.tsv http://db...archive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1....Adipocyte.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.C...ardiovascular.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.Liver.tsv,http://dbarchive.biosc

  15. Nonlocal N=1 Supersymmetry

    CERN Document Server

    Kimura, Tetsuji; Noumi, Toshifumi; Yamaguchi, Masahide

    2016-01-01

    We construct $\\mathcal{N}=1$ supersymmetric nonlocal theories in four dimension. We discuss higher derivative extensions of chiral and vector superfields, and write down generic forms of K\\"ahler potential and superpotential up to quadratic order. We derive the condition in which an auxiliary field remains non-dynamical, and the dynamical scalars and fermions are free from the ghost degrees of freedom. We also investigate the nonlocal effects on the supersymmetry breaking and find that supertrace (mass) formula is significantly modified even at the tree level.

  16. Type 1 narcolepsy

    DEFF Research Database (Denmark)

    Degn, Matilda; Kornum, Birgitte Rahbek

    2015-01-01

    Type 1 narcolepsy is a sleep disorder characterized by excessive daytime sleepiness with unintentional sleep attacks and cataplexy. The disorder is caused by a loss of hypocretinergic neurons in the brain. The specific loss of these neurons in narcolepsy is thought to result from an autoimmune...... attack, and this is supported by evidence of both environmental and genetic factors pointing toward an involvement of the immune system. However, definitive proof of an autoimmune etiology is still missing. Several different immune-mediated disorders targeting neurons are known, and many...

  17. Chandrayaan-1: Science goals

    Indian Academy of Sciences (India)

    N Bhandari

    2005-12-01

    The primary objectives of the Chandrayaan-1 mission are simultaneous chemical,mineralogical and topographic mapping of the lunar surface at high spatial resolution.These data should enable us to understand compositional variation of major elements,which in turn,should lead to a better understanding of the stratigraphic relationships between various litho units occurring on the lunar surface.The major element distribution will be determined using an X-ray fluorescence spectrometer (LEX),sensitive in the energy range of 1 –10 keV where Mg,Al,Si,Ca and Fe give their K lines.A solar X-ray monitor (SXM)to measure the energy spectrum of solar X-rays,which are responsible for the fluorescent X-rays,is included.Radioactive elements like Th will be measured by its 238.6 keV line using a low energy gamma-ray spectrometer (HEX)operating in the 20 –250 keV region.The mineral composition will be determined by a hyper-spectral imaging spectrometer (HySI)sensitive in the 400 –920 nm range.The wavelength range is further extended to 2600 nm where some spectral features of the abundant lunar minerals and water occur,by using a near-infrared spectrometer (SIR-2),similar to that used on the Smart-1 mission,in collaboration with ESA.A terrain mapping camera (TMC)in the panchromatic band will provide a three-dimensional map of the lunar surface with a spatial resolution of about 5 m.Aided by a laser altimeter (LLRI) to determine the altitude of the lunar craft,to correct for spatial coverage by various instruments, TMC should enable us to prepare an elevation map with an accuracy of about 10 m. Four additional instruments under international collaboration are being considered.These are: a Miniature Imaging Radar Instrument (mini-SAR),Sub Atomic Re flecting Analyser (SARA), the Moon Mineral Mapper (M3)and a Radiation Monitor (RADOM).Apart from these scientific payloads,certain technology experiments have been proposed,which may include an impactor which will be released to

  18. Nuflood, Version 1.x

    Energy Technology Data Exchange (ETDEWEB)

    2016-07-29

    NUFLOOD Version 1.x is a surface-water hydrodynamic package designed for the simulation of overland flow of fluids. It consists of various routines to address a wide range of applications (e.g., rainfall-runoff, tsunami, storm surge) and real time, interactive visualization tools. NUFLOOD has been designed for general-purpose computers and workstations containing multi-core processors and/or graphics processing units. The software is easy to use and extensible, constructed in mind for instructors, students, and practicing engineers. NUFLOOD is intended to assist the water resource community in planning against water-related natural disasters.

  19. Cuaderno de dibujos 1

    OpenAIRE

    Unamuno, Miguel de, 1864-1936

    2010-01-01

    47 dibujos sobre papel; 133 x 224. Tinta y lápiz negro. Papel. - h. 1. Pilastra de la fachada de la casa de Solís / hs. 2-4. Motivos escultóricos en madera (parecen del coro de la Catedral d Ciudad Rodrigo). / h. 5. Interior de la Catedral de Ciudad Rodrigo. / h. 6. Boceto de un detalle del friso de la fachada de la Casa de Solís. / h. 7. Mujer con niño. / h. 8. Plaza de La Alberca / h. 9. Muchacho / hs. 10, 11, 12, 13. Motivos arquitectónicos. / h. 14. Esquina de una calle. / h. 15. Fachada ...

  20. ISR Intersection 1

    CERN Multimedia

    1974-01-01

    The experimental apparatus used at intersection 1 by the CERN-Bologna Collaboration (experiment R105). It consists of two almost identical magnetic spectrometers centered at 90 degrees on opposite sides of the intersection region. In each spectrometer one can see magnetostrictive wire spark chambers, a magnet, more chambers and various hodoscopes of scintillation counters. Gas Cerenkov counters (almost invisible in the picture) are located in the gap of each magnet. On the left hand side, a matrix of 119 lead glass Cerenkov counters is located behind some concrete and iron shielding.

  1. Dynamic Cosmic Strings, 1

    CERN Document Server

    Sjodin, K R P; Vickers, J A

    2001-01-01

    The field equations for a time dependent cylindrical cosmic string coupled togravity are reformulated in terms of geometrical variables defined on a2+1-dimensional spacetime by using the method of Geroch decomposition. Unlikethe 4-dimensional spacetime the reduced case is asymptotically flat. Anumerical method for solving the field equations which involves conformallycompactifying the space and including null infinity as part of the grid isdescribed. It is shown that the code reproduces the results of a number ofvacuum solutions with one or two degrees of freedom. In the final section theinteraction between the cosmic string and a pulse of gravitational radiation isbriefly described. This will be fully analysed in the sequel.

  2. Frameworks in CS1

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak; Caspersen, Michael Edelgaard

    2002-01-01

    point for introducing graphical user interface frameworks such as Java Swing and AWT as the students are not overwhelmed by all the details of such frameworks right away but given a conceptual road-map and practical experience that allow them to cope with the complexity.......In this paper we argue that introducing object-oriented frameworks as subject already in the CS1 curriculum is important if we are to train the programmers of tomorrow to become just as much software reusers as software producers. We present a simple, graphical, framework that we have successfully...

  3. Laryngeal cleft type 1

    Directory of Open Access Journals (Sweden)

    Danilo de Assis Pereira

    2015-06-01

    Full Text Available The clinical itinerary and the institution of conservative therapy in a case of laryngeal cleft type 1 refers to a child born by cesarean section, Apgar 9 and 10, a history of placental nd abruption in the 2 month of pregnancy, with respiratory nd distress on the 2 day of life and difficulty in breast feeding mothers. Presented evidence of aspiration pneumonia. The videodeglutogram showed aspiration of large amounts of material contrasted during swallowing. In bronchoscopy was visualized formation of threadlike small slit making the diagnosis of laryngeal cleft. We then decided, by institution of conservative treatment with enteral nutrition training and thickened with swallowing.

  4. H1N1: pandemia e perspectiva atual H1N1: overview and perspectives

    Directory of Open Access Journals (Sweden)

    Nancy Bellei

    2011-12-01

    Full Text Available O vírus influenza de origem suína, A/California/04/2009 (H1N1, foi inicialmente detectado no México e determinou a pandemia de influenza de 2009. Em agosto de 2010, a Organização Mundial da Saúde (OMS declarou o início da fase pós-pandêmica. As características dessa última pandemia foram marcadamente diferentes das anteriores. O vírus emergiu de rearranjos genéticos originários em hospedeiro mamífero não humano, demonstrou transmissibilidade interespécies e afetou a população humana de forma diferente dos vírus pandêmicos anteriores (1918, 1957 e 1968 com maior morbidade e mortalidade em crianças e adultos jovens. Atualmente, o vírus apresenta padrão sazonal da mesma forma que o influenza A H3N2 e o influenza B, mantendo, até o momento, o mesmo perfil de patogenicidade, espectro clínico e sensibilidade a antivirais. A cepa foi incluída na vacina sazonal trivalente anual recomendada, principalmente para proteção dos grupos de risco mais vulneráveis a complicações pelas diferentes cepas de influenza.The swine origin influenza virus A/CALIFORNIA/04/2009 (H1N1 was first detected in Mexico and determined the 2009 influenza pandemic. In August 2010, World Health Organization (WHO declared the beginning of the post-pandemic period. This last pandemic was distinctly different from previous ones. The virus emerged from genetic rearrangement in non-human mammalian host. Moreover, its inter-species transmission is fully reported. However, it affected human population differently from previous pandemic viruses (1918, 1957, 1968, with increased morbidity and mortality among children and young adults. Currently, the virus has a seasonal pattern in the same way as influenza A H3N2 and influenza B, maintaining the same pathogenicity profile, clinical spectrum and sensitivity to antiviral agents. The strain was included in the annual trivalent seasonal vaccine formulation, mainly for risk groups, which are more vulnerable to

  5. Characterisation of polymers, 1

    CERN Document Server

    Crompton, Roy

    2008-01-01

    This essential guide to Polymer Characterisation is a complete compendium of methodologies that have evolved for the determination of the chemical composition of polymers. This 478-page book gives an up-to-date and thorough exposition of the state-of-the-art theories and availability of instrumentation needed to effect chemical and physical analysis of polymers. This is supported by approximately 1200 references. Volume 1 covers the methodology used for the determination of metals, non-metals and organic functional groups in polymers, and for the determination of the ratio in which different m

  6. VENESAT-1 Successfully Launched

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ Venezuelan first satellite VENESAT-1 (or Simon Bolivar) was sent to space from the Xichang Satellite Launch Center(XSLC) at 0:53 (Beijing time) on October 30 atop a LM-3B launch vehicle. About 12 minutes later, the satellite entered the preset GTO orbit at the altitude of 36,000km. After four maneuvers, the satellite was normally positioned at 78 degrees west longitude at 15:39 (Beijing time) on November 9,beaming the majority of Latin America and part of the Caribbean region.

  7. Nordslesvigeren er nr. 1

    DEFF Research Database (Denmark)

    Christensen, Steffen Lind

    2015-01-01

    Historien om de nordslesvigske krigsdeltagere under 1. Verdenskrig er traditionelt blevet behandlet i et nationalt perspektiv. Her benævnes soldaterne oftest som ’danske’. Denne artikel undersøger, hvordan nordslesvigske soldater på Østfronten selv udtrykte deres identitet i krigssituationen....... Udgangspunktet er krigsdeltagernes beskrivelser af og syn på dels de fællesskaber, de var en del af ved fronten, og dels de grupperinger, de anså for deres modsætninger. Hovedpointen er, at det mest italesatte tilhørsforhold blandt disse soldater var det regionale bånd til Nordslesvig....

  8. R806 (part 1)

    CERN Multimedia

    1976-01-01

    R806 was designed by the BNL-CERN-Syracuse-Yale Collaboration (Bill Willis spokesman) to study large transverse momentum phenomena, and installed in intersection 8 of the ISR. The main detectors were Lithium foil transition radiation detectors to identify electrons and liquid argon calorimeters to measure the energy of the electrons and photons (among the first such calorimeters to be used in an experiment). In part 1 there were two modules, top and bottom of the horizontal beam pipe; the black vertical pipe contains the cryogenics (LN2 and Lar) and is connected to the two modules with the horizontal piping.

  9. 78 FR 79007 - 1,1,1,2-Tetrafluoroethane From China

    Science.gov (United States)

    2013-12-27

    ... the notice in the Federal Register of October 28, 2013 (78 FR 64243). The conference was held in... COMMISSION 1,1,1,2-Tetrafluoroethane From China Determinations On the basis of the record \\1\\ developed in... reason of imports from China of 1,1,1,2- Tetrafluoroethane, provided for in subheadings 2903.39.20 of...

  10. 26 CFR 1.1053-1 - Property acquired before March 1, 1913.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Property acquired before March 1, 1913. 1.1053-1... TAX (CONTINUED) INCOME TAXES Special Rules § 1.1053-1 Property acquired before March 1, 1913. (a) Basis for determining gain. In the case of property acquired before March 1, 1913, the basis as of...

  11. ATLAS Point 1 Construction

    CERN Multimedia

    Inigo-Golfin, J

    After 3 years of work in point 1, a number of surface buildings have already been completed and handed over to CERN (the control, the gas and the cooling and ventilation buildings) and, probably more appealing to the public, 60,000 m3 of earth have already been excavated from underground. At present, the technical cavern USA15 and its access shaft are almost finished, leaving only the main cavern and the liaison galleries to be completed in the coming year and a half. The main cavern has been excavated down to the radiation limit and its walls and vault will presently be concreted (see below the picture of the section of the vault with the impressive shell of 1.2 m thickness). The excavation of the bench (27 vertical metres to go yet!) will proceed from August, when some additional civil engineering work in the LHC tunnel will be undertaken. Needless to say many different services are necessary around the detector, both for its installation and future operation for physics. To that end much of the heavy...

  12. ATLAS Data Challenge 1

    CERN Document Server

    Poulard, G

    2003-01-01

    In 2002 the ATLAS experiment started a series of Data Challenges (DC) of which the goals are the validation of the Computing Model, of the complete software suite, of the data model, and to ensure the correctness of the technical choices to be made. A major feature of the first Data Challenge (DC1) was the preparation and the deployment of the software required for the production of large event samples for the High Level Trigger (HLT) and physics communities, and the production of those samples as a world-wide distributed activity. The first phase of DC1 was run during summer 2002, and involved 39 institutes in 18 countries. More than 10 million physics events and 30 million single particle events were fully simulated. Over a period of about 40 calendar days 71000 CPU-days were used producing 30 Tbytes of data in about 35000 partitions. In the second phase the next processing step was performed with the participation of 56 institutes in 21 countries (~ 4000 processors used in parallel). The basic elements of ...

  13. (E-1-Phenylethanone semicarbazone

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2009-08-01

    Full Text Available In the title compound, C9H11N3O, the benzene ring is disordered over two positions with refined occupancies of 0.922 (5 and 0.078 (5. The program PLATON [Spek (2009. Acta Cryst. D65, 148–155] recommends the solution in the space group C2/m with a = 7.3050 (3, b = 6.6745 (2, c = 18.3853 (6 Å and β = 96.986 (2°. However, the large number of non-extinct reflections needed to be ignored if C2/m is chosen suggested that the space group is incorrect, even though the R values are lower than that for P21/c. The semicarbazone group is essentially planar, with a maximum deviation of 0.046 (1 Å for one of the N atoms. The mean plane of the semicarbazone group forms dihedral angles of 33.61 (8 and 39.1 (9° with the benzene ring of the major and minor components, respectively. In the crystal structure, molecules are linked by intermolecular N—H...O hydrogen bonds into extended chains along the c axis. The crystal structure is further stabilized by weak intermolucular C—H...π interactions.

  14. UA1 prototype detector

    CERN Multimedia

    1980-01-01

    Prototype of UA1 central detector inside a plexi tube. The UA1 central detector was crucial to understanding the complex topology of proton-antiproton events. It played a most important role in identifying a handful of Ws and Zs among billions of collisions. The detector was a 6-chamber cylindrical assembly 5.8 m long and 2.3 m in diameter, the largest imaging drift chamber of its day. It recorded the tracks of charged particles curving in a 0.7 Tesla magnetic field, measuring their momentum, the sign of their electric charge and their rate of energy loss (dE/dx). Atoms in the argon-ethane gas mixture filling the chambers were ionised by the passage of charged particles. The electrons which were released drifted along an electric field shaped by field wires and were collected on sense wires. The geometrical arrangement of the 17000 field wires and 6125 sense wires allowed a spectacular 3-D interactive display of reconstructed physics events to be produced.

  15. OSS-1/contamination monitor

    Science.gov (United States)

    Kruger, R.; Triolo, J.; Mcintosh, R.

    1983-01-01

    A 20-cm high, 18-cm wide, and 30-cm long (8x7x12 inch) box weighing about 7 kg (15 lbs) and consuming about 7 watts of power was carried on the OSS-1 pallet to monitor the mass build-up or accretion of condensible, volatile materials on surfaces in the shuttle bay during all phases of ascent, on-orbit, and descent. Passively thermally controlled, the box holds two witness samples and four actively temperature controlled quartz crystal microbalances (TQCM) whose temperature can vary from -60 C to +80 C. Graphs show the accretion indicated by the TQCM during the launch and early orbital phase. Conditions during tail to the Sun, nose to the Sun, and bay to the Sun attitudes of the shuttle during STS-3 are reflected in temperatures indicated by the OSS-1 thermistor. These temperatures influence outgassing rates of various materials as well as measurements made by the contamination monitor package. The parameters that bear on TQCM measurements data are shown in graphs and discussed.

  16. OSS-1/contamination monitor

    Science.gov (United States)

    Kruger, R.; Triolo, J.; McIntosh, R.

    1983-02-01

    A 20-cm high, 18-cm wide, and 30-cm long (8x7x12 inch) box weighing about 7 kg (15 lbs) and consuming about 7 watts of power was carried on the OSS-1 pallet to monitor the mass build-up or accretion of condensible, volatile materials on surfaces in the shuttle bay during all phases of ascent, on-orbit, and descent. Passively thermally controlled, the box holds two witness samples and four actively temperature controlled quartz crystal microbalances (TQCM) whose temperature can vary from -60 C to +80 C. Graphs show the accretion indicated by the TQCM during the launch and early orbital phase. Conditions during tail to the Sun, nose to the Sun, and bay to the Sun attitudes of the shuttle during STS-3 are reflected in temperatures indicated by the OSS-1 thermistor. These temperatures influence outgassing rates of various materials as well as measurements made by the contamination monitor package. The parameters that bear on TQCM measurements data are shown in graphs and discussed.

  17. Alpha 1-antitrypsin does not inhibit human monocyte caspase-1.

    Directory of Open Access Journals (Sweden)

    Mohd Akhlakur Rahman

    Full Text Available Alpha 1-antitrypsin (A1AT is a 52 kDa serine protease inhibitor produced largely by hepatocytes but also by mononuclear phagocytes. A1AT chiefly inhibits neutrophil elastase and proteinase-3 but has also been reported to have immune modulatory functions including the ability to inhibit caspases. Its clinical availability for infusion suggests that A1AT therapy might modulate caspase related inflammation. Here we tested the ability of A1AT to modulate caspase-1 function in human mononuclear phagocytes.Purified plasma derived A1AT was added to active caspase-1 in a cell-free system (THP-1 lysates as well as added exogenously to cell-culture models and human whole blood models of caspase-1 activation. Functional caspase-1 activity was quantified by the cleavage of the caspase-1 specific fluorogenic tetrapeptide substrate (WEHD-afc and the release of processed IL-18 and IL-1β.THP-1 cell lysates generated spontaneous activation of caspase-1 both by WEHD-afc cleavage and the generation of p20 caspase-1. A1AT added to this cell free system was unable to inhibit caspase-1 activity. Release of processed IL-18 by THP-1 cells was also unaffected by the addition of exogenous A1AT prior to stimulation with LPS/ATP, a standard caspase-1 activating signal. Importantly, the A1AT exhibited potent neutrophil elastase inhibitory capacity. Furthermore, A1AT complexed to NE (and hence conformationally modified also did not affect THP-1 cell caspase-1 activation. Finally, exogenous A1AT did not inhibit the ability of human whole blood samples to process and release IL-1β.A1AT does not inhibit human monocyte caspase-1.

  18. Main: ALF1NTPARC [PLACE

    Lifescience Database Archive (English)

    Full Text Available ALF1NTPARC S000238 11-Oct-1999 (last modified) kehi ALF-1 (as-1-like sequence bindi...ng factor) binding site found in tobacco (N.t.) parC gene; Found in auxin-responsive regions; as-1-like sequences in parA, pa...rB and parC bind with ASF-1, ALF-2, and ALF-1, respectively; See S000190 (ABFOS); as-1; ALF-1; par; auxin; tobacco (Nicotiana tabacum); TTACGCAAGCAATGACA ...

  19. Investigations on Collectin Liver 1

    DEFF Research Database (Denmark)

    Axelgaard, Esben; Jensen, Lisbeth; Dyrlund, Thomas Franck;

    2013-01-01

    Collectins are pattern recognition molecules of the innate immune system showing binding to carbohydrate structures on microorganisms in a calcium-dependent manner. Recently, three novel collectins, collectin liver 1 (CL-L1), collectin kidney 1 (CL-K1 and CL-11), and collectin placenta 1 (CL-P1...

  20. Sintesis Molibdenum Oksida Berpenyangga Silika sebagai Katalis pada Reaksi Oksidasi Etanol Menjadi Asetaldehida

    Directory of Open Access Journals (Sweden)

    Achyar Rasyidi

    2015-06-01

    Full Text Available Oksidasi etanol membentuk asetaldehida dengan menggunakan katalis molibdenum oksida berpenyangga silika oksida telah dilakukan. Preparasi katalis dilakukan dengan metode impregnasi dengan rasio Mo : Si 1 : 1, 3 : 1, 6 : 1, 9 : 1. Karakterisasi katalis dilakukan menggunakan X-Ray Difractometer (XRD. Hasil identifikasi menunjukkan bahwa komponen katalis yang telah dibuat mengandung kristal MoO3 dan SiO2. Uji kinerja katalis dilakukan terhadap reaksi oksidasi etanol menjadi asetaldehida. Reaksi oksidasi dilangsungkan dalam reaktor pipa lurus berunggun tetap yang beroperasi pada suhu 200oC, 225oC, 250oC, 275oC, 300oC, 325oC, dan 350oC pada tekanan atmosfir. Hasil uji kinerja menunjukkan bahwa konversi tertinggi diperoleh sebesar 91,99% pada temperatur 350oC menggunakan katalis dengan rasio Mo : Si = 9 : 1. Selektivitas tertinggi diperoleh sebesar 89,10% pada temperatur 200oC dengan rasio Mo : Si = 9 : 1. Yield tertinggi diperoleh sebesar 74,80% pada temperatur 350oC pada katalis dengan rasio Mo : Si = 9 : 1.

  1. 26 CFR 1.305-1 - Stock dividends.

    Science.gov (United States)

    2010-04-01

    ... § 1.301-1, is the fair market value of such stock or rights on the date of distribution. See Example...) Definitions. (1) For purposes of this section and §§ 1.305-2 through 1.305-7, the term stock includes rights... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Stock dividends. 1.305-1 Section...

  2. Cytochrome P450 (CYP and glutathione S-transferases (GST polymorphisms (CYP1A1, CYP1B1, GSTM1, GSTP1 and GSTT1 and urinary levels of 1-hydroxypyrene in Turkish coke oven workers

    Directory of Open Access Journals (Sweden)

    Ahmet Oguz Ada

    2007-01-01

    Full Text Available Genetic polymorphisms of xenobiotic metabolizing enzymes have been associated with cancer risk. We evaluated the influences of genetic polymorphisms of polycyclic aromatic hydrocarbon (PAH metabolizing enzymes on urinary 1-hydroxypyrene (1-OHP excretion in Turkish coke oven workers. Urinary 1-OHP was analyzed by HPLC after enzymatic hydrolysis. Lymphocyte DNA was used for PCR-based genotyping of cytochrome P450 (CYP polymorphisms (CYP1A1 and CYP1B1 and glutathione S-transferases (GST polymorphisms (GSTM1, GSTT1 and GSTP1. The mean urinary 1-OHP levels of coke oven workers were significantly higher than that of controls. No significant difference was detected in the mean urinary 1-OHP levels of smokers and non-smokers either for coke oven workers or controls. Genetic polymorphisms of the CYPs and GSTs studied had no significant influence on 1-OHP excretion in coke oven workers, but in the control group the urinary 1-OHP levels of individuals carrying the GSTT1- genotype were significantly higher than those of individuals carrying GSTT1+ genotype. The duration of occupational exposure and metabolic genotype for GSTT1 were the significant predictors of urinary 1-OHP levels. The control individuals carrying combined GSTM1-/GSTT1- genotypes also had significantly higher levels of urinary 1-OHP than those of individuals carrying GSTM1+/GSTTI+, GSTM1-/GSTT1+, and GSTM1+/GSTT1- genotypes. These results indicate that urinary 1-OHP is a sensitive indicator of recent human exposure to PAHs and that genetic polymorphism of GSTT1 may also to some extent reflect the interindividual variation in susceptibility to PAHs only at low PAH exposure.

  3. Type 1 autoimmune pancreatitis

    Directory of Open Access Journals (Sweden)

    Zen Yoh

    2011-12-01

    Full Text Available Abstract Before the concept of autoimmune pancreatitis (AIP was established, this form of pancreatitis had been recognized as lymphoplasmacytic sclerosing pancreatitis or non-alcoholic duct destructive chronic pancreatitis based on unique histological features. With the discovery in 2001 that serum IgG4 concentrations are specifically elevated in AIP patients, this emerging entity has been more widely accepted. Classical cases of AIP are now called type 1 as another distinct subtype (type 2 AIP has been identified. Type 1 AIP, which accounts for 2% of chronic pancreatitis cases, predominantly affects adult males. Patients usually present with obstructive jaundice due to enlargement of the pancreatic head or thickening of the lower bile duct wall. Pancreatic cancer is the leading differential diagnosis for which serological, imaging, and histological examinations need to be considered. Serologically, an elevated level of IgG4 is the most sensitive and specific finding. Imaging features include irregular narrowing of the pancreatic duct, diffuse or focal enlargement of the pancreas, a peri-pancreatic capsule-like rim, and enhancement at the late phase of contrast-enhanced images. Biopsy or surgical specimens show diffuse lymphoplasmacytic infiltration containing many IgG4+ plasma cells, storiform fibrosis, and obliterative phlebitis. A dramatic response to steroid therapy is another characteristic, and serological or radiological effects are normally identified within the first 2 or 3 weeks. Type 1 AIP is estimated as a pancreatic manifestation of systemic IgG4-related disease based on the fact that synchronous or metachronous lesions can develop in multiple organs (e.g. bile duct, salivary/lacrimal glands, retroperitoneum, artery, lung, and kidney and those lesions are histologically identical irrespective of the organ of origin. Several potential autoantigens have been identified so far. A Th2-dominant immune reaction and the activation of

  4. Selenium adsorption at different coverages on Fe(1 0 0) and Fe(1 1 1): A DFT study

    Energy Technology Data Exchange (ETDEWEB)

    Schwindt, V. Cardoso; Ardenghi, J.S.; Bechthold, P.; González, E.A.; Jasen, P.V. [Departamento de Física, Universidad Nacional del Sur and IFISUR (UNS-CONICET), Av. Alem 1253, (8000) Bahía Blanca (Argentina); Juan, A., E-mail: cajuan@uns.edu.ar [Departamento de Física, Universidad Nacional del Sur and IFISUR (UNS-CONICET), Av. Alem 1253, (8000) Bahía Blanca (Argentina); Batic, B.S.; Jenko, M. [Institute of Metals and Technology, Lepipot 11, p.p. 431, SI-1001 Ljubljana (Slovenia)

    2014-10-01

    Graphical abstract: - Highlights: • Selenium is adsorbed in a distorted bridge on the (1 1 1) surface. • In the case of (1 0 0) surface is adsorbed in a 4-fold hollow site. • The magnetic moment decrease 50% on the Fe(1 0v0) surface after Se adsorption. • Fe–Se bonds are formed at the expense of the metallic bond. • Se–Se bonds are detected only in the (1 0 0) surface at 1 ML. - Abstract: Se adsorption on Fe(1 0 0) and (1 1 1) surfaces is examined using the density functional theory (DFT). Selenium is adsorbed in a distorted bridge on the (1 1 1) surface while in the (1 0 0) surface it prefers a 4-fold hollow site, with energies of −10.36 and −5.25 eV, respectively. Se adsorption results in surface reconstruction. There is some contraction in the case of the (1 0 0) plane for 1/4 and 1/2 ML coverage and some relaxation at 1 ML (4.5%). Contraction increases to 15% for the (1 1 1) plane at ¼ ML. At a higher coverage, there is a non-regular movement of surface metal atoms, and there is almost no change at 1 ML. The magnetic moment for surface Fe atoms decreases with coverage. The most important changes are in the (1 0 0) plane, followed by the (1 1 0) and then the (1 1 1) planes with a reduction of 52%, 24% and 7% respectively. The density of states presents a contribution of Se states at −5.0 and −13.1 eV, when stabilized after adsorption. The Fe–Fe bond weakening is higher in the (1 0 0) plane. Fe–Se bonds are formed at the expense of the metallic bond.

  5. A novel function of peroxiredoxin 1 (Prx-1) in apoptosis signal-regulating kinase 1 (ASK1)-mediated signaling pathway.

    Science.gov (United States)

    Kim, So Yong; Kim, Tae Jin; Lee, Ki-Young

    2008-06-11

    We report a novel function of peroxiredoxin-1 (Prx-1) in the ASK1-mediated signaling pathway. Prx-1 interacts with ASK1 via the thioredoxin-binding domain of ASK1 and this interaction is highly inducible by H2O2. However, catalytic mutants of Prx1, C52A, C173A, and C52A/C173A, could not undergo H2O2 inducible interactions, indicating that the redox-sensitive catalytic activity of Prx-1 is required for the interaction with ASK1. Prx-1 overexpression inhibited the activation of ASK1, and resulted in the inhibition of downstream signaling cascades such as the MKK3/6 and p38 pathway. In Prx-1 knockdown cells, ASK1, p38, and JNK were quickly activated, leading to apoptosis in response to H2O2. These findings suggest a negative role of Prx-1 in ASK1-induced apoptosis.

  6. Overview of EHN1

    CERN Multimedia

    1982-01-01

    The beams enter from the bottom of the photo. Starting from left (Jura side)three experiments lay upstream of the European Hybrid Spectrometer (EHS), NA20, NA25 (with a small HOlographic Bubble Chamber, HOBC) and NA24. The EHS houses NA21, NA22 and NA23 with the Rapid Cycling Bubble Chamber RCBC, NA26, NA27 with the HOlographic LExan Bubble Chamber, HOLEBC. Along the beam line most at the right (H8) lays the NA3 setup, while downstream one sees the assembly of the GAMS detector (blue) of the CERN/USSR experiment NA12. At the centre run the beam H2/E2 for the FRAMM experiments NA1 (now completed), NA7 and NA29, and the beam H6 for NA30 and NA11.

  7. Generalised Rabin(1) synthesis

    CERN Document Server

    Ehlers, Ruediger

    2010-01-01

    We present a novel method for the synthesis of finite state systems that is a generalisation of the generalised reactivity(1) synthesis approach by Piterman, Pnueli and Sa'ar. In particular, we describe an efficient method to synthesize systems from linear-time temporal logic specifications for which all assumptions and guarantees have a Rabin index of one. We show how to build a parity game with at most five colours that captures all solutions to the synthesis problem from such a specification. This parity game has a structure that is amenable to symbolic implementations. We furthermore show that the results obtained are in some sense tight, i.e., that there does not exist a similar synthesis method for assumptions and specifications of higher Rabin index, unless P=NP.

  8. Petroleum resources assessment 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-01

    This report consists of two articles. (1) Petroleum resources assessment of the Okinawa Trough: The hydrocarbon potential has been evaluated for the Tertiary strata in the northwestern margin of the Okinawa Trough on the basis of the pale-ontological, petrological, geochemical data from two wells (Nikkan 8-9 and JDZ 7-3), and geophysical data. (2) Petroliferous basin analysis in Jinju area (2): Petroleum geological studies such as stratigraphy, sedimentology, petrology and organic geochemistry were carried out in the Gyeongsang Supergroup, Junju area. Based on lithofacies and rock color, the sequence can be divided into seven formations which can be organized into two groups (Sindong Group: Nagdong, Hasandong and Jinju formations in ascending order; Hayang Group: Chilgog, Silla Conglomerate, Haman and Jindong formations). (author). 57 refs.

  9. Bis(1-adamantylammonium hexafluoridogermanate

    Directory of Open Access Journals (Sweden)

    Liying Cheng

    2008-01-01

    Full Text Available The title compound, (C10H18N2[GeF6], was obtained hydrothermally from an aqueous solution of GeO2, H3BO3, NiCl2, adamantylammonium chloride, butanol and hydrofluoric acid. The structure consists of discrete bis(1-adamantylammonium cations lying on crystallographic mirror planes and hexafluoridogermanate anions disordered about sites of 2/m point symmetry. In the latter, the Ge atom lies on the site of 2/m symmetry, one F atom lies on the mirror plane and two further F atoms are included in general positions with 50% site occupancy. The cations and anions lie in layers with N—H...F hydrogen bonds formed between them.

  10. UA1 central detector

    CERN Multimedia

    The UA1 central detector was crucial to understanding the complex topology of proton-antiproton events. It played a most important role in identifying a handful of Ws and Zs among billions of collisions. The detector was a 6-chamber cylindrical assembly 5.8 m long and 2.3 m in diameter, the largest imaging drift chamber of its day. It recorded the tracks of charged particles curving in a 0.7 Tesla magnetic field, measuring their momentum, the sign of their electric charge and their rate of energy loss (dE/dx). Atoms in the argon-ethane gas mixture filling the chambers were ionised by the passage of charged particles. The electrons which were released drifted along an electric field shaped by field wires and were collected on sense wires. The geometrical arrangement of the 17000 field wires and 6125 sense wires allowed a spectacular 3-D interactive display of reconstructed physics events to be produced.

  11. 5-Amino-1-naphthol

    Directory of Open Access Journals (Sweden)

    Agnieszka Czapik

    2009-11-01

    Full Text Available In the title compound, C10H9NO, the amino and the hydroxy groups act both as a single donor and a single acceptor in hydrogen bonding. In the crystal, molecules are connected via chains of intermolecular ...N—H...O—H... interactions, forming a two-dimensional polymeric structure resembling the hydrogen-bonded molecular assembly found in the crystal structure of naphthalene-1,5-diol. Within this layer, molecules related by a translation along the a axis are arranged into slipped stacks via π–π stacking interactions [interplanar distance = 3.450 (4 Å]. The amino N atom shows sp3 hybridization and the two attached H atoms are located on the same side of the aromatic ring.

  12. Main: O2F1BE2S1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available quences of be2S1 promoter; F1 is hybrid C/G box; O2; opaque-2; be2S1; F1; seed; Brazil nut tree (Bertholletia excelsa); TCCACGTCGA ... ...O2F1BE2S1 S000162 17-May-1998 (last modified) kehi opaque-2 recognition site F1 in Bertholletia excelsa (Bra...zil nut tree) 2S storage protein gene (be2S1); O2 protein binds to F1, F2 and F3 se

  13. Main: ASF1MOTIFCAMV [PLACE

    Lifescience Database Archive (English)

    Full Text Available ASF1MOTIFCAMV S000024 11-May-2006 (last modified) kehi ASF-1 binding site in CaMV 35S promoter; AS...auxin; salicylic acid; light; as-1; TGA1a, TGA1b; CREB; ASF1; TGA6; shoot; xenobi...F-1 binds to two TGACG motifs; See S000023 (AS1); Found in HBP-1 binding site of wheat histon...c and biotic stress differentially stimulate as-1 element activity; TGACG; root; leaf; CaMV; 35S; promoter; ...otic stress; SAR; SA; Disease resistance; CaMV; Cauliflower mosaic virus; plant; tobacco (Nicotiana tabacum); Arabidopsis thaliana; TGACG ...

  14. Ape1/Ref-1 Stimulates GDNF/GFRalpha1-mediated Downstream Signaling and Neuroblastoma Proliferation.

    Science.gov (United States)

    Kang, Mi-Young; Kim, Kweon Young; Yoon, Young; Kang, Yoonsung; Kim, Hong Beum; Youn, Cha Kyung; Kim, Dong-Hui; Kim, Mi-Hwa

    2009-10-01

    We previously reported that glial cell line-derived neurotropic factor (GDNF) receptor alpha1 (GFRalpha1) is a direct target of apurinic/apyrimidinic endonuclease 1 (Ape1/Ref-1). In the present study, we further analyzed the physiological roles of Ape1/Ref-1-induced GFRalpha1 expression in Neuro2a mouse neuroblastoma cells. Ape1/Ref-1 expression caused the clustering of GFRalpha1 immunoreactivity in lipid rafts in response to GDNF. We also found that Ret, a downstream target of GFRalpha1, was functionally activated by GDNF in Ape1/Ref-1-expressing cells. Moreover, GDNF promoted the proliferation of Ape1/Ref-1-expressing Neuro2a cells. Furthermore, GFRalpha1-specific RNA experiments demonstrated that the downregulation of GFRalpha1 by siRNA in Ape1/Ref-1-expressing cells impaired the ability of GDNF to phosphorylate Akt and PLCgamma-1 and to stimulate cellular proliferation. These results show an association between Ape1/Ref-1 and GDNF/GFRalpha signaling, and suggest a potential molecular mechanism for the involvement of Ape1/Ref-1 in neuronal proliferation.

  15. The MAT1-1:MAT1-2 ratio of Sporothrix globosa isolates in Japan.

    Science.gov (United States)

    Kano, Rui; Tsui, Clement K-M; Hamelin, Richard C; Anzawa, Kazushi; Mochizuki, Takashi; Nishimoto, Katsutaro; Hiruma, Masataro; Kamata, Hiroshi; Hasegawa, Atsuhiko

    2015-02-01

    In order to understand the reproductive biology of pathogenic species in the Sporothrix schenckii complex, we characterized the partial mating type (MAT1-1) loci of Sporothrix schenckii, as well as the S. globosa MAT1-1-1 gene, which encoded 262 amino acid sequences. The data confirmed that the MAT1-1 locus of S. globosa was divergent from the MAT1-2 locus of the opposite mating type, suggesting that the fungus is heterothallic. To determine the mating type ratio of 20 isolates from Japanese patients, we analyzed the MAT loci by specific PCR amplification of MAT1-1-1 and MAT1-2-1 genes. The MAT1-1-1 was detected in 5 isolates but not in the other 15 isolates with the presence of MAT1-2-1. The MAT1-1:1-2 ratio of S. globosa isolates in Japan was estimated to be 1:3. Phylogenetic analysis indicated that the sequences of the MAT1-1-1 were identical among S. globosa isolates but different from S. schenckii and Ophiostoma montium.

  16. Surface conduction at phase transitions in (Au,Ag)/Si(1 1 1) submonolayer films

    Energy Technology Data Exchange (ETDEWEB)

    Tsukanov, D.A., E-mail: tsukanov@iacp.dvo.ru [Institute of Automation and Control Processes, FEB RAS, Vladivostok 690041 (Russian Federation); Far Eastern Federal University, Vladivostok 690950 (Russian Federation); Ryzhkova, M.V.; Borisenko, E.A. [Institute of Automation and Control Processes, FEB RAS, Vladivostok 690041 (Russian Federation); Bondarenko, L.V.; Matetskiy, A.V.; Gruznev, D.V. [Institute of Automation and Control Processes, FEB RAS, Vladivostok 690041 (Russian Federation); Far Eastern Federal University, Vladivostok 690950 (Russian Federation); Zotov, A.V. [Institute of Automation and Control Processes, FEB RAS, Vladivostok 690041 (Russian Federation); Far Eastern Federal University, Vladivostok 690950 (Russian Federation); Vladivostok State University of Economics and Service, Vladivostok 690600 (Russian Federation); Saranin, A.A. [Institute of Automation and Control Processes, FEB RAS, Vladivostok 690041 (Russian Federation); Far Eastern Federal University, Vladivostok 690950 (Russian Federation)

    2012-10-01

    Highlights: Black-Right-Pointing-Pointer Structural reordering occurs upon Ag adsorption onto Si(1 1 1){alpha}-{radical}3 Multiplication-Sign {radical}3-Au surface phase at 350 Degree-Sign C. Black-Right-Pointing-Pointer The new surface structure identified as Si(1 1 1){radical}93 Multiplication-Sign {radical}93-(Au,Ag) has been found by LEED and STM. Black-Right-Pointing-Pointer Electrical conductivity of various (Au,Ag)/Si(1 1 1) nanostructures has been characterized. - Abstract: Surface structure and electrical conductance of the (Au,Ag)/Si(1 1 1) two-dimensional system have been studied in situ with low-energy electron diffraction, scanning tunneling microscopy and four-point probe technique. The new surface structure identified as Si(1 1 1){radical}93 Multiplication-Sign {radical}93-(Au,Ag) has been found to form upon deposition of {approx}0.1 ML of Ag onto Si(1 1 1){alpha}-{radical}3 Multiplication-Sign {radical}3-Au surface held at 350 Degree-Sign C. With further Ag deposition at this growth temperature, the surface structure evolves to Si(1 1 1)2{radical}3 Multiplication-Sign 2{radical}3 and eventually to Si(1 1 1){radical}21 Multiplication-Sign {radical}21. Structural transformations have been found to be accompanied by non-monotonous changeover of the surface conductance. Possible factors affecting the surface conductivity are discussed.

  17. Growth of ultra-thin fluoride heterostructures on Ge(1 1 1) for quantum devices

    Science.gov (United States)

    Oshita, Takao; Takahashi, Keita; Tsutsui, Kazuo

    2009-03-01

    Epitaxial growth of fluoride quantum well structure of Ca xSr 1-xF 2/CdF 2/Ca xSr 1-xF 2 on Ge(1 1 1) is investigated. The two-step growth method was found to be useful for growth of the initial Ca xSr 1-xF 2 layer on Ge(1 1 1) in which Ca xSr 1-xF 2 was deposited at room temperature followed by in situ annealing for solid phase epitaxy. The quantum well structures composed of triple fluoride layers on Ge(1 1 1) substrates were superior to conventional ones grown on Si(1 1 1) substrate, due to the less chemical reactivity of CdF 2 with Ge than that with Si.

  18. 26 CFR 1.642(e)-1 - Depreciation and depletion.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Depreciation and depletion. 1.642(e)-1 Section 1... (CONTINUED) INCOME TAXES Estates, Trusts, and Beneficiaries § 1.642(e)-1 Depreciation and depletion. An estate or trust is allowed the deductions for depreciation and depletion, but only to the extent...

  19. Arfaptin-1 negatively regulates Arl1-mediated retrograde transport.

    Directory of Open Access Journals (Sweden)

    Lien-Hung Huang

    Full Text Available The small GTPase Arf-like protein 1 (Arl1 is well known for its role in intracellular vesicular transport at the trans-Golgi network (TGN. In this study, we used differential affinity chromatography combined with mass spectrometry to identify Arf-interacting protein 1b (arfaptin-1b as an Arl1-interacting protein and characterized a novel function for arfaptin-1 (including the arfaptin-1a and 1b isoforms in Arl1-mediated retrograde transport. Using a Shiga-toxin subunit B (STxB transportation assay, we demonstrated that knockdown of arfaptin-1 accelerated the retrograde transport of STxB from the endosome to the Golgi apparatus, whereas Arl1 knockdown inhibited STxB transport compared with control cells. Arfaptin-1 overexpression, but not an Arl1 binding-defective mutant (arfaptin-1b-F317A, consistently inhibited STxB transport. Exogenous arfaptin-1 expression did not interfere with the localization of the Arl1-interacting proteins golgin-97 and golgin-245 to the TGN and vice versa. Moreover, we found that the N-terminal region of arfaptin-1 was involved in the regulation of retrograde transport. Our results show that arfaptin-1 acts as a negative regulator in Arl1-mediated retrograde transport and suggest that different functional complexes containing Arl1 form in distinct microdomains and are responsible for different functions.

  20. 26 CFR 1.926(a)-1 - Distributions to shareholders.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Distributions to shareholders. 1.926(a)-1... to shareholders. (a) Treatment of distributions. . For guidance, see § 1.926(a)-1T(a). (b) Order of distribution—(1) In general—(i) Distributions by a FSC received by a shareholder in a taxable year of...

  1. 26 CFR 1.66-1 - Treatment of community income.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Treatment of community income. 1.66-1 Section 1... § 1.66-1 Treatment of community income. (a) In general. Married individuals domiciled in a community... generally must report half of the total community income earned by the spouses during the taxable...

  2. 26 CFR 1.1403-1 - Cross references.

    Science.gov (United States)

    2010-04-01

    ...)-1, inclusive. For other administrative provisions relating to the tax on self-employment income, see...) INCOME TAXES Tax on Self-Employment Income § 1.1403-1 Cross references. For provisions relating to the requirement for filing returns with respect to net earnings from self-employment, see § 1.6017-1....

  3. 26 CFR 1.405-1 - Qualified bond purchase plans.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Qualified bond purchase plans. 1.405-1 Section 1... (CONTINUED) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.405-1 Qualified bond purchase... are funded through the purchase of United States retirement plan bonds. Such bonds may be...

  4. 26 CFR 1.1202-1 - Deduction for capital gains.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Deduction for capital gains. 1.1202-1 Section 1... (CONTINUED) INCOME TAXES Wash Sales of Stock Or Securities § 1.1202-1 Deduction for capital gains. (a) In computing gross income, adjusted gross income, taxable income, capital gain net income (net capital gain...

  5. 26 CFR 1.954-1 - Foreign base company income.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Foreign base company income. 1.954-1 Section 1... (CONTINUED) INCOME TAXES Controlled Foreign Corporations § 1.954-1 Foreign base company income. (a) In... foreign base company income of a controlled foreign corporation. Foreign base company income is...

  6. 26 CFR 1.823-1 - Net premiums.

    Science.gov (United States)

    2010-04-01

    ... TAXES Mutual Insurance Companies (other Than Life and Certain Marine Insurance Companies and Other Than Fire Or Flood Insurance Companies Which Operate on Basis of Perpetual Policies Or Premium Deposits) § 1... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Net premiums. 1.823-1 Section 1.823-1...

  7. 26 CFR 1.970-1 - Export trade corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Export trade corporations. 1.970-1 Section 1... (CONTINUED) INCOME TAXES Export Trade Corporations § 1.970-1 Export trade corporations. (a) In general. Sections 970 through 972 provide in general that if a controlled foreign corporation is an export...

  8. 26 CFR 1.341-1 - Collapsible corporations; in general.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Collapsible corporations; in general. 1.341-1... TAX (CONTINUED) INCOME TAXES Collapsible Corporations; Foreign Personal Holding Companies § 1.341-1 Collapsible corporations; in general. Subject to the limitations contained in § 1.341-4 and the...

  9. ADD1/SREBP1c activates the PGC1-alpha promoter in brown adipocytes

    DEFF Research Database (Denmark)

    Hao, Qin; Hansen, Jacob B; Petersen, Rasmus K

    2010-01-01

    regulatory element-binding protein-1c (SREBP1c) and peroxisome proliferator-activated receptor gamma coactivator-1alpha (PGC1alpha) in brown and inguinal white adipose tissues, but not in epididymal white adipose tissue. Using in vitro models of white and brown adipocytes we demonstrate that beta......-adrenergic stimulation induced expression of LXRalpha, ADD1/SREBP1c and PGC1alpha in cells with a brown-like adipose phenotype. We demonstrate that ADD1/SREBP1c is a powerful inducer of PGC1alpha expression via a conserved E box in the proximal promoter and that beta-adrenergic stimulation led to recruitment of ADD1...

  10. Group divisible designs of four groups and block size five with configuration (1; 1; 1; 2

    Directory of Open Access Journals (Sweden)

    Ronald Mwesigwa

    2016-09-01

    Full Text Available We present constructions and results about GDDs with four groups and block size five in which each block has Configuration $(1, 1, 1, 2$, that is, each block has exactly one point from three of the four groups and two points from the fourth group. We provide the necessary conditions of the existence of a GDD$(n, 4, 5; \\lambda_1, \\lambda_2$ with Configuration $(1, 1, 1, 2$, and show that the necessary conditions are sufficient for a GDD$(n, 4, 5; \\lambda_1,$ $\\lambda_2$ with Configuration $(1, 1, 1, 2$ if $n \

  11. Biotransformation of 1,1,1-trichloroethane, trichloromethane, and tetrachloromethane by a Clostridium sp.

    OpenAIRE

    Gälli, R; McCarty, P L

    1989-01-01

    A gram-positive, strictly anaerobic, motile, endospore-forming rod, tentatively identified as a proteolytic Clostridium sp., was isolated from the effluent of an anaerobic suspended-growth bioreactor. The organism was able to biotransform 1,1,1-trichloroethane, trichloromethane, and tetrachloromethane. 1,1,1-Trichloroethane was completely transformed (greater than or equal to 99.5%) by reductive dehalogenation to 1,1-dichloroethane (30 to 40%) and, presumably by other mechanisms, to acetic ac...

  12. Experimental Conditions: SE18_S1_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available liver and brain by Orbitrap MS and automated search engine Lipid Search SE18_S1 Mouse liver SE18_S1_M1 34.1...phy. SE18_MS1 Preparation of lipid extract and ESI negative detection by LC-MS analysis SE18_DS1 Identification of phospholipids with Lipid Search default ...

  13. 1918 pandemic H1N1 DNA vaccine protects ferrets against 2007 H1N1 virus infection

    DEFF Research Database (Denmark)

    Bragstad, Karoline; Martel, Cyril Jean-Marie; Aasted, Bent;

    of the H1N1 pandemic virus from 1918 induce protection in ferrets against infection with a H1N1 (A/New Caledonia/20/99(H1N1)) virus which was included in the conventional vaccine for the 2006-2007 season. The viruses are separated by a time interval of 89 years and differ by 21.2% in the HA1 protein...

  14. Main: AS1CAMV [PLACE

    Lifescience Database Archive (English)

    Full Text Available AS1CAMV S000023 16-Jan-1998 (last modified) kehi as-1 (activation sequence 1) in Ca...and tobacco; Expression in root and leaf; CaMV 35S promoter; ASF-1; leaf; root; as-1; Cauliflower mosaic virus; CaMV; CCACTGACGTAAGGGATGACGCACAATCC ... ...MV 35S promoter; from -85 to -58 (subdomain AI); Binding with ASF-1 (activation sequence factor 1) from pea

  15. MAN1B1 deficiency: an unexpected CDG-II.

    Directory of Open Access Journals (Sweden)

    Daisy Rymen

    Full Text Available Congenital disorders of glycosylation (CDG are a group of rare metabolic diseases, due to impaired protein and lipid glycosylation. In the present study, exome sequencing was used to identify MAN1B1 as the culprit gene in an unsolved CDG-II patient. Subsequently, 6 additional cases with MAN1B1-CDG were found. All individuals presented slight facial dysmorphism, psychomotor retardation and truncal obesity. Generally, MAN1B1 is believed to be an ER resident alpha-1,2-mannosidase acting as a key factor in glycoprotein quality control by targeting misfolded proteins for ER-associated degradation (ERAD. However, recent studies indicated a Golgi localization of the endogenous MAN1B1, suggesting a more complex role for MAN1B1 in quality control. We were able to confirm that MAN1B1 is indeed localized to the Golgi complex instead of the ER. Furthermore, we observed an altered Golgi morphology in all patients' cells, with marked dilatation and fragmentation. We hypothesize that part of the phenotype is associated to this Golgi disruption. In conclusion, we linked mutations in MAN1B1 to a Golgi glycosylation disorder. Additionally, our results support the recent findings on MAN1B1 localization. However, more work is needed to pinpoint the exact function of MAN1B1 in glycoprotein quality control, and to understand the pathophysiology of its deficiency.

  16. 1 Ft. x 1 Ft. Supersonic Wind Tunnel, Bldg. 37

    Data.gov (United States)

    Federal Laboratory Consortium — The 1- by 1-Foot Supersonic Wind Tunnel (1x), located in the Engine Research Building, is one of the most active test facilities at the Glenn Research Center. Used...

  17. Les graphes (-1)-critiques

    CERN Document Server

    Belkhechine, Houmem; Elayech, Mohamed Baka

    2010-01-01

    Given a (directed) graph G=(V,A), a subset X of V is an interval of G provided that for any a, b\\in X and x\\in V-X, (a,x)\\in A if and only if (b,x)\\in A and (x,a)\\in A if and only if (x,b)\\in A. For example, \\emptyset, \\{x\\} (x \\in V) and V are intervals of G, called trivial intervals. A graph, all the intervals of which are trivial, is indecomposable; otherwise, it is decomposable. A vertex x of an indecomposable graph is critical if G-x is decomposable. In 1993, J.H. Schmerl and W.T. Trotter characterized the indecomposable graphs, all the vertices of which are critical, called critical graphs. In this article, we characterize the indecomposable graphs which admit a single non critical vertex, that we call (-1)-critical graphs.} This gives an answer to a question asked by Y. Boudabbous and P. Ille in a recent article studying the critical vertices in an indecomposable graph.

  18. ATLAS Data Challenge 1

    CERN Document Server

    DC1 TaskForce

    2003-01-01

    The ATLAS Collaboration at CERN is preparing for the data taking and analysis at LHC that will start in 2007. Therefore, in 2002 a series of Data Challenges (DC's) was started whose goals are the validation of the Computing Model, of the complete software suite, of the data model, and to ensure the correctness of the technical choices to be made. A major feature of the first Data Challenge (DC1) was the preparation and the deployment of the software required for the production of large event samples for the High Level Trigger and Physics communities, and the production of those large data samples as a worldwide distributed activity. It should be noted that it was not an option to "run everything at CERN" even if we had wanted to; the resources were not available at CERN to carry out the production on a reasonable time-scale. We were therefore faced with the great challenge of organising and then carrying out this large-scale production at a significant number of sites around the world. However, the benefits o...

  19. Transmission electron microscope study of the topotactic reaction of (0 0 1), (0 1 1) and (1 1 1) Ag films and Te

    Energy Technology Data Exchange (ETDEWEB)

    Safran, G.; Geszti, O.; Radnoczi, G

    2003-09-01

    The formation, structure and morphology of silver telluride was investigated in the reaction of (0 0 1), (0 1 1) and (1 1 1) single crystalline Ag films with vacuum deposited Te. Silver films 30-40 nm in thickness were deposited by thermal evaporation onto water- and chlorine-treated NaCl. Onto this silver 1-40 nm of tellurium were deposited at 100 and 200 deg. C. The Ag-Te reaction occurred during Te deposition. Accordingly, formation of the compound phase was investigated from the nucleation stage through complete tellurization on either side of the polymorphic phase transformation temperature (T{sub c}=150 deg. C). Transmission electron microscope and selected area electron diffraction showed that monoclinic silver telluride (Ag{sub 2}Te) of different morphology and texture was always formed. The orientation of silver and monoclinic phase upon differently oriented monocrystalline Ag films and at deposition temperatures around T{sub c} is discussed.

  20. Proof without Words: (1 + 1/n)[superscript n] less than e less than (1 + 1/n)[superscript n+1

    Science.gov (United States)

    Khattri, Sanjay Kumar

    2008-01-01

    We present a pictorial proof of the inequation (1 + 1/n)[superscript n] less than e less than (1 + 1/n)[superscript n+1]. The inequation is also confirmed through the Taylor expansion and alternating series theorem.

  1. H1N1快速治疗计

    Institute of Scientific and Technical Information of China (English)

    罗炯尧; 陈艳莲

    2010-01-01

    近来,因为H1N1的流行,使得好多大型聚会都取消了,人们出行的活动也有所减少,大家都有点谈H1N1色变。如果我们能制造出一种H1N1快速治疗仪,那该多好啊!

  2. 26 CFR 1.414(s)-1 - Definition of compensation.

    Science.gov (United States)

    2010-04-01

    ... prior regulation provisions of § 1.414(s)-1T. (See § 1.414(s)-1T as contained in the CFR edition revised... to the extent necessary to satisfy the requirements of 29 CFR 2530.204-2(d) (regarding double... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Definition of compensation. 1.414(s)-1 Section...

  3. RIPK1 counteracts ZBP1-mediated necroptosis to inhibit inflammation.

    Science.gov (United States)

    Lin, Juan; Kumari, Snehlata; Kim, Chun; Van, Trieu-My; Wachsmuth, Laurens; Polykratis, Apostolos; Pasparakis, Manolis

    2016-12-01

    Receptor-interacting protein kinase 1 (RIPK1) regulates cell death and inflammation through kinase-dependent and -independent functions. RIPK1 kinase activity induces caspase-8-dependent apoptosis and RIPK3 and mixed lineage kinase like (MLKL)-dependent necroptosis. In addition, RIPK1 inhibits apoptosis and necroptosis through kinase-independent functions, which are important for late embryonic development and the prevention of inflammation in epithelial barriers. The mechanism by which RIPK1 counteracts RIPK3-MLKL-mediated necroptosis has remained unknown. Here we show that RIPK1 prevents skin inflammation by inhibiting activation of RIPK3-MLKL-dependent necroptosis mediated by Z-DNA binding protein 1 (ZBP1, also known as DAI or DLM1). ZBP1 deficiency inhibited keratinocyte necroptosis and skin inflammation in mice with epidermis-specific RIPK1 knockout. Moreover, mutation of the conserved RIP homotypic interaction motif (RHIM) of endogenous mouse RIPK1 (RIPK1(mRHIM)) caused perinatal lethality that was prevented by RIPK3, MLKL or ZBP1 deficiency. Furthermore, mice expressing only RIPK1(mRHIM) in keratinocytes developed skin inflammation that was abrogated by MLKL or ZBP1 deficiency. Mechanistically, ZBP1 interacted strongly with phosphorylated RIPK3 in cells expressing RIPK1(mRHIM), suggesting that the RIPK1 RHIM prevents ZBP1 from binding and activating RIPK3. Collectively, these results show that RIPK1 prevents perinatal death as well as skin inflammation in adult mice by inhibiting ZBP1-induced necroptosis. Furthermore, these findings identify ZBP1 as a critical mediator of inflammation beyond its previously known role in antiviral defence and suggest that ZBP1 might be implicated in the pathogenesis of necroptosis-associated inflammatory diseases.

  4. DJ-1 activates SIRT1 through its direct binding to SIRT1.

    Science.gov (United States)

    Takahashi-Niki, Kazuko; Ganaha, Yoko; Niki, Takeshi; Nakagawa, Shota; Kato-Ose, Izumi; Iguchi-Ariga, Sanae M M; Ariga, Hiroyoshi

    2016-05-20

    The DJ-1 gene is a ras-dependent oncogene and also a causative gene for a familial form of Parkinson's disease park7. DJ-1 is a multi-functional protein and plays roles in regulation of cell growth, cells death, metabolism and mitochondrial homeostasis against oxidative stress. To explore various functions, DJ-1 associates with a number of proteins localized in the nucleus, cytoplasm and mitochondria. The oxidative status of a cysteine residue at an amino acid number 106 (C106) of DJ-1 determines the active level of DJ-1. Precise molecular mechanism of exploration of DJ-1 function is, however, not resolved. In this study, we identified Sirtuin family proteins (SIRT1, 2, and 4-6) as DJ-1-binding proteins, and DJ-1 associated with SIRT1 in cells. Sirtuins like DJ-1 also regulates growth, death and metabolism of cells and mitochondrial homeostasis. We found that DJ-1 stimulated deacetylase activity of SIRT1 and that SIRT1-suppressed transcriptional activity of SIRT1-target p53 was further decreased by DJ-1. Furthermore, SIRT1 activity was reduced in DJ-1-knockout cells, and this reduced activity was restored by re-introduction of wild-type DJ-1 but not of C106-mutant DJ-1 into DJ-1-knockout cells. It is first report showing direct connection of DJ-1 with SIRT1.

  5. Interface effects between germanene and Au(111) from first principles

    Science.gov (United States)

    Li, Fengping; Wei, Wei; Yu, Lin; Huang, Baibiao; Dai, Ying

    2017-03-01

    We study two-dimensional (2D) germanene supported on Au(111) to determine the structural, electronic and interface interaction properties on the basis of first-principles electronic calculations. In light of the lattice commensurability, (2  ×  2)/(√7  ×  √7) and (√3  ×  √3)/(√7  ×  √7) germanene/Au(111) superstructures are obtained with low-binding energy. We find that the interface effects between germanene and Au(111) break the inversion symmetry of germanene to a significant extent. The electron accumulation layer between germanene and Au(111) bonds the adlayer and substrate together, indicating strong adsorption behavior. Charge transfer occurs from Au(111) to germanene with the formation of a dipole layer. In addition, the intense electronic orbital hybridization effects between germanene and Au(111) are revealed through the atomic projected band structures. Clearly, resonant behavior occurs between germanene p orbitals and Au(111) s orbitals. As germanene is peeled off from Au(111), the band structures are characterized as metallic, and in the absence of the Au(111) substrate the band structure of (√3  ×  √3) single layer germanene demonstrates a lower effective mass due to its higher geometrical symmetry, which is similar to that of planar graphene. This paper shows that Au(111) is a suitable candidate for the growth of germanene, and our results offer useful information for the application of germanene in electronic devices.

  6. Main: ASF1NTPARA [PLACE

    Lifescience Database Archive (English)

    Full Text Available ASF1NTPARA S000240 11-Oct-1999 (last modified) kehi ASF-1 (as-1 binding nuclear fac...PARC), S000239 (ALF2NTPARB); as-1; ASF-1; par; auxin; tobacco (Nicotiana tabacum); TTACGCAAGCAATGACAT ... ...tor) binding site found in tobacco (N.t.) parA gene; Found in auxin-responsive regions; as-1-like sequences ...in parA, parB and parC bind with ASF-1, ALF-2, and ALF-1, respectively; See S000190 (ABFOS), S000238 (ALF1NT

  7. Urinary APE1/Ref-1: A Potential Bladder Cancer Biomarker.

    Science.gov (United States)

    Choi, Sunga; Shin, Ju Hyun; Lee, Yu Ran; Joo, Hee Kyoung; Song, Ki Hak; Na, Yong Gil; Chang, Seok Jong; Lim, Jae Sung; Jeon, Byeong Hwa

    2016-01-01

    Bladder cancer (BCa) is one of the most common urothelial cancers with still noticeable incidence rate. Early detection of BCa is highly correlated with successful therapeutic outcomes. We previously showed that apurinic/apyrimidinic endonuclease 1/redox factor-1 (APE1/Ref-1) was expressed at an increased level in the serum of BCa patients when compared to the level in healthy controls. In this study, we investigated whether urinary APE1/Ref-1 was also elevated in patients with BCa. In this case-control study, voided urine was collected from 277 subjects including 169 BCa patients and 108 non-BCa controls. Urinary APE1/Ref-1 level was assessed by enzyme-linked immunosorbent assay (ELISA). APE1/Ref-1 levels were significantly elevated in BCa patients relative to levels in non-BCa controls and were correlated with tumor grade and stage. Urinary APE1/Ref-1 levels were also higher in patients with recurrence history of BCa. The receiver operating characteristics (ROC) curve of APE1/Ref-1 showed an area under the curve of 0.83, indicating the reliability and validity of this biomarker. The optimal combination of sensitivity and specificity was determined to be 82% and 80% at a cut-off value of 0.376 ng/100 μL for detection of APE1/Ref-1 in urine. In conclusion, urinary APE1/Ref-1 levels measured from noninvasively obtained body fluids would be clinically applicable for diagnosis of BCa.

  8. Cytogenetic damage in Turkish coke oven workers exposed to polycyclic aromatic hydrocarbons: Association with CYP1A1, CYP1B1, EPHX1, GSTM1, GSTT1, and GSTP1 gene polymorphisms.

    Science.gov (United States)

    Ada, Ahmet Oguz; Demiroglu, Canan; Yilmazer, Meltem; Suzen, Halit Sinan; Demirbag, Ali Eba; Efe, Sibel; Alemdar, Yilmaz; Iscan, Mumtaz; Burgaz, Sema

    2013-09-01

    The aim of this study was to determine the frequencies of chromosomal aberrations (CA) and cytochalasin-blocked micronuclei (CBMN) in peripheral blood lymphocytes from Turkish coke oven workers and the influence of CYP1A1, CYP1B1, EPHX1, GSTM1, GSTT1, and GSTP1 gene polymorphisms on these biomarkers. Cytogenetic analysis showed that occupational exposure significantly increased the CA and CBMN frequencies. Gene polymorphisms, on the other hand, did not affect CA or CBMN in either exposed or control subjects. However, due to the limited sample size, our findings need to be verified in future studies with a larger sample.

  9. Synthesis and characterization of arsenate antimonic acid AAAc(1 : 1)

    Institute of Scientific and Technical Information of China (English)

    WANG Xue-wen; CHEN Qi-yuan; YIN Zhou-lan; ZHANG Ping-min; WANG Yu-wen

    2005-01-01

    The AAAc(1 : 1) was synthesized in water by As2O3 and Sb2O3 with molar ratio of 1 : 1: AAAc(1 : 1)was characterized by Raman, IR, TG/DTG, DSC, XPS and XRD. The results show that there are four peaks to vsof As-OH, As-O-Sb, Sb-OH and Sb-O-Sb in Raman spectra of AAAc(1 : 1) at 100 - 1 000 cm-1. The solution of AAAc(1 : 1) was also titrated with KOH solution. The titration results show that AAAc(1 : 1) is a hexabasic acid with dissociation constants of k1 = 3.62 × 10-2 , k2 = 3.05 × 10-3 , k3 = 6. 43 × 10-6 , k4 = 9. 78 × 10-8 ,k5 = 1.32 × 10-11 , k6 =3.87 × 10-12. AAAc(1 : 1) has a good solubility and stability in water, its solid obtained by free volatilizing water from its solution under air at ambient temperature is amorphous. Chemical and thermal analyture of AsO ( OH )2-OH-Sb ( OH )4-O-Sb ( OH )4-OH-AsO ( OH )2 or As ( OH )3-O-Sb(OH)4-O-Sb(OH)4-O-As(OH)3 (isomerism) through experimental determination and geometry optimization.

  10. YY1 positively regulates human UBIAD1 expression

    Energy Technology Data Exchange (ETDEWEB)

    Funahashi, Nobuaki, E-mail: nfunahashi@ri.ncgm.go.jp [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Department of Metabolic Disorder, Diabetes Research Center, Research Institute, National Center for Global Health and Medicine, Tokyo (Japan); Hirota, Yoshihisa [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Faculty of Pharmaceutical Sciences, Suzuka University of Medical Science, Suzuka (Japan); Nakagawa, Kimie; Sawada, Natumi; Watanabe, Masato [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan); Suhara, Yoshitomo [Department of Bioscience and Engineering, Shibaura Institute of Technology, Saitama (Japan); Okano, Toshio [Department of Hygienic Sciences, Kobe Pharmaceutical University, Kobe (Japan)

    2015-05-01

    Vitamin K is involved in bone formation and blood coagulation. Natural vitamin K compounds are composed of the plant form phylloquinone (vitamin K{sub 1}) and a series of bacterial menaquionones (MK-n; vitamin K{sub 2}). Menadione (vitamin K{sub 3}) is an artificial vitamin K compound. MK-4 contains 4-isoprenyl as a side group in the 2-methyl-1,4-naphthoquinone common structure and has various bioactivities. UbiA prenyltransferase domain containing 1 (UBIAD1 or TERE1) is the menaquinone-4 biosynthetic enzyme. UBIAD1 transcript expression significantly decreases in patients with prostate carcinoma and overexpressing UBIAD1 inhibits proliferation of a tumour cell line. UBIAD1 mRNA expression is ubiquitous in mouse tissues, and higher UBIAD1 mRNA expression levels are detected in the brain, heart, kidneys and pancreas. Several functions of UBIAD1 have been reported; however, regulation of the human UBIAD1 gene has not been elucidated. Here we report cloning and characterisation of the human UBIAD1 promoter. A 5′ rapid amplification of cDNA ends analysis revealed that the main transcriptional start site was 306 nucleotides upstream of the translation initiation codon. Deletion and mutation analyses revealed the functional importance of the YY1 consensus motif. Electrophoretic gel mobility shift and chromatin immunoprecipitation assays demonstrated that YY1 binds the UBIAD1 promoter in vitro and in vivo. In addition, YY1 small interfering RNA decreased endogenous UBIAD1 mRNA expression and UBIAD1 conversion activity. These results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter. - Highlights: • We cloned the human UBIAD1 promoter. • The functional importance of the YY1 motif was identified in the UBIAD1 promoter. • YY1 binds the UBIAD1 promoter in vitro and in vivo. • Knockdown of YY1 significantly decreased UBIAD1 expression. • YY1 up-regulates UBIAD1 conversion activity through the UBIAD1

  11. Neuroprotective properties of GLP-1

    DEFF Research Database (Denmark)

    Holst, Jens Juul; Burcelin, Remy; Nathanson, Esther

    2011-01-01

    In the past few years, the development of pharmaceutical agents that enhance the physiological effects of glucagon-like peptide-1 (GLP-1), either through GLP-1 receptor agonism (GLP-1 agonists) or by inhibiting GLP-1 degradation (dipeptidylpeptidase-4 inhibitors) has broadened the range of treatm...

  12. Main: AGL1ATCONSENSUS [PLACE

    Lifescience Database Archive (English)

    Full Text Available AGL1ATCONSENSUS S000338 16-May-2001 (last modified) uchi Binding consensus sequence... of Arabidopsis (A.t.) AGL1 (AGAMOUS-like 1); AGL1 contains MADS domain; See S000339; AGL20 is a MADS domain...ing several MADS-genes underlie development of vegetative structures; MADS; AGL1; AGAMOUS; AGL20; floral ind

  13. Main: GT1CONSENSUS [PLACE

    Lifescience Database Archive (English)

    Full Text Available m of GT-1 may be achieved through direct interaction between TFIIA and GT-1; Binding of GT-1-like factors to the PR-1a promoter influ...ences the level of SA-inducible gene expression; GT-1; light; TATA; TFIIA; TBP; HR;

  14. Main: TL1ATSAR [PLACE

    Lifescience Database Archive (English)

    Full Text Available TL1ATSAR S000473 13-August-2005 (last modified) kehi TL1, a consensus sequence over...or of pathogenesis-related genes 1, also known as NIM1; SAR; ER; PR; NIM1; Arabidopsis thaliana CTGAAGAAGAA ...

  15. Nucleosome Assembly Protein 1-Like 1 (Nap1l1 Regulates the Proliferation of Murine Induced Pluripotent Stem Cells

    Directory of Open Access Journals (Sweden)

    Yuan Yan

    2016-01-01

    Full Text Available Background/Aims: To investigate whether nucleosome assembly protein 1-like 1 (Nap1l1 regulates the proliferation of induced pluripotent stem cells (iPSC and the potential mechanisms. Methods: Nap1l1-knockdown-iPSC and Nap1l1-overexpression-iPSC were constructed by transfection of lentiviral particles. The proliferation of iPSC was detected by MTT analysis, and cell cycle was analyzed by flow cytometry. Results: Nap1l1 overexpression promoted iPSC proliferation and induced G2/M transition compared to their control iPSC while Nap1l1-knockdown-iPSC dramatically displayed the reduced proliferation and accumulated G2/M phase cells. Further analysis showed that Nap1l1 overexpression in iPSC increased the expression of cyclin B1, downregulated the expression of p21 and p27, while knockdown of Nap1l1 showed the opposite effects. In addition, overexpression of Nap1l1 promoted the phosphorylation of AKT and ERK in iPSC, while knockdown of Nap1l1 inhibited the effects. However, these effects displayed in Nap1l1-overexpression-iPSC were greatly suppressed by the inhibition of AKT or ERK signaling. Conclusions: The results indicate that Nap1l1 promotes the proliferation of iPSC attributable to G2/M transition caused by downregulation of p27 and p21, and upregulation of cyclin B1, the activation of AKT or ERK is involved in the process. The present study has revealed a novel molecular mechanism involved in the proliferation of iPSC.

  16. USML-1 Glovebox experiments

    Science.gov (United States)

    Naumann, Robert J.

    1995-01-01

    This report covers the development of and results from three experiments that were flown in the Materials Science Glovebox on USML-1: Marangoni convection in Closed Containers (MCCC), Double Float Zone (DFZ), and Fiber Pulling in Microgravity (FPM). The Glovebox provided a convenient, low cost method for doing simple 'try and see' experiments that could test new concepts or elucidate microgravity phenomena. Since the Glovebox provided essentially one (or possibly two levels of confinement, many of the stringent verification and test requirements on the experiment apparatus could be relaxed and a streamlined test and verification plan for flight qualification could be implemented. Furthermore, the experiments were contained in their own carrying cases whose external configurations could be identified early in the integration sequence for stowage considerations while delivery of the actual experiment apparatus could be postponed until only a few months before flight. This minimized the time fluids must be contained and reduced the possibility of corrosive reactions that could ruin the experiment. In many respects, this exercise was as much about developing a simpler, cheaper way of doing crew-assisted science as it was about the actual scientific accomplishments of the individual experiments. The Marangoni Convection in Closed Containers experiment was designed to study the effects of a void space in a simulated Bridgman crystal growth configuration and to determine if surface tension driven convective flows that may result from thermal gradients along any free surfaces could affect the solidification process. The Fiber Pulling in Microgravity experiment sought to separate the role of gravity drainage from capillarity effects in the break-up of slender cylindrical liquid columns. The Stability of a Double Float Zone experiment explored the feasibility of a quasi-containerless process in which a solidifying material is suspended by two liquid bridges of its own melt.

  17. E1M1 and E1E2 transition probabilities in one-electron ions

    Energy Technology Data Exchange (ETDEWEB)

    Labzowsky, L.N. [Institute of Physics, St. Petersburg State University, Uljanovskaya 1, Petrodvorets, 198904 St. Petersburg (Russian Federation) and Petersburg Nuclear Physics Institute, Gatchina, 188350 St. Petersburg (Russian Federation)]. E-mail: leonti@landau.phys.spbu.ru; Shonin, A.V. [Institute of Physics, St. Petersburg State University, Uljanovskaya 1, Petrodvorets, 198904 St. Petersburg (Russian Federation)

    2004-12-06

    The quantum electrodynamical (QED) theory of the two-photon transitions in hydrogenlike ions is presented. The emission probability for 2s1/2->2{gamma}(E1)+1s1/2 transitions is calculated and compared to the results of the previous calculations. The emission probabilities 2p1/2->{gamma}(E1)+{gamma}(E2)+1s1/2 and 2p1/2->{gamma}(E1)+{gamma}(M1)+1s1/2 are also calculated for the nuclear charge Z values 1=

  18. Spin polarized surface resonance bands in single layer Bi on Ge(1 1 1)

    Science.gov (United States)

    Bottegoni, F.; Calloni, A.; Bussetti, G.; Camera, A.; Zucchetti, C.; Finazzi, M.; Duò, L.; Ciccacci, F.

    2016-05-01

    The spin features of surface resonance bands in single layer Bi on Ge(1 1 1) are studied by means of spin- and angle-resolved photoemission spectroscopy and inverse photoemission spectroscopy. We characterize the occupied and empty surface states of Ge(1 1 1) and show that the deposition of one monolayer of Bi on Ge(1 1 1) leads to the appearance of spin-polarized surface resonance bands. In particular, the C 3v symmetry, which Bi adatoms adopt on Ge(1 1 1), allows for the presence of Rashba-like occupied and unoccupied electronic states around the \\overline{\\text{M}} point of the Bi surface Brillouin zone with a giant spin-orbit constant |{α\\text{R}}| =≤ft(1.4+/- 0.1\\right) eV · Å.

  19. Effects of human SAMHD1 polymorphisms on HIV-1 susceptibility

    Energy Technology Data Exchange (ETDEWEB)

    White, Tommy E.; Brandariz-Nuñez, Alberto; Valle-Casuso, Jose Carlos [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, 1301 Morris Park – Price Center 501, New York, NY 10461 (United States); Knowlton, Caitlin; Kim, Baek [Department of Microbiology and Immunology, University of Rochester School of Medicine and Dentistry, Rochester, NY 14642 (United States); Sawyer, Sara L. [Department of Molecular Biosciences, University of Texas at Austin, Austin, TX 78712 (United States); Diaz-Griffero, Felipe, E-mail: Felipe.Diaz-Griffero@einstein.yu.edu [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, 1301 Morris Park – Price Center 501, New York, NY 10461 (United States)

    2014-07-15

    SAMHD1 is a human restriction factor that prevents efficient infection of macrophages, dendritic cells and resting CD4+ T cells by HIV-1. Here we explored the antiviral activity and biochemical properties of human SAMHD1 polymorphisms. Our studies focused on human SAMHD1 polymorphisms that were previously identified as evolving under positive selection for rapid amino acid replacement during primate speciation. The different human SAMHD1 polymorphisms were tested for their ability to block HIV-1, HIV-2 and equine infectious anemia virus (EIAV). All studied SAMHD1 variants block HIV-1, HIV-2 and EIAV infection when compared to wild type. We found that these variants did not lose their ability to oligomerize or to bind RNA. Furthermore, all tested variants were susceptible to degradation by Vpx, and localized to the nuclear compartment. We tested the ability of human SAMHD1 polymorphisms to decrease the dNTP cellular levels. In agreement, none of the different SAMHD1 variants lost their ability to reduce cellular levels of dNTPs. Finally, we found that none of the tested human SAMHD1 polymorphisms affected the ability of the protein to block LINE-1 retrotransposition. - Highlights: • Human SAMHD1 single-nucleotide polymorphisms block HIV-1 and HIV-2 infection. • SAMHD1 polymorphisms do not affect its ability to block LINE-1 retrotransposition. • SAMHD1 polymorphisms decrease the cellular levels of dNTPs.

  20. Prox1 regulates the notch1-mediated inhibition of neurogenesis.

    Directory of Open Access Journals (Sweden)

    Valeria Kaltezioti

    Full Text Available Activation of Notch1 signaling in neural progenitor cells (NPCs induces self-renewal and inhibits neurogenesis. Upon neuronal differentiation, NPCs overcome this inhibition, express proneural genes to induce Notch ligands, and activate Notch1 in neighboring NPCs. The molecular mechanism that coordinates Notch1 inactivation with initiation of neurogenesis remains elusive. Here, we provide evidence that Prox1, a transcription repressor and downstream target of proneural genes, counteracts Notch1 signaling via direct suppression of Notch1 gene expression. By expression studies in the developing spinal cord of chick and mouse embryo, we showed that Prox1 is limited to neuronal precursors residing between the Notch1+ NPCs and post-mitotic neurons. Physiological levels of Prox1 in this tissue are sufficient to allow binding at Notch1 promoter and they are critical for proper Notch1 transcriptional regulation in vivo. Gain-of-function studies in the chick neural tube and mouse NPCs suggest that Prox1-mediated suppression of Notch1 relieves its inhibition on neurogenesis and allows NPCs to exit the cell cycle and differentiate. Moreover, loss-of-function in the chick neural tube shows that Prox1 is necessary for suppression of Notch1 outside the ventricular zone, inhibition of active Notch signaling, down-regulation of NPC markers, and completion of neuronal differentiation program. Together these data suggest that Prox1 inhibits Notch1 gene expression to control the balance between NPC self-renewal and neuronal differentiation.

  1. Protein: MPA1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA1 TLR signaling molecules MAVS IPS1, KIAA1271, VISA VISA_(gene) Mitochondrial an...tiviral-signaling protein CARD adapter inducing interferon beta, Interferon beta promoter stimulator protein 1, Putative NF-kappa

  2. Tetraaqua{1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole}sulfatozinc(II dihydrate

    Directory of Open Access Journals (Sweden)

    Yan-Zhi Wang

    2010-11-01

    Full Text Available In the title complex, [Zn(SO4(C9H8N6(H2O4]·2H2O, the ZnII ion is six-coordinated by one N atom from a 1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole ligand and five O atoms from one monodentate sulfate anion and four water molecules in a distorted octahedral geometry. The sulfate tetrahedron is rotationally disordered over two positions in a 0.618 (19:0.382 (19 ratio. In the crystal, adjacent molecules are linked through O—H...O and O—H...N hydrogen bonds involving the cation, the anion, and the coordinated and uncoordinated water molecules into a three-dimensional network.

  3. Tetraaqua{1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole}sulfatocadmium dihydrate

    Directory of Open Access Journals (Sweden)

    Yu-xian Li

    2011-09-01

    Full Text Available In the title complex, [Cd(SO4(C9H8N6(H2O4]·2H2O, the CdII ion is six-coordinated by one N atom from a 1-[(1H-1,2,3-benzotriazol-1-ylmethyl]-1H-1,2,4-triazole ligand and by five O atoms from four water molecules and one monodentate sulfate anion in a distorted octahedral geometry. The sulfate tetrahedron is rotationally disordered over two positions in a 0.651 (12:0.349 (12 ratio. In the crystal, adjacent molecules are linked through O—H...O and O—H...N hydrogen bonds into a three-dimensional network.

  4. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  5. Transcriptional Auto-Regulation of RUNX1 P1 Promoter.

    Science.gov (United States)

    Martinez, Milka; Hinojosa, Marcela; Trombly, Daniel; Morin, Violeta; Stein, Janet; Stein, Gary; Javed, Amjad; Gutierrez, Soraya E

    2016-01-01

    RUNX1 a member of the family of runt related transcription factors (RUNX), is essential for hematopoiesis. The expression of RUNX1 gene is controlled by two promoters; the distal P1 promoter and the proximal P2 promoter. Several isoforms of RUNX1 mRNA are generated through the use of both promoters and alternative splicing. These isoforms not only differs in their temporal expression pattern but also exhibit differences in tissue specificity. The RUNX1 isoforms derived from P2 are expressed in a variety of tissues, but expression of P1-derived isoform is restricted to cells of hematopoietic lineage. However, the control of hematopoietic-cell specific expression is poorly understood. Here we report regulation of P1-derived RUNX1 mRNA by RUNX1 protein. In silico analysis of P1 promoter revealed presence of two evolutionary conserved RUNX motifs, 0.6kb upstream of the transcription start site, and three RUNX motifs within 170bp of the 5'UTR. Transcriptional contribution of these RUNX motifs was studied in myeloid and T-cells. RUNX1 genomic fragment containing all sites show very low basal activity in both cell types. Mutation or deletion of RUNX motifs in the UTR enhances basal activity of the RUNX1 promoter. Chromatin immunoprecipitation revealed that RUNX1 protein is recruited to these sites. Overexpression of RUNX1 in non-hematopoietic cells results in a dose dependent activation of the RUNX1 P1 promoter. We also demonstrate that RUNX1 protein regulates transcription of endogenous RUNX1 mRNA in T-cell. Finally we show that SCL transcription factor is recruited to regions containing RUNX motifs in the promoter and the UTR and regulates activity of the RUNX1 P1 promoter in vitro. Thus, multiple lines of evidence show that RUNX1 protein regulates its own gene transcription.

  6. Transcriptional Auto-Regulation of RUNX1 P1 Promoter.

    Directory of Open Access Journals (Sweden)

    Milka Martinez

    Full Text Available RUNX1 a member of the family of runt related transcription factors (RUNX, is essential for hematopoiesis. The expression of RUNX1 gene is controlled by two promoters; the distal P1 promoter and the proximal P2 promoter. Several isoforms of RUNX1 mRNA are generated through the use of both promoters and alternative splicing. These isoforms not only differs in their temporal expression pattern but also exhibit differences in tissue specificity. The RUNX1 isoforms derived from P2 are expressed in a variety of tissues, but expression of P1-derived isoform is restricted to cells of hematopoietic lineage. However, the control of hematopoietic-cell specific expression is poorly understood. Here we report regulation of P1-derived RUNX1 mRNA by RUNX1 protein. In silico analysis of P1 promoter revealed presence of two evolutionary conserved RUNX motifs, 0.6kb upstream of the transcription start site, and three RUNX motifs within 170bp of the 5'UTR. Transcriptional contribution of these RUNX motifs was studied in myeloid and T-cells. RUNX1 genomic fragment containing all sites show very low basal activity in both cell types. Mutation or deletion of RUNX motifs in the UTR enhances basal activity of the RUNX1 promoter. Chromatin immunoprecipitation revealed that RUNX1 protein is recruited to these sites. Overexpression of RUNX1 in non-hematopoietic cells results in a dose dependent activation of the RUNX1 P1 promoter. We also demonstrate that RUNX1 protein regulates transcription of endogenous RUNX1 mRNA in T-cell. Finally we show that SCL transcription factor is recruited to regions containing RUNX motifs in the promoter and the UTR and regulates activity of the RUNX1 P1 promoter in vitro. Thus, multiple lines of evidence show that RUNX1 protein regulates its own gene transcription.

  7. Phenomenology of 3-3-1-1 model

    CERN Document Server

    Dong, P V; Queiroz, Farinaldo S; Thuy, N T

    2014-01-01

    In this work we discuss a new model, 3-3-1-1 for short, that overhauls the theoretical and phenomenological aspects of the known 3-3-1 models. Additionally, we sift the outcome of the 3-3-1-1 model from precise electroweak bounds to dark matter observables. We advocate that B-L is conserved as electric charge, thus the standard model gauge symmetry extension to SU(3)_C X SU(3)_L X U(1)_X X U(1)_N (3-3-1-1) provides a minimal, self-contained framework that unifies all weak, electromagnetic and B-L interactions, apart from the strong interaction. W-parity (similar to R-parity) arises as a remnant subgroup of broken 3-3-1-1 gauge symmetry. The mass spectra of scalar and gauge sectors are diagonalized when the scale of 3-3-1-1 symmetry breaking is compatible to that of ordinary 3-3-1 symmetry breaking. All interactions of gauge bosons with fermions and scalars are obtained. The standard model Higgs boson H is naturally light with the consistent mass due to a seesaw mechanism. The 3-3-1-1 model provides two dark m...

  8. Hawking's singularity theorem for $C^{1,1}$-metrics

    CERN Document Server

    Kunzinger, Michael; Stojkovic, Milena; Vickers, James A

    2014-01-01

    We provide a detailed proof of Hawking's singularity theorem in the regularity class $C^{1,1}$, i.e., for spacetime metrics possessing locally Lipschitz continuous first derivatives. The proof uses recent results in $C^{1,1}$-causality theory and is based on regularisation techniques adapted to the causal structure.

  9. 26 CFR 1.437-1.440 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false 1.437-1.440 Section 1.437-1.440 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Certain Stock Options §§...

  10. 26 CFR 1.432-1.435 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false 1.432-1.435 Section 1.432-1.435 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Certain Stock Options §§...

  11. 26 CFR 1.425-1.429 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false 1.425-1.429 Section 1.425-1.429 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Certain Stock Options §§...

  12. 26 CFR 1.1201-1 - Alternative tax.

    Science.gov (United States)

    2010-04-01

    ... January 1, 1962, section 802(a)(2), as amended by the Life Insurance Company Income Tax Act of 1959 (73... Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Wash Sales of Stock Or Securities § 1.1201-1 Alternative tax. (a) Corporations—(1)...

  13. 26 CFR 1.985-1 - Functional currency.

    Science.gov (United States)

    2010-04-01

    ... trades or businesses. (3) Books and records presumption. A QBU shall be presumed to keep books and...) INCOME TAXES Export Trade Corporations § 1.985-1 Functional currency. (a) Applicability and effective... the currency used in keeping its books and records (as defined in § 1.989(a)-1(d)). The dollar...

  14. Genetics Home Reference: 1q21.1 microdeletion

    Science.gov (United States)

    ... communication and social interaction, attention deficit hyperactivity disorder (ADHD), and sleep disturbances. Studies suggest that deletions of genetic material from the 1q21.1 region may also be risk factors for schizophrenia. Some people with a 1q21.1 ...

  15. LINE-1 ORF1 protein enhances Alu SINE retrotransposition.

    Science.gov (United States)

    Wallace, Nicholas; Wagstaff, Bradley J; Deininger, Prescott L; Roy-Engel, Astrid M

    2008-08-01

    Retroelements have contributed over one third of the human genome mass. The currently active LINE-1 (L1) codes for two proteins (ORF1p and ORF2p), both strictly required for retrotransposition. In contrast, the non-coding parasitic SINE (Alu) only appears to need the L1 ORF2p for its own amplification. This requirement was previously determined using a tissue culture assay system in human cells (HeLa). Because HeLa are likely to express functional L1 proteins, it is possible that low levels of endogenous ORF1p are necessary for the observed tagged Alu mobilization. By individually expressing ORF1 and ORF2 proteins from both human (L1RP and LRE3) and rodent (L1A102 and L1spa) L1 sources, we demonstrate that increasing amounts of ORF1 expressing vector enhances tagged Alu mobilization in HeLa cells. In addition, using chicken fibroblast cells as an alternate cell culture source, we confirmed that ORF1p is not strictly required for Alu mobilization in our assay. Supporting our observations in HeLa cells, we find that tagged Alu retrotransposition is improved by supplementation of ORF1p in the cultured chicken cells. We postulate that L1 ORF1p plays either a direct or indirect role in enhancing the interaction between the Alu RNA and the required factors needed for its retrotransposition.

  16. 26 CFR 1.7702B-1 - Consumer protection provisions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Consumer protection provisions. 1.7702B-1 Section 1.7702B-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME...-Term Care Insurance Model Act (Model Act) and Long-Term Care Insurance Model Regulation...

  17. 26 CFR 1.1368-1 - Distributions by S corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Distributions by S corporations. 1.1368-1... TAX (CONTINUED) INCOME TAXES Small Business Corporations and Their Shareholders § 1.1368-1 Distributions by S corporations. (a) In general. This section provides rules for distributions made by an...

  18. Data of evolutionary structure change: 1B1GA-1AK8A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1B1GA KEGDP-NQLSK > - EEE...> A 1AK8A FDKDGDGTITT H ...A LFEEL---DKNGD >HHHHH--- ...entryIDChain>1AK8A LQDMINEVDADGN ...>HHHHH > ATOM 722 CA LEU A 48 3.325 7.917 -3.325 1.00 0

  19. 40 CFR 721.6075 - Phosphonic acid, 1,1-methylenebis-tetrakis(1-methylethyl) ester.

    Science.gov (United States)

    2010-07-01

    ...-tetrakis(1-methylethyl) ester. 721.6075 Section 721.6075 Protection of Environment ENVIRONMENTAL PROTECTION...-methylethyl) ester. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as phosphonic acid, 1,1-methylenebis-tetrakis(1-methylethyl) ester (PMN P-95-168)...

  20. BOB.1/OBF.1 controls the balance of TH1 and TH2 immune responses.

    Science.gov (United States)

    Brunner, Cornelia; Sindrilaru, Anca; Girkontaite, Irute; Fischer, Klaus-Dieter; Sunderkötter, Cord; Wirth, Thomas

    2007-07-11

    BOB.1/OBF.1 is a transcriptional coactivator essential at several stages of B-cell development. In T cells, BOB.1/OBF.1 expression is inducible by co-stimulation. However, a defined role of BOB.1/OBF.1 for T-cell function had not been discovered so far. Here, we show that BOB.1/OBF.1 is critical for T helper cell function. BOB.1/OBF.1(-/-) mice showed imbalanced immune responses, resulting in increased susceptibility to Leishmania major infection. Functional analyses revealed specific defects in TH1 and TH2 cells. Whereas expression levels of TH1 cytokines were reduced, the secretion of TH2 cytokines was increased. BOB.1/OBF.1 directly contributes to the IFNgamma and IL2 promoter activities. In contrast, increased TH2 cytokine production is controlled indirectly, probably via the transcription factor PU.1, the expression of which is regulated by BOB.1/OBF.1. Thus, BOB.1/OBF.1 regulates the balance of TH1 versus TH2 mediated immunity.

  1. 甲型H1N1流感

    Institute of Scientific and Technical Information of China (English)

    赵苹

    2010-01-01

    @@ 2009年3月以来,许多国家先后发生甲型H1N1流感.甲型H1N1流感原名猪流感,为避免"猪流感"一词对人们的误导,世界卫生组织将此前被称为猪流感的新型致命病毒更名为"AH1N1型流感"(influenza A (H1N1)),我国按惯例称为"甲型H1N1流感". 世卫组织已将该病警告级别提高到6级,表明它将会成为全球性流行病.

  2. Genotype frequencies of polymorphic GSTM1, GSTT1, and cytochrome P450 CYP1A1 in Mexicans.

    Science.gov (United States)

    Montero, Regina; Araujo, Antonio; Carranza, Paloma; Mejía-Loza, Vanessa; Serrano, Luis; Albores, Arnulfo; Salinas, Juan E; Camacho-Carranza, Rafael

    2007-06-01

    The genotype frequencies of three metabolic polymorphisms were determined in a sample of a typical community in central Mexico. CYP1A1*3, GSTM1, and GSTT1 polymorphisms were studied in 150 donors born in Mexico and with Mexican ascendants; with respect to ethnicity the subjects can be considered Mestizos. PCR reactions were used to amplify specific fragments of the selected genes from genomic DNA. An unexpected 56.7% frequency of the CYP1A1*3 allele (which depends on the presence of a Val residue in the 462 position of the enzyme, instead of Ile) was found, the highest described for open populations of different ethnic origins (i.e., Caucasian, Asian, African, or African American). The GSTM1 null genotype was found with a frequency of 42.6%, which is not different from other ethnicities, whereas the GSTT1 null genotype had a frequency of 9.3%, one of the lowest described for any ethnic group but comparable to the frequency found in India (9.7%). The frequency of the combined genotype CYP1A1*3/*3 and the GSTM1 null allele is one of the highest observed to date (or perhaps the highest): 13.7% among all the ethnicities studied, including Caucasians and Asians, whereas the combination of CYP1A1*3/*3 with the GSTT1 null allele reached only 2.8%. The GSTM1 null allele combined with the GSTT1 null allele, on the other hand, has one of the lowest frequencies described, 4.24%, comparable to the frequencies found in African Americans and Indians. Finally, the combined CYP1A1*3/*3, GSTM1 null allele, and GSTT1 null allele genotype could not be found in the sample studied; it is assumed that the frequency of carriers of these combined genotypes is less than 1%. CYP1A1*3 and CYP1A1*2 polymorphisms were also evaluated in 50 residents in a community of northern Mexico; the CYP1A1*3 frequency was 54%, similar to that found in the other community studied, and the CYP1A1*2 frequency was 40%, which is high compared to Caucasians and Asians but comparable to the frequency found in

  3. 26 CFR 1.1402(c)-1 - Trade or business.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Trade or business. 1.1402(c)-1 Section 1.1402(c... (CONTINUED) INCOME TAXES Tax on Self-Employment Income § 1.1402(c)-1 Trade or business. In order for an individual to have net earnings from self-employment, he must carry on a trade or business, either as...

  4. CYP1B1 and hormone-induced cancer.

    Science.gov (United States)

    Gajjar, Ketan; Martin-Hirsch, Pierre L; Martin, Francis L

    2012-11-01

    Cancers in hormone-responsive tissues (e.g., breast, ovary, endometrium, prostate) occur at high incidence rates worldwide. However, their genetic basis remains poorly understood. Studies to date suggest that endogenous/exogenous oestrogen and environmental carcinogens may play a role in development and/or progression of hormone-induced cancers via oxidative oestrogen metabolism. Cytochrome P450 1B1 is a key enzyme in its oestrogen metabolism pathway, giving rise to hydroxylation and conjugation. Although CYP1B1 is expressed in many cancers, particularly high levels of expression are observed in oestrogen-mediated disease. CYP1B1 is more readily found in tumour tissue compared to normal. Given the role of CYP1B1 in pro-carcinogen and oestrogen metabolism, polymorphisms in CYP1B1 could result in modifications in its enzyme activity and subsequently lead to hormone-mediated carcinogenesis. CYP1B1 may also be involved in progression of the disease by altering the tissue response to hormones and clinical response to chemotherapy. The exact mechanism behind these events is complex and unclear. Only a few functional single nucleotide polymorphisms of CYP1B1 are known to result in amino acid substitutions and have been extensively investigated. Studies examining the contribution of different CYP1B1 alleles to hormone-mediated cancer risks are inconsistent. The main focus of this review is to appraise the available studies linking the pathogenesis of the hormone-induced cancers to various CYP1B1 polymorphisms. Additionally, we explore the role of a neuronal protein, γ-synuclein, in CYP1B1-mediated pathogenesis.

  5. Interleukin-1 antagonism in type 1 diabetes of recent onset

    DEFF Research Database (Denmark)

    Moran, Antoinette; Bundy, Brian; Becker, Dorothy J

    2013-01-01

    Innate immunity contributes to the pathogenesis of autoimmune diseases, such as type 1 diabetes, but until now no randomised, controlled trials of blockade of the key innate immune mediator interleukin-1 have been done. We aimed to assess whether canakinumab, a human monoclonal anti-interleukin-1...... antibody, or anakinra, a human interleukin-1 receptor antagonist, improved β-cell function in recent-onset type 1 diabetes....

  6. YY1-MIR372-SQSTM1 regulatory axis in autophagy.

    Science.gov (United States)

    Feng, Lifeng; Ma, Yanning; Sun, Jie; Shen, Qi; Liu, Leiming; Lu, Haiqi; Wang, Faliang; Yue, Yongfang; Li, Jiaqiu; Zhang, Shenjie; Lin, Xiaoying; Chu, Jue; Han, Weidong; Wang, Xian; Jin, Hongchuan

    2014-08-01

    Autophagy is a self-proteolytic process that degrades intracellular material to enable cellular survival under unfavorable conditions. However, how autophagy is activated in human carcinogenesis remains largely unknown. Herein we report an epigenetic regulation of autophagy in human cancer cells. YY1 (YY1 transcription factor) is a well-known epigenetic regulator and is upregulated in many cancers. We found that YY1 knockdown inhibited cell viability and autophagy flux through downregulating SQSTM1 (sequestosome 1). YY1 regulated SQSTM1 expression through the epigenetic modulation of the transcription of MIR372 (microRNA 372) which was found to target SQSTM1 directly. During nutrient starvation, YY1 was stimulated to promote SQSTM1 expression and subsequent autophagy activation by suppressing MIR372 expression. Similar to YY1 depletion, MIR372 overexpression blocked autophagy activation and inhibited in vivo tumor growth. SQSTM1 upregulation and competent autophagy flux thus contributed to the oncogenic function of YY1. YY1-promoted SQSTM1 upregulation might be a useful histological marker for cancer detection and a potential target for drug development.

  7. AAS 227: Day 1

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    The mission was featured on the front pages of 450 newspapers worldwide on every single continent (including Antartica!)New Horizons reached the Moon in9 HOURSafter launch (compared to the ~3 days it took the Apollo missions)The mission controllers were aiming for a 100km window of space all the way from EarthThere was a window of ~400seconds which the probe had to arrive within the probe arrived90 seconds early! Putting tardy astronomers everywhere to shame.Charon was the only satellite of Pluto known at the time of the mission proposalThe canyon found on Charon is not only bigger than the Grand Canyon but bigger than Mariner Valley on Mars which is already4000 km (2500 mi) long and reaches depths of up to 7 km (4 mi)!Charons surface. Tectonic feature runs about 1500 km, around 10 km deep. Eat it, Mars. #aas227 pic.twitter.com/blewwJaXEn Danny Barringer (@HeavyFe_H) January 5, 2016The mountains ringing the Sputnik Planum (aka the heart of Pluto) are over 4km high and are snow capped with methane icePlutos mountain ranges. Means surface nitrogen layer is thin, probably water ice according to @AlanStern. #aas227 pic.twitter.com/0yyHZvpBOE Danny Barringer (@HeavyFe_H) January 5, 2016Plutos atmosphere has a dozendistincthaze layers but how they arecreated is a mystery#aas227 hazes on Pluto wow pic.twitter.com/VPx99ZhPj1 Lisa StorrieLombardi (@lisajsl) January 5, 2016Alan also spoke about the future of New Horizons there is a new mission proposal for a fly by of a Kuiper Belt object 2014MU69 in Jan 2019 which should give us a better understanding of this icy frontier at the edge ofthe Solar System. As a parting gift Alan playedthemost gorgeously detailed fly over video of Plutos surface that had all in the room melting into their flip flops. Its safe to say that the whole room is now Pluto-curious and wondering whether a change of discipline is in order!Press Conference: Black Holes and Exoplanets (by Susanna Kohler)This morning marked the first press conference of the meeting

  8. PINK1 positively regulates IL-1β-mediated signaling through Tollip and IRAK1 modulation

    Directory of Open Access Journals (Sweden)

    Lee Hyun Jung

    2012-12-01

    Full Text Available Abstract Background Parkinson disease (PD is characterized by a slow, progressive degeneration of dopaminergic neurons in the substantianigra. The cause of neuronal loss in PD is not well understood, but several genetic loci, including PTEN-induced putative kinase 1 (PINK1, have been linked to early-onset autosomal recessive forms of familial PD. Neuroinflammation greatly contributes to PD neuronal degeneration and pathogenesis. IL-1 is one of the principal cytokines that regulates various immune and inflammatory responses via the activation of the transcription factors NF-κB and activating protein-1. Despite the close relationship between PD and neuroinflammation, the functional roles of PD-linked genes during inflammatory processes remain poorly understood. Methods To explore the functional roles of PINK1 in response to IL-1β stimulation, HEK293 cells, mouse embryonic fibroblasts derived from PINK1-null (PINK1−/− and control (PINK1+/+ mice, and 293 IL-1RI cells stably expressing type 1 IL-1 receptor were used. Immunoprecipitation and western blot analysis were performed to detect protein–protein interaction and protein ubiquitination. To confirm the effect of PINK1 on NF-κB activation, NF-κB-dependent firefly luciferase reporter assay was conducted. Results PINK1 specifically binds two components of the IL-1-mediated signaling cascade, Toll-interacting protein (Tollip and IL-1 receptor-associated kinase 1 (IRAK1. The association of PINK1 with Tollip, a negative regulator of IL-1β signaling, increases upon IL-1β stimulation, which then facilitates the dissociation of Tollip from IRAK1 as well as the assembly of the IRAK1–TNF receptor-associated factor 6 (TRAF6 complex. PINK1 also enhances Lys63-linked polyubiquitination of IRAK1, an essential modification of recruitment of NF-κB essential modulator and subsequent IκB kinase activation, and increases formation of the intermediate signalosome including IRAK1, TRAF6, and

  9. Gromov-Witten Theory of P^1\\timesP^1\\timesP^1

    CERN Document Server

    Karp, Dagan

    2012-01-01

    We prove equivalences between the Gromov-Witten theories of four blowups of P1\\timesP1\\timesP1 and P3. In particular, we prove that the all genus, virtual dimension zero Gromov-Witten theory of the blowup of P3 at points precisely coincides with that of the blowup at points of P1 \\times P1 \\times P1, for non-exceptional classes. It follows that the all-genus stationary Gromov-Witten theory of P1 \\times P1 \\times P1 coincides with that of P3 in low degree. We also prove there exists a toric symmetry of the Gromov-Witten theory of P1\\timesP1\\timesP1 analogous to and intimately related to Cremona symmetry of P3. Enumerative applications are given.

  10. Synthesis of Some New Derivatives of 1,3-Dichloro-1,1,3,3-tetraphenyldisilazane

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The reactive properties of 1,3-dichloro-1,1,3,3-tetraphenyldisilazane (DCTPS) with water, methanol, phenylamine and lithium salt of hexamethylcyclotrisilazane (D3NLi) were investigated, and four new derivatives were obtained.

  11. Police Districts, Law, Published in 2012, 1:63360 (1in=1mile) scale, Taylor County.

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — This Police Districts dataset, published at 1:63360 (1in=1mile) scale, was produced all or in part from Hardcopy Maps information as of 2012. It is described as...

  12. Experimental Conditions: SE24_S1_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available rometry with 13C‑Labeling for Chemical Assignment of Sulfur-Containing Metabolites ...SE24_S1_M1_D1 SE24 Combination of Liquid Chromatography-Fourier Transform Ion Cyclotron Resonance-Mass Spect

  13. Galectin-1 exerts inhibitory effects during DENV-1 infection.

    Directory of Open Access Journals (Sweden)

    Karina Alves Toledo

    Full Text Available Dengue virus (DENV is an enveloped RNA virus that is mosquito-transmitted and can infect a variety of immune and non-immune cells. Response to infection ranges from asymptomatic disease to a severe disorder known as dengue hemorrhagic fever. Despite efforts to control the disease, there are no effective treatments or vaccines. In our search for new antiviral compounds to combat infection by dengue virus type 1 (DENV-1, we investigated the role of galectin-1, a widely-expressed mammalian lectin with functions in cell-pathogen interactions and immunoregulatory properties. We found that DENV-1 infection of cells in vitro exhibited caused decreased expression of Gal-1 in several different human cell lines, suggesting that loss of Gal-1 is associated with virus production. In test of this hypothesis we found that exogenous addition of human recombinant Gal-1 (hrGal-1 inhibits the virus production in the three different cell types. This inhibitory effect was dependent on hrGal-1 dimerization and required its carbohydrate recognition domain. Importantly, the inhibition was specific for hrGal-1, since no effect was observed using recombinant human galectin-3. Interestingly, we found that hrGal-1 directly binds to dengue virus and acts, at least in part, during the early stages of DENV-1 infection, by inhibiting viral adsorption and its internalization to target cells. To test the in vivo role of Gal-1 in DENV infection, Gal-1-deficient-mice were used to demonstrate that the expression of endogenous Galectin-1 contributes to resistance of macrophages to in vitro-infection with DENV-1 and it is also important to physiological susceptibility of mice to in vivo infection with DENV-1. These results provide novel insights into the functions of Gal-1 in resistance to DENV infection and suggest that Gal-1 should be explored as a potential antiviral compound.

  14. Irradiation programme SAMARCANDE. Impact test results; Bestrahlungsprogramm SAMARCANDE. Ergebnisse der Kerbschlagbiegeversuche

    Energy Technology Data Exchange (ETDEWEB)

    Rieth, M.; Dafferner, B.; Ries, H.; Romer, O.

    1994-08-01

    To produce proof of the usability of the martensitic 10.5% Cr-steel 1.4914 as alternative wrapper tube material the irradiation induced embrittlement was characterised with impact tests. The examinations were based on specimens, which were fabricated out of an irradiated wrapper tube. The irradiation was carried out within the EFR project (European Fast Reactor) in the PHENIX reactor in Cadarache (irradiation programme SAMARCANDE). The evaluation of ductile-to-brittle-transition temperatures and upper shelf energies of safety relevant segments of the tube led to a positive assessment: the 10.5% Cr-steel 1.4914 is excellently suited to the usage as wrapper tube material. (orig.) [Deutsch] Zum Nachweis der Tauglichkeit des martensitischen 10,5% Cr-Stahls 1.4914 als alternaties Kastenmaterial wurde anhand von Kerbschlagbiegeversuchen die bestrahlungsinduzierte Versproedung charakterisiert. Die Untersuchungen stuetzten sich hauptsaechlich auf Proben, die aus einem im Rahmen des EFR-Projekts in Cadarache (PHENIX-Reaktor, Bestrahlungsprogramm SAMAR-CANDE) bestrahlten Brennelementhuellkasten gefertig wurden. Die Auswertung der Sproedbruchuebergangstemperatur und der Schlagarbeit in der Hochlage der sicherheitsrelevanten Segmente des Huellkastens fuehrte zu einer positiven Bewertung: der 10,5% Cr-Stahl 1.4914 ist fuer den Einsatz als Brennelementhuellkastenwerkstoff bestens geeignet. (orig.)

  15. Molecular characterization of zebrafish Oatp1d1 (Slco1d1), a novel organic anion-transporting polypeptide.

    Science.gov (United States)

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2013-11-22

    The organic anion-transporting polypeptide (OATP/Oatp) superfamily includes a group of polyspecific transporters that mediate transport of large amphipathic, mostly anionic molecules across cell membranes of eukaryotes. OATPs/Oatps are involved in the disposition and elimination of numerous physiological and foreign compounds. However, in non-mammalian species, the functional properties of Oatps remain unknown. We aimed to elucidate the role of Oatp1d1 in zebrafish to gain insights into the functional and structural evolution of the OATP1/Oatp1 superfamily. We show that diversification of the OATP1/Oatp1 family occurs after the emergence of jawed fish and that the OATP1A/Oatp1a and OATP1B/Oatp1b subfamilies appeared at the root of tetrapods. The Oatp1d subfamily emerged in teleosts and is absent in tetrapods. The zebrafish Oatp1d1 is similar to mammalian OATP1A/Oatp1a and OATP1B/Oatp1b members, with the main physiological role in transport and balance of steroid hormones. Oatp1d1 activity is dependent upon pH gradient, which could indicate bicarbonate exchange as a mode of transport. Our analysis of evolutionary conservation and structural properties revealed that (i) His-79 in intracellular loop 3 is conserved within OATP1/Oatp1 family and is crucial for the transport activity; (ii) N-glycosylation impacts membrane targeting and is conserved within the OATP1/Oatp1 family with Asn-122, Asn-133, Asn-499, and Asn-512 residues involved; (iii) the evolutionarily conserved cholesterol recognition interaction amino acid consensus motif is important for membrane localization; and (iv) Oatp1d1 is present in dimeric and possibly oligomeric form in the cell membrane. In conclusion, we describe the first detailed characterization of a new Oatp transporter in zebrafish, offering important insights into the functional evolution of the OATP1/Oatp1 family and the physiological role of Oatp1d1.

  16. SIRT1 mediates Sphk1/S1P-induced proliferation and migration of endothelial cells.

    Science.gov (United States)

    Gao, Zhan; Wang, Hua; Xiao, Feng-Jun; Shi, Xue-Feng; Zhang, Yi-Kun; Xu, Qin Qin; Zhang, Xiao-Yan; Ha, Xiao-Qin; Wang, Li-Sheng

    2016-05-01

    Angiogenesis is one of the most important components of embryonic organ formation and vessel growth after birth. Sphingosine kinase 1 (Sphk1) and S1P has been confirmed to participate in various cell signaling pathways and physiological processes including neovascularisation. However, the mechanisms that Sphk1/S1P regulates neovascularisation remain unclear. In this study, we elucidated that Sphk1/S1P upregulates sirtuin 1 (SIRT1), a NAD+ dependent deacetylases protease which exerts multiple cellular functions, to regulate the proliferation and migration of endothelial cells. By using CCK8 and Transwell assays, we demonstrated that Sphk1 and SIRT1 knockdown could significantly decrease proliferation and migration of HUVEC cells. Sphk1 inhibition results in SIRT1 downregulation which could be reversed by exogenous S1P in HUVEC cells. Treatment of HUVECs with S1P reverses the impaired proliferation and migration caused by SIRT1 knockdown. Furthermore, Sphk1 knockdown inhibits the phosphorylation of P38 MAPK, ERK and AKT. Treatment of HUVECs with PD98059, SB203580 and Wortmannin, which are the inhibitors of ERK, P38 MAPK and AKT respectively, resulted in decreased SIRT1 expression and reduced migration of HUVEC cells. Thus, we conclude that Sphk1/S1P induces SIRT1 upregulation through multiple pathways including P38 MAPK, ERK and AKT signals. This is the first report to disclose the existence and roles of Sphk1/S1P/SIRT1 axis in regulation of endothelial cell proliferation and migration, which may provide a theoretical basis for angiogenesis.

  17. 2016 SPD: Day 1

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors note: This week were in Boulder, Colorado at the 47th meeting of the AAS Solar Physics Division (SPD). Follow along to catch some of the latest news from the field of solar physics!The 2016 SPD meeting was launched this morning from the University of Colorado Boulder campus. Two of the hot topics at this years meeting include celebration of the recent move of the National Solar Observatorys headquarters to Boulder, and discussion of the future Daniel K. Inouye Solar Telescope (DKIST, formerly the Advanced Technology Solar Telescope, ATST). DKIST, planned for a 2019 completion in Hawaii, is the next big telescope on the horizon for solar physics.Todays press conference had an interesting focus: instruments providing new high-energy observations of the Sun. Representatives from four different instruments were here to talk about some of the latest X-ray solar observations.GRIPSThe GRIPS payload flew at 130,000 ft over Antarctica on a giant balloon in January 2016. [NASA/Albert Shih]First up, Albert Shih (NASA Goddard) described the Gamma-Ray Imager/Polarimeter for Solar flares, or GRIPS. GRIPS is a balloon-borne instrument designed to detect X-rays and gamma rays emitted during solar flares. Up to tens of a percent of the energy in solar flares is emitted in the form of accelerated particles, but the physics behind this process is not well understood. GRIPS observes where the highest-energy particles are accelerated, in an effort to learn more about the process.GRIPS was launched on 19 January, 2016 and flew for roughly 12 days gathering ~1 million seconds of data! The logistics of this instruments flight are especially interesting, since it was launched from Antarctica and carried by a balloon at a whopping elevation of 130,000 ft (to get high enough that the atmosphere doesnt absorb all the photons GRIPS is trying to observe). Though the data from the mission has been retrieved, the bulk of the hardware remains where it landed at the end of January. It must

  18. Stromal cell-derived factor 1α (SDF-1α)

    DEFF Research Database (Denmark)

    Li, Dana; Bjørnager, Louise; Langkilde, Anne

    2016-01-01

    OBJECTIVES: Stromal cell-derived factor 1a (SDF-1α), is a chemokine and is able to home hematopoietic progenitor cells to injured areas of heart tissue for structural repair. Previous studies have found increased levels of SDF-1α in several cardiac diseases, but only few studies have investigated...... SDF-1α in patients with atrial fibrillation (AF). We aimed to test SDF-1α in a large cohort of patients with AF and its role as a prognostic marker. DESIGN: Between January 1st 2008 to December 1st 2012, 290 patients with ECG documented AF were enrolled from the in- and outpatient clinics...... at the Department of Cardiology, Hvidovre Hospital, University of Copenhagen, Hvidovre, Denmark. Plasma levels of SDF-1α were measured using ELISA technique. Clinical data were registered and patient follow-up was conducted. RESULTS: Patients with permanent AF had significantly higher SDF-1α levels (2199.5 pg...

  19. Emerging GLP-1 receptor agonists

    DEFF Research Database (Denmark)

    Lund, Asger; Knop, Filip K; Vilsbøll, Tina

    2011-01-01

    Introduction: Recently, glucagon-like peptide-1 receptor (GLP-1R) agonists have become available for the treatment of type 2 diabetes. These agents exploit the physiological effects of GLP-1, which is able to address several of the pathophysiological features of type 2 diabetes. GLP-1R agonists...

  20. Regional gene expression of LOX-1, VCAM-1, and ICAM-1 in aorta of HIV-1 transgenic rats.

    Directory of Open Access Journals (Sweden)

    Anne Mette Fisker Hag

    Full Text Available BACKGROUND: Increased prevalence of atherosclerotic cardiovascular disease in HIV-infected patients has been observed. The cause of this accelerated atherosclerosis is a matter of controversy. As clinical studies are complicated by a multiplicity of risk-factors and a low incidence of hard endpoints, studies in animal models could be attractive alternatives. METHODOLOGY/PRINCIPAL FINDINGS: We evaluated gene expression of lectin-like oxidized-low-density-lipoprotein receptor-1 (LOX-1, vascular cell adhesion molecule-1 (VCAM-1, and intercellular adhesion molecule-1 (ICAM-1 in HIV-1 transgenic (HIV-1Tg rats; these genes are all thought to play important roles in early atherogenesis. Furthermore, the plasma level of sICAM-1 was measured. We found that gene expressions of LOX-1 and VCAM-1 were higher in the aortic arch of HIV-1Tg rats compared to controls. Also, the level of sICAM-1 was elevated in the HIV-1Tg rats compared to controls, but the ICAM-1 gene expression profile did not show any differences between the groups. CONCLUSIONS/SIGNIFICANCE: HIV-1Tg rats have gene expression patterns indicating endothelial dysfunction and accelerated atherosclerosis in aorta, suggesting that HIV-infection per se may cause atherosclerosis. This transgenic rat model may be a very promising model for further studies of the pathophysiology behind HIV-associated cardiovascular disease.

  1. Main: AS1LIKECSHPRA [PLACE

    Lifescience Database Archive (English)

    Full Text Available AS1LIKECSHPRA S000260 14-Oct-1999 (last modified) kehi as-1-like motif found in cuc...umber (C.s.) hydroxypyruvate reductase (hprA) gene; Required for cytokinin responsiveness; Also see S000261 ...(CYTOSITECSHPRA); cytokinin; as-1; as-1 TGACG motif; cucumber (Cucumis sativus) AAATGACGAAAATGC ...

  2. Regulation of TRPML1 function.

    Science.gov (United States)

    Waller-Evans, Helen; Lloyd-Evans, Emyr

    2015-06-01

    TRPML1 is a ubiquitously expressed cation channel found on lysosomes and late endosomes. Mutations in TRPML1 cause mucolipidosis type IV and it has been implicated in Alzheimer's disease and HIV. However, the mechanisms by which TRPML1 activity is regulated are not well understood. This review summarizes the current understanding of TRPML1 activation and regulation.

  3. Stoichiometry of the KCNQ1 - KCNE1 ion channel complex.

    Science.gov (United States)

    Nakajo, Koichi; Ulbrich, Maximilian H; Kubo, Yoshihiro; Isacoff, Ehud Y

    2010-11-02

    The KCNQ1 voltage-gated potassium channel and its auxiliary subunit KCNE1 play a crucial role in the regulation of the heartbeat. The stoichiometry of KCNQ1 and KCNE1 complex has been debated, with some results suggesting that the four KCNQ1 subunits that form the channel associate with two KCNE1 subunits (a 42 stoichiometry), while others have suggested that the stoichiometry may not be fixed. We applied a single molecule fluorescence bleaching method to count subunits in many individual complexes and found that the stoichiometry of the KCNQ1 - KCNE1 complex is flexible, with up to four KCNE1 subunits associating with the four KCNQ1 subunits of the channel (a 44 stoichiometry). The proportion of the various stoichiometries was found to depend on the relative expression densities of KCNQ1 and KCNE1. Strikingly, both the voltage-dependence and kinetics of gating were found to depend on the relative densities of KCNQ1 and KCNE1, suggesting the heart rhythm may be regulated by the relative expression of the auxiliary subunit and the resulting stoichiometry of the channel complex.

  4. Adenosine deaminase acting on RNA-1 (ADAR1 inhibits HIV-1 replication in human alveolar macrophages.

    Directory of Open Access Journals (Sweden)

    Michael D Weiden

    Full Text Available While exploring the effects of aerosol IFN-γ treatment in HIV-1/tuberculosis co-infected patients, we observed A to G mutations in HIV-1 envelope sequences derived from bronchoalveolar lavage (BAL of aerosol IFN-γ-treated patients and induction of adenosine deaminase acting on RNA 1 (ADAR1 in the BAL cells. IFN-γ induced ADAR1 expression in monocyte-derived macrophages (MDM but not T cells. ADAR1 siRNA knockdown induced HIV-1 expression in BAL cells of four HIV-1 infected patients on antiretroviral therapy. Similar results were obtained in MDM that were HIV-1 infected in vitro. Over-expression of ADAR1 in transformed macrophages inhibited HIV-1 viral replication but not viral transcription measured by nuclear run-on, suggesting that ADAR1 acts post-transcriptionally. The A to G hyper-mutation pattern observed in ADAR1 over-expressing cells in vitro was similar to that found in the lungs of HIV-1 infected patients treated with aerosol IFN-γ suggesting the model accurately represented alveolar macrophages. Together, these results indicate that ADAR1 restricts HIV-1 replication post-transcriptionally in macrophages harboring HIV-1 provirus. ADAR1 may therefore contribute to viral latency in macrophages.

  5. E1M1 and E1E2 transition probabilities in one-electron ions

    Science.gov (United States)

    Labzowsky, L. N.; Shonin, A. V.

    2004-12-01

    The quantum electrodynamical (QED) theory of the two-photon transitions in hydrogenlike ions is presented. The emission probability for 2s→2γ(E1)+1s transitions is calculated and compared to the results of the previous calculations. The emission probabilities 2p→γ(E1)+γ(E2)+1s and 2p→γ(E1)+γ(M1)+1s are also calculated for the nuclear charge Z values 1⩽Z⩽100. This is the first calculation of the two latter probabilities. The results are given in two different gauges.

  6. Thyrocyte-interleukin-1 interactions

    DEFF Research Database (Denmark)

    Rasmussen, A K; Bendtzen, K; Feldt-Rasmussen, U

    2000-01-01

    characterized by massive infiltration of lymphoid cells. The interleukin-1 (IL-1) family of molecules is together with other cytokines an integral component of the complex intercellular communication required to mount and control an immune response. IL-1alpha/beta in moderate and high concentrations reversibly...... inhibit thyroid cell function, while IL-1beta in low concentrations stimulates thyroid cell function. The biphasic, non-cytotoxic and reversible influence of IL-1 supports a role of IL-1 in the physiological regulation of thyroid cell function. IL-1 stimulates the guanylate mediated pathways and inhibits...

  7. Treatment of type 1 diabetic patients with glucagon-like peptide-1 (GLP-1) and GLP-1R agonists

    DEFF Research Database (Denmark)

    Holst, JJ; Kielgast, Urd; Holst, Jens J

    2009-01-01

    GLP-1 (glucagon-like peptide-1) is a peptide hormone secreted from endocrine cells in the intestinal mucosa in response to meals. The major effects of GLP-1 are to increase glucose-induced insulin secretion and reduce glucagon release, but GLP-1 also inhibits gastric emptying rate and reduces......, as well as the potential of GLP-1 as an adjuvant therapy in islet cell transplantation, will be reviewed. Suggestions for future studies of GLP-1 treatment in type 1 diabetes may include early treatment in order to preserve beta-cell mass and prolong the remission period, but should also take a potential...

  8. CYP1B1: a unique gene with unique characteristics.

    Science.gov (United States)

    Faiq, Muneeb A; Dada, Rima; Sharma, Reetika; Saluja, Daman; Dada, Tanuj

    2014-01-01

    CYP1B1, a recently described dioxin inducible oxidoreductase, is a member of the cytochrome P450 superfamily involved in the metabolism of estradiol, retinol, benzo[a]pyrene, tamoxifen, melatonin, sterols etc. It plays important roles in numerous physiological processes and is expressed at mRNA level in many tissues and anatomical compartments. CYP1B1 has been implicated in scores of disorders. Analyses of the recent studies suggest that CYP1B1 can serve as a universal/ideal cancer marker and a candidate gene for predictive diagnosis. There is plethora of literature available about certain aspects of CYP1B1 that have not been interpreted, discussed and philosophized upon. The present analysis examines CYP1B1 as a peculiar gene with certain distinctive characteristics like the uniqueness in its chromosomal location, gene structure and organization, involvement in developmentally important disorders, tissue specific, not only expression, but splicing, potential as a universal cancer marker due to its involvement in key aspects of cellular metabolism, use in diagnosis and predictive diagnosis of various diseases and the importance and function of CYP1B1 mRNA in addition to the regular translation. Also CYP1B1 is very difficult to express in heterologous expression systems, thereby, halting its functional studies. Here we review and analyze these exceptional and startling characteristics of CYP1B1 with inputs from our own experiences in order to get a better insight into its molecular biology in health and disease. This may help to further understand the etiopathomechanistic aspects of CYP1B1 mediated diseases paving way for better research strategies and improved clinical management.

  9. Dynamin 1 regulates amyloid generation through modulation of BACE-1.

    Directory of Open Access Journals (Sweden)

    Li Zhu

    Full Text Available BACKGROUND: Several lines of investigation support the notion that endocytosis is crucial for Alzheimer's disease (AD pathogenesis. Substantial evidence have already been reported regarding the mechanisms underlying amyloid precursor protein (APP traffic, but the regulation of beta-site APP-Cleaving Enzyme 1 (BACE-1 distribution among endosomes, TGN and plasma membrane remains unclear. Dynamin, an important adaptor protein that controls sorting of many molecules, has recently been associated with AD but its functions remain controversial. Here we studied possible roles for dynamin 1 (dyn1 in Aβ biogenesis. PRINCIPAL FINDINGS: We found that genetic perturbation of dyn1 reduces both secreted and intracellular Aβ levels in cell culture. There is a dramatic reduction in BACE-1 cleavage products of APP (sAPPβ and βCTF. Moreover, dyn1 knockdown (KD leads to BACE-1 redistribution from the Golgi-TGN/endosome to the cell surface. There is an increase in the amount of surface holoAPP upon dyn1 KD, with resultant elevation of α-secretase cleavage products sAPPα and αCTF. But no changes are seen in the amount of nicastrin (NCT or PS1 N-terminal fragment (NTF at cell surface with dyn1 KD. Furthermore, treatment with a selective dynamin inhibitor Dynasore leads to similar reduction in βCTF and Aβ levels, comparable to changes with BACE inhibitor treatment. But combined inhibition of BACE-1 and dyn1 does not lead to further reduction in Aβ, suggesting that the Aβ-lowering effects of dynamin inhibition are mainly mediated through regulation of BACE-1 internalization. Aβ levels in dyn1(-/- primary neurons, as well as in 3-month old dyn1 haploinsufficient animals with AD transgenic background are consistently reduced when compared to their wildtype counterparts. CONCLUSIONS: In summary, these data suggest a previously unknown mechanism by which dyn1 affects amyloid generation through regulation of BACE-1 subcellular localization and therefore its

  10. The mappings of degree 1

    Directory of Open Access Journals (Sweden)

    2006-01-01

    Full Text Available The maps of the form f( x = ∑ i=1 n a i ⋅x⋅ b i , called 1-degree maps, are introduced and investigated. For noncommutative algebras and modules over them 1-degree maps give an analogy of linear maps and differentials. Under some conditions on the algebra &#x1d49c; , contractibility of the group of 1-degree isomorphisms is proved for the module l 2 ( &#x1d49c; . It is shown that these conditions are fulfilled for the algebra of linear maps of a finite-dimensional linear space. The notion of 1-degree map gives a possibility to define a nonlinear Fredholm map of l 2 ( &#x1d49c; and a Fredholm manifold modelled by l 2 ( &#x1d49c; . 1-degree maps are also applied to some problems of Markov chains.

  11. Time-resolved photoisomerization of 1,1‧-di-tert-butylstilbene and 1,1‧-dicyanostilbene

    Science.gov (United States)

    Dobryakov, A. L.; Quick, M.; Lenoir, D.; Detert, H.; Ernsting, N. P.; Kovalenko, S. A.

    2016-05-01

    Photoisomerization of 1,1‧-di-tert-butylstilbene (3) and 1,1‧-dicyanostilbene (4) is monitored with stationary and broadband transient absorption spectroscopy. The electron affinity of the substituents correlates with the shift of the absorption band. The weak extinction of 3 complicates data interpretation, but comparison with earlier measured 1,1‧-dimethylstilbene (1) and 1,1‧-diethylstilbene (2) helps to assign transient spectra and relaxation paths. For 3 a long-lived perpendicular state P is observed with lifetime τP = 134 ps in acetonitrile. For 4τP = 2.1 ps in acetonitrile and 27 ps in n-hexane, the difference indicating a substantial dipole moment (∼3D) of the P state.

  12. Sigma-1 receptor agonists directly inhibit Nav1.2/1.4 channels.

    Directory of Open Access Journals (Sweden)

    Xiao-Fei Gao

    Full Text Available (+-SKF 10047 (N-allyl-normetazocine is a prototypic and specific sigma-1 receptor agonist that has been used extensively to study the function of sigma-1 receptors. (+-SKF 10047 inhibits K(+, Na(+ and Ca2+ channels via sigma-1 receptor activation. We found that (+-SKF 10047 inhibited Na(V1.2 and Na(V1.4 channels independently of sigma-1 receptor activation. (+-SKF 10047 equally inhibited Na(V1.2/1.4 channel currents in HEK293T cells with abundant sigma-1 receptor expression and in COS-7 cells, which barely express sigma-1 receptors. The sigma-1 receptor antagonists BD 1063,BD 1047 and NE-100 did not block the inhibitory effects of (+-SKF-10047. Blocking of the PKA, PKC and G-protein pathways did not affect (+-SKF 10047 inhibition of Na(V1.2 channel currents. The sigma-1 receptor agonists Dextromethorphan (DM and 1,3-di-o-tolyl-guanidine (DTG also inhibited Na(V1.2 currents through a sigma-1 receptor-independent pathway. The (+-SKF 10047 inhibition of Na(V1.2 currents was use- and frequency-dependent. Point mutations demonstrated the importance of Phe(1764 and Tyr(1771 in the IV-segment 6 domain of the Na(V1.2 channel and Phe(1579 in the Na(V1.4 channel for (+-SKF 10047 inhibition. In conclusion, our results suggest that sigma-1 receptor agonists directly inhibit Na(V1.2/1.4 channels and that these interactions should be given special attention for future sigma-1 receptor function studies.

  13. Glucagon-like peptide 1 receptor agonist (GLP-1 RA)

    DEFF Research Database (Denmark)

    von Scholten, Bernt Johan; Hansen, Tine Willum; Goetze, Jens Peter;

    2015-01-01

    AIMS: In a short-term study including 31 patients with type 2 diabetes, glucagon-like peptide 1 receptor agonist (GLP-1 RA) treatment was associated with a significant reversible decline in GFR. Twenty-three patients re-initiated GLP-1 RA treatment after the primary study, and the aim was to inve......AIMS: In a short-term study including 31 patients with type 2 diabetes, glucagon-like peptide 1 receptor agonist (GLP-1 RA) treatment was associated with a significant reversible decline in GFR. Twenty-three patients re-initiated GLP-1 RA treatment after the primary study, and the aim...

  14. Glucagon-related peptide 1 (GLP-1): hormone and neurotransmitter

    DEFF Research Database (Denmark)

    Larsen, Philip J; Holst, Jens Juul

    2005-01-01

    The interest in glucagon-like petide-1 (GLP-1) and other pre-proglucagon derived peptides has risen almost exponentially since seminal papers in the early 1990s proposed to use GLP-1 agonists as therapeutic agents for treatment of type 2 diabetes. A wealth of interesting studies covering both...... normal and pathophysiological role of GLP-1 have been published over the last two decades and our understanding of GLP-1 action has widened considerably. In the present review, we have tried to cover our current understanding of GLP-1 actions both as a peripheral hormone and as a central neurotransmitter...

  15. Are 1+1 and 2+2 exceptional signatures?

    CERN Document Server

    Nieto, J A

    2004-01-01

    We prove that 1+1 and 2+2 target `spacetimes' of a 0-brane are exceptional signatures. Our proof is based on the requirement of SL(2,R) and `Lorentz' symmetries of a first order lagrangian. Using a special kind of 0-brane called `quatl', we also show that the exceptional signatures 1+1 and 2+2 are closely related. Moreover, we argue that the 2+2 target `spacetime' can be understood either as 2+2 worldvolume `spacetime' or as `1+1-matrix-brane'. The possibility that the exceptional 2+2-signature implies an exceptional chirotope is briefly outlined.

  16. Recognition factors of Ricinus communis agglutinin 1 (RCA(1)).

    Science.gov (United States)

    Wu, Albert M; Wu, June H; Singh, Tanuja; Lai, Li-Ju; Yang, Zhangung; Herp, Anthony

    2006-04-01

    Ricinus communis agglutinin (RCA1) is one of the most important applied lectins that has been widely used as a tool to study cell surfaces and to purify glycans. Although the carbohydrate specificity of RCA1 has been described, the information obtained was mainly focused on inhibition of simple Galbeta1-related oligosaccharides and simple clusters. Here, all possible recognition factors of RCA1 of glycan binding were examined by enzyme-linked lectinosorbent (ELLSA) and inhibition assays, using known mammalian Gal/GalNAc carbohydrate structural units and natural polyvalent glycans. Among the glycoproteins (gps) tested and expressed as 50% nanogram inhibition, the high-density polyvalent Galbeta1-4GlcNAc (II) glycotopes occurring in natural gps, such as Pneumococcus type 14 capsular polysaccharide which is composed of repeating poly II residues, resulted in 9.0 x 10(4), 1.5 x 10(5), 2.3 x 10(4) and 2.1 x 10(4)-fold higher affinities to RCA1 than the monomeric Gal, linear I/II and Tri-antennary-II (Tri-II). Of the ligands tested and expressed as nanomoles of 50% inhibition, Tri-II was the best, being about 2, 4, 25.6 and 33.3 times better inhibitor than Di-II, II, I (Galbeta1-3GlcNAc) and Gal, respectively. From the results of this study, it is concluded that: (a) Galbeta1-4GlcNAc and other Galbeta1-related oligosaccharides are essential for lectin binding and their polyvalent form in macromolecules should be the most important recognition factor for RCA1; (b) the combining site of RCA1 may be a groove type, recognizing Galbeta1-4GlcNAc (II) as the major binding site; (c) its combining size may be large enough to accommodate a tetrasaccharide of beta-anomeric Gal at the non-reducing end and most complementary to human blood group I Ma active trisaccharide (Galbeta1-4GlcNAcbeta1-6Gal) and lacto-N-neotetraose (Galbeta1-4GlcNAcbeta1-3Galbeta1-4Glc); (d) RCA1 has a preference for the beta-anomer of Gal oligosaccharides with a Galbeta1-4 linkage > Galbeta1-6 > or = Galbeta

  17. Kinetic mixing effect in the 3 -3 -1 -1 model

    Science.gov (United States)

    Dong, P. V.; Si, D. T.

    2016-06-01

    We show that the mixing effect of the neutral gauge bosons in the 3 -3 -1 -1 model comes from two sources. The first one is due to the 3 -3 -1 -1 gauge symmetry breaking as usual, whereas the second one results from the kinetic mixing between the gauge bosons of U (1 )X and U (1 )N groups, which are used to determine the electric charge and baryon minus lepton numbers, respectively. Such mixings modify the ρ -parameter and the known couplings of Z with fermions. The constraints that arise from flavor-changing neutral currents due to the gauge boson mixings and nonuniversal fermion generations are also given.

  18. The IRS-1 signaling system.

    Science.gov (United States)

    Myers, M G; Sun, X J; White, M F

    1994-07-01

    Insulin-receptor substrate 1 (IRS-1) is a principal substrate of the receptor tyrosine kinase for insulin and insulin-like growth factor 1, and a substrate for a tyrosine kinase activated by interleukin 4. IRS-1 undergoes multisite tyrosine phosphorylation and mediates downstream signals by 'docking' various proteins that contain Src homology 2 domains. IRS-1 appears to be a unique molecule; however, 4PS, a protein found mainly in hemopoietic cells, may represent another member of this family.

  19. Main: TCA1MOTIF [PLACE

    Lifescience Database Archive (English)

    Full Text Available TCA1MOTIF S000159 17-May-1998 (last modified) kehi TCA-1 (tobacco nuclear protein 1...) binding site; Related to salicylic acid-inducible expression of many genes; Found in barley beta-1,3-gluca...nase and over 30 different plant genes which are known to be induced by one or more forms of stress; A similar sequence (TCA... et al., 1997); SA; salicylic acid; stress; TCA-1; barley (Hordeum vulgare); tobacco (Nicotiana tabacum); TCATCTTCTT ...

  20. SIRT1-mediated acute cardioprotection

    OpenAIRE

    Nadtochiy, Sergiy M; Yao, Hongwei; McBurney, Michael W.; Gu, Wei; Guarente, Leonard; Rahman, Irfan; Paul S. Brookes

    2011-01-01

    Overexpression studies have revealed a role for silent information regulator of transcription 1 (SIRT1) lysine deacetylase in cardioprotection against ischemia-reperfusion injury via long-term transcriptional effects. However, short-term SIRT1-mediated lysine deacetylation, within the context of acute cardioprotection, is poorly understood. In this study, the role of SIRT1 in the acute cardioprotective paradigm of first window ischemic preconditioning (IPC) was studied using SIRT1-deficient (...

  1. Sulfation of fulvestrant by human liver cytosols and recombinant SULT1A1 and SULT1E1

    Directory of Open Access Journals (Sweden)

    Edavana VK

    2011-11-01

    Full Text Available Vineetha Koroth Edavana1, Xinfeng Yu1, Ishwori B Dhakal1, Suzanne Williams1, Baitang Ning2, Ian T Cook3, David Caldwell1, Charles N Falany3, Susan Kadlubar11Division of Medical Genetics, College of Medicine, University of Arkansas for Medical Sciences, Little Rock, AR, USA; 2Division of Personalized Nutrition and Medicine, National Center for Toxicological Research, Food and Drug Administration, Jefferson, AR, USA; 3Department of Pharmacology, University of Alabama, Birmingham, AL, USAAbstract: Fulvestrant (Faslodex™ is a pure antiestrogen that is approved to treat hormone receptor-positive metastatic breast cancer in postmenopausal women. Previous studies have demonstrated that fulvestrant metabolism in humans involves cytochromes P450 and UDP-glucuronosyltransferases (UGTs. To date, fulvestrant sulfation has not been characterized. This study examined fulvestrant sulfation with nine recombinant sulfotransferases and found that only SULT1A1 and SULT1E1 displayed catalytic activity toward this substrate, with Km of 4.2 ± 0.99 and 0.2 ± 0.16 µM, respectively. In vitro assays of 104 human liver cytosols revealed marked individual variability that was highly correlated with β-naphthol sulfation (SULT1A1 diagnostic substrate; r = 0.98, P < 0.0001, but not with 17ß-estradiol sulfation (SULT1E1 diagnostic substrate; r = 0.16, P = 0.10. Fulvestrant sulfation was correlated with both SULT1A1*1/2 genotype (P value = 0.023 and copy number (P < 0.0001. These studies suggest that factors influencing SULT1A1/1E1 tissue expression and/or enzymatic activity could influence the efficacy of fulvestrant therapy.Keywords: fulvestrant, sulfotransferase, genotype, copy number

  2. Insulin like growth factor-1/insulin bypasses Pref-1/FA1-mediated inhibition of adipocyte differentiation

    DEFF Research Database (Denmark)

    Zhang, Hongbin; Nøhr, Jane; Jensen, Charlotte Harken;

    2003-01-01

    of Pref-1/FA1 in 3T3-L1 or 3T3-F442A cells inhibited adipocyte differentiation when insulin or insulin-like growth factor-1 (IGF-1) was omitted from the differentiation mixture. We demonstrate that the level of the mature form of the IGF-1 receptor is reduced and that IGF-1-dependent activation of p42/p44......, and adipocyte differentiation in a dose-dependent manner. Udgivelsesdato: 2003-Jun-6......Pref-1 is a highly glycosylated Delta-like transmembrane protein containing six epidermal growth factor-like repeats in the extracellular domain. Pref-1 is abundantly expressed in preadipocytes, but expression is down-regulated during adipocyte differentiation. Forced expression of Pref-1 in 3T3-L1...

  3. Ire1 Has Distinct Catalytic Mechanisms for XBP1/HAC1 Splicing and RIDD

    Directory of Open Access Journals (Sweden)

    Arvin B. Tam

    2014-11-01

    Full Text Available An evolutionarily conserved unfolded protein response (UPR component, IRE1, cleaves XBP1/HAC1 introns in order to generate spliced mRNAs that are translated into potent transcription factors. IRE1 also cleaves endoplasmic-reticulum-associated RNAs leading to their decay, an activity termed regulated IRE1-dependent decay (RIDD; however, the mechanism by which IRE1 differentiates intron cleavage from RIDD is not well understood. Using in vitro experiments, we found that IRE1 has two different modes of action: XBP1/HAC1 is cleaved by IRE1 subunits acting cooperatively within IRE1 oligomers, whereas a single subunit of IRE1 performs RIDD without cooperativity. Furthermore, these distinct activities can be separated by complementation of catalytically inactive IRE1 RNase and mutations at oligomerization interfaces. Using an IRE1 RNase inhibitor, STF-083010, selective inhibition of XBP1 splicing indicates that XBP1 promotes cell survival, whereas RIDD leads to cell death, revealing modulation of IRE1 activities as a drug-development strategy.

  4. SAMHD1 controls cell cycle status, apoptosis and HIV-1 infection in monocytic THP-1 cells

    Energy Technology Data Exchange (ETDEWEB)

    Bonifati, Serena [Center for Retrovirus Research, Department of Veterinary Biosciences, The Ohio State University, Columbus, OH (United States); Daly, Michele B. [Center for Drug Discovery, Department of Pediatrics, School of Medicine, Emory University, Atlanta, GA (United States); St Gelais, Corine; Kim, Sun Hee [Center for Retrovirus Research, Department of Veterinary Biosciences, The Ohio State University, Columbus, OH (United States); Hollenbaugh, Joseph A.; Shepard, Caitlin [Center for Drug Discovery, Department of Pediatrics, School of Medicine, Emory University, Atlanta, GA (United States); Kennedy, Edward M. [Department of Molecular Genetics and Microbiology, Duke University, Durham, NC (United States); Kim, Dong-Hyun [Department of Pharmacy, School of Pharmacy, Kyung-Hee University, Seoul (Korea, Republic of); Schinazi, Raymond F. [Center for Drug Discovery, Department of Pediatrics, School of Medicine, Emory University, Atlanta, GA (United States); Kim, Baek, E-mail: baek.kim@emory.edu [Center for Drug Discovery, Department of Pediatrics, School of Medicine, Emory University, Atlanta, GA (United States); Department of Pharmacy, School of Pharmacy, Kyung-Hee University, Seoul (Korea, Republic of); Wu, Li, E-mail: wu.840@osu.edu [Center for Retrovirus Research, Department of Veterinary Biosciences, The Ohio State University, Columbus, OH (United States)

    2016-08-15

    SAMHD1 limits HIV-1 infection in non-dividing myeloid cells by decreasing intracellular dNTP pools. HIV-1 restriction by SAMHD1 in these cells likely prevents activation of antiviral immune responses and modulates viral pathogenesis, thus highlighting a critical role of SAMHD1 in HIV-1 physiopathology. Here, we explored the function of SAMHD1 in regulating cell proliferation, cell cycle progression and apoptosis in monocytic THP-1 cells. Using the CRISPR/Cas9 technology, we generated THP-1 cells with stable SAMHD1 knockout. We found that silencing of SAMHD1 in cycling cells stimulates cell proliferation, redistributes cell cycle population in the G{sub 1}/G{sub 0} phase and reduces apoptosis. These alterations correlated with increased dNTP levels and more efficient HIV-1 infection in dividing SAMHD1 knockout cells relative to control. Our results suggest that SAMHD1, through its dNTPase activity, affects cell proliferation, cell cycle distribution and apoptosis, and emphasize a key role of SAMHD1 in the interplay between cell cycle regulation and HIV-1 infection.

  5. Sphingosine 1-Phosphate Receptor 1 Signaling in Mammalian Cells

    Directory of Open Access Journals (Sweden)

    Nigel J. Pyne

    2017-02-01

    Full Text Available The bioactive lipid, sphingosine 1-phosphate (S1P binds to a family of G protein-coupled receptors, termed S1P1-S1P5. These receptors function in, for example, the cardiovascular system to regulate vascular barrier integrity and tone, the nervous system to regulate neuronal differentiation, myelination and oligodendrocyte/glial cell survival and the immune system to regulate T- and B-cell subsets and trafficking. S1P receptors also participate in the pathophysiology of autoimmunity, inflammatory disease, cancer, neurodegeneration and others. In this review, we describe how S1P1 can form a complex with G-protein and β-arrestin, which function together to regulate effector pathways. We also discuss the role of the S1P1-Platelet derived growth factor receptor β functional complex (which deploys G-protein/β-arrestin and receptor tyrosine kinase signaling in regulating cell migration. Possible mechanisms by which different S1P-chaperones, such as Apolipoprotein M-High-Density Lipoprotein induce biological programmes in cells are also described. Finally, the role of S1P1 in health and disease and as a target for clinical intervention is appraised.

  6. 40 CFR 180.450 - Beta-(4-Chlorophenoxy)-alpha-(1,1-dimethylethyl)-1H-1,2,4-triazole-1-ethanol; tolerances for...

    Science.gov (United States)

    2010-07-01

    ...-dimethylethyl)-1H-1,2,4-triazole-1-ethanol; tolerances for residues. 180.450 Section 180.450 Protection of...-dimethylethyl)-1H-1,2,4-triazole-1-ethanol; tolerances for residues. (a) General. Tolerances are established for the combined residues of the fungicide...

  7. Relationship between polymorphisms of CYP1A1, CYP1B1 genes and susceptibility to recurrent abortion%CYP1A1和CYP1B1基因多态性与RPL易感性

    Institute of Scientific and Technical Information of China (English)

    朱壮彦; 赵富玺; 富晓敏; 穆雅琴; 畅学艳

    2012-01-01

    Objective To investigate the relationship between polymorphisms of CYP1A1 and CYP lBlgenes and the susceptibility to recurrent pregnancy loss(RPL). Methods The Mspl polymorphism of CYP1A1 and the polymorphism in exon 3 codon 432(C-G of CYP1B1) were detected with the methods of polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) and allele specific-PCR (AS-PCR) in a case-control study including 81 cases of RPL and 98 healthy controls. Results There was no significant correlation between Mspl polymorphism and RPL susceptibility (x2 =0. 335 ,P =0. 846). There were significant differences in the genotype distributions or allele frequencies of CYP1B1 L432V polymorphism between the two groups (x2 = 7. 467 , P = 0. 024;x2 = 9. 129, P = 0. 003). Compared with wild-type C/C,the susceptibility of recurrent abortion with the genotypes of homozygotic mutation G/G and heterozygotic mutation C/G were increased by 2. 620 and 1. 954 times,respectively. Compared with allele C,the risk of recurrent abortion with allele G was increased by 2. 038. Conclusion The gene polymorphism of CYP1B1 in exon 3 condon 432 (C-G) might be a genetic risk factor of RPL and the allelic polymorphism of CYP1B1 L432V increases the risk of recurrent abortion. The results do not show that polymorphism of Mspl is associated with the susceptibility of RPL.%目的 探讨CYP1A1、CYP1B1基因多态性与复发性流产(RPL)遗传易感性关系,为预防和治疗该病提供新靶点.方法 本研究采用等位基因特异性PCR (As-PCR)和聚合酶链反应-限制性片断长度多态性(PCRRFLP)方法,针对CYP1A1基因MspI酶切位点和CYP1B1 L432V多态位点,检测81例患有原因不明RPL病例组和98名有生育史健康女性对照组之间差异.结果 RPL组和对照组CYP1A1 MspI位点3种基因型m1/m1、m1/m2、m2/m2分布频率差异无统计学意义(x2=0.335,P>0.05);CYP1B1 L432V多态位点3种基因型C/C、C/G、G/G在病例组和对照组分

  8. Niemann-Pick C1 (NPC1/NPC1-like1 Chimeras Define Sequences Critical for NPC1’s Function as a Filovirus Entry Receptor

    Directory of Open Access Journals (Sweden)

    Esther Ndungo

    2012-10-01

    Full Text Available We recently demonstrated that Niemann-Pick C1 (NPC1, a ubiquitous 13-pass cellular membrane protein involved in lysosomal cholesterol transport, is a critical entry receptor for filoviruses. Here we show that Niemann-Pick C1-like1 (NPC1L1, an NPC1 paralog and hepatitis C virus entry factor, lacks filovirus receptor activity. We exploited the structural similarity between NPC1 and NPC1L1 to construct and analyze a panel of chimeras in which NPC1L1 sequences were replaced with cognate sequences from NPC1. Only one chimera, NPC1L1 containing the second luminal domain (C of NPC1 in place of its own, bound to the viral glycoprotein, GP. This engineered protein mediated authentic filovirus infection nearly as well as wild-type NPC1, and more efficiently than did a minimal NPC1 domain C-based receptor recently described by us. A reciprocal chimera, NPC1 containing NPC1L1’s domain C, was completely inactive. Remarkably, an intra-domain NPC1L1-NPC1 chimera bearing only a ~130-amino acid N–terminal region of NPC1 domain C could confer substantial viral receptor activity on NPC1L1. Taken together, these findings account for the failure of NPC1L1 to serve as a filovirus receptor, highlight the central role of the luminal domain C of NPC1 in filovirus entry, and reveal the direct involvement of N–terminal domain C sequences in NPC1’s function as a filovirus receptor.

  9. Cytochrome P1B1 (CYP1B1) polymorphisms and ovarian cancer risk: a meta-analysis.

    Science.gov (United States)

    Gajjar, Ketan; Owens, Gemma; Sperrin, Matthew; Martin-Hirsch, Pierre L; Martin, Francis L

    2012-12-16

    CYP1B1 is a key P450 enzyme involved in the metabolism of exogenous and endogenous substrates and plays a key role in hormone-induced carcinogenesis. Risk factors for ovarian cancer are related to hormonal exposure and reproduction, and polymorphisms within genes involved in metabolism of oestrogen and certain xenobiotics may influence the risk of developing ovarian cancer. Current meta-analysis evaluated four CYP1B1 polymorphisms (Leu432Val, Arg48Gly, Ala119Ser and Asn453Ser) for their association with ovarian cancer risk. A search of the MEDLINE bibliographic database for the period up to April 2012 identified five relevant studies. With regards to Leu432Val polymorphism, all of the five studies were eligible (1199 cases and 2596 controls) for analysis, while for Arg48Gly (799 cases and 1169 controls), Ala119Ser (799 cases and 1172 controls) and Asn453Ser (361cases and 1577 controls) only two studies were eligible for analysis. Fixed-effect models were used to estimate pooled odds ratios (OR) with 95% confidence intervals (95% CI) and chi-square based Q-test was used to test for heterogeneity. The pooled OR (95% CI) for CYP1B1_Leu432Val polymorphism were 1.1 (0.84-1.31) for heterozygous subjects and 0.82 (0.57-1.17) for homozygous Val subjects. In a recessive model, homozygous carriers of Leu432Val showed a weak trend towards reduced risk as compared to 'wild type' and heterozygous carriers (OR 0.8, 95% CI; 0.66-0.99); however, this association was of limited significance. Regarding Arg48Gly, the pooled OR (95% CI) were 1.06 (0.89-1.27) for heterozygous and 0.98 (1.72-1.33) for homozygous Gly subjects. With respect to Ala119Ser and Asn453Ser, the pooled OR were 1.06 (0.87-1.29) and 1.24 (0.94-1.63) for heterozygous and 1.1 (0.8-1.52) and 1.09 (0.5-2.34) for homozygous respectively. In conclusion, this meta-analysis suggests that CYP1B1 polymorphisms are not associated with ovarian cancer risk. Studies evaluating CYP1B1_Leu432Val polymorphism are required to

  10. CYP1A1, GSTM1, GSTT1 and TP53 Polymorphisms and Risk of Gallbladder Cancer in Bolivians.

    Science.gov (United States)

    Sakai, Kazuaki; Loza, Ernesto; Roig, Guido Villa-Gomez; Nozaki, Ryoko; Asai, Takao; Ikoma, Toshikazu; Tsuchiya, Yasuo; Kiyohara, Chikako; Yamamoto, Masaharu; Nakamura, Kazutoshi

    2016-01-01

    The Plurinational State of Bolivia (Bolivia) has a high incidence rate of gallbladder cancer (GBC). However, the genetic and environmental risk factors for GBC development are not well understood. We aimed to assess whether or not cytochrome P450 (CYP1A1), glutathione S-transferase mu 1 (GSTM1), theta 1 (GSTT1) and tumor suppressor protein p53 (TP53) genetic polymorphisms modulate GBC susceptibility in Bolivians. This case-control study covered 32 patients with GBC and 86 healthy subjects. GBC was diagnosed on the basis of histological analysis of tissues at the Instituto de Gastroenterologia Boliviano-Japones (IGBJ); the healthy subjects were members of the staff at the IGBJ. Distributions of the CYP1A1 rs1048943 and TP53 rs1042522 polymorphisms were assayed using PCR-restriction fragment length polymorphism assay. GSTM1 and GSTT1 deletion polymorphisms were detected by a multiplex PCR assay. The frequency of the GSTM1 null genotype was significantly higher in GBC patients than in the healthy subjects (odds ratio [OR], 2.35; 95% confidence interval [CI], 1.03-5.37; age-adjusted OR, 3.53; 95% CI, 1.29-9.66; age- and sex-adjusted OR, 3.40; 95% CI, 1.24-9.34). No significant differences were observed in the frequencies of CYP1A1, GSTT1, or TP53 polymorphisms between the two groups. The GSTM1 null genotype was associated with increased GBC risk in Bolivians. Additional studies with larger control and case populations are warranted to confirm the association between the GSTM1 deletion polymorphism and GBC risk suggested in the present study.

  11. On the transmutation of Am in a fast lead-cooled system

    Indian Academy of Sciences (India)

    B P Kochurov; V N Konev; A Yu Kwaretzkheli

    2007-02-01

    Characteristics of the equilibrium fuel cycle for the core or a blanket of ADS having the structure of the core of a fast lead-cooled reactor of type BREST (Russian abbreviation for `Bystryy Reaktor so Svintsovym Teplonositelem') in a mode of americium transmutation are calculated. Americium loading was taken 5% of heavy atoms. Keeping the average multiplication factor the same as in a standard equilibrium cycle, reactivity swing over 1 year's microcycle is about 1%, that demands partial fuel reloading with a periodicity of about one month. For one year of operation, 61 kg of americium is destroyed, and due to increased 238Pu content, americium is mainly converted to fission products. Thus in a system of 1 GWt (thermal), 87 kg of americium can be transmuted yearly. The estimate of the reactivity void effect has shown that it increases to 0.6% almost linearly with the void fraction increasing up to 25% and reaches its maximum of 0.7% at a void fraction of about 50%. Application of similar strategy for ADS with a sub-criticality level ≈ 0.96–0.98 can essentially relax safety problems related to positive void effects.

  12. DSS1/Sem1, a multifunctional and intrinsically disordered protein

    DEFF Research Database (Denmark)

    Kragelund, Birthe Brandt; Schenstrøm, Signe Marie; Rebula, Caio A.;

    2016-01-01

    DSS1/Sem1 is a versatile intrinsically disordered protein. Besides being a bona fide subunit of the 26S proteasome, DSS1 associates with other protein complexes, including BRCA2-RPA, involved in homologous recombination; the Csn12-Thp3 complex, involved in RNA splicing; the integrator, involved...... in transcription; and the TREX-2 complex, involved in nuclear export of mRNA and transcription elongation. As a subunit of the proteasome, DSS1 functions both in complex assembly and possibly as a ubiquitin receptor. Here, we summarise structural and functional aspects of DSS1/Sem1 with particular emphasis on its...... multifunctional and disordered properties. We suggest that DSS1/Sem1 can act as a polyanionic adhesive to prevent nonproductive interactions during construction of protein assemblies, uniquely employing different structures when associating with the diverse multisubunit complexes....

  13. Kink manifolds in (1+1)-dimensional scalar field theory

    Energy Technology Data Exchange (ETDEWEB)

    Alonso Izquierdo, A.; Gonzalez Leon, M.A. [Departamento de Estadistica y Matematica Aplicadas, Facultad de Ciencias, Universidad de Salamanca, Salamanca (Spain); Mateos Guilarte, J. [Departamento de Fisica, Facultad de Ciencias, Universidad de Salamanca, Salamanca (Spain)

    1998-01-09

    The general structure of kink manifolds in (1+1)-dimensional complex scalar field theory is described by analysing three special models. New solitary waves are reported. Kink energy sum rules arise between different types of solitary waves. (author)

  14. The Penrose singularity theorem in regularity $C^{1,1}$

    CERN Document Server

    Kunzinger, Michael; Vickers, James A

    2015-01-01

    We extend the validity of the Penrose singularity theorem to spacetime metrics of regularity $C^{1,1}$. The proof is based on regularisation techniques, combined with recent results in low regularity causality theory.

  15. ERF1 -- Enhanced River Reach File 1.2

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — U.S. Environmental Protection Agency's River Reach File 1 (RF1)to ensure the hydrologic integrity of the digital reach traces and to quantify the mean water time of...

  16. Modulators of the Sphingosine 1-phosphate receptor 1.

    Science.gov (United States)

    Urbano, Mariangela; Guerrero, Miguel; Rosen, Hugh; Roberts, Edward

    2013-12-01

    The Sphingosine 1-phosphate receptor (S1P-R) signaling system has proven to be of biological and medical importance in autoimmune settings. S1P1-R is a validated drug target for multiple sclerosis (MS) for which FTY720 (Fingolimod), a S1P1,3-5-R pan-agonist, was recently approved as the first orally active drug for the treatment of relapsing-remitting MS. Transient bradycardia and long half-life are the FTY720 critical pitfalls. This review provides the latest advances on next-generation S1P1-R modulators from 2012 up to date, with an overview of the chemical structures, structure-activity relationships, and relevant biological and clinical properties.

  17. Data of evolutionary structure change: 1BFTA-1NFKB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BFTA-1NFKB 1BFT 1NFK A B ---------------------------------------...EACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGE... 1BFT A 1BFTA YFTGP-

  18. A humanized UGT1 mouse model expressing the UGT1A1*28 allele for assessing drug clearance by UGT1A1-dependent glucuronidation.

    Science.gov (United States)

    Cai, Hongliang; Nguyen, Nghia; Peterkin, Vincent; Yang, Young-Sun; Hotz, Kathy; La Placa, Deirdre Beaton; Chen, Shujuan; Tukey, Robert H; Stevens, Jeffrey C

    2010-05-01

    Humanized mice that express the human UDP-glucuronosyltransferase (UGT) 1 locus have been developed in a Ugt1-null background as a model to improve predictions of human UGT1A-dependent drug clearance. Enzyme kinetic parameters (K(m) and V(max)) and pharmacokinetic properties of three probe drugs were compared using wild-type and humanized UGT1 mice that express the Gilbert's UGT1A1*28 allele [Tg(UGT1(A1*28)) Ugt1(-/-) mice]. The well characterized substrate for UGT1A1, 7-ethyl-10-hydroxy-camptothecin (SN-38), showed the greatest difference in parent drug exposure ( approximately 3-fold increase) and clearance ( approximately 3-fold decrease) in Tg(UGT1(A1*28)) Ugt1(-/-) mice after intravenous administration compared with wild-type and phenobarbital-treated animals. In contrast, the clearance of the UGT2B7 substrate (-)-17-allyl-4, 5alpha-epoxy-3, 14-dihydroxymorphinan-6-one (naloxone) was not altered in Tg(UGT1(A1*28)) Ugt1(-/-) mice. In addition, pharmacokinetic parameters with 1-(4-fluorophenyl)3(R)-[3-(4-fluorophenyl)-3(S)-hydroxypropyl]-4(S)-(4-hydroxyphenyl)-2-azetidinone (ezetimibe, Zetia; Merck & Co., Whitehouse Station, NJ), considered to be a major substrate for UGT1A1, showed small to no dependence on UGT1A1-directed glucuronidation. Enzyme kinetic parameters assessed for SN-38, ezetimibe, and naloxone using liver microsomes prepared from wild-type and Tg(UGT1(A1*28)) Ugt1(-/-) mice showed patterns consistent with the in vivo pharmacokinetic data. For SN-38 glucuronidation, V(max) decreased 5-fold in Tg(UGT1(A1*28)) Ugt1(-/-) mouse liver microsomes compared with microsomes prepared from wild-type mice, and decreased 10-fold compared with phenobarbital-treated Tg(UGT1(A1*28)) Ugt1(-/-) mice. These differences are consistent with SN-38 glucuronidation activities using HLMs isolated from individuals genotyped as UGT1A1*1 or UGT1A1*28. For ezetimibe and naloxone the differences in V(max) were minimal. Thus, Tg(UGT1(A1*28)) Ugt1(-/-) mice can serve as a

  19. 26 CFR 1.267(f)-1 - Controlled groups.

    Science.gov (United States)

    2010-04-01

    ... significant purpose the avoidance of Federal income tax. (f) Receivables. If S acquires a receivable from the... section. See, e.g., §§ 1.312-6(a), 1.312-7, and 1.1502-33(c)(2). (h) Anti-avoidance rule. If a transaction... the land for sale to customers in the ordinary course of business. On July 1 of Year 3, B sells...

  20. On Hardy's Theorem on SU(1,1)

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The classical Hardy theorem asserts that f and its Fourier transform (f) can not both be very rapidly decreasing. This theorem was generalized on Lie groups and also for the Fourier-Jacobi transform. However, on SU(1, 1) there are infinitely many "good"functions in the sense that f and its spherical Fourier transform (f) both have good decay.In this paper, we shall characterize such functions on SU(1,1).