WorldWideScience

Sample records for based cfd modelling

  1. Towards a CFD-based mechanistic deposit formation model for straw-fired boilers

    DEFF Research Database (Denmark)

    Kær, Søren Knudsen; Rosendahl, Lasse Aistrup; Baxter, L.L.

    2006-01-01

    This paper discusses the application of FLUENTe in the analysis of grate-fired biomass boilers. A short description of the concept used to model fuel conversion on the grate and the coupling to the CFD code is offered. The development and implementation of a CFD-based deposition model is presented...... in the reminder of the paper. The growth of deposits on furnace walls and super heater tubes is treated including the impact on heat transfer rates determined by the CFD code. Based on the commercial CFD code FLUENTe, the overall model is fully implemented through the User Defined Functions. The model...... resistance changes. The model is applied to the straw-fired Masnedø boiler. Results are in good qualitative agreement with both measurements and observations at the plants. q 2005 Elsevier Ltd. All rights reserved....

  2. Application of a CFD based containment model to different large-scale hydrogen distribution experiments

    International Nuclear Information System (INIS)

    Highlights: • A CFD based model developed in ANSYS-FLUENT for simulating the distribution of hydrogen in the containment of a nuclear power plant during a severe accident is validated against four large-scale experiments. • The successive formation and mixing of a stratified gas-layer in experiments performed in the THAI and PANDA facilities are predicted well by the CFD model. • The pressure evolution and related condensation rate during different mixed convection flow conditions in the TOSQAN facility are predicted well by the CFD model. • The results give confidence in the general applicability of the CFD model and model settings. - Abstract: In the event of core degradation during a severe accident in water-cooled nuclear power plants (NPPs), large amounts of hydrogen are generated that may be released into the reactor containment. As the hydrogen mixes with the air in the containment, it can form a flammable mixture. Upon ignition it can damage relevant safety systems and put the integrity of the containment at risk. Despite the installation of mitigation measures, it has been recognized that the temporary existence of combustible or explosive gas clouds cannot be fully excluded during certain postulated accident scenarios. The distribution of hydrogen in the containment and mitigation of the risk are, therefore, important safety issues for NPPs. Complementary to lumped parameter code modelling, Computational Fluid Dynamics (CFD) modelling is needed for the detailed assessment of the hydrogen risk in the containment and for the optimal design of hydrogen mitigation systems in order to reduce this risk as far as possible. The CFD model applied by NRG makes use of the well-developed basic features of the commercial CFD package ANSYS-FLUENT. This general purpose CFD package is complemented with specific user-defined sub-models required to capture the relevant thermal-hydraulic phenomena in the containment during a severe accident as well as the effect of

  3. Development of a compartment model based on CFD simulations for description of mixing in bioreactors

    Directory of Open Access Journals (Sweden)

    Crine, M.

    2010-01-01

    Full Text Available Understanding and modeling the complex interactions between biological reaction and hydrodynamics are a key problem when dealing with bioprocesses. It is fundamental to be able to accurately predict the hydrodynamics behavior of bioreactors of different size and its interaction with the biological reaction. CFD can provide detailed modeling about hydrodynamics and mixing. However, it is computationally intensive, especially when reactions are taken into account. Another way to predict hydrodynamics is the use of "Compartment" or "Multi-zone" models which are much less demanding in computation time than CFD. However, compartments and fluxes between them are often defined by considering global quantities not representative of the flow. To overcome the limitations of these two methods, a solution is to combine compartment modeling and CFD simulations. Therefore, the aim of this study is to develop a methodology in order to propose a compartment model based on CFD simulations of a bioreactor. The flow rate between two compartments can be easily computed from the velocity fields obtained by CFD. The difficulty lies in the definition of the zones in such a way they can be considered as perfectly mixed. The creation of the model compartments from CFD cells can be achieved manually or automatically. The manual zoning consists in aggregating CFD cells according to the user's wish. The automatic zoning defines compartments as regions within which the value of one or several properties are uniform with respect to a given tolerance. Both manual and automatic zoning methods have been developed and compared by simulating the mixing of an inert scalar. For the automatic zoning, several algorithms and different flow properties have been tested as criteria for the compartment creation.

  4. A CFD-based wind solver for a fast response transport and dispersion model

    Energy Technology Data Exchange (ETDEWEB)

    Gowardhan, Akshay A [Los Alamos National Laboratory; Brown, Michael J [Los Alamos National Laboratory; Pardyjak, Eric R [UNIV OF UTAH; Senocak, Inanc [BOISE STATE UNIV

    2010-01-01

    In many cities, ambient air quality is deteriorating leading to concerns about the health of city inhabitants. In urban areas with narrow streets surrounded by clusters of tall buildings, called street canyons, air pollution from traffic emissions and other sources is difficult to disperse and may accumulate resulting in high pollutant concentrations. For various situations, including the evacuation of populated areas in the event of an accidental or deliberate release of chemical, biological and radiological agents, it is important that models should be developed that produce urban flow fields quickly. For these reasons it has become important to predict the flow field in urban street canyons. Various computational techniques have been used to calculate these flow fields, but these techniques are often computationally intensive. Most fast response models currently in use are at a disadvantage in these cases as they are unable to correlate highly heterogeneous urban structures with the diagnostic parameterizations on which they are based. In this paper, a fast and reasonably accurate computational fluid dynamics (CFD) technique that solves the Navier-Stokes equations for complex urban areas has been developed called QUIC-CFD (Q-CFD). This technique represents an intermediate balance between fast (on the order of minutes for a several block problem) and reasonably accurate solutions. The paper details the solution procedure and validates this model for various simple and complex urban geometries.

  5. CFD simulation of aerosol deposition in an anatomically based human large-medium airway model.

    Science.gov (United States)

    Ma, Baoshun; Lutchen, Kenneth R

    2009-02-01

    Quantitative data on aerosol deposition in the human respiratory tract are useful for understanding the causes of certain lung diseases and for designing efficient drug delivery systems via inhalation. In this study, aerosol deposition in a 3D anatomically based human large-medium airway model was simulated using computational fluid dynamics (CFD). The model extended from mouth to generation 10 and included two-thirds of the airways obtained by multi-detector row computed tomography (MDCT) imaging on normal healthy human subjects. Steady oral inhalation (15, 30, and 60 L/min) and aerosol (1-30 micrometer) deposition were computed by CFD using the realizable k-epsilon turbulence model. Based on the mean turbulence flow field, the computed extrathoracic deposition, ratio of left to right lung deposition, and deposition efficiency at each generation compared favorably with existing in vivo and in vitro experiments. The significant deposition in the large-medium airway model showed that the total tracheobronchial deposition is dominated by the large-medium airways for micrometer-sized aerosol particles. These quantitative data and the methods developed in this study provided valuable means toward subject-specific modeling of aerosol deposition in the human lung based on realistic lung geometry. PMID:19082892

  6. CFD based combustion model for sewage sludge gasification in a fluidized bed

    Institute of Scientific and Technical Information of China (English)

    Yiqun WANG; Lifeng YAN

    2009-01-01

    Gasification is one potential way to use sewage sludge as renewable energy and solve the environmental problems caused by the huge amount of sewage sludge. In this paper, a three-dimensional Computational Fluid Dynamics (CFD) model has been developed to simulate the sewage sludge gasification process in a fluidized bed. The model describes the complex physical and chemical phenomena in the gasifier including turbulent flow, heat and mass transfer, and chemical reactions. The model is based on the Eulerian-Lagrangian concept using the non-premixed combustion modeling approach. In terms of the CFD software FLUENT, which represents a powerful tool for gasifIer analysis, the simulations provide detailed information on the gas products and temperature distribution in the gasifier. The model sensitivity is analyzed by performing the model in a laboratory-scale fluidized bed in the literature, and the model validation is carried out by comparing with experimental data from the literature. Results show that reasonably good agreement was achieved. Effects of temperature and Equivalence Ratio (ER) on the quality of product syngas (H2 + CO) are also studied.

  7. Active-passive measurements and CFD based modelling for indoor radon dispersion study

    International Nuclear Information System (INIS)

    Computational fluid dynamics (CFD) play a significant role in indoor pollutant dispersion study. Radon is an indoor pollutant which is radioactive and inert gas in nature. The concentration level and spatial distribution of radon may be affected by the dwelling's ventilation conditions. Present work focus at the study of indoor radon gas distribution via measurement and CFD modeling in naturally ventilated living room. The need of the study is the prediction of activity level and to study the effect of natural ventilation on indoor radon. Two measurement techniques (Passive measurement using pin-hole dosimeters and active measurement using continuous radon monitor (SRM)) were used for the validation purpose of CFD results. The CFD simulation results were compared with the measurement results at 15 points, 3 XY planes at different heights along with the volumetric average concentration. The simulation results found to be comparable with the measurement results. The future scope of these CFD codes is to study the effect of varying inflow rate of air on the radon concentration level and dispersion pattern. - Highlights: • The distribution of radon gas in indoor environment was simulated using CFD modelling. • The distribution of radon was found to be more homogenous in open room condition. • The radon concentration level in open room was low as compare to closed room due to enhanced ventilation rate. • Simulation results are in agreement with active and passive measurements results

  8. Assessment of CFD URANS models for buoyancy driven mixing flows based on ROCOM experiments

    International Nuclear Information System (INIS)

    An assessment of STAR-CCM+ Computational Fluid Dynamics (CFD) models of a KONVOI type Reactor Pressure Vessel (RPV) has been performed based on experimental data collected at the ROssendorf COolant Mixing (ROCOM) test facility as part of the OECD-NEA PKL 2 Project. Three different experimental configurations typical of Main Steam Line Break (MSLB) with Loss-Of-Offsite-Power (LOOP) scenarios are investigated (i.e. Test 1.1, 2.1 and 2.2). The transport of the mixing scalar is based on an equivalent thermal model of the isothermal experimental system. The focus of the study is on the modeling of the physical properties and the turbulent heat flux (closure term) needed by the Unsteady Reynolds Averaged Navier-Stokes (URANS) equations. Results show that a standard Constant Turbulent Prandtl number (CTP) and the chosen Variable Turbulent Prandtl number (VTP) models are capable of describing qualitatively and quantitatively well the time-evolution of the temperature field in the core inlet zone (Test 1.1). When large density differences of the coolant are present in the system, the VTP model outperforms the CTP model in predicting the elevation of the thermal stratification line that builds up in the downcomer due to incomplete mixing. Nevertheless, the CTP model performs very well when the density difference is very low (Test 2.1). No significant changes have been observed for Test 2.2 when idealized boundary conditions are used instead of the experimental ones. (author)

  9. Improvement of core effective thermal conductivity model of GAMMA+ code based on CFD analysis

    International Nuclear Information System (INIS)

    Highlights: • We assessed the core effective thermal conductivity (ETC) model of GAMMA+ code. • The analytical model of GAMMA+ code was compared with the result of CFD analysis. • Effects of material property of composite and geometric configuration were studied. • The GAMMA+ model agreed with the CFD result when the fuel gap is ignored. • The GAMMA+ model was improved by the ETC model of fuel compact including fuel gap. - Abstract: The GAMMA+ code has been developed for the thermo-fluid and safety analyses of a high temperature gas-cooled reactor (HTGR). In order to calculate the core effective thermal conductivity, this code adopts a heterogeneous model derived from the Maxwell’s theory that accounts for three distinct materials in a fuel block of the reactor core. In this model, the fuel gap is neglected since the gap thickness is quite small. In addition, the configuration of the fuel block is assumed to be homogeneous, and the volume fraction and material properties of each component are taken into account. In the accident condition, the conduction and radiation are major heat transfer mechanism. Therefore, the core effective thermal conductivity model should be validated in order to estimate the heat transfer in the core appropriately. In this regard, the objective of this study is to validate the core effective thermal conductivity model of the GAMMA+ code by a computational fluid dynamics (CFD) analysis using a commercial CFD code, CFX-13. The effects of the temperature condition, material property and geometric modeling on the core effective thermal conductivity were investigated. When the fuel gap is not modeled in the CFD analysis, the result of the GAMMA+ code shows a good agreement with the CFD result. However, when the fuel gap is modeled, the GAMMA+ model overestimates the core effective thermal conductivity considerably for all cases. This is because of the increased thermal resistance by the fuel gap which is not taken into account in

  10. Efficient Turbulence Modeling for CFD Wake Simulations

    DEFF Research Database (Denmark)

    van der Laan, Paul

    Wind turbine wakes can cause 10-20% annual energy losses in wind farms, and wake turbulence can decrease the lifetime of wind turbine blades. One way of estimating these effects is the use of computational fluid dynamics (CFD) to simulate wind turbines wakes in the atmospheric boundary layer. Since...... wind farm, the simulated results cannot be compared directly with wind farm measurements that have a high uncertainty in the measured reference wind direction. When this uncertainty is used to post-process the CFD results, a fairer comparison with measurements is achieved....... this flow is in the high Reynolds number regime, it is mainly dictated by turbulence. As a result, the turbulence modeling in CFD dominates the wake characteristics, especially in Reynolds-averaged Navier-Stokes (RANS). The present work is dedicated to study and develop RANS-based turbulence models...

  11. Coupled simulation of chemical lasers based on intracavity partially coherent light model and 3D CFD model.

    Science.gov (United States)

    Wu, Kenan; Huai, Ying; Jia, Shuqin; Jin, Yuqi

    2011-12-19

    Coupled simulation based on intracavity partially coherent light model and 3D CFD model is firstly achieved in this paper. The dynamic equation of partially coherent intracavity field is derived based on partially coherent light theory. A numerical scheme for the coupled simulation as well as a method for computing the intracavity partially coherent field is given. The presented model explains the formation of the sugar scooping phenomenon, and enables studies on the dependence of the spatial mode spectrum on physical parameters of laser cavity and gain medium. Computational results show that as the flow rate of iodine increases, higher order mode components dominate in the partially coherent field. Results obtained by the proposed model are in good agreement with experimental results. PMID:22274214

  12. SLURRY FLOW MODELLING BY CFD

    Directory of Open Access Journals (Sweden)

    K.C. Ghanta

    2010-12-01

    Full Text Available An attempt has been made in the present study to develop a generalized slurry flow model using CFD and utilize the model to predict concentration profile. The purpose of the CFD model is to gain better insight into the solid liquid slur¬ry flow in pipelines. Initially a three-dimensional model problem was developed to understand the influence of the particle drag coefficient on the solid concen¬tration profile. The preliminary simulations highlighted the need for correct mo¬delling of the inter phase drag force. The various drag correlations available in the literature were incorporated into a two-fluid model (Euler-Euler along with the standard k- turbulence model with mixture properties to simulate the tur¬bulent solid-liquid flow in a pipeline. The computational model was mapped on to a commercial CFD solver FLUENT6.2 (of Fluent Inc., USA. To push the en¬velope of applicability of the simulation, recent data from Kaushal (2005 (with solid concentration up to 50% was selected to validate the three dimensional simulations. The experimental data consisted of water-glass bead slurry at 125 and 440-micron particle with different flow velocity (from 1 to 5 m/s and overall concentration up to 10 to 50% by volume. The predicted pressure drop and concentration profile were validated by experimental data and showed excel-lent agreement. Interesting findings came out from the parametric study of ve-locity and concentration profiles. The computational model and results discus¬sed in this work would be useful for extending the applications of CFD models for simulating large slurry pipelines.

  13. Development of a flocculation sub-model for a 3-D CFD model based on rectangular settling tanks.

    Science.gov (United States)

    Gong, M; Xanthos, S; Ramalingam, K; Fillos, J; Beckmann, K; Deur, A; McCorquodale, J A

    2011-01-01

    To assess performance and evaluate alternatives to improve the efficiency of rectangular Gould II type final settling tanks (FSTs), New York City Department of Environmental Protection and City College of NY developed a 3D computer model depicting the actual structural configuration of the tanks and the current and proposed hydraulic and solids loading rates. Fluent 6.3.26™ was the base platform for the computational fluid dynamics (CFD) model, for which sub-models of the SS settling characteristics, turbulence, flocculation and rheology were incorporated. This was supplemented by field and bench scale experiments to quantify the coefficients integral to the sub-models. The 3D model developed can be used to consider different baffle arrangements, sludge withdrawal mechanisms and loading alternatives to the FSTs. Flocculation in the front half of the rectangular tank especially in the region before and after the inlet baffle is one of the vital parameters that influences the capture efficiency of SS. Flocculation could be further improved by capturing medium and small size particles by creating an additional zone with an in-tank baffle. This was one of the methods that was adopted in optimizing the performance of the tank where the CCNY 3D CFD model was used to locate the in-tank baffle position. This paper describes the development of the flocculation sub-model and the relationship of the flocculation coefficients in the known Parker equation to the initial mixed liquor suspended solids (MLSS) concentration X0. A new modified equation is proposed removing the dependency of the breakup coefficient to the initial value of X0 based on preliminary data using normal and low concentration mixed liquor suspended solids values in flocculation experiments performed.

  14. CFD based approach for modeling direct contact condensation heat transfer in two-phase turbulent stratified flows

    International Nuclear Information System (INIS)

    This paper describes a CFD based strategy for the modeling of stratified two-phase flows with heat and mass transfer across a moving steam-water interface due to direct contact condensation. Such flows have been of major importance for example in connection with the analysis of nuclear reactor safety systems, in particular during two-phase Pressurized Thermal Shock (PTS) scenarios. The approach is based on the two-fluid phase-average model. The interfacial friction was modeled by using an Algebraic Interfacial Area Density (AIAD) framework where the drag coefficient is a function of the local flow characteristics. To show the impact of the modeling of interfacial friction the simulation with the AIAD model was compared with a simulation where a constant drag coefficient of 0.44 was used in the whole domain. For the modeling of interfacial heat and mass transfer two correlations for the water heat transfer coefficient based on the penetration theory were utilized. The CFD simulations were validated against a steady-state TOPFLOW-PTS steam/water experiment. In the experiment, very detailed temperature measurements were conducted using special thermocouple lances and infrared thermography. Total condensation rate was determined indirectly by using three different methods. The simulations have shown that the results obtained with the AIAD model are considerably closer to the experimental observations than the results obtained with the constant drag coefficient. The condensation models used in the current study predict quite different total condensation rates. That caused significant differences in the temperature field. The simulations of the TOPFLOW-PTS steam/water experiment with condensation have shown that the proposed CFD modeling approach can be successfully applied for the prediction of temperature field and condensation rate during two-phase Pressurized Thermal Shock scenarios. However, the modeling of turbulent interfacial heat transfer should be improved

  15. Operations based optimisation using simulation and CFD

    OpenAIRE

    Doherty, JJ; Clifton, DP; Gillan, MA; Ciampoli, F

    2007-01-01

    An initial investigation of an optimisation based approach for design across a continuous range of operating conditions is presented. The objective for this 'operations based optimisation' approach is to avoid the need to choose critical design point conditions and associated weighting factors by tackling the overall operational performance instead. The approach integrates numerical optimisation, response surface modelling, CFD and operational simulation. An optimisation test bed involving th...

  16. Temperature Field-Wind Velocity Field Optimum Control of Greenhouse Environment Based on CFD Model

    Directory of Open Access Journals (Sweden)

    Yongbo Li

    2014-01-01

    Full Text Available The computational fluid dynamics technology is applied as the environmental control model, which can include the greenhouse space. Basic environmental factors are set to be the control objects, the field information is achieved via the division of layers by height, and numerical characteristics of each layer are used to describe the field information. Under the natural ventilation condition, real-time requirements, energy consumption, and distribution difference are selected as index functions. The optimization algorithm of adaptive simulated annealing is used to obtain optimal control outputs. A comparison with full-open ventilation shows that the whole index can be reduced at 44.21% and found that a certain mutual exclusiveness exists between the temperature and velocity field in the optimal course. All the results indicate that the application of CFD model has great advantages to improve the control accuracy of greenhouse.

  17. An automatic generation of non-uniform mesh for CFD analyses of image-based multiscale human airway models

    Science.gov (United States)

    Miyawaki, Shinjiro; Tawhai, Merryn H.; Hoffman, Eric A.; Lin, Ching-Long

    2014-11-01

    The authors have developed a method to automatically generate non-uniform CFD mesh for image-based human airway models. The sizes of generated tetrahedral elements vary in both radial and longitudinal directions to account for boundary layer and multiscale nature of pulmonary airflow. The proposed method takes advantage of our previously developed centerline-based geometry reconstruction method. In order to generate the mesh branch by branch in parallel, we used the open-source programs Gmsh and TetGen for surface and volume meshes, respectively. Both programs can specify element sizes by means of background mesh. The size of an arbitrary element in the domain is a function of wall distance, element size on the wall, and element size at the center of airway lumen. The element sizes on the wall are computed based on local flow rate and airway diameter. The total number of elements in the non-uniform mesh (10 M) was about half of that in the uniform mesh, although the computational time for the non-uniform mesh was about twice longer (170 min). The proposed method generates CFD meshes with fine elements near the wall and smooth variation of element size in longitudinal direction, which are required, e.g., for simulations with high flow rate. NIH Grants R01-HL094315, U01-HL114494, and S10-RR022421. Computer time provided by XSEDE.

  18. The Crucial Role of Error Correlation for Uncertainty Modeling of CFD-Based Aerodynamics Increments

    Science.gov (United States)

    Hemsch, Michael J.; Walker, Eric L.

    2011-01-01

    The Ares I ascent aerodynamics database for Design Cycle 3 (DAC-3) was built from wind-tunnel test results and CFD solutions. The wind tunnel results were used to build the baseline response surfaces for wind-tunnel Reynolds numbers at power-off conditions. The CFD solutions were used to build increments to account for Reynolds number effects. We calculate the validation errors for the primary CFD code results at wind tunnel Reynolds number power-off conditions and would like to be able to use those errors to predict the validation errors for the CFD increments. However, the validation errors are large compared to the increments. We suggest a way forward that is consistent with common practice in wind tunnel testing which is to assume that systematic errors in the measurement process and/or the environment will subtract out when increments are calculated, thus making increments more reliable with smaller uncertainty than absolute values of the aerodynamic coefficients. A similar practice has arisen for the use of CFD to generate aerodynamic database increments. The basis of this practice is the assumption of strong correlation of the systematic errors inherent in each of the results used to generate an increment. The assumption of strong correlation is the inferential link between the observed validation uncertainties at wind-tunnel Reynolds numbers and the uncertainties to be predicted for flight. In this paper, we suggest a way to estimate the correlation coefficient and demonstrate the approach using code-to-code differences that were obtained for quality control purposes during the Ares I CFD campaign. Finally, since we can expect the increments to be relatively small compared to the baseline response surface and to be typically of the order of the baseline uncertainty, we find that it is necessary to be able to show that the correlation coefficients are close to unity to avoid overinflating the overall database uncertainty with the addition of the increments.

  19. Time analysis of aneurysm wall shear stress for both Newtonian and Casson flows from image-based CFD models

    Science.gov (United States)

    Castro, Marcelo A.; Ahumada Olivares, María. C.; Putman, Christopher M.; Cebral, Juan R.

    2014-03-01

    The optimal management of unruptured aneurysms is controversial, and current decision making is mainly based on aneurysm size and location. Incidentally detected unruptured aneurysms less than 5mm in diameter should be treated conservatively. However, small unruptured aneurysms also bleed. Risk factors based on the hemodynamic forces exerted over the arterial wall have been investigated using image-based computational fluid dynamic (CFD) methodologies during the last decade. Accurate estimation of wall shear stress (WSS) is required to properly study associations between flow features and aneurysm processes. Previous works showed that Newtonian and non-Newtonian (Casson) models produce similar WSS distributions and characterization, with no significant differences. Other authors showed that the WSS distribution computed from time-averaged velocity fields is significantly higher for the Newtonian model where WSS is low. In this work we reconstructed ten patient-specific CFD models from angiography images to investigate the time evolution of WSS at selected locations such as aneurysm blebs (low WSS), and the parent artery close to the aneurysm neck (high WSS). When averaging all cases it is seen that the estimation of the time-averaged WSS, the peak WSS and the minimum WSS value before the systolic peak were all higher when the Casson rheology was considered. However, none of them showed statistically significant differences. At the afferent artery Casson rheology systematically predicted higher WSS values. On the other hand, at the selected blebs either Newtonian or Casson WSS estimations are higher in some phases of the cardiac cycle. Those observations differ among individual cases.

  20. New Evaluation Technique for WTG Design Wind Speed Using a CFD-Model-Based Unsteady Flow Simulation with Wind Direction Changes

    Directory of Open Access Journals (Sweden)

    Takanori Uchida

    2011-01-01

    Full Text Available Because a significant portion of the topography in Japan is characterized by steep, complex terrain, which results in a complex spatial distribution of wind speed, great care is necessary for selecting a site for the construction of wind turbine generators (WTG. We have developed a CFD model for unsteady flow called RIAM-COMPACT (Research Institute for Applied Mechanics, Kyushu University, computational prediction of airflow over complex terrain. The RIAM-COMPACT CFD model is based on large eddy simulation (LES. The computational domain of RIAM-COMPACT can extend from several meters to several kilometers, and RIAM-COMPACT can predict airflow and gas diffusion over complex terrain with high accuracy. The present paper proposes a technique for evaluating the deployment location of a WTG. The proposed technique employs the RIAM-COMPACT CFD model and simulates a continuous wind direction change over 360 degrees.

  1. TANK48 CFD MODELING ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S.

    2011-05-17

    The process of recovering the waste in storage tanks at the Savannah River Site (SRS) typically requires mixing the contents of the tank to ensure uniformity of the discharge stream. Mixing is accomplished with one to four dual-nozzle slurry pumps located within the tank liquid. For the work, a Tank 48 simulation model with a maximum of four slurry pumps in operation has been developed to estimate flow patterns for efficient solid mixing. The modeling calculations were performed by using two modeling approaches. One approach is a single-phase Computational Fluid Dynamics (CFD) model to evaluate the flow patterns and qualitative mixing behaviors for a range of different modeling conditions since the model was previously benchmarked against the test results. The other is a two-phase CFD model to estimate solid concentrations in a quantitative way by solving the Eulerian governing equations for the continuous fluid and discrete solid phases over the entire fluid domain of Tank 48. The two-phase results should be considered as the preliminary scoping calculations since the model was not validated against the test results yet. A series of sensitivity calculations for different numbers of pumps and operating conditions has been performed to provide operational guidance for solids suspension and mixing in the tank. In the analysis, the pump was assumed to be stationary. Major solid obstructions including the pump housing, the pump columns, and the 82 inch central support column were included. The steady state and three-dimensional analyses with a two-equation turbulence model were performed with FLUENT{trademark} for the single-phase approach and CFX for the two-phase approach. Recommended operational guidance was developed assuming that local fluid velocity can be used as a measure of sludge suspension and spatial mixing under single-phase tank model. For quantitative analysis, a two-phase fluid-solid model was developed for the same modeling conditions as the single

  2. Geometry optimization of a fibrous scaffold based on mathematical modelling and CFD simulation of adynamic cell culture

    DEFF Research Database (Denmark)

    Tajsoleiman, Tannaz; J. Abdekhodaie, Mohammad; Gernaey, Krist;

    2016-01-01

    the main bottlenecks in this type of processes. In this regard, mathematical modelling and computational fluid dynamics simulation (CFD) are powerful tools to identify an efficient and optimized design by providing reliable insights of the process. This study presents a mathematical model and CFD...... simulation of cartilage cell culture under a perfusion flow, which allows not only to characterize the supply of nutrients and metabolic products inside a fibrous scaffold, but also to assess the overall culture condition and predict the cell growth rate. Afterwards, the simulation results supported finding...

  3. Liquid rocket propulsion impeller CFD modeling

    Science.gov (United States)

    Ratcliff, Mark L.; Athavale, Mahesh M.; Thomas, Matthew E.; Williams, Robert W.

    1993-01-01

    Steady-state impeller geometric modeling and typical Navier-Stokes CFD algorithm analysis procedures are assessed using two benchmark quality impeller data sets. Two geometric modeling and grid generation software packages, ICEM-CFD and PATRAN, are considered. Results show that a significant advantage of PATRAN's open-ended architecture is the potential interaction between CFD and structural/thermal analysts inside the mechanical computer-aided engineering environment. However the time required to construct the inducer grid would be unacceptable in a design and engineering environment. The ICEM-CFD package is considered to be more appropriate for structural grid generation but lacks the mature link to structural/thermal analysis arena as compared to PATRAN.

  4. 3D CFD computations of transitional flows using DES and a correlation based transition model

    DEFF Research Database (Denmark)

    Sørensen, Niels N.

    process can be important for the aerodynamic performance. Today, the most widespread approach is to use fully turbulent computations, where the transitional process is ignored and the entire boundary layer on the wings or airfoils is handled by the turbulence model. The correlation based transition model......The report describes the application of the correlation based transition model of of Menter et. al. [1, 2] to the cylinder drag crisis and the stalled flow over an DU-96-W-351 airfoil using the DES methodology. When predicting the flow over airfoils and rotors, the laminar-turbulent transition...... has lately shown promising results, and the present paper describes the application of the model to predict the drag and shedding frequency for flow around a cylinder from sub to super-critical Reynolds numbers. Additionally, the model is applied to the flow around the DU-96 airfoil, at high angles...

  5. Study of indoor radon distribution using measurements and CFD modeling

    International Nuclear Information System (INIS)

    Measurement and/or prediction of indoor radon (222Rn) concentration are important due to the impact of radon on indoor air quality and consequent inhalation hazard. In recent times, computational fluid dynamics (CFD) based modeling has become the cost effective replacement of experimental methods for the prediction and visualization of indoor pollutant distribution. The aim of this study is to implement CFD based modeling for studying indoor radon gas distribution. This study focuses on comparison of experimentally measured and CFD modeling predicted spatial distribution of radon concentration for a model test room. The key inputs for simulation viz. radon exhalation rate and ventilation rate were measured as a part of this study. Validation experiments were performed by measuring radon concentration at different locations of test room using active (continuous radon monitor) and passive (pin-hole dosimeters) techniques. Modeling predictions have been found to be reasonably matching with the measurement results. The validated model can be used to understand and study factors affecting indoor radon distribution for more realistic indoor environment. - Highlights: • Indoor radon distribution has been studied using active and passive measurements and CFD simulation. • At low ventilation, non-uniformity of radon concentration was observed. • Measured wall radon flux and ventilation rate has been used in simulations. • CFD simulation results were found to be close to measurements

  6. 3D CFD computations of trasitional flows using DES and a correlation based transition model

    DEFF Research Database (Denmark)

    Sørensen, Niels N.; Bechmann, Andreas; Zahle, Frederik

    2011-01-01

    The present article describes the application of the correlation based transition model of Menter et al. in combination with the Detached Eddy Simulation (DES) methodology to two cases with large degree of flow separation typically considered difficult to compute. Firstly, the flow is computed over...

  7. CFD modelling of moisture interactions between air and constructions

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard; Woloszyn, Monika; Hohota, Raluca;

    2005-01-01

    There is a strong demand for accurate moisture modelling since moisture poses a risk for both the constructions and the indoor climate. Thus, in this investigation there is special focus on moisture modelling. The paper describes a new model based on a CFD tool that is enhanced to include both de...

  8. Linearised CFD Models for Wakes

    DEFF Research Database (Denmark)

    Ott, Søren; Berg, Jacob; Nielsen, Morten

    from generic look{up tables. Three dierent models, based on three dierent closures, are examined:  - the 'simple closure' using an unperturbed eddy viscosity uz  - the mixing length closure  - the E-ε closure Model results are evaluated against oshore wind farm production data from Horns Rev I...

  9. Validation of a CFD model simulating charge and discharge of a small heat storage test module based on a sodium acetate water mixture

    DEFF Research Database (Denmark)

    Dannemand, Mark; Fan, Jianhua; Furbo, Simon;

    2014-01-01

    Computational Fluid Dynamics (CFD) model. The CFD calculated temperatures are compared to measured temperatures internally in the box to validate the CFD model. Four cases are investigated; heating the test module with the sodium acetate water mixture in solid phase from ambient temperature to 52˚C; heating the...... the crystallization, ending at ambient temperature with the sodium acetate water mixture in solid phase. Comparisons have shown reasonable good agreement between experimental measurements and theoretical simulation results for the investigated scenarios....

  10. Modelling Complex Inlet Geometries in CFD

    DEFF Research Database (Denmark)

    Skovgaard, M.; Nielsen, Peter V.

    field. In order to apply CFD for this purpose it is essential to be able to model the inlet conditions precisely and effectively, in a way which is comprehensible to the manufacturer of inlet devices and in a way which can be coped with by the computer. In this paper a universal method is presented and...

  11. CFD based extraction column design-Chances and challenges

    Institute of Scientific and Technical Information of China (English)

    Mark W Hlawitschka; Menwer M Attarakih; Samer S Alzyod; Hans-Jrg Bart

    2016-01-01

    This paper shows that one-dimensional (1-D) [and three-dimensional (3-D) computational fluid dynamics (CFD)] simulations can replace the state-of-the-art usage of pseudo-homogeneous dispersion or back mixing models. This is based on standardized lab-scale cel experiments for the determination of droplet rise, breakage, coalescence and mass transfer parameters in addition to a limited number of additional mini-plant experiments with original fluids. Alternatively, the hydrodynamic parameters can also be derived using more sophisticated 3-D CFD simulations. Computational 1-D modeling served as a basis to replace pilot-plant experiments in any column geometry. The combination of 3-D CFD simulations with droplet population balance models (DPBM) increased the accuracy of the hydrodynamic simulations and gave information about the local droplet size. The high computational costs can be reduced by open source CFD codes when using a flexible mesh generation. First combined simulations using a three way coupled CFD/DPBM/mass-transfer solver pave the way for a safer design of industrial-sized columns, where no correlations are available.

  12. CFD Modeling of Sodium Fires

    International Nuclear Information System (INIS)

    A sodium cooled fast reactor is one of the attractive concepts for the 4th generation nuclear reactors. For the safety of a sodium cooled fast reactor, sodium-air and sodium-water reactions must be avoided. A sodium-air reaction typically occurs in two dominant modes, namely the spray fire and the pool fire. To avoid sodium-air accidents and to deal with their consequences, it is essential to understand the physical phenomena. Numerical modeling is one of the methods, which can be used to understand all the physics involved. This paper will present new numerical methods to model sodium pool combustion based on advanced state-of-the-art Computational Fluid Dynamics techniques. The models have been developed, implemented and validated against available experimental data of Newman and Payne. (author)

  13. Development of a CFD-compatible transition model based on linear stability theory

    Science.gov (United States)

    Coder, James G.

    A new laminar-turbulent transition model for low-turbulence external aerodynamic applications is presented that incorporates linear stability theory in a manner compatible with modern computational fluid dynamics solvers. The model uses a new transport equation that describes the growth of the maximum Tollmien-Schlichting instability amplitude in the presence of a boundary layer. To avoid the need for integration paths and non-local operations, a locally defined non-dimensional pressure-gradient parameter is used that serves as an estimator of the integral boundary-layer properties. The model has been implemented into the OVERFLOW 2.2f solver and interacts with the Spalart-Allmaras and Menter SST eddy-viscosity turbulence models. Comparisons of predictions using the new transition model with high-quality wind-tunnel measurements of airfoil section characteristics validate the predictive qualities of the model. Predictions for three-dimensional aircraft and wing geometries show the correct qualitative behavior even though limited experimental data are available. These cases also demonstrate that the model is well-behaved about general aeronautical configurations. These cases confirm that the new transition model is an improvement over the current state of the art in computational fluid dynamics transition modeling by providing more accurate solutions at approximately half the added computational expense.

  14. Linearised CFD models for wakes

    Energy Technology Data Exchange (ETDEWEB)

    Ott, S.; Berg, J.; Nielsen, Morten

    2011-12-15

    This report describes the development of a fast and reasonably accurate model for the prediction of energy production in offshore wind farms taking wake effects into account. The model has been implemented as a windows application called Fuga which can run in batch mode or as a graphical user interface. Fuga is briefly described. The model is based on a linearization technique which is described in some detail, and linearized, governing equations are derived and written in a standard form based on a mixed-spectral formulation. A new solution method is used to solve the equations which involves intensive use of look-up tables for storage of intermediate results. Due to the linearity of the model, multiple wakes from many turbines can be constructed from the wake of a single, solitary turbine. These are in turn constructed from Fourier components by a fast Fourier integral transform of results derived from generic look-up tables. Three different models, based on three different closures, are examined: 1) the 'simple closure' using an unperturbed eddy viscosity kucentre dotz. 2) the mixing length closure. 3) the E-epsilon closure. Model results are evaluated against offshore wind farm production data from Horns Rev I and the Nysted wind farm, and a comparison with direct wake measurements in an onshore turbine (Nibe B) is also made. A very satisfactory agreement with data is found for the simple closure. The exception is the near wake, just behind the rotor, where all three linearized models fail. The mixing length closure underestimates wake effects in all cases. The E-epsilon closure overestimates wake losses in the offshore farms while it predicts a too shallow and too wide the wake in the onshore case. The simple closure performs distinctly better than the other two. Wind speed data from the the Horns rev met masts are used to further validate Fuga results with the 'simple' closure. Finally, Roedsand 1 and 2 are used as an example to illustrate

  15. The role of CFD combustion modeling in hydrogen safety management – III: Validation based on homogeneous hydrogen–air–diluent experiments

    International Nuclear Information System (INIS)

    Highlights: • A CFD based method proposed in the previous article is used for the simulation of the effect of CO2–He dilution on hydrogen deflagration. • A theoretical study is presented to verify whether CO2–He diluent can be used as a replacement for H2O as diluent. • CFD model used for the validation work is described. • TFC combustion model results are in good agreement with large-scale homogeneous hydrogen–air–CO2–He experiments. - Abstract: Large quantities of hydrogen can be generated and released into the containment during a severe accident in a PWR. The generated hydrogen, when mixed with air, can lead to hydrogen combustion. The dynamic pressure loads resulting from hydrogen combustion can be detrimental to the structural integrity of the reactor safety systems and the reactor containment. Therefore, accurate prediction of these pressure loads is an important safety issue. In our previous article, a CFD based method to determine these pressure loads was presented. This CFD method is based on the application of a turbulent flame speed closure combustion model. The method was validated against three uniform hydrogen–air deflagration experiments with different blockage ratio performed in the ENACCEF facility. It was concluded that the maximum pressures were predicted within 13% accuracy, while the rate of pressure rise dp/dt was predicted within about 30%. The eigen frequencies of the residual pressure wave phenomena were predicted within a few %. In the present article, we perform additional validation of the CFD based method against three uniform hydrogen–air–CO2–He deflagration experiments with three different concentrations of the CO2–He diluent. The trends of decrease in the flame velocity, the intermediate peak pressure, the rate of pressure rise dp/dt, and the maximum value of the mean pressure with an increase in the CO2–He dilution are captured well in the simulations. From the presented validation analyses, it can be

  16. CFD modeling of fouling in crude oil pre-heaters

    International Nuclear Information System (INIS)

    Highlights: ► A conceptual CFD-based model to predict fouling in industrial crude oil pre-heaters. ► Tracing fouling formation in the induction and developing continuation periods. ► Effect of chemical components, shell-side HTC and turbulent flow on the fouling rate. - Abstract: In this study, a conceptual procedure based on the computational fluid dynamic (CFD) technique has been developed to predict fouling rate in an industrial crude oil pre-heater. According to the developed CFD concept crude oil was assumed to be composed of three pseudo-components comprising of petroleum, asphaltene and salt. The binary diffusion coefficients were appropriately categorized into five different groups. The species transport model was applied to simulate the mixing and transport of chemical species. The possibility of adherence of reaction products to the wall was taken into account by applying a high viscosity for the products in competition with the shear stress on the wall. Results showed a reasonable agreement between the model predictions and the plant data. The CFD model could be applied to new operating conditions to investigate the details of the crude oil fouling in the industrial pre-heaters.

  17. Modeling Pulse Tube Cryocoolers with CFD

    Science.gov (United States)

    Flake, Barrett; Razani, Arsalan

    2004-06-01

    A commercial computational fluid dynamics (CFD) software package is used to model the oscillating flow inside a pulse tube cryocooler. Capabilities for modeling pulse tubes are demonstrated with preliminary case studies and the results presented. The 2D axi-symmetric simulations demonstrate the time varying temperature and velocity fields in the tube along with computation of the heat fluxes at the hot and cold heat exchangers. The only externally imposed boundary conditions are a cyclically moving piston wall at one end of the tube and constant temperature or heat flux boundaries at the external walls of the hot and cold heat exchangers.

  18. CFD modeling of the EPR primary circuit

    International Nuclear Information System (INIS)

    Highlights: • A RANS CFD computation of almost all of the EPR reactor primary circuit is demonstrated. • Comparison with experimental data of the obtained results is carried out. • Hydraulic decoupling between main vessel elements in normal operation is pointed out. • Promising results are found out with regards to nuclear plants’ safety demonstration. - Abstract: The present paper deals with the feasibility of a RANS CFD computation of almost all of the primary circuit of a EPR PWR reactor. The developed model includes the vessel, the core, the steam generators and the associated piping. The flow in the primary circuit is studied under normal operations with balanced flow rates between loops. The k–ε realizable model is retained for the turbulence modeling, and standard wall functions are used as wall treatment. The constructed grid contains about 181,000,000 elements, mainly hexahedrons. The computation is performed with the commercial CFD code STAR-CD, and despite the relatively large amount of cells, such kind of computation is fully accessible at an industrial scale with today available computational resources. A comparison with experimental data of the obtained results is carried out. The simulation results in the vessel are confronted to measurements issued from JULIETTE and ROMEO mock-ups, representative of the EPR lower and upper internals respectively. Regarding the steam generators, a benchmark with the dedicated code GENEPI is also performed. An overall good agreement with the reference data is underlined. The potential up-and-downstream effects of the different modeled components brought interesting knowledge, especially with regards to safety issues. These encouraging results allow in testing, in a near future, this model in other configurations such as unbalanced operation or accidental transients

  19. Sources of error in CEMRA-based CFD simulations of the common carotid artery

    Science.gov (United States)

    Khan, Muhammad Owais; Wasserman, Bruce A.; Steinman, David A.

    2013-03-01

    Magnetic resonance imaging is often used as a source for reconstructing vascular anatomy for the purpose of computational fluid dynamics (CFD) analysis. We recently observed large discrepancies in such "image-based" CFD models of the normal common carotid artery (CCA) derived from contrast enhanced MR angiography (CEMRA), when compared to phase contrast MR imaging (PCMRI) of the same subjects. A novel quantitative comparison of velocity profile shape of N=20 cases revealed an average 25% overestimation of velocities by CFD, attributed to a corresponding underestimation of lumen area in the CEMRA-derived geometries. We hypothesized that this was due to blurring of edges in the images caused by dilution of contrast agent during the relatively long elliptic centric CEMRA acquisitions, and confirmed this with MRI simulations. Rescaling of CFD models to account for the lumen underestimation improved agreement with the velocity levels seen in the corresponding PCMRI images, but discrepancies in velocity profile shape remained, with CFD tending to over-predict velocity profile skewing. CFD simulations incorporating realistic inlet velocity profiles and non-Newtonian rheology had a negligible effect on velocity profile skewing, suggesting a role for other sources of error or modeling assumptions. In summary, our findings suggest that caution should be exercised when using elliptic-centric CEMRA data as a basis for image-based CFD modeling, and emphasize the importance of comparing image-based CFD models against in vivo data whenever possible.

  20. Study of indoor radon distribution using measurements and CFD modeling.

    Science.gov (United States)

    Chauhan, Neetika; Chauhan, R P; Joshi, M; Agarwal, T K; Aggarwal, Praveen; Sahoo, B K

    2014-10-01

    Measurement and/or prediction of indoor radon ((222)Rn) concentration are important due to the impact of radon on indoor air quality and consequent inhalation hazard. In recent times, computational fluid dynamics (CFD) based modeling has become the cost effective replacement of experimental methods for the prediction and visualization of indoor pollutant distribution. The aim of this study is to implement CFD based modeling for studying indoor radon gas distribution. This study focuses on comparison of experimentally measured and CFD modeling predicted spatial distribution of radon concentration for a model test room. The key inputs for simulation viz. radon exhalation rate and ventilation rate were measured as a part of this study. Validation experiments were performed by measuring radon concentration at different locations of test room using active (continuous radon monitor) and passive (pin-hole dosimeters) techniques. Modeling predictions have been found to be reasonably matching with the measurement results. The validated model can be used to understand and study factors affecting indoor radon distribution for more realistic indoor environment.

  1. Gasification CFD Modeling for Advanced Power Plant Simulations

    Energy Technology Data Exchange (ETDEWEB)

    Zitney, S.E.; Guenther, C.P.

    2005-09-01

    In this paper we have described recent progress on developing CFD models for two commercial-scale gasifiers, including a two-stage, coal slurry-fed, oxygen-blown, pressurized, entrained-flow gasifier and a scaled-up design of the PSDF transport gasifier. Also highlighted was NETL’s Advanced Process Engineering Co-Simulator for coupling high-fidelity equipment models with process simulation for the design, analysis, and optimization of advanced power plants. Using APECS, we have coupled the entrained-flow gasifier CFD model into a coal-fired, gasification-based FutureGen power and hydrogen production plant. The results for the FutureGen co-simulation illustrate how the APECS technology can help engineers better understand and optimize gasifier fluid dynamics and related phenomena that impact overall power plant performance.

  2. CFD and FEM Model of an Underwater Vehicle Propeller

    Directory of Open Access Journals (Sweden)

    Chruściel Tadeusz

    2014-10-01

    Full Text Available Within the framework of the project for design and optimization of the Remotely Operated Vehicle (ROV, research on its propulsion has been carried out. Te entire project was supported by CFD and FEM calculations taking into account the characteristics of the underwater vehicle. One of the tasks was to optimize the semi-open duct for horizontal propellers, which provided propulsion and controllability in horizontal plane. In order to create a measurable model of this task it was necessary to analyze numerical methodology of propeller design, along with the structure of a propellers with nozzles and contra-rotating propellers. It was confronted with theoretical solutions which included running of the analyzed propeller near an underwater vehicle. Also preliminary qualitative analyses of a simplified system with contra-rotating propellers and a semi-open duct were carried out. Te obtained results enabled to make a decision about the ROVs duct form. Te rapid prototyping SLS (Selective Laser Sintering method was used to fabricate a physical model of the propeller. As a consequence of this, it was necessary to verify the FEM model of the propeller, which based on the load obtained from the CFD model. Te article contains characteristics of the examined ROV, a theoretical basis of propeller design for the analyzed cases, and the results of CFD and FEM simulations.

  3. A CFD model for pollutant dispersion in rivers

    Directory of Open Access Journals (Sweden)

    Modenesi K.

    2004-01-01

    Full Text Available Studies have shown that humankind will experience a water shortage in the coming decades. It is therefore paramount to develop new techniques and models with a view to minimizing the impact of pollution. It is important to predict the environmental impact of new emissions in rivers, especially during periods of drought. Computational fluid dynamics (CFD has proved to be an invaluable tool to develop models able to analyze in detail particle dispersion in rivers. However, since these models generate grids with thousands (even millions of points to evaluate velocities and concentrations, they still require powerful machines. In this context, this work contributes by presenting a new three-dimensional model based on CFD techniques specifically developed to be fast, providing a significant improvement in performance. It is able to generate predictions in a couple of hours for a one-thousand-meter long section of river using Pentium IV computers. Commercial CFD packages would require weeks to solve the same problem. Another innovation inb this work is that a half channel with a constant elliptical cross section represents the river, so the Navier Stokes equations were derived for the elliptical system. Experimental data were obtained from REPLAN (PETROBRAS refining unit on the Atibaia River in São Paulo, Brazil. The results show good agreement with experimental data.

  4. CFD modeling of the IRIS pressurizer dynamic

    Energy Technology Data Exchange (ETDEWEB)

    Sanz, Ronny R.; Montesinos, Maria E.; Garcia, Carlos; Bueno, Elizabeth D.; Mazaira, Leorlen R., E-mail: rsanz@instec.cu, E-mail: mmontesi@instec.cu, E-mail: cgh@instec.cu, E-mail: leored1984@gmail.com [Instituto Superior de Tecnologias y Ciencias Aplicadas (InSTEC), La Habana (Cuba); Bezerra, Jair L.; Lira, Carlos A.B. Oliveira, E-mail: jair.lima@ufpe.br, E-mail: cabol@ufpe.br [Universida Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Energia Nuclear

    2015-07-01

    Integral layout of nuclear reactor IRIS makes possible the elimination of the spray system, which is usually used to mitigate in-surge transient and also help to Boron homogenization. The study of transients with deficiencies in the Boron homogenization in this technology is very important, because they can cause disturbances in the reactor power and insert a strong reactivity in the core. The detailed knowledge of the behavior of multiphase multicomponent flows is challenging due to the complex phenomena and interactions at the interface. In this context, the CFD modeling is employed in the design of equipment in the nuclear industry as it allows predicting accidents or predicting their performance in dissimilar applications. The aim of the present research is to model the IRIS pressurizer's dynamic using the commercial CFD code CFX. A symmetric tri dimensional model equivalent to 1/8 of the total geometry was adopted to reduce mesh size and minimize processing time. The model considers the coexistence of four phases and also takes into account the heat losses. The relationships for interfacial mass, energy, and momentum transport are programmed and incorporated into CFX. Moreover, two subdomains and several additional variables are defined to monitoring the boron dilution sequences and condensation-evaporation rates in different control volumes. For transient states a non - equilibrium stratification in the pressurizer is considered. This paper discusses the model developed and the behavior of the system for representative transients sequences. The results of analyzed transients of IRIS can be applied to the design of pressurizer internal structures and components. (author)

  5. Simultaneous Excitation of Multiple-Input Multiple-Output CFD-Based Unsteady Aerodynamic Systems

    Science.gov (United States)

    Silva, Walter A.

    2008-01-01

    A significant improvement to the development of CFD-based unsteady aerodynamic reduced-order models (ROMs) is presented. This improvement involves the simultaneous excitation of the structural modes of the CFD-based unsteady aerodynamic system that enables the computation of the unsteady aerodynamic state-space model using a single CFD execution, independent of the number of structural modes. Four different types of inputs are presented that can be used for the simultaneous excitation of the structural modes. Results are presented for a flexible, supersonic semi-span configuration using the CFL3Dv6.4 code.

  6. Modelling of Air Flow trough a Slatted Floor by CFD

    DEFF Research Database (Denmark)

    Svidt, Kjeld; Bjerg, Bjarne; Morsing, Svend;

    In this paper two different CFD-approaches are investigated to model the airflow through a slatted floor. Experiments are carried out in a full-scale test room. The computer simulations are carried out with the CFD-code FLOVENT, which solves the time-averaged Navier-Stokes equations by use of the...

  7. Qualification of CFD-models for multiphase flows

    Energy Technology Data Exchange (ETDEWEB)

    Lucas, Dirk [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany)

    2016-05-15

    While Computational Fluid Dynamics (CFD) is already an accepted industrial tool for single phase flows it is not yet mature for two-phase flows. For this reason the qualification of CFD for reactor safety relevant applications which involve multiphase flows is a present topic of research. At the CFD division of Helmholtz-Zentrum Dresden-Rossendorf (HZDR) hereby beside an application-oriented model development and validation also more generic investigations are done. Thus, the baseline model strategy aims on the consolidation of the CFD-modelling for multiphase to enable reliable predictions for well-defined flow pattern in future. In addition the recently developed GENTOP-concept broadens the range of applicability of CFD. Different flow morphologies including transitions between them can be considered in frame of this concept.

  8. Qualification of CFD-models for multiphase flows

    International Nuclear Information System (INIS)

    While Computational Fluid Dynamics (CFD) is already an accepted industrial tool for single phase flows it is not yet mature for two-phase flows. For this reason the qualification of CFD for reactor safety relevant applications which involve multiphase flows is a present topic of research. At the CFD division of Helmholtz-Zentrum Dresden-Rossendorf (HZDR) hereby beside an application-oriented model development and validation also more generic investigations are done. Thus, the baseline model strategy aims on the consolidation of the CFD-modelling for multiphase to enable reliable predictions for well-defined flow pattern in future. In addition the recently developed GENTOP-concept broadens the range of applicability of CFD. Different flow morphologies including transitions between them can be considered in frame of this concept.

  9. CFD modeling of passive autocatalytic recombiners*

    Directory of Open Access Journals (Sweden)

    Orszulik Magdalena

    2015-06-01

    Full Text Available This study deals with numerical modeling of passive autocatalytic hydrogen recombiners (PARs. Such devices are installed within containments of many nuclear reactors in order to remove hydrogen and convert it to steam. The main purpose of this work is to develop a numerical model of passive autocatalytic recombiner (PAR using the commercial computational fluid dynamics (CFD software ANSYS-FLUENT and tuning the model using experimental results. The REKO 3 experiment was used for this purpose. Experiment was made in the Institute for Safety Research and Reactor Technology in Julich (Germany. It has been performed for different hydrogen concentrations, different flow rates, the presence of steam, and different initial temperatures of the inlet mixture. The model of this experimental recombiner was elaborated within the framework of this work. The influence of mesh, gas thermal conductivity coefficient, mass diffusivity coefficients, and turbulence model was investigated. The best results with a good agreement with REKO 3 data were received for k-ɛ model of turbulence, gas thermal conductivity dependent on the temperature and mass diffusivity coefficients taken from CHEMKIN program. The validated model of the PAR was next implemented into simple two-dimensional simulations of hydrogen behavior within a subcompartment of a containment building.

  10. MODELLING MANTLE TANKS FOR SDHW SYSTEMS USING PIV AND CFD

    DEFF Research Database (Denmark)

    Shah, Louise Jivan; Morrison, G.L.; Behnia, Masud

    1999-01-01

    Characteristics of vertical mantle heat exchanger tanks for SDHW systems have been investigated experimentally and theoretically using particle image velocimetry (PIV) and CFD modelling. A glass model of a mantle heat exchanger tank was constructed so that the flow distribution in the mantle could...... be studied using the PIV test facility. Two transient three-dimensional CFD-models of the glass model mantle tank were developed using the CFD-programmes CFX and FLUENT.The experimental results illustrate that the mantle flow structure in the mantle is complicated and the distribution of flow in the mantle...

  11. A semi-parabolic wake model for large offshore wind farms based on the open source CFD solver OpenFOAM

    Directory of Open Access Journals (Sweden)

    Cabezón D.

    2014-01-01

    Full Text Available Wake effect represents one of the main sources of energy loss and uncertainty when designing offshore wind farms. Traditionally analytical models have been used to optimize and estimate power deficits. However these models have shown to underestimate wake effect and consequently overestimate output power [1, 2]. This means that analytical models can be very helpful at optimizing preliminary layouts but not as accurate as needed for an ultimate fine design. Different techniques can be found in the literature to study wind turbine wakes that include simplified kinematic models and more advanced field models, that solve flow equations with different turbulence closure schemes. See the review papers of Crespo et al. [3], Vermeer et al. [4], and Sanderse et al. [5]. Purely elliptic Computational Fluid Dynamics (CFD models based on the actuator disk technique have been developed during the last years [6–8]. They consider wind turbine rotor as a disk where a distribution of axial forces act over the incoming air. It is a fair approach but it can still be computationally expensive for big wind farms in an operative mode. With this technique still active, an alternative approach inspired on the parabolic wake models [9, 10] is proposed. Wind turbine rotors continue to be represented as actuator disks but now the domain is split into subdomains containing one or more wind turbines. The output of each subdomain is mapped onto the input boundary of the next one until the end of the domain is reached, getting a considerable decrease on computational time, by a factor of order 10. As the model is based on the open source CFD solver OpenFOAM, it can be parallelized to speed-up convergence. The near wake is calculated so no initial wind speed deficit profiles have to be supposed as in totally parabolic models and alternative turbulence models, such as the anisotropic Reynolds Stress Model (RSM can be used. Traditional problems of elliptic models related to

  12. CFD and FEM modeling of PPOOLEX experiments

    Energy Technology Data Exchange (ETDEWEB)

    Paettikangas, T.; Niemi, J.; Timperi, A. (VTT Technical Research Centre of Finland (Finland))

    2011-01-15

    Large-break LOCA experiment performed with the PPOOLEX experimental facility is analysed with CFD calculations. Simulation of the first 100 seconds of the experiment is performed by using the Euler-Euler two-phase model of FLUENT 6.3. In wall condensation, the condensing water forms a film layer on the wall surface, which is modelled by mass transfer from the gas phase to the liquid water phase in the near-wall grid cell. The direct-contact condensation in the wetwell is modelled with simple correlations. The wall condensation and direct-contact condensation models are implemented with user-defined functions in FLUENT. Fluid-Structure Interaction (FSI) calculations of the PPOOLEX experiments and of a realistic BWR containment are also presented. Two-way coupled FSI calculations of the experiments have been numerically unstable with explicit coupling. A linear perturbation method is therefore used for preventing the numerical instability. The method is first validated against numerical data and against the PPOOLEX experiments. Preliminary FSI calculations are then performed for a realistic BWR containment by modeling a sector of the containment and one blowdown pipe. For the BWR containment, one- and two-way coupled calculations as well as calculations with LPM are carried out. (Author)

  13. Application of Simple CFD Models in Smoke Ventilation Design

    DEFF Research Database (Denmark)

    Brohus, Henrik; Nielsen, Peter Vilhelm; la Cour-Harbo, Hans;

    2004-01-01

    The paper examines the possibilities of using simple CFD models in practical smoke ventilation design. The aim is to assess if it is possible with a reasonable accuracy to predict the behaviour of smoke transport in case of a fire. A CFD code mainly applicable for “ordinary” ventilation design...... uses a standard k-ε turbulence model. Simulations comprise both steady-state and dynamic approaches. Several boundary conditions are tested. Finally, the paper discusses the prospects of simple CFD models in smoke ventilation design including the inherent limitations....

  14. CFD modeling of a boiler's tubes rupture

    International Nuclear Information System (INIS)

    This paper reports the results of a study on the reason for tubes damage in the superheater Platen section of the 320 MW Bisotoun power plant, Iran. The boiler has three types of superheater tubes and the damage occurs in a series of elbows belongs to the long tubes. A three-dimensional modeling was performed using an in-house computational fluid dynamics (CFD) code in order to explore the reason. The code has ability of simultaneous solving of the continuity, the Reynolds-Averaged Navier-Stokes (RANS) equations and employing the turbulence, combustion and radiation models. The whole boiler including; walls, burners, air channels, three types of tubes, etc., was modeled in the real scale. The boiler was meshed into almost 2,000,000 tetrahedral control volumes and the standard k-ε turbulence model and the Rosseland radiation model were used in the model. The theoretical results showed that the inlet 18.9 MPa saturated steam becomes superheated inside the tubes and exit at a pressure of 17.8 MPa. The predicted results showed that the temperature of the steam and tube's wall in the long tubes is higher than the short and medium size tubes. In addition, the predicted steam mass flow rate in the long tube was lower than other ones. Therefore, it was concluded that the main reason for the rupture in the long tubes elbow is changing of the tube's metal microstructure due to working in a temperature higher than the design temperature. In addition, the structural fatigue tension makes the last elbow of the long tube more ready for rupture in comparison with the other places. The concluded result was validated by observations from the photomicrograph of the tube's metal samples taken from the damaged and undamaged sections

  15. CFD model of an aerating hydrofoil

    International Nuclear Information System (INIS)

    Improving water quality in the tailrace below hydroelectric dams has become a priority in many river systems. In warm climates, water drawn by the turbine from deep in a reservoir can be deficient in dissolved oxygen (DO), a critical element in maintaining a healthy aquatic ecosystem. Many different solutions have been proposed in order to increase the DO levels in turbine discharge, including: turbine aeration systems (adding air to the water through either the turbine hub, the periphery or through distributed aeration in the runner blades); bubble diffusers in the reservoir or in the tailrace; aerating weirs downstream of the dams; and surface water pumps in the reservoir near the dam. There is a significant potential to increase the effectiveness of these solutions by improving the way that oxygen is introduced into the water; better distributions of bubbles will result in better oxygen transfer. In the present study, a two-phase Computational Fluid Dynamics model has been formulated using a commercial code to study the distribution of air downstream of a simple aerating hydrofoil. The two-phase model uses the Eulerian-Eulerian approach. Appropriate relations are used to model the interphase forces, including the Grace drag force model, the Favre averaged drag force and the Sato enhanced eddy viscosity. The model is validated using experimental results obtained in the water tunnel at the University of Minnesota's Saint Anthony Falls Laboratory. Results are obtained for water velocities between 5 and 10 m/s, air flow rates between 0.5 and 1.5 sL/min and for angles of attack between 0° and -8°. The results of this study show that the CFD model provides a good qualitative comparison to the experimental results by well predicting the wake location at the different flow rates and angles of attack used

  16. CFD model of an aerating hydrofoil

    Science.gov (United States)

    Scott, D.; Sabourin, M.; Beaulieu, S.; Papillon, B.; Ellis, C.

    2014-03-01

    Improving water quality in the tailrace below hydroelectric dams has become a priority in many river systems. In warm climates, water drawn by the turbine from deep in a reservoir can be deficient in dissolved oxygen (DO), a critical element in maintaining a healthy aquatic ecosystem. Many different solutions have been proposed in order to increase the DO levels in turbine discharge, including: turbine aeration systems (adding air to the water through either the turbine hub, the periphery or through distributed aeration in the runner blades); bubble diffusers in the reservoir or in the tailrace; aerating weirs downstream of the dams; and surface water pumps in the reservoir near the dam. There is a significant potential to increase the effectiveness of these solutions by improving the way that oxygen is introduced into the water; better distributions of bubbles will result in better oxygen transfer. In the present study, a two-phase Computational Fluid Dynamics model has been formulated using a commercial code to study the distribution of air downstream of a simple aerating hydrofoil. The two-phase model uses the Eulerian-Eulerian approach. Appropriate relations are used to model the interphase forces, including the Grace drag force model, the Favre averaged drag force and the Sato enhanced eddy viscosity. The model is validated using experimental results obtained in the water tunnel at the University of Minnesota's Saint Anthony Falls Laboratory. Results are obtained for water velocities between 5 and 10 m/s, air flow rates between 0.5 and 1.5 sL/min and for angles of attack between 0° and -8°. The results of this study show that the CFD model provides a good qualitative comparison to the experimental results by well predicting the wake location at the different flow rates and angles of attack used.

  17. CFD-based method of determining form factor k for different ship types and different drafts

    Science.gov (United States)

    Wang, Jinbao; Yu, Hai; Zhang, Yuefeng; Xiong, Xiaoqing

    2016-07-01

    The value of form factor k at different drafts is important in predicting full-scale total resistance and speed for different types of ships. In the ITTC community, most organizations predict form factor k using a low-speed model test. However, this method is problematic for ships with bulbous bows and transom. In this article, a Computational Fluid Dynamics (CFD)-based method is introduced to obtain k for different type of ships at different drafts, and a comparison is made between the CFD method and the model test. The results show that the CFD method produces reasonable k values. A grid generating method and turbulence model are briefly discussed in the context of obtaining a consistent k using CFD.

  18. Investigation of the Structure of Airflow Behind a Porous Fence Aided by CFD Based Virtual Sensor Data

    OpenAIRE

    Mustafa, Mohamad; Xu, Yizhong

    2015-01-01

    Physical experiments have difficulties to thoroughly investigate the full structure of air flow behind a porous fence. Physical measurement sensors have their limitations of data acquisitions in turbulent air flow. Computational Fluid Dynamics (CFD) technique provides an infinite number of virtual sensors that allows producing quantitative CFD based virtual sensors data for users. In this paper, a 3D CFD model is assessed by the physical sensors data, and the simulation has provid...

  19. Coupling a CFD code with neutron kinetics and pin thermal models for nuclear reactor safety analyses

    International Nuclear Information System (INIS)

    Highlights: • A CFD/neutron kinetics coupled code FLUENT/PK for nuclear reactor transient safety was developed. • The mathematical models and coupling methods of FLUENT/PK were described. • The code-to-code validation between FLUENT/PK and SIMMER-III was conducted. - Abstract: Most system codes are based on the one-dimensional lumped-parameter method, which is unsuitable to simulate multi-dimensional thermal-hydraulics problems. CFD method is a good tool to simulate multi-dimensional thermal-hydraulics phenomena in the nuclear reactor, which can increase the accuracy of analysis results. However, since there is no neutron kinetics model and pin thermal model in current CFD codes, the application of the CFD method in the area of nuclear reactor safety analyses is still limited. Coupling a CFD code with the neutron kinetics model (PKM) and the pin thermal model (PTM) is a good way to use CFD code to simulate multi-dimensional thermal-hydraulics problems of nuclear reactors. The motivation for this work is to develop a CFD/neutron kinetics coupled code named FLUENT/PK for nuclear reactor safety analyses by coupling the commercial CFD code named FLUENT with the point kinetics model (PKM) and the pin thermal model (PTM). The mathematical models and the coupling method are described and the unprotected transient overpower (UTOP) accident of a liquid metal cooled fast reactor (LMFR) is chosen as an application case. As a general validation, the calculated results are used to compare with that of another multi-physics coupled code named SIMMER-III and good agreements are achieved for various characteristic parameters

  20. Controls/CFD Interdisciplinary Research Software Generates Low-Order Linear Models for Control Design From Steady-State CFD Results

    Science.gov (United States)

    Melcher, Kevin J.

    1997-01-01

    The NASA Lewis Research Center is developing analytical methods and software tools to create a bridge between the controls and computational fluid dynamics (CFD) disciplines. Traditionally, control design engineers have used coarse nonlinear simulations to generate information for the design of new propulsion system controls. However, such traditional methods are not adequate for modeling the propulsion systems of complex, high-speed vehicles like the High Speed Civil Transport. To properly model the relevant flow physics of high-speed propulsion systems, one must use simulations based on CFD methods. Such CFD simulations have become useful tools for engineers that are designing propulsion system components. The analysis techniques and software being developed as part of this effort are an attempt to evolve CFD into a useful tool for control design as well. One major aspect of this research is the generation of linear models from steady-state CFD results. CFD simulations, often used during the design of high-speed inlets, yield high resolution operating point data. Under a NASA grant, the University of Akron has developed analytical techniques and software tools that use these data to generate linear models for control design. The resulting linear models have the same number of states as the original CFD simulation, so they are still very large and computationally cumbersome. Model reduction techniques have been successfully applied to reduce these large linear models by several orders of magnitude without significantly changing the dynamic response. The result is an accurate, easy to use, low-order linear model that takes less time to generate than those generated by traditional means. The development of methods for generating low-order linear models from steady-state CFD is most complete at the one-dimensional level, where software is available to generate models with different kinds of input and output variables. One-dimensional methods have been extended

  1. CFD modelling of Stirling engines with complex design topologies

    OpenAIRE

    Alexakis, Thanos

    2013-01-01

    This research is in the field of CFD modelling of heat engines, particularly the advanced CFD methodologies for the performance characterization of solar Stirling Engines with complex geometrical topologies. The research aims to investigate whether these methods can provide a more inclusive picture of the engine performance and how this information can be used for the design improvement of Stirling engines and the investigation of more complex engine topologies.

  2. Modelling of a CFD Microscale Model and Its Application in Wind Energy Resource Assessment

    Directory of Open Access Journals (Sweden)

    Yue Jie-shun

    2016-01-01

    Full Text Available The prediction of a wind farm near the wind turbines has a significant effect on the safety as well as economy of wind power generation. To assess the wind resource distribution within a complex terrain, a computational fluid dynamics (CFD based wind farm forecast microscale model is developed. The model uses the Reynolds Averaged Navier-Stokes (RANS model to characterize the turbulence. By using the results of Weather Research and Forecasting (WRF mesoscale weather forecast model as the input of the CFD model, a coupled model of CFD-WRF is established. A special method is used for the treatment of the information interchange on the lateral boundary between two models. This established coupled model is applied in predicting the wind farm near a wind turbine in Hong Gang-zi, Jilin, China. The results from this simulation are compared to real measured data. On this basis, the accuracy and efficiency of turbulence characterization schemes are discussed. It indicates that this coupling system is easy to implement and can make these two separate models work in parallel. The CFD model coupled with WRF has the advantage of high accuracy and fast speed, which makes it valid for the wind power generation.

  3. Towards a CFD Model for Prediction of Wind Turbine Power Losses due to Icing in Cold Climate

    DEFF Research Database (Denmark)

    Pedersen, Marie Cecilie; Sørensen, Henrik

    Icing induced power losses is an important issue when operating wind turbines in cold climate. This paper presents a concept of modelling ice accretion on wind turbines using Computational Fluid Dynamics (CFD). The modelling concept works towards unifying the processes of modelling ice accretion...... and the aerodynamic analysis of the iced object into one CFD-based icing model. Modelling of icing and obtaining ice shapes in combination with mesh update by surface boundary displacement was demonstrated in the paper. It has been done by expressing in-cloud icing in CFD by an Eulerian multiphase model, implementing...... an icing module into the CFD solution and finally by surface boundary displacement also included in the CFD solution. The model has been developed using ANSYS-FLUENT and user-defined functions. The naca profile, NACA64618, has been used to illustrate the functionality of the model. Running ice accretion...

  4. Development of an integrated methodology for the design and optimization of charging and EGR circuits in modern diesel engines based on 1D-CFD engine modelling

    Energy Technology Data Exchange (ETDEWEB)

    Arrigoni, Stefano; Avolio, Giovanni; Loudjertli, Lydia; Renella, Alfonso; Vassallo, Alberto [General Motors Powertrain Europe, Turin (Italy)

    2011-07-01

    In modern diesel engines, the requirements on the combustion system are very tightening, due to an aggressive combination of pollutant emission, fuel economy, NVH and fun-to-drive targets. In particular, the charging and EGR circuits, with their impact on combustion system performance, deserve a special attention, both in terms of architecture selection, as well as component design and specifications. Since most of these choices occur very early in the engine design phase, it is of high importance to have a reliable analytical tool capable to predict the performance of such components, prior than the actual hardware is available for testing. The present paper describes the development and application to a new diesel engine of an integrated approach for charging and EGR circuit design optimization, based on a set of high-level targets for emissions, fuel economy and performance. In order to achieve this goal, a 1D-CFD approach based on GT-Power suite has been employed: specific sub-routines and semi-empirical models for accurate heat-release and emission prediction have been developed and validated, and finally applied to a light-duty passenger car diesel engine under development. The results show that the tool is capable to predict engine indicated cycle as well as NOx, PM emissions depending on the characteristics of charging and EGR circuits, and can be used to cascade high-level engine target to component specifications (turbocharger, EGR cooler, intercooler) in an effective way. (orig.)

  5. Investigation of Microclimate by CFD Modeling of Moisture Interactions between Air and Constructions

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard; Woloszyn, Monika; Rode, Carsten;

    2007-01-01

    There is a strong demand for accurate moisture modeling since moisture poses a risk for both the constructions and the indoor climate. This investigation has special focus on moisture modeling. The paper describes a new model based on a CFD tool enhanced to include both detailed modeling of airfl...

  6. iCFD: Interpreted Computational Fluid Dynamics - Degeneration of CFD to one-dimensional advection-dispersion models using statistical experimental design - The secondary clarifier.

    Science.gov (United States)

    Guyonvarch, Estelle; Ramin, Elham; Kulahci, Murat; Plósz, Benedek Gy

    2015-10-15

    The present study aims at using statistically designed computational fluid dynamics (CFD) simulations as numerical experiments for the identification of one-dimensional (1-D) advection-dispersion models - computationally light tools, used e.g., as sub-models in systems analysis. The objective is to develop a new 1-D framework, referred to as interpreted CFD (iCFD) models, in which statistical meta-models are used to calculate the pseudo-dispersion coefficient (D) as a function of design and flow boundary conditions. The method - presented in a straightforward and transparent way - is illustrated using the example of a circular secondary settling tank (SST). First, the significant design and flow factors are screened out by applying the statistical method of two-level fractional factorial design of experiments. Second, based on the number of significant factors identified through the factor screening study and system understanding, 50 different sets of design and flow conditions are selected using Latin Hypercube Sampling (LHS). The boundary condition sets are imposed on a 2-D axi-symmetrical CFD simulation model of the SST. In the framework, to degenerate the 2-D model structure, CFD model outputs are approximated by the 1-D model through the calibration of three different model structures for D. Correlation equations for the D parameter then are identified as a function of the selected design and flow boundary conditions (meta-models), and their accuracy is evaluated against D values estimated in each numerical experiment. The evaluation and validation of the iCFD model structure is carried out using scenario simulation results obtained with parameters sampled from the corners of the LHS experimental region. For the studied SST, additional iCFD model development was carried out in terms of (i) assessing different density current sub-models; (ii) implementation of a combined flocculation, hindered, transient and compression settling velocity function; and (iii

  7. iCFD: Interpreted Computational Fluid Dynamics - Degeneration of CFD to one-dimensional advection-dispersion models using statistical experimental design - The secondary clarifier.

    Science.gov (United States)

    Guyonvarch, Estelle; Ramin, Elham; Kulahci, Murat; Plósz, Benedek Gy

    2015-10-15

    The present study aims at using statistically designed computational fluid dynamics (CFD) simulations as numerical experiments for the identification of one-dimensional (1-D) advection-dispersion models - computationally light tools, used e.g., as sub-models in systems analysis. The objective is to develop a new 1-D framework, referred to as interpreted CFD (iCFD) models, in which statistical meta-models are used to calculate the pseudo-dispersion coefficient (D) as a function of design and flow boundary conditions. The method - presented in a straightforward and transparent way - is illustrated using the example of a circular secondary settling tank (SST). First, the significant design and flow factors are screened out by applying the statistical method of two-level fractional factorial design of experiments. Second, based on the number of significant factors identified through the factor screening study and system understanding, 50 different sets of design and flow conditions are selected using Latin Hypercube Sampling (LHS). The boundary condition sets are imposed on a 2-D axi-symmetrical CFD simulation model of the SST. In the framework, to degenerate the 2-D model structure, CFD model outputs are approximated by the 1-D model through the calibration of three different model structures for D. Correlation equations for the D parameter then are identified as a function of the selected design and flow boundary conditions (meta-models), and their accuracy is evaluated against D values estimated in each numerical experiment. The evaluation and validation of the iCFD model structure is carried out using scenario simulation results obtained with parameters sampled from the corners of the LHS experimental region. For the studied SST, additional iCFD model development was carried out in terms of (i) assessing different density current sub-models; (ii) implementation of a combined flocculation, hindered, transient and compression settling velocity function; and (iii

  8. iCFD: Interpreted Computational Fluid Dynamics – Degeneration of CFD to one-dimensional advection-dispersion models using statistical experimental design – The secondary clarifier

    DEFF Research Database (Denmark)

    Guyonvarch, Estelle; Ramin, Elham; Kulahci, Murat;

    2015-01-01

    The present study aims at using statistically designed computational fluid dynamics (CFD) simulations as numerical experiments for the identification of one-dimensional (1-D) advection-dispersion models – computationally light tools, used e.g., as sub-models in systems analysis. The objective...... is to develop a new 1-D framework, referred to as interpreted CFD (iCFD) models, in which statistical meta-models are used to calculate the pseudo-dispersion coefficient (D) as a function of design and flow boundary conditions. The method – presented in a straightforward and transparent way – is illustrated...... using the example of a circular secondary settling tank (SST). First, the significant design and flow factors are screened out by applying the statistical method of two-level fractional factorial design of experiments. Second, based on the number of significant factors identified through the factor...

  9. Numerical Simulation of Desulfurization Behavior in Gas-Stirred Systems Based on Computation Fluid Dynamics-Simultaneous Reaction Model (CFD-SRM) Coupled Model

    Science.gov (United States)

    Lou, Wentao; Zhu, Miaoyong

    2014-10-01

    A computation fluid dynamics-simultaneous reaction model (CFD-SRM) coupled model has been proposed to describe the desulfurization behavior in a gas-stirred ladle. For the desulfurization thermodynamics, different models were investigated to determine sulfide capacity and oxygen activity. For the desulfurization kinetic, the effect of bubbly plume flow, as well as oxygen absorption and oxidation reactions in slag eyes are considered. The thermodynamic and kinetic modification coefficients are proposed to fit the measured data, respectively. Finally, the effects of slag basicity and gas flow rate on the desulfurization efficiency are investigated. The results show that as the interfacial reactions (Al2O3)-(FeO)-(SiO2)-(MnO)-[S]-[O] simultaneous kinetic equilibrium is adopted to determine the oxygen activity, and the Young's model with the modification coefficient R th of 1.5 is adopted to determine slag sulfide capacity, the predicted sulfur distribution ratio LS agrees well with the measured data. With an increase of the gas blowing time, the predicted desulfurization rate gradually decreased, and when the modification parameter R k is 0.8, the predicted sulfur content changing with time in ladle agrees well with the measured data. If the oxygen absorption and oxidation reactions in slag eyes are not considered in this model, then the sulfur removal rate in the ladle would be overestimated, and this trend would become more obvious with an increase of the gas flow rate and decrease of the slag layer height. With the slag basicity increasing, the total desulfurization ratio increases; however, the total desulfurization ratio changes weakly as the slag basicity exceeds 7. With the increase of the gas flow rate, the desulfurization ratio first increases and then decreases. When the gas flow rate is 200 NL/min, the desulfurization ratio reaches a maximum value in an 80-ton gas-stirred ladle.

  10. CFD-model of the mass transfer in the vertical settler

    Directory of Open Access Journals (Sweden)

    E. K. Nagornaya

    2013-02-01

    Full Text Available Purpose. Nowadays the mathematical models of the secondary settlers are intensively developed. As a rule the engineers use the 0-D models or 1-D models to design settlers. But these models do not take into account the hydrodynamics process inside the settler and its geometrical form. That is why the CFD-models based on Navier - Stokes equations are not widely used in practice now. The use of CFD-models based on Navier - Stokes equations needs to incorporate very refine grid. It is very actually now to develop the CFD-models which permit to take into account the geometrical form of the settler, the most important physical processes and needs small computer time for calculation. That is why the development of the 2-D numerical model for the investigation of the waste waters transfer in the vertical settlers which permits to take into account the geometrical form and the constructive features of the settler is essential. Methodology. The finite - difference schemes are applied. Findings. The new 2-D-CFD-model was developed, which permits to perform the CFD investigation of the vertical settler. This model takes into account the geometrical form of the settler, the central pipe inside it and others peculiarities. The method of «porosity technique» is used to create the geometrical form of the settler in the numerical model. This technique permits to build any geometrical form of the settler for CFD investigation. Originality. Making of CFD-model which permits on the one hand to take into account the geometrical form of the settler, basic physical processes of mass transfer in construction and on the other hand requiring the low time cost in order to obtain results. Practical value. CFD-model is designed and code which is constructed on its basis allows at low cost of computer time and about the same as in the calculation of the 1-D model to solve complex multiparameter problems that arise during the design of vertical settlers with their shape and

  11. 基于CFD-DEM耦合并行算法的锥形喷动床内离散颗粒数值模拟%Numerical simulation of discrete particles in conical-base spouted bed based on parallel coupled CFD-DEM model

    Institute of Scientific and Technical Information of China (English)

    任立波; 韩吉田

    2014-01-01

    Based on MPI (Message Passing Interface)platform of FLUENT software,the parallel technique for coupled CFD (computational fluid dynamics)-DEM(discrete element method)model is implemented by user defined functions in the framework of secondary development,which has good scalability and acceleration performance with the increase of CPU number.The convergence of the governing equations is improved by constructing the void fraction scalar field and reorganizing the governing equations of the gas phase which follow the volume-averaged form of the two-fluid mod-el.Inter-particle and particle-wall interactions are determined with the soft-sphere model and the two phases are coupled based on the drag model.The parallel coupled CFD-DEM model is applied to the simulation of gas-particle two-phase flow in a conical-base spouted bed.Simulation results show that this model could well simulate gas-flow behavior in the spouted bed.Two distinct regions can be identified:the start-up and stable fluidization stage.In the stable fluidization stage,an oscillation cy-cle period can be observed,and the characteristics of the time-averaged particle velocity are obtained on the basis of the instantaneous particle velocity field.%基于 FLUENT 软件的 MPI 平台,在二次开发框架内通过用户自定义函数文件实现了CFD-DEM耦合并行算法。该并行算法具有随CPU核数增加的较佳扩展性能和良好加速性能。通过构建空隙率标量场、重组基于局部平均并考虑气固相互作用的气相控制方程,提高了气相控制方程的求解稳定性与收敛性;通过软球模型确定颗粒颗粒及颗粒壁面间的相互作用,以曳力模型为基础建立了相间相互作用关系。将该CFD-DEM耦合并行模型应用于锥形喷动床气固两相流动的数值模拟中,结果表明:该CFD-DEM耦合并行模型能较好地模拟锥形喷动床内气固流动行为;锥形喷动床内的颗粒流动经历了鼓泡阶段

  12. An asynchronous metamodel-assisted memetic algorithm for CFD-based shape optimization

    Science.gov (United States)

    Kontoleontos, Evgenia A.; Asouti, Varvara G.; Giannakoglou, Kyriakos C.

    2012-02-01

    This article presents an asynchronous metamodel-assisted memetic algorithm for the solution of CFD-based optimization problems. This algorithm is appropriate for use on multiprocessor platforms and may solve computationally expensive optimization problems in reduced wall-clock time, compared to conventional evolutionary or memetic algorithms. It is, in fact, a hybridization of non-generation-based (asynchronous) evolutionary algorithms, assisted by surrogate evaluation models, a local search method and the Lamarckian learning process. For the objective function gradient computation, in CFD applications, the adjoint method is used. Issues concerning the 'smart' implementation of local search in multi-objective problems are discussed. In this respect, an algorithmic scheme for reducing the number of calls to the adjoint equations to just one, irrespective of the number of objectives, is proposed. The algorithm is applied to the CFD-based shape optimization of the tubes of a heat exchanger and of a turbomachinery cascade.

  13. CFD model of multiphase flow in the abrasive water jet tool

    OpenAIRE

    Říha, Zdeněk

    2015-01-01

    The possibility of using CFD fluid flow modeling in area of tools with abrasive water jet is described in the paper. The correct function of such tool is based on proper setting of multiphase flow of water, air and solid particles in the inner space of the tool. The multiphase fluid flow numerical simulation can provide information which show relation between the geometry and the flow field. Then, this stable CFD model of multiphase flow creates key to design of the tool able to work wi...

  14. Global hydroelastic model for springing and whipping based on a free-surface CFD code (OpenFOAM

    Directory of Open Access Journals (Sweden)

    Seng Sopheak

    2014-12-01

    Full Text Available The theoretical background and a numerical solution procedure for a time domain hydroelastic code are presented in this paper. The code combines a VOF-based free surface flow solver with a flexible body motion solver where the body linear elastic deformation is described by a modal superposition of dry mode shapes expressed in a local floating frame of reference. These mode shapes can be obtained from any finite element code. The floating frame undergoes a pseudo rigid-body motion which allows for a large rigid body translation and rotation and fully preserves the coupling with the local structural deformation. The formulation relies on the ability of the flow solver to provide the total fluid action on the body including e.g. the viscous forces, hydrostatic and hydrodynamic forces, slamming forces and the fluid damping. A numerical simulation of a flexible barge is provided and compared to experiments to show that the VOF-based flow solver has this ability and the code has the potential to predict the global hydroelastic responses accurately.

  15. CFD Simulation of Nanosufur Crystallization Incorporating Population Balance Modeling

    OpenAIRE

    Fatemeh Golkhou; Mahmod Tajee Hamed Mosavian

    2013-01-01

    A physical vapor condensation process for synthesizing nanosized sulfur powder as a precursor for various industries was simulated by the use of computational ?uid dynamic (CFD) modeling. The phase change, swirl flow and heat transfer taking place inside the cyclone are analyzed along with particle formation via gas condensation method. The population balance model is a mathematical framework for the modeling of crystal size distribution (CSD) and the study of gas-phase changes leading to nuc...

  16. Comparison of mesh-based and particle-based CFD coupling with DEM

    CERN Document Server

    Markauskas, D; Sivanesapillai, R; Steeb, H

    2016-01-01

    A comparative study on mesh-based and particle-based computational fluid dynamics (CFD) coupling with a discrete element method (DEM) is presented. As the mesh-based CFD method a finite volume method (FVM) is used. A smoothed particle hydrodynamics (SPH) method represents particle-based CFD. An unresolved fluid model with locally averaged Navier-Stokes equations for the fluid is used. A newly developed model of boundary conditions for the SPH is described and the validation tests are performed. With the help of the performed comparative tests, the similarities and differences of particle movements in both DEM-FVM and DEM-SPH methods are discussed. Three test cases, namely a single particle sedimentation test, flow through a porous block and sedimentation of a porous block, are performed using DEM-FVM and DEM-SPH methods. The drag force acting onto the solid particles highly depends on the fluid fraction. To be able to compare both methods, the size of the cell in FVM is chosen to give the same fluid fraction ...

  17. CFD-based System Identification%基于CFD的系统辨识方法

    Institute of Scientific and Technical Information of China (English)

    孟庆龙; 官燕玲; 谢安生

    2011-01-01

    The principle of CFD (computational fluid dynamics) simulation and system identification were summarized, including the presentation of "grey-box" modeling method and steps of CFD-based system identification ; some applications in practice were analyzed to point out potential problems and its developing trends.%概述了计算流体力学(CFD)数值模拟和系统辨识的原理,详细阐述了基于CFD数值模拟的系统辨识“灰箱”建模方法的基本原理和实现步骤,对近几年该方法的应用案例进行分析,指出该建模方法存在的问题及发展方向.

  18. Euler-Lagrange CFD modelling of unconfined gas mixing in anaerobic digestion.

    Science.gov (United States)

    Dapelo, Davide; Alberini, Federico; Bridgeman, John

    2015-11-15

    A novel Euler-Lagrangian (EL) computational fluid dynamics (CFD) finite volume-based model to simulate the gas mixing of sludge for anaerobic digestion is developed and described. Fluid motion is driven by momentum transfer from bubbles to liquid. Model validation is undertaken by assessing the flow field in a labscale model with particle image velocimetry (PIV). Conclusions are drawn about the upscaling and applicability of the model to full-scale problems, and recommendations are given for optimum application.

  19. CFD simulation on hydrodynamics in fluidized beds: assessment of gradient approximations and turbulence models

    Science.gov (United States)

    Guo, Yuan; Deng, Baoqing; Ge, Daqiang; Shen, Xiuzhong

    2015-08-01

    CFD simulations of gas-solid fluidized beds have been performed in Euler-Euler framework. Green-Gauss Cell Based gradient approximation can predict the solid velocity well among gradient approximations. The dispersed choice in the turbulence model can reproduce the solid velocity correctly while the mixture and per phase choices cannot. The standard k-ɛ model, RNG k-ɛ model and SST k-ω model with the dispersed choice can predict the solid velocity well.

  20. Isothermal CFD-model of Peirce-Smith converting process

    Energy Technology Data Exchange (ETDEWEB)

    Vaarno, J.; Pitkaelae, J.; Ahokainen, T.; Jokilaakso, A.

    1997-12-31

    The Peirce-Smith converter has been a dominating copper and nickel matte refining process since 1905. Due to extremely difficult process conditions, very little measured data has been available for studying interactions of the gas injection and molten sulphide matte. Detailed information on fluid dynamics of the gas injection is needed in solving gas injection related problems like refractory wear, accretion growth and tuyere blockage as well as optimising the efficiency of momentum and mass transfer created by the gas jets. A commercial CFD-code PHOENICS was used to solve isothermal flow field of gas and liquid in a Peirce-Smith converter. An Euler-Euler based algorithm was chosen for modelling fluid dynamics and evaluating controlling forces of a submerged gas injection generally. Predictions were made with a {kappa}-{epsilon} turbulence model in the body fitted co-ordinate system. The model has been verified with a 1/4 scale water model, and a parametric study with the mathematical model of submerged gas injection was made for the PS-process and the ladle injection processes. Limits of the modelling technique used were recognised, but calculated results indicates that the present model predicts the general flow field with reasonable accuracy and it can be used as input for more detailed mathematical models of gas plumes. Predicted bubble distribution, pattern of the flow field and magnitude of flow velocities were also used to evaluate scaling factors of physical models and general flow conditions of an industrial PS-converter. (orig.) 28 refs.

  1. CFD DPAL modeling for various schemes of flow configurations

    Science.gov (United States)

    Waichman, Karol; Barmashenko, Boris D.; Rosenwaks, Salman

    2014-10-01

    Comprehensive analysis of kinetic and fluid dynamic processes in flowing-gas diode pumped alkali lasers (DPALs) using two- and three-dimensional computational fluid dynamics (2D and 3D CFD) models is reported for Cs DPALs. The models take into account effects of temperature rise and losses of alkali atoms due to ionization. Various gas flow regimes and transverse and parallel flow-optics directions configurations are studied. Optimization of the Cs DPAL parameters, using 3D CFD modeling, shows that applying high flow velocity and narrowband pumping, maximum lasing power as high as 40 kW can be obtained at pump power of 80 kW for transverse flow configuration in a pumped volume of ~ 0.7 cm3. At high pump power the calculated laser power is higher for the transverse scheme than for the parallel scheme because of a more efficient heat convection from the beam volume in the transverse configuration. The CFD models are applied to experimental devices and the calculated results are in good agreement with the measurements.

  2. CFD Modeling in Development of Renewable Energy Applications

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi

    2013-01-01

    Full Text Available Chapter 1: A Multi-fluid Model to Simulate Heat and Mass Transfer in a PEM Fuel Cell. Torsten Berning, Madeleine Odgaard, Søren K. Kær Chapter 2: CFD Modeling of a Planar Solid Oxide Fuel Cell (SOFC for Clean Power Generation. Meng Ni Chapter 3: Hydrodynamics and Hydropower in the New Paradigm for a Sustainable Engineering. Helena M. Ramos, Petra A. López-Jiménez Chapter 4: Opportunities for CFD in Ejector Solar Cooling. M. Dennis Chapter 5: Three Dimensional Modelling of Flow Field Around a Horizontal Axis Wind Turbine (HAWT. Chaouki Ghenai, Armen Sargsyan, Isam Janajreh Chapter 6: Scaling Rules for Hydrodynamics and Heat Transfer in Jetting Fluidized-Bed Biomass Gasifiers. K. Zhang, J. Chang, P. Pei, H. Chen, Y. Yang Chapter 7: Investigation of Low Reynolds Number Unsteady Flow around Airfoils in Pitching, Plunging and Flapping Motions. M.R. Amiralaei, H. Alighanbari, S.M. Hashemi Chapter 8: Justification of Computational Fluid Dynamics Simulation for Flat Plate Solar Energy Collector. Mohamed Selmi, Mohammed J. Al-Khawaja, Abdulhamid Marafia Chapter 9: Comparative Performance of a 3-Bladed Airfoil Chord H-Darrieus and a 3-Bladed Straight Chord H-Darrieus Turbines using CFD. R. Gupta, Agnimitra Biswas Chapter 10: Computational Fluid Dynamics for PEM Fuel Cell Modelling. A. Iranzo, F. Rosa Chapter 11: Analysis of the Performance of PEM Fuel Cells: Tutorial of Major Functional and Constructive Characteristics using CFD Analysis. P.J. Costa Branco, J.A. Dente Chapter 12: Application of Techniques of Computational Fluid Dynamics in the Design of Bipolar Plates for PEM Fuel Cells. A.P. Manso, F.F. Marzo, J. Barranco, M. Garmendia Mujika.

  3. CFD and FEM Model of an Underwater Vehicle Propeller

    OpenAIRE

    Chruściel Tadeusz; Ciba Ewelina; Dopke Julita

    2014-01-01

    Within the framework of the project for design and optimization of the Remotely Operated Vehicle (ROV), research on its propulsion has been carried out. Te entire project was supported by CFD and FEM calculations taking into account the characteristics of the underwater vehicle. One of the tasks was to optimize the semi-open duct for horizontal propellers, which provided propulsion and controllability in horizontal plane. In order to create a measurable model of this task it was necessary to ...

  4. A Quasi-One-Dimensional CFD Model for Multistage Turbomachines

    Institute of Scientific and Technical Information of China (English)

    Olivier Léonard; Olivier Adam

    2008-01-01

    The objective of this paper is to present a fast and reliable CFD model that is able to simulate stationary and transient operations of multistage compressors and turbines. This analysis tool is based on an adapted version of the Euler equations solved by a time-marching, finite-volume method. The Euler equations have been extended by including source terms expressing the blade-flow interactions. These source terms are determined using the velocity triangles and a row-by-row representation of the blading at mid-span. The losses and deviations undergone by the fluid across each blade row are supplied by correlations. The resulting flow solver is a performance prediction tool based only on the machine geometry, offering the possibility of exploring the entire characteristic map of a multistage compressor or turbine. Its efficiency in terms of CPU time makes it possible to couple it to an optimization algorithm or to a gas turbine performance tool. Different test-cases are presented for which the calculated characteristic maps are compared to experimental ones.

  5. New weighted sum of gray gases model applicable to Computational Fluid Dynamics (CFD) modeling of oxy-fuel combustion

    DEFF Research Database (Denmark)

    Yin, Chungen; Johansen, Lars Christian Riis; Rosendahl, Lasse;

    2010-01-01

    Radiation is the principal mode of heat transfer in furnaces. Models for gaseous radiative properties have been well established for air combustion. However, there is uncertainty regarding their applicability to oxy-fuel conditions. In this paper, a new and complete set of weighted sum of gray......), and the calculated results are validated in very details against data in literature. Then the validated code is used to generate emissivity databases for representative air-firing and oxy-firing conditions, for each of which a refined WSGGM with new parameters is derived. The practical way to implement the model...... into CFD simulations of combustion systems is given. Finally, as a demonstration, the new model is implemented into CFD modeling of two furnaces of very different beam lengths, respectively. The CFD results are compared with those based on the widely used WSGGM in literature, from which some useful...

  6. Modeling and verification of hemispherical solar still using ANSYS CFD

    Energy Technology Data Exchange (ETDEWEB)

    Panchal, Hitesh N. [KSV University, Gujarat Power Engineering and Research Institute, Mehsana (India); Shah, P.K. [Silver Oak College of Engineering and Technology, Ahmedabad, Gujarat (India)

    2013-07-01

    In every efficient solar still design, water temperature, vapor temperature and distillate output, and difference between water temperature and inner glass cover temperatures are very important. Here, two dimensional three phase model of hemispherical solar still is made for evaporation as well as condensation process in ANSYS CFD. Simulation results like water temperature, vapor temperature, distillate output compared with actual experimental results of climate conditions of Mehsana (latitude of 23° 59’ and longitude of 72° 38) of hemispherical solar still. Water temperature and distillate output were good agreement with actual experimental results. Study shows that ANSYS-CFD is very powerful as well as efficient tool for design, comparison purpose of hemispherical solar still.

  7. CFD simulation of direct contact condensation with ANSYS CFX using surface renewal theory based heat transfer coefficients

    Energy Technology Data Exchange (ETDEWEB)

    Wanninger, Andreas; Ceuca, Sabin Cristian; Macian-Juan, Rafael [Technische Univ. Muenchen, Garching (Germany). Dept. of Nuclear Engineering

    2013-07-01

    Different approaches for the calculation of Direct Contact Condensation (DCC) using Heat Transfer Coefficients (HTC) based on the Surface Renewal Theory (SRT) are tested using the CFD simulation tool ANSYS CFX. The present work constitutes a preliminary study of the flow patterns and conditions observed using different HTC models. A complex 3D flow pattern will be observed in the CFD simulations as well as a strong coupling between the condensation rate and the two-phase flow dynamics. (orig.)

  8. The numerical simulation based on CFD of hydraulic turbine pump

    Science.gov (United States)

    Duan, X. H.; Kong, F. Y.; Liu, Y. Y.; Zhao, R. J.; Hu, Q. L.

    2016-05-01

    As the functions of hydraulic turbine pump including self-adjusting and compensation with each other, it is far-reaching to analyze its internal flow by the numerical simulation based on CFD, mainly including the pressure field and the velocity field in hydraulic turbine and pump.The three-dimensional models of hydraulic turbine pump are made by Pro/Engineer software;the internal flow fields in hydraulic turbine and pump are simulated numerically by CFX ANSYS software. According to the results of the numerical simulation in design condition, the pressure field and the velocity field in hydraulic turbine and pump are analyzed respectively .The findings show that the static pressure decreases systematically and the pressure gradient is obvious in flow area of hydraulic turbine; the static pressure increases gradually in pump. The flow trace is regular in suction chamber and flume without spiral trace. However, there are irregular traces in the turbine runner channels which contrary to that in flow area of impeller. Most of traces in the flow area of draft tube are spiral.

  9. CFD Wake Modelling with a BEM Wind Turbine Sub-Model

    Directory of Open Access Journals (Sweden)

    Anders Hallanger

    2013-01-01

    Full Text Available Modelling of wind farms using computational fluid dynamics (CFD resolving the flow field around each wind turbine's blades on a moving computational grid is still too costly and time consuming in terms of computational capacity and effort. One strategy is to use sub-models for the wind turbines, and sub-grid models for turbulence production and dissipation to model the turbulent viscosity accurately enough to handle interaction of wakes in wind farms. A wind turbine sub-model, based on the Blade Momentum Theory, see Hansen (2008, has been implemented in an in-house CFD code, see Hallanger et al. (2002. The tangential and normal reaction forces from the wind turbine blades are distributed on the control volumes (CVs at the wind turbine rotor location as sources in the conservation equations of momentum. The classical k-epsilon turbulence model of Launder and Spalding (1972 is implemented with sub-grid turbulence (SGT model, see Sha and Launder (1979 and Sand and Salvesen (1994. Steady state CFD simulations were compared with flow and turbulence measurements in the wake of a model scale wind turbine, see Krogstad and Eriksen (2011. The simulated results compared best with experiments when stalling (boundary layer separation on the wind turbine blades did not occur. The SGT model did improve turbulence level in the wake but seems to smear the wake flow structure. It should be noted that the simulations are carried out steady state not including flow oscillations caused by vortex shedding from tower and blades as they were in the experiments. Further improvement of the simulated velocity defect and turbulence level seems to rely on better parameter estimation to the SGT model, improvements to the SGT model, and possibly transient- instead of steady state simulations.

  10. A Multi-Model Approach for Uncertainty Propagation and Model Calibration in CFD Applications

    CERN Document Server

    Wang, Jian-xun; Xiao, Heng

    2015-01-01

    Proper quantification and propagation of uncertainties in computational simulations are of critical importance. This issue is especially challenging for CFD applications. A particular obstacle for uncertainty quantifications in CFD problems is the large model discrepancies associated with the CFD models used for uncertainty propagation. Neglecting or improperly representing the model discrepancies leads to inaccurate and distorted uncertainty distribution for the Quantities of Interest. High-fidelity models, being accurate yet expensive, can accommodate only a small ensemble of simulations and thus lead to large interpolation errors and/or sampling errors; low-fidelity models can propagate a large ensemble, but can introduce large modeling errors. In this work, we propose a multi-model strategy to account for the influences of model discrepancies in uncertainty propagation and to reduce their impact on the predictions. Specifically, we take advantage of CFD models of multiple fidelities to estimate the model ...

  11. CFD based draft tube hydraulic design optimization

    Science.gov (United States)

    McNabb, J.; Devals, C.; Kyriacou, S. A.; Murry, N.; Mullins, B. F.

    2014-03-01

    The draft tube design of a hydraulic turbine, particularly in low to medium head applications, plays an important role in determining the efficiency and power characteristics of the overall machine, since an important proportion of the available energy, being in kinetic form leaving the runner, needs to be recovered by the draft tube into static head. For large units, these efficiency and power characteristics can equate to large sums of money when considering the anticipated selling price of the energy produced over the machine's life-cycle. This same draft tube design is also a key factor in determining the overall civil costs of the powerhouse, primarily in excavation and concreting, which can amount to similar orders of magnitude as the price of the energy produced. Therefore, there is a need to find the optimum compromise between these two conflicting requirements. In this paper, an elaborate approach is described for dealing with this optimization problem. First, the draft tube's detailed geometry is defined as a function of a comprehensive set of design parameters (about 20 of which a subset is allowed to vary during the optimization process) and are then used in a non-uniform rational B-spline based geometric modeller to fully define the wetted surfaces geometry. Since the performance of the draft tube is largely governed by 3D viscous effects, such as boundary layer separation from the walls and swirling flow characteristics, which in turn governs the portion of the available kinetic energy which will be converted into pressure, a full 3D meshing and Navier-Stokes analysis is performed for each design. What makes this even more challenging is the fact that the inlet velocity distribution to the draft tube is governed by the runner at each of the various operating conditions that are of interest for the exploitation of the powerhouse. In order to determine these inlet conditions, a combined steady-state runner and an initial draft tube analysis, using a

  12. CFD based draft tube hydraulic design optimization

    International Nuclear Information System (INIS)

    The draft tube design of a hydraulic turbine, particularly in low to medium head applications, plays an important role in determining the efficiency and power characteristics of the overall machine, since an important proportion of the available energy, being in kinetic form leaving the runner, needs to be recovered by the draft tube into static head. For large units, these efficiency and power characteristics can equate to large sums of money when considering the anticipated selling price of the energy produced over the machine's life-cycle. This same draft tube design is also a key factor in determining the overall civil costs of the powerhouse, primarily in excavation and concreting, which can amount to similar orders of magnitude as the price of the energy produced. Therefore, there is a need to find the optimum compromise between these two conflicting requirements. In this paper, an elaborate approach is described for dealing with this optimization problem. First, the draft tube's detailed geometry is defined as a function of a comprehensive set of design parameters (about 20 of which a subset is allowed to vary during the optimization process) and are then used in a non-uniform rational B-spline based geometric modeller to fully define the wetted surfaces geometry. Since the performance of the draft tube is largely governed by 3D viscous effects, such as boundary layer separation from the walls and swirling flow characteristics, which in turn governs the portion of the available kinetic energy which will be converted into pressure, a full 3D meshing and Navier-Stokes analysis is performed for each design. What makes this even more challenging is the fact that the inlet velocity distribution to the draft tube is governed by the runner at each of the various operating conditions that are of interest for the exploitation of the powerhouse. In order to determine these inlet conditions, a combined steady-state runner and an initial draft tube analysis

  13. Development of a three-dimensional CFD model for rotary lime kilns

    Energy Technology Data Exchange (ETDEWEB)

    Lixin Tao; Blom, Roger (FS Dynamics Sweden AB, Goeteborg (Sweden)); Nordgren, Daniel (Innventia, Stockholm (Sweden))

    2010-11-15

    In the calcium loop of the recovery cycle in a Kraft process of pulp and paper production, rotary lime kilns are used to convert the lime mud, mainly CaCO3, back to quick lime, CaO, for re-use in the causticizing process. The lime kilns are one of the major energy consumption devices for paper and pulp industry. Because of the rising oil price and new emission limits, the pulp mills have been forced to look for alternative fuels for their lime kilns. One interesting alternative to oil, often easily available at pulp mills, is biofuels such as sawdust and bark. However the practical kiln operation often encounters some difficulties because of the uncertainties around the biofuel impact on the lime kiln performance. A deeper understanding of the flame characteristics is required when shifting from oil to biofuels. Fortunately recent advances in modern Computational Fluid Dynamics, CFD, have provided the possibility to study and predict the detailed flame characteristics regarding the lime kiln performance. In this project a three-dimensional CFD model for rotary lime kilns has been developed. To simulate a rotary lime kiln the developed CFD model integrates the three essential sub-models, i.e. the freeboard hot flow model, the lime bed model and the rotating refractory wall model and it is developed based on the modern CFD package: FLUENT which is commercially available on the market. The numerical simulations using the developed CFD model have been performed for three selected kiln operations fired with three different fuel mixtures. The predicted results from the CFD modelling are presented and discussed in order to compare the impacts on the kiln performance due to the different firing conditions. During the development, the lime kiln at the Soedra Cell Moensteraas mill has been used as reference kiln. To validate the CFD model, in-plant measurements were carried out in the Moensteraas lime kiln during an experiment campaign. The results obtained from the

  14. CFD Based Study of Heterogeneous Microclimate in a Typical Chinese Greenhouse in Central China

    Institute of Scientific and Technical Information of China (English)

    WANG Xiao-wei; LUO Jin-yao; LI Xiao-ping

    2013-01-01

    Indoor microclimate is important for crop production and quality in greenhouse cultivation. This paper focuses on microclimate study based on a computational fluid dynamics (CFD) model of a typical plastic greenhouse (with a sector shape vertical cross-section) popularly used in central China. A radiation model is added into the CFD model so as to simulate coupling of convective transfers and radiative exchanges at the cover and the roof, instead of using the usual coupling approach based on energy balance. In addition, a fractal permeability model is innovatively adopted in the modeling of the crop canopy. Compared the numerical results with measured experimental data, the model simulation is proved with success. This model then is used to explore the microclimate variable distributions in the greenhouse. It shows that the airflow pattern, temperature and humidity profiles are different from those in a sawtooth Mediterranean-type greenhouse. The study suggests that this deliberately developed CFD model can be served as a useful tool in macroclimate research and greenhouse design investigating.

  15. CFD Modelling of Abdominal Aortic Aneurysm on Hemodynamic Loads Using a Realistic Geometry with CT

    Directory of Open Access Journals (Sweden)

    Eduardo Soudah

    2013-01-01

    Full Text Available The objective of this study is to find a correlation between the abdominal aortic aneurysm (AAA geometric parameters, wall stress shear (WSS, abdominal flow patterns, intraluminal thrombus (ILT, and AAA arterial wall rupture using computational fluid dynamics (CFD. Real AAA 3D models were created by three-dimensional (3D reconstruction of in vivo acquired computed tomography (CT images from 5 patients. Based on 3D AAA models, high quality volume meshes were created using an optimal tetrahedral aspect ratio for the whole domain. In order to quantify the WSS and the recirculation inside the AAA, a 3D CFD using finite elements analysis was used. The CFD computation was performed assuming that the arterial wall is rigid and the blood is considered a homogeneous Newtonian fluid with a density of 1050 kg/m3 and a kinematic viscosity of 4×10-3 Pa·s. Parallelization procedures were used in order to increase the performance of the CFD calculations. A relation between AAA geometric parameters (asymmetry index (β, saccular index (γ, deformation diameter ratio (χ, and tortuosity index (ε and hemodynamic loads was observed, and it could be used as a potential predictor of AAA arterial wall rupture and potential ILT formation.

  16. Validation of CFD-models for non-stoichiometric oxycoal combustion

    Energy Technology Data Exchange (ETDEWEB)

    Bohn, Jan-Peter; Goanta, Adrian; Baumgartner, Andreas; Blume, Maximilian; Spliethoff, Hartmut [Technische Univ. Muenchen, Garching (Germany). Inst. of Energy Systems

    2013-07-01

    To compensate the drawback of high flue gas recirculation rates specific for oxyfuel processes, a new concept based on staged combustion, called controlled staging with non-stoichiometric burners (CSNB) was investigated. A combination of over- and sub-stoichiometric burners avoids inadmissible high flame temperatures even with oxygen concentrations up to 40 vol.-% in the oxidant. The non-stoichiometric burners are arranged in such a way that the overall stoichiometry at the combustion chamber outlet is slightly over-stoichiometric similar to conventional combustion processes, so that full burn out is secured. This concept aims at a more efficient oxyfuel process due to the decreasing effort in the recirculation loop and a new designed, more cost effective, steam generator. For further process optimization of the CSNB concept and the adjacent steam generator layout are validated CFD simulations urgently required. This paper shows first steps in validation of the CSNB combustion concept against state of the art CFD codes. The CFD code was optimized for oxyfuel combustion including a new char combustion and gas radiation model. Experimental investigations and CFD modelling are showing good agreement in concerns of temperature, CO and CO{sub 2} profiles. However the prediction of the oxygen concentration differs significantly between experiment and simulation.

  17. CFD Modelling of Abdominal Aortic Aneurysm on Hemodynamic Loads Using a Realistic Geometry with CT

    Science.gov (United States)

    Ng, E. Y. K.; Loong, T. H.; Bordone, Maurizio; Pua, Uei; Narayanan, Sriram

    2013-01-01

    The objective of this study is to find a correlation between the abdominal aortic aneurysm (AAA) geometric parameters, wall stress shear (WSS), abdominal flow patterns, intraluminal thrombus (ILT), and AAA arterial wall rupture using computational fluid dynamics (CFD). Real AAA 3D models were created by three-dimensional (3D) reconstruction of in vivo acquired computed tomography (CT) images from 5 patients. Based on 3D AAA models, high quality volume meshes were created using an optimal tetrahedral aspect ratio for the whole domain. In order to quantify the WSS and the recirculation inside the AAA, a 3D CFD using finite elements analysis was used. The CFD computation was performed assuming that the arterial wall is rigid and the blood is considered a homogeneous Newtonian fluid with a density of 1050 kg/m3 and a kinematic viscosity of 4 × 10−3 Pa·s. Parallelization procedures were used in order to increase the performance of the CFD calculations. A relation between AAA geometric parameters (asymmetry index (β), saccular index (γ), deformation diameter ratio (χ), and tortuosity index (ε)) and hemodynamic loads was observed, and it could be used as a potential predictor of AAA arterial wall rupture and potential ILT formation. PMID:23864906

  18. CFD Modelling of Abdominal Aortic Aneurysm on Hemodynamic Loads Using a Realistic Geometry with CT

    OpenAIRE

    Loong, T. H.; Maurizio Bordone; Uei Pua; Sriram Narayanan; Eduardo Soudah; E. Y. K. Ng

    2013-01-01

    The objective of this study is to find a correlation between the abdominal aortic aneurysm (AAA) geometric parameters, wall stress shear (WSS), abdominal flow patterns, intraluminal thrombus (ILT), and AAA arterial wall rupture using computational fluid dynamics (CFD). Real AAA 3D models were created by three-dimensional (3D) reconstruction of in vivo acquired computed tomography (CT) images from 5 patients. Based on 3D AAA models, high quality volume meshes were created using an optimal tetr...

  19. Improved similarity criterion for seepage erosion using mesoscopic coupled PFC-CFD model

    Institute of Scientific and Technical Information of China (English)

    倪小东; 王媛; 陈珂; 赵帅龙

    2015-01-01

    Conventional model tests and centrifuge tests are frequently used to investigate seepage erosion. However, the centrifugal test method may not be efficient according to the results of hydraulic conductivity tests and piping erosion tests. The reason why seepage deformation in model tests may deviate from similarity was first discussed in this work. Then, the similarity criterion for seepage deformation in porous media was improved based on the extended Darcy-Brinkman-Forchheimer equation. Finally, the coupled particle flow code–computational fluid dynamics (PFC−CFD) model at the mesoscopic level was proposed to verify the derived similarity criterion. The proposed model maximizes its potential to simulate seepage erosion via the discrete element method and satisfy the similarity criterion by adjusting particle size. The numerical simulations achieved identical results with the prototype, thus indicating that the PFC−CFD model that satisfies the improved similarity criterion can accurately reproduce the processes of seepage erosion at the mesoscopic level.

  20. CFD modeling of sodium spray combustion

    International Nuclear Information System (INIS)

    A sodium cooled fast reactor is one of the attractive concept for the IVth generation advanced reactor designs. For the safety of a sodium cooled fast reactor, sodium-air and sodium-water reactions must be avoided. A sodium-air reaction typically occurs in two dominant modes, namely the spray fire and pool fire. The focus of the paper will be on spray fires. To avoid sodium-air accidents and to mitigate the consequences if a sodium fire occurs, it is essential to understand all the physical phenomena involved in sodium spray combustion. Numerical modeling is one of the methods, which can be used to understand all the physics involved. The goal of the work presented in this paper is to propose a numerical method to simulate sodium spray combustion and to validate this method against experiments. Free falling single droplet sodium spray combustion experiments are used as a validation case for the proposed numerical method. The trend obtained using our numerical simulations matches well with the experimental data. Further validation needs to be performed, before the presented modeling can be used for sodium fast reactor safety analyses. (author)

  1. CFD modeling of dust dispersion through Najaf historic city centre

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi

    2014-01-01

    Full Text Available The aim of this project is to study the influences of the wind flow and dust particles dispersion through Najaf historic city centre. Two phase Computational Fluid Dynamics (CFD model using a Reynolds Average Navier Stokes (RANS equations has been used to simulate the wind flow and the transport and dispersion of the dust particles through the historic city centre. This work may provide useful insight to urban designers and planners interested in examining the variation of city breathability as a local dynamic morphological parameter with the local building packing density.

  2. CFD Modeling of Particulate Matter Dispersion from Kerman Cement Plant

    Directory of Open Access Journals (Sweden)

    M. Panahandeh

    2010-04-01

    Full Text Available "n "n "nBackgrounds and Objectives: The dispersion of particulate matter has been known as the most serious environmental pollution of cement plants. In the present work, dispersion of the particulate matter from stack of Kerman Cement Plant was investigated using Computational Fluid Dynamics (CFD modeling."nMaterials and Methods: In order to study the dispersion of particulate matter from the stack, a calculation domain with dimensions of 8000m × 800m × 400m was considered. The domain was divided to 936781 tetrahedral control volumes. The mixture two-phase model was employed to model the interaction of the particulate matter (dispersed phase and air (continuous phase. The Large Eddy Simulation (LES method was used for turbulence modeling."nResults: The concentration of particulate matter in the whole calculation domain was computed. The predicted concentrations were compared to the measured values from the literature and a good agreement was observed. The predicted concentration profiles at different cross sections were analyzed."nConclusion:The results of the present work showed that CFD is a useful tool for understanding the dispersion of particulate matter in air. Although the obtained results were promising, more investigations on the properties of the dispersed phase, turbulent parameters and the boundary layer effect is needed to obtain more accurate results.

  3. Integration of CFD codes and advanced combustion models for quantitative burnout determination

    Energy Technology Data Exchange (ETDEWEB)

    Javier Pallares; Inmaculada Arauzo; Alan Williams [University of Zaragoza, Zaragoza (Spain). Centre of Research for Energy Resources and Consumption (CIRCE)

    2007-10-15

    CFD codes and advanced kinetics combustion models are extensively used to predict coal burnout in large utility boilers. Modelling approaches based on CFD codes can accurately solve the fluid dynamics equations involved in the problem but this is usually achieved by including simple combustion models. On the other hand, advanced kinetics combustion models can give a detailed description of the coal combustion behaviour by using a simplified description of the flow field, this usually being obtained from a zone-method approach. Both approximations describe correctly general trends on coal burnout, but fail to predict quantitative values. In this paper a new methodology which takes advantage of both approximations is described. In the first instance CFD solutions were obtained of the combustion conditions in the furnace in the Lamarmora power plant (ASM Brescia, Italy) for a number of different conditions and for three coals. Then, these furnace conditions were used as inputs for a more detailed chemical combustion model to predict coal burnout. In this, devolatilization was modelled using a commercial macromolecular network pyrolysis model (FG-DVC). For char oxidation an intrinsic reactivity approach including thermal annealing, ash inhibition and maceral effects, was used. Results from the simulations were compared against plant experimental values, showing a reasonable agreement in trends and quantitative values. 28 refs., 4 figs., 4 tabs.

  4. A CFD model of the wake of an offshore wind farm: Using a prescribed wake inflow

    DEFF Research Database (Denmark)

    Réthoré, P.-E.; Bechmann, Andreas; Sørensen, Niels N.;

    2007-01-01

      An CFD model of the wake of an offshore wind farm, expanding existing measurements is proposed. The method is based on solving the Navier Stokes equation in a large domain downstream an offshore wind farm. The inflow of the domain is estimated using existing met mast measurements from both free...... stream and directly in-wake conditions. A comparison between the simulation results and measurements from a met mast are presented and the shortcomings of the methods are discussed.  ...

  5. CFD modeling of multiphase reacting flow in blast furnace shaft with layered burden

    International Nuclear Information System (INIS)

    The ironmaking blast furnace is a counter-current chemical reactor which includes the ascending gas flow and the counter-current descending porous bed (burden). A Computational Fluid Dynamics (CFD) model has been developed to simulate the multiphase reacting flow in blast furnace shaft. The gas flow dynamics, burden movement, chemical reactions, heat and mass transfer between the gas phase and burden phase are included in the CFD model. The blast furnace burden consists of alternative layers of iron ore and coke. A novel methodology is proposed to efficiently model the effects of alternative burden layer structure on gas flow, heat transfer, mass transfer and chemical reactions. Different reactions and heat transfer characteristics are applied for difference types of layer. In addition, the layered CFD model accurately predicts the Cohesive Zone (CZ) shape where the melting of solid burden taking place. The shape and location of the CZ are determined by an iterative method based on the ore temperature distribution. The theoretical formation and the methodology of the CFD model are presented and the model is applied to simulate industry blast furnaces. The proposed method can be applied to investigate the blast furnace shaft process and other moving bed system with periodic burden structure configuration. - Highlights: •A novel methodology is proposed to efficiently model the blast furnace shaft with layered burden. •The effects of layered burden on flow, heat transfer, and chemical reactions are considered in the model. •The shape and location of the cohesive zone is determined by an iterative method

  6. A Study on the Role of Reaction Modeling in Multi-phase CFD-based Simulations of Chemical Looping Combustion Impact du modèle de réaction sur les simulations CFD de la combustion en boucle chimique

    Directory of Open Access Journals (Sweden)

    Kruggel-Emden H.

    2011-03-01

    Full Text Available Chemical Looping Combustion is an energy efficient combustion technology for the inherent separation of carbon dioxide for both gaseous and solid fuels. For scale up and further development of this process multi-phase CFD-based simulations have a strong potential which rely on kinetic models for the solid/gaseous reactions. Reaction models are usually simple in structure in order to keep the computational cost low. They are commonly derived from thermogravimetric experiments. With only few CFD-based simulations performed on chemical looping combustion, there is a lack in understanding of the role and of the sensitivity of the applied chemical reaction model on the outcome of a simulation. The aim of this investigation is therefore the study of three different carrier materials CaSO4, Mn3O4 and NiO with the gaseous fuels H2 and CH4 in a batch type reaction vessel. Four reaction models namely the linear shrinking core, the spherical shrinking core, the Avrami-Erofeev and a recently proposed multi parameter model are applied and compared on a case by case basis. La combustion en boucle chimique (Chemical Looping Combustion est une technologie de combustion efficace permettant le captage in situ du CO2 pour des charges gazeuses ou solides. Dans l’optique du développement et de l’extrapolation du procédé, la CFD est un outil de simulation à fort potentiel qui s’appuie notamment sur des modèles cinétiques pour décrire les réactions gaz-solide. Ces modèles décrivant les réactions sont généralement assez simples pour limiter les temps de simulation et sont obtenus à partir d’expérimentations en thermobalance. Il y a encore peu de travaux de modélisation CFD du procédé CLC et il est difficile d’estimer l’importance du modèle décrivant les réactions chimiques sur les résultats des simulations. Le but de ce travail est donc d’étudier la combustion de charges gazeuses H2 et CH4 dans des réacteurs en batch en consid

  7. Lime Kiln Modeling. CFD and One-dimensional simulations

    Energy Technology Data Exchange (ETDEWEB)

    Svedin, Kristoffer; Ivarsson, Christofer; Lundborg, Rickard

    2009-03-15

    The incentives for burning alternative fuels in lime kilns are growing. An increasing demand on thorough investigations of alternative fuel impact on lime kiln performance have been recognized, and the purpose of this project has been to develop a lime kiln CFD model with the possibility to fire fuel oil and lignin. The second part of the project consists of three technical studies. Simulated data from a one-dimensional steady state program has been used to support theories on the impact of biofuels and lime mud dryness. The CFD simulations was carried out in the commercial code FLUENT. Due to difficulties with the convergence of the model the calcination reaction is not included. The model shows essential differences between the two fuels. Lignin gives a different flame shape and a longer flame length compared to fuel oil. Mainly this depends on how the fuel is fed into the combustion chamber and how much combustion air that is added as primary and secondary air. In the case of lignin combustion the required amount of air is more than in the fuel oil case. This generates more combustion gas and a different flow pattern is created. Based on the values from turbulent reaction rate for the different fuels an estimated flame length can be obtained. For fuel oil the combustion is very intense with a sharp peak in the beginning and a rapid decrease. For lignin the combustion starts not as intense as for the fuel oil case and has a smoother shape. The flame length appears to be approximately 2-3 meter longer for lignin than for fuel oil based on turbulent reaction rate in the computational simulations. The first technical study showed that there are many benefits of increasing dry solids content in the lime mud going into a kiln such as increased energy efficiency, reduced TRS, and reduced sodium in the kiln. However, data from operating kilns indicates that these benefits can be offset by increasing exit gas temperature that can limit kiln production capacity. Simulated

  8. Validation of NEPTUNE-CFD two-phase flow models using experimental data

    OpenAIRE

    Jorge Pérez Mañes; Victor Hugo Sánchez Espinoza; Sergio Chiva Vicent; Michael Böttcher; Robert Stieglitz

    2014-01-01

    This paper deals with the validation of the two-phase flow models of the CFD code NEPTUNEC-CFD using experimental data provided by the OECD BWR BFBT and PSBT Benchmark. Since the two-phase models of CFD codes are extensively being improved, the validation is a key step for the acceptability of such codes. The validation work is performed in the frame of the European NURISP Project and it was focused on the steady state and transient void fraction tests. The influence of different NEPTUNE-CFD ...

  9. Numerical modelling of pressure suppression pools with CFD and FEM codes

    Energy Technology Data Exchange (ETDEWEB)

    Paettikangas, T.; Niemi, J.; Timperi, A. (VTT Technical Research Centre of Finland (Finland))

    2011-06-15

    Experiments on large-break loss-of-coolant accident for BWR is modeled with computational fluid (CFD) dynamics and finite element calculations. In the CFD calculations, the direct-contact condensation in the pressure suppression pool is studied. The heat transfer in the liquid phase is modeled with the Hughes-Duffey correlation based on the surface renewal model. The heat transfer is proportional to the square root of the turbulence kinetic energy. The condensation models are implemented with user-defined functions in the Euler-Euler two-phase model of the Fluent 12.1 CFD code. The rapid collapse of a large steam bubble and the resulting pressure source is studied analytically and numerically. Pressure source obtained from simplified calculations is used for studying the structural effects and FSI in a realistic BWR containment. The collapse results in volume acceleration, which induces pressure loads on the pool walls. In the case of a spherical bubble, the velocity term of the volume acceleration is responsible of the largest pressure load. As the amount of air in the bubble is decreased, the peak pressure increases. However, when the water compressibility is accounted for, the finite speed of sound becomes a limiting factor. (Author)

  10. Two Phase Flow Models and Numerical Methods of the Commercial CFD Codes

    Energy Technology Data Exchange (ETDEWEB)

    Bae, Sung Won; Jeong, Jae Jun; Chang, Seok Kyu; Cho, Hyung Kyu

    2007-11-15

    The use of commercial CFD codes extend to various field of engineering. The thermal hydraulic analysis is one of the promising engineering field of application of the CFD codes. Up to now, the main application of the commercial CFD code is focused within the single phase, single composition fluid dynamics. Nuclear thermal hydraulics, however, deals with abrupt pressure changes, high heat fluxes, and phase change heat transfer. In order to overcome the CFD limitation and to extend the capability of the nuclear thermal hydraulics analysis, the research efforts are made to collaborate the CFD and nuclear thermal hydraulics. To achieve the final goal, the current useful model and correlations used in commercial CFD codes should be reviewed and investigated. This report gives the summary information about the constitutive relationships that are used in the FLUENT, STAR-CD, and CFX. The brief information of the solution technologies are also enveloped.

  11. Two Phase Flow Models and Numerical Methods of the Commercial CFD Codes

    International Nuclear Information System (INIS)

    The use of commercial CFD codes extend to various field of engineering. The thermal hydraulic analysis is one of the promising engineering field of application of the CFD codes. Up to now, the main application of the commercial CFD code is focused within the single phase, single composition fluid dynamics. Nuclear thermal hydraulics, however, deals with abrupt pressure changes, high heat fluxes, and phase change heat transfer. In order to overcome the CFD limitation and to extend the capability of the nuclear thermal hydraulics analysis, the research efforts are made to collaborate the CFD and nuclear thermal hydraulics. To achieve the final goal, the current useful model and correlations used in commercial CFD codes should be reviewed and investigated. This report gives the summary information about the constitutive relationships that are used in the FLUENT, STAR-CD, and CFX. The brief information of the solution technologies are also enveloped

  12. CFD Simulation of Nanosufur Crystallization Incorporating Population Balance Modeling

    Directory of Open Access Journals (Sweden)

    Fatemeh Golkhou

    2013-01-01

    Full Text Available A physical vapor condensation process for synthesizing nanosized sulfur powder as a precursor for various industries was simulated by the use of computational ?uid dynamic (CFD modeling. The phase change, swirl flow and heat transfer taking place inside the cyclone are analyzed along with particle formation via gas condensation method. The population balance model is a mathematical framework for the modeling of crystal size distribution (CSD and the study of gas-phase changes leading to nucleation of the first solid particles. In this paper the Direct Quadrature Method of Moments is used for solving the transport equations of the moments of the size distribution. The temperature, velocity and particle size distribution ranges inside the cyclone were computed. The results show the formation of nanosulfur particles in 1-7 nm range.

  13. CFD-aided modelling of activated sludge systems - A critical review.

    Science.gov (United States)

    Karpinska, Anna M; Bridgeman, John

    2016-01-01

    Nowadays, one of the major challenges in the wastewater sector is the successful design and reliable operation of treatment processes, which guarantee high treatment efficiencies to comply with effluent quality criteria, while keeping the investment and operating cost as low as possible. Although conceptual design and process control of activated sludge plants are key to ensuring these goals, they are still based on general empirical guidelines and operators' experience, dominated often by rule of thumb. This review paper discusses the rationale behind the use of Computational Fluid Dynamics (CFD) to model aeration, facilitating enhancement of treatment efficiency and reduction of energy input. Several single- and multiphase approaches commonly used in CFD studies of aeration tank operation, are comprehensively described, whilst the shortcomings of the modelling assumptions imposed to evaluate mixing and mass transfer in AS tanks are identified and discussed. Examples and methods of coupling of CFD data with biokinetics, accounting for the actual flow field and its impact on the oxygen mass transfer and yield of the biological processes occurring in the aeration tanks, are also critically discussed. Finally, modelling issues, which remain unaddressed, (e.g. coupling of the AS tank with secondary clarifier and the use of population balance models to simulate bubbly flow or flocculation of the activated sludge), are also identified and discussed. PMID:26615385

  14. Wind Loads on Ships and Offshore Structures Determined by Model Tests, CFD and Full-Scale Measurements

    DEFF Research Database (Denmark)

    Aage, Christian

    1998-01-01

    be validated systematically against full-scale measurements, but due to the great practical difficulties involved, this is almost never done. In this investigation, wind loads on a seagoing ferry and on a semisubmersible platform have been determined by model tests and by CFD. On the ferry, full......Wind loads on ships and offshore structures have until recently been determined only by model tests, or by statistical methods based on model tests. By the development of Computational Fluid Dynamics or CFD there is now a realistic computational alternative. In principle, both methods should......-scale measurements have been carried out as well. The CFD method also offers the possibility of a computational estimate of scale effects related to wind tunnel model testing. An example of such an estimate on the ferry is discussed. This work has been published in more details in Proceedings of BOSS'97, Aage et al...

  15. Data-Driven CFD Modeling of Turbulent Flows Through Complex Structures

    CERN Document Server

    Wang, Jian-Xun

    2016-01-01

    The growth of computational resources in the past decades has expanded the application of Computational Fluid Dynamics (CFD) from the traditional fields of aerodynamics and hydrodynamics to a number of new areas. Examples range from the heat and fluid flows in nuclear reactor vessels and in data centers to the turbulence flows through wind turbine farms and coastal vegetation plants. However, in these new applications complex structures are often exist (e.g., rod bundles in reactor vessels and turbines in wind farms), which makes fully resolved, first-principle based CFD modeling prohibitively expensive. This obstacle seriously impairs the predictive capability of CFD models in these applications. On the other hand, a limited amount of measurement data is often available in the systems in the above-mentioned applications. In this work we propose a data-driven, physics-based approach to perform full field inversion on the effects of the complex structures on the flow. This is achieved by assimilating observati...

  16. Engineering-Based Thermal CFD Simulations on Massive Parallel Systems

    KAUST Repository

    Frisch, Jérôme

    2015-05-22

    The development of parallel Computational Fluid Dynamics (CFD) codes is a challenging task that entails efficient parallelization concepts and strategies in order to achieve good scalability values when running those codes on modern supercomputers with several thousands to millions of cores. In this paper, we present a hierarchical data structure for massive parallel computations that supports the coupling of a Navier–Stokes-based fluid flow code with the Boussinesq approximation in order to address complex thermal scenarios for energy-related assessments. The newly designed data structure is specifically designed with the idea of interactive data exploration and visualization during runtime of the simulation code; a major shortcoming of traditional high-performance computing (HPC) simulation codes. We further show and discuss speed-up values obtained on one of Germany’s top-ranked supercomputers with up to 140,000 processes and present simulation results for different engineering-based thermal problems.

  17. Engineering-Based Thermal CFD Simulations on Massive Parallel Systems

    Directory of Open Access Journals (Sweden)

    Jérôme Frisch

    2015-05-01

    Full Text Available The development of parallel Computational Fluid Dynamics (CFD codes is a challenging task that entails efficient parallelization concepts and strategies in order to achieve good scalability values when running those codes on modern supercomputers with several thousands to millions of cores. In this paper, we present a hierarchical data structure for massive parallel computations that supports the coupling of a Navier–Stokes-based fluid flow code with the Boussinesq approximation in order to address complex thermal scenarios for energy-related assessments. The newly designed data structure is specifically designed with the idea of interactive data exploration and visualization during runtime of the simulation code; a major shortcoming of traditional high-performance computing (HPC simulation codes. We further show and discuss speed-up values obtained on one of Germany’s top-ranked supercomputers with up to 140,000 processes and present simulation results for different engineering-based thermal problems.

  18. CFD modelling of subcooled flow boiling for nuclear engineering applications

    International Nuclear Information System (INIS)

    In this work a general-purpose CFD code CFX-5 was used for simulations of subcooled flow boiling. The subcooled boiling model, available in a custom version of CFX-5, uses a special treatment of the wall boiling boundary, which assures the grid invariant solution. The simulation results have been validated against the published experimental data [1] of high-pressure flow boiling in a vertical pipe covering a wide range of conditions (relevant to the pressurized water reactor). In general, a good agreement with the experimental data has been achieved. To adequately predict the lateral distribution of two-phase flow parameters, the modelling of two-phase flow turbulence and non-drag forces under wall boiling conditions have been also investigated in the paper. (author)

  19. CFD modelling of condensers for freeze-drying processes

    Indian Academy of Sciences (India)

    Miriam Petitti; Antonello A Barresi; Daniele L Marchisio

    2013-12-01

    The aim of the present research is the development of a computational tool for investigating condensation processes and equipment with particular attention to freeze-dryers. These condensers in fact are usually operated at very low pressures, making it difficult to experimentally acquire quantitative knowledge of all the variables involved. Mathematical modelling and CFD (Computational Fluid Dynamics) simulations are used here to achieve a better comprehension of the flow dynamics and of the process of ice condensation and deposition in the condenser, in order to evaluate condenser efficiency and gain deeper insights of the process to be used for the improvement of its design. Both a complete laboratory-scale freeze-drying apparatus and an industrial-scale condenser have been investigated in this work, modelling the process of water vapour deposition. Different operating conditions have been considered and the influence exerted by the inert gas as well as other parameters has been investigated.

  20. Model test and CFD calculation of a cavitating bulb turbine

    Energy Technology Data Exchange (ETDEWEB)

    Necker, J; Aschenbrenner, T, E-mail: joerg.necker@voith.co [Voith Hydro Holding GmbH and Co. KG Alexanderstrasse 11, 89522 Heidenheim (Germany)

    2010-08-15

    The flow in a horizontal shaft bulb turbine is calculated as a two-phase flow with a commercial Computational Fluid Dynamics (CFD-)-code including cavitation model. The results are compared with experimental results achieved at a closed loop test rig for model turbines. On the model test rig, for a certain operating point (i.e. volume flow, net head, blade angle, guide vane opening) the pressure behind the turbine is lowered (i.e. the Thoma-coefficient {sigma} is lowered) and the efficiency of the turbine is recorded. The measured values can be depicted in a so-called {sigma}-break curve or {eta}- {sigma}-diagram. Usually, the efficiency is independent of the Thoma-coefficient up to a certain value. When lowering the Thoma-coefficient below this value the efficiency will drop rapidly. Visual observations of the different cavitation conditions complete the experiment. In analogy, several calculations are done for different Thoma-coefficients {sigma}and the corresponding hydraulic losses of the runner are evaluated quantitatively. For a low {sigma}-value showing in the experiment significant efficiency loss, the the change of volume flow in the experiment was simulated. Besides, the fraction of water vapour as an indication of the size of the cavitation cavity is analyzed qualitatively. The experimentally and the numerically obtained results are compared and show a good agreement. Especially the drop in efficiency can be calculated with satisfying accuracy. This drop in efficiency is of high practical importance since it is one criterion to determine the admissible cavitation in a bulb-turbine. The visual impression of the cavitation in the CFD-analysis is well in accordance with the observed cavitation bubbles recorded on sketches and/or photographs.

  1. Inertisation options for BG method and optimisation using CFD modelling

    Institute of Scientific and Technical Information of China (English)

    Morla Ramakrishna; Balusu Rao; Tanguturi Krishna; Ting Ren

    2015-01-01

    Spontaneous combustion (sponcom) is one of the issues of concern with the blasting gallery (BG) method of coal mining and has the potential to cause fires, and impact on production and safety, greenhouse gas (GHG) emissions and huge costs involved in controlling the aftermath situations. Some of the research attempts made to prevent and control coal mine fires and spontaneous combustion in thick seams worked with bord and pillar mining methods are presented in this paper. In the study, computational fluid dynamics (CFD) modelling techniques were used to simulate and assess the effects of various mining methods, layouts, designs, and different operational and ventilation parameters on the flow of goaf gases in BG panels. A wide range of parametric studies were conducted to develop proactive strategies to control and prevent ingress of oxygen into the goaf area preventing spontaneous combustion and mine fires.

  2. CFD modeling and experience of waste-to-energy plant burning waste wood

    DEFF Research Database (Denmark)

    Rajh, B.; Yin, Chungen; Samec, N.;

    2013-01-01

    Computational Fluid Dynamics (CFD) is being increasingly used in industry for in-depth understanding of the fundamental mixing, combustion, heat transfer and pollutant formation in combustion processes and for design and optimization of Waste-to-Energy (WtE) plants. In this paper, CFD modeling...... of waste wood combustion in a 13 MW grate-fired boiler in a WtE plant is presented. As a validation effort, the temperature profiles at a number of ports in the furnace are measured and the experimental results are compared with the CFD predictions. In the simulation, a 1D model is developed to simulate...... the conversion of the waste wood in the fuel bed on the grate, which provides the appropriate inlet boundary condition for the freeboard 3D CFD simulation. The CFD analysis reveals the detailed mixing and combustion characteristics in the waste wood-fired furnace, pinpointing how to improve the design...

  3. VERIFICATION OF SMOM AND QMOM POPULATION BALANCE MODELING IN CFD CODE USING ANALYTICAL SOLUTIONS FOR BATCH PARTICULATE PROCESSES

    Institute of Scientific and Technical Information of China (English)

    Bin Wan; Terry A.Ring

    2006-01-01

    For many processes of industrial significance, due to the strong coupling between particle interactions and fluid dynamics, the population balance must be solved as part of a computational fluid dynamics (CFD) simulation. In this work, a CFD based population balance model is tested using a batch crystallization reactor. In this CFD model, the population balance is solved by the standard method of moments (SMOM) and the quadrature method of moments (QMOM). The results of these simulations are compared to analytical solutions for the population balance in a batch tank where 1) nucleation, 2) growth, 3) aggregation, and 4) breakage are taking place separately. The results of these comparisons show that the first 6 moments of the population balance are accurately predicted for nucleation, growth, aggregation and breakage at all times.

  4. A CFD Approach to Modeling Spacecraft Fuel Slosh

    Science.gov (United States)

    Marsell, Brandon; Gangadharan, Sathya; Chatman, Yadira; Sudermann, James; Schlee, Keith; Ristow, James E.

    2009-01-01

    Energy dissipation and resonant coupling from sloshing fuel in spacecraft fuel tanks is a problem that occurs in the design of many spacecraft. In the case of a spin stabilized spacecraft, this energy dissipation can cause a growth in the spacecrafts' nutation (wobble) that may lead to disastrous consequences for the mission. Even in non-spinning spacecraft, coupling between the spacecraft or upper stage flight control system and an unanticipated slosh resonance can result in catastrophe. By using a Computational Fluid Dynamics (CFD) solver such as Fluent, a model for this fuel slosh can be created. The accuracy of the model must be tested by comparing its results to an experimental test case. Such a model will allow for the variation of many different parameters such as fluid viscosity and gravitational field, yielding a deeper understanding of spacecraft slosh dynamics. In order to gain a better understanding of the dynamics behind sloshing fluids, the Launch Services Program (LSP) at the NASA Kennedy Space Center (KSC) is interested in finding ways to better model this behavior. Thanks to past research, a state-of-the-art fuel slosh research facility was designed and fabricated at Embry Riddle Aeronautical University (ERAU). This test facility has produced interesting results and a fairly reliable parameter estimation process to predict the necessary values that accurately characterize a mechanical pendulum analog model. The current study at ERAU uses a different approach to model the free surface sloshing of liquid in a spherical tank using Computational Fluid Dynamics (CFD) methods. Using a software package called Fluent, a model was created to simulate the sloshing motion of the propellant. This finite volume program uses a technique called the Volume of Fluid (VOF) method to model the interaction between two fluids [4]. For the case of free surface slosh, the two fluids are the propellant and air. As the fuel sloshes around in the tank, it naturally

  5. Optimization the design of venturi gas mixer for syngas engine using three-dimensional CFD modeling

    International Nuclear Information System (INIS)

    A venturi mixer prototype is developed for mixing air and synthesis gas or 'syngas' as a fuel. Syngas is recognized as a viable energy source worldwide, particularly for stationary power generation. It has a very low energy density, so a mixer with λ (ratio of actual to stoichiometric air-fuel ratio) in the range of 1.1 to 1.7 is expected. In this study, three-dimensional computational fluid dynamics (CFD) modeling is used to investigate and analyze the influence of the throat diameter, gas chamber thickness and gas exits diameter on mixer characteristics and performance. Attention is focused on the effect of venturi mixer geometry on the air-fuel ratio, pressure loss and mixing quality. Based on the numerical results, an optimized design of venturi gas mixer is made. The optimized design has λ in the range of 1.2 to 1.3, and gives very good mixing quality and acceptable pressure loss. The CFD results are validated with experimental data. The CFD results show good agreement with experimental data

  6. Development and validation of a CFD model predicting the backfill process of a nuclear waste gallery

    Energy Technology Data Exchange (ETDEWEB)

    Gopala, Vinay Ramohalli, E-mail: gopala@nrg.eu [Nuclear Research and consultancy Group (NRG), P.O. Box 25, 1755 ZG Petten (Netherlands); Lycklama a Nijeholt, Jan-Aiso [Nuclear Research and consultancy Group (NRG), P.O. Box 25, 1755 ZG Petten (Netherlands); Bakker, Paul [Van Hattum en Blankevoort, Woerden (Netherlands); Haverkate, Benno [Nuclear Research and consultancy Group (NRG), P.O. Box 25, 1755 ZG Petten (Netherlands)

    2011-07-15

    Research highlights: > This work presents the CFD simulation of the backfill process of Supercontainers with nuclear waste emplaced in a disposal gallery. > The cement-based material used for backfill is grout and the flow of grout is modelled as a Bingham fluid. > The model is verified against an analytical solution and validated against the flowability tests for concrete. > Comparison between backfill plexiglas experiment and simulation shows a distinct difference in the filling pattern. > The numerical model needs to be further developed to include segregation effects and thixotropic behavior of grout. - Abstract: Nuclear waste material may be stored in underground tunnels for long term storage. The example treated in this article is based on the current Belgian disposal concept for High-Level Waste (HLW), in which the nuclear waste material is packed in concrete shielded packages, called Supercontainers, which are inserted into these tunnels. After placement of the packages in the underground tunnels, the remaining voids between the packages and the tunnel lining is filled-up with a cement-based material called grout in order to encase the stored containers into the underground spacing. This encasement of the stored containers inside the tunnels is known as the backfill process. A good backfill process is necessary to stabilize the waste gallery against ground settlements. A numerical model to simulate the backfill process can help to improve and optimize the process by ensuring a homogeneous filling with no air voids and also optimization of the injection positions to achieve a homogeneous filling. The objective of the present work is to develop such a numerical code that can predict the backfill process well and validate the model against the available experiments and analytical solutions. In the present work the rheology of Grout is modelled as a Bingham fluid which is implemented in OpenFOAM - a finite volume-based open source computational fluid dynamics

  7. Development and validation of a CFD model predicting the backfill process of a nuclear waste gallery

    International Nuclear Information System (INIS)

    Research highlights: → This work presents the CFD simulation of the backfill process of Supercontainers with nuclear waste emplaced in a disposal gallery. → The cement-based material used for backfill is grout and the flow of grout is modelled as a Bingham fluid. → The model is verified against an analytical solution and validated against the flowability tests for concrete. → Comparison between backfill plexiglas experiment and simulation shows a distinct difference in the filling pattern. → The numerical model needs to be further developed to include segregation effects and thixotropic behavior of grout. - Abstract: Nuclear waste material may be stored in underground tunnels for long term storage. The example treated in this article is based on the current Belgian disposal concept for High-Level Waste (HLW), in which the nuclear waste material is packed in concrete shielded packages, called Supercontainers, which are inserted into these tunnels. After placement of the packages in the underground tunnels, the remaining voids between the packages and the tunnel lining is filled-up with a cement-based material called grout in order to encase the stored containers into the underground spacing. This encasement of the stored containers inside the tunnels is known as the backfill process. A good backfill process is necessary to stabilize the waste gallery against ground settlements. A numerical model to simulate the backfill process can help to improve and optimize the process by ensuring a homogeneous filling with no air voids and also optimization of the injection positions to achieve a homogeneous filling. The objective of the present work is to develop such a numerical code that can predict the backfill process well and validate the model against the available experiments and analytical solutions. In the present work the rheology of Grout is modelled as a Bingham fluid which is implemented in OpenFOAM - a finite volume-based open source computational fluid

  8. Assessment of Computational Fluid Dynamics (CFD) Models for Shock Boundary-Layer Interaction

    Science.gov (United States)

    DeBonis, James R.; Oberkampf, William L.; Wolf, Richard T.; Orkwis, Paul D.; Turner, Mark G.; Babinsky, Holger

    2011-01-01

    A workshop on the computational fluid dynamics (CFD) prediction of shock boundary-layer interactions (SBLIs) was held at the 48th AIAA Aerospace Sciences Meeting. As part of the workshop numerous CFD analysts submitted solutions to four experimentally measured SBLIs. This paper describes the assessment of the CFD predictions. The assessment includes an uncertainty analysis of the experimental data, the definition of an error metric and the application of that metric to the CFD solutions. The CFD solutions provided very similar levels of error and in general it was difficult to discern clear trends in the data. For the Reynolds Averaged Navier-Stokes methods the choice of turbulence model appeared to be the largest factor in solution accuracy. Large-eddy simulation methods produced error levels similar to RANS methods but provided superior predictions of normal stresses.

  9. Numerical Simulation of the Submarine Self-Propulsion Model Based on CFD Technology%基于 CFD 的潜艇模型自航仿真分析

    Institute of Scientific and Technical Information of China (English)

    杨琴; 王国栋; 张志国; 冯大奎; 王先洲

    2013-01-01

      The self-propulsion test of submarines is a key technology when evaluating its performance. In this paper,the simulation and modeling of a full appendage submarine with high-skew propeller are pre⁃sented. Particularly,the flow patterns,the thrust and torque of the propeller and the wave resistance of the submarine are obtained via three-dimensional numerical analysis. Furthermore,analysis of the hydrody⁃namic properties of the SUBOFF bare hull as well as the appended submarine reveals high consistency be⁃tween the two. It is observed that both the propeller thrust and the submarine body resistance are functions of the propeller rotating rate while the inflow velocity remains constant. Consequently,through altering the propeller rotating rate,various self-propulsion points can be determined under different inflow velocities. In brief,the proposed model provides insight into the flow pattern of full appendage submarines with 7-bladed propellers,and helps improving the overall performance and efficiency of the propeller.%  潜艇自航试验是预报和评估潜艇快速性的关键技术。采用数值模拟方法系统地研究全附体潜艇+螺旋桨的三维粘性流场和水动力特性。在对全附体 SUBOFF 模型+螺旋桨水动力特性进行仿真分析前,分别将全附体 SUBOFF 模型的阻力和敞水桨水动力特性的数值预报结果与试验数据进行比较,结果吻合较好。通过对全附体 SUBOFF 模型+螺旋桨进行仿真分析和研究,实现了全附体潜艇+螺旋桨三维流场的数值计算。在给定航速下,螺旋桨推力与艇体阻力为螺旋桨转速的函数,通过改变螺旋桨转速得到潜艇在既定航速下的自航点,仿真分析结果清晰、形象地描述了带桨全附体艇的水动力性能。

  10. Development and Verification of CFD Models for Modeling Wind Conditions on Forested Wind Turbine Sites

    DEFF Research Database (Denmark)

    Andersen, Morten Q.; Mortensen, Kasper; Nielsen, Daniel E.;

    2009-01-01

    This paper describes a proposed CFD model to simulate the wind conditions on a forested site. The model introduces porous subdomains representing the forests in the terrain. Obtained simulation values are compared to field measurements in- and outside a forest. Initial results are very promising...

  11. CFD Modeling of Free-Piston Stirling Engines

    Science.gov (United States)

    Ibrahim, Mounir B.; Zhang, Zhi-Guo; Tew, Roy C., Jr.; Gedeon, David; Simon, Terrence W.

    2001-01-01

    NASA Glenn Research Center (GRC) is funding Cleveland State University (CSU) to develop a reliable Computational Fluid Dynamics (CFD) code that can predict engine performance with the goal of significant improvements in accuracy when compared to one-dimensional (1-D) design code predictions. The funding also includes conducting code validation experiments at both the University of Minnesota (UMN) and CSU. In this paper a brief description of the work-in-progress is provided in the two areas (CFD and Experiments). Also, previous test results are compared with computational data obtained using (1) a 2-D CFD code obtained from Dr. Georg Scheuerer and further developed at CSU and (2) a multidimensional commercial code CFD-ACE+. The test data and computational results are for (1) a gas spring and (2) a single piston/cylinder with attached annular heat exchanger. The comparisons among the codes are discussed. The paper also discusses plans for conducting code validation experiments at CSU and UMN.

  12. Two-dimensional CFD modeling of wave rotor flow dynamics

    Science.gov (United States)

    Welch, Gerard E.; Chima, Rodrick V.

    1993-01-01

    A two-dimensional Navier-Stokes solver developed for detailed study of wave rotor flow dynamics is described. The CFD model is helping characterize important loss mechanisms within the wave rotor. The wave rotor stationary ports and the moving rotor passages are resolved on multiple computational grid blocks. The finite-volume form of the thin-layer Navier-Stokes equations with laminar viscosity are integrated in time using a four-stage Runge-Kutta scheme. The Roe approximate Riemann solution scheme or the computationally less expensive Advection Upstream Splitting Method (AUSM) flux-splitting scheme are used to effect upwind-differencing of the inviscid flux terms, using cell interface primitive variables set by MUSCL-type interpolation. The diffusion terms are central-differenced. The solver is validated using a steady shock/laminar boundary layer interaction problem and an unsteady, inviscid wave rotor passage gradual opening problem. A model inlet port/passage charging problem is simulated and key features of the unsteady wave rotor flow field are identified. Lastly, the medium pressure inlet port and high pressure outlet port portion of the NASA Lewis Research Center experimental divider cycle is simulated and computed results are compared with experimental measurements. The model accurately predicts the wave timing within the rotor passage and the distribution of flow variables in the stationary inlet port region.

  13. RAPID CREATION OF CFD-CAPABLE CAD-MODELS FOR CABIN AIR VENTILATION SIMULATION

    OpenAIRE

    Fuchte, Jörg; Wick, Andreas; Rajkowski, Sergej

    2011-01-01

    The objective of this paper is to describe a method for rapid creation of cabin CAD (Computer Aided Design) models for usage in CFD (Computational Fluid Dynamics) simulations of cabin air ventilation. The intention is to automate the process of model creation in order to speed up the process and reduce the workload both in CAD modeling and mesh creation. The described method is part of a larger process intended to facilitate the usage of CFD cabin air ventilation simulations for passenger com...

  14. CFD-based Analysis of Aeroelastic behavior of Supersonic Fins

    Directory of Open Access Journals (Sweden)

    Tianxing Cai

    2011-02-01

    Full Text Available The main goal of this paper is to analyze the flutter boundary, transient loads of a supersonic fin, and the flutter with perturbation. Reduced order mode (ROM based on Volterra Series is presented to calculate the flutter boundary, and CFD/CSD coupling is used to compute the transient aerodynamic load. The Volterra-based ROM is obtained using the derivative of unsteady aerodynamic step-response, and the infinite plate spline is used to perform interpolation of physical quantities between the fluid and the structural grids. The results show that inertia force plays a significant role in the transient loads, the moment cause by inertia force is lager than the aerodynamic force, because of the huge transient loads, structure may be broken by aeroelasticity below the flutter dynamic pressure. Perturbations of aircraft affect the aeroelastic response evident, the reduction of flutter dynamic pressure by rolling perturbation form 15.4% to 18.6% when Mach from 2.0 to 3.0. It is necessary to analyze the aeroelasticity behaviors under the compositive force environment.

  15. Development of CFD Approaches for Modeling Advanced Concepts of Nuclear Thermal Propulsion Test Facilities Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The project will be developing a CFD approach that can handle the additional complexities needed in a NTP testing facility when modeling the combustion processes in...

  16. Summary of best guidelines and validation of CFD modeling in livestock buildings to ensure prediction quality

    DEFF Research Database (Denmark)

    Rong, Li; Nielsen, Peter Vilhelm; Bjerg, Bjarne Schmidt;

    2016-01-01

    scale pig barns was simulated to show the procedures of validating a CFD simulation in livestock buildings. After summarizing the guideline and/or best practice for CFD modeling, the authors addressed the issues related to numerical methods and the governing equations, which were limited to RANS models....... Although it is not necessary to maintain the same format of reporting the CFD modeling as presented in this paper, the authors would suggest including all the information related to the selection of turbulence models, difference schemes, convergence criteria, boundary conditions, geometry simplification......Computational Fluid Dynamics (CFD) is increasingly used to study airflow around and in livestock buildings, to develop technologies to mitigate emissions and to predict the contaminant dispersion from livestock buildings. In this paper, an example of air flow distribution in a room with two full...

  17. CFD Modeling of LNG Spill: Humidity Effect on Vapor Dispersion

    Science.gov (United States)

    Giannissi, S. G.; Venetsanos, A. G.; Markatos, N.

    2015-09-01

    The risks entailed by an accidental spill of Liquefied Natural Gas (LNG) should be indentified and evaluated, in order to design measures for prevention and mitigation in LNG terminals. For this purpose, simulations are considered a useful tool to study LNG spills and to understand the mechanisms that influence the vapor dispersion. In the present study, the ADREA-HF CFD code is employed to simulate the TEEX1 experiment. The experiment was carried out at the Brayton Fire Training Field, which is affiliated with the Texas A&M University system and involves LNG release and dispersion over water surface in open- obstructed environment. In the simulation the source was modeled as a two-phase jet enabling the prediction of both the vapor dispersion and the liquid pool spreading. The conservation equations for the mixture are solved along with the mass fraction for natural gas. Due to the low prevailing temperatures during the spill ambient humidity condenses and this might affect the vapor dispersion. This effect was examined in this work by solving an additional conservation equation for the water mass fraction. Two different models were tested: the hydrodynamic equilibrium model which assumes kinetic equilibrium between the phases and the non hydrodynamic equilibrium model, in order to assess the effect of slip velocity on the prediction. The slip velocity is defined as the difference between the liquid phase and the vapor phase and is calculated using the algebraic slip model. Constant droplet diameter of three different sizes and a lognormal distribution of the droplet diameter were applied and the results are discussed and compared with the measurements.

  18. A hybrid CFD-DSMC model designed to simulate rapidly rarefying flow fields and its application to physical vapor deposition

    Science.gov (United States)

    Gott, Kevin

    This research endeavors to better understand the physical vapor deposition (PVD) vapor transport process by determining the most appropriate fluidic model to design PVD coating manufacturing. An initial analysis was completed based on the calculation of Knudsen number from titanium vapor properties. The results show a dense Navier-Stokes solver best describes flow near the evaporative source, but the material properties suggest expansion into the chamber may result in a strong drop in density and a rarefied flow close to the substrate. A hybrid CFD-DSMC solver is constructed in OpenFOAM for rapidly rarefying flow fields such as PVD vapor transport. The models are patched together combined using a new patching methodology designed to take advantage of the one-way motion of vapor from the CFD region to the DSMC region. Particles do not return to the dense CFD region, therefore the temperature and velocity can be solved independently in each domain. This novel technique allows a hybrid method to be applied to rapidly rarefying PVD flow fields in a stable manner. Parameter studies are performed on a CFD, Navier-Stokes continuum based compressible solver, a Direct Simulation Monte Carlo (DSMC) rarefied particle solver, a collisionless free molecular solver and the hybrid CFD-DSMC solver. The radial momentum at the inlet and radial diffusion characteristics in the flow field are shown to be the most important to achieve an accurate deposition profile. The hybrid model also shows sensitivity to the shape of the CFD region and rarefied regions shows sensitivity to the Knudsen number. The models are also compared to each other and appropriate experimental data to determine which model is most likely to accurately describe PVD coating deposition processes. The Navier-Stokes solvers are expected to yield backflow across the majority of realistic inlet conditions, making their physics unrealistic for PVD flow fields. A DSMC with improved collision model may yield an accurate

  19. CFD MODEL OF THE CNG DIRECT INJECTION ENGINE

    Directory of Open Access Journals (Sweden)

    Zbigniew Czyż

    2014-09-01

    Full Text Available The paper presents CFD analysis of fuel flow in the CNG injector. The issues such a pressure drop along an injector channel, mass flow through the key sections of the injector geometry, flow rates, the impact of the needle shape on the deflection of the sprayed gas cone and the impact of the wall head are analyzed in the article. The simulation was made in the transient states conditions for full injection process, including the opening and closing of the injector. An injection time of 6 ms, velocity of 0.33 mm/ms and a lift of 0.5 mm were selected for opening and closing of injector based on experimental test. The simulation shows that the volume inside the injector is a kind of fuel accumulator, and the opening process of the needle influence the flow parameters in an inlet cross-section after a certain time, depending on a channel cross section. The calculations allowed to select the ratio of an injector duct cross sectional area to the aperture area of the injection capable of the reducing pressure loss. The unusual location of the injector in the socket of a glow plug in the Andoria ADCR engine makes a stream be impaired by a part of the head. This research result would be useful in developing an injector construction which will be used for an investigation of CNG addition into diesel engine.

  20. Simulation and Scale-up of Barium Sulphate Precipitation Process Using CFD Modeling

    Institute of Scientific and Technical Information of China (English)

    龚俊波; 卫宏远; 王静康; JohnGarsideb

    2005-01-01

    Some empirical mixing models were used to describe the imperfect mixing in precipitation process.However, the models can not, in general, reflect the details of interactions between mixing and crystallization in a vessel. In this study, CFD (computational fluid dynamics) technique were developed by simulating the precipitation of barium sulphate in stirred tanks by integration of population balance equations with a CFD solver. Two typical impellers, Rushton and pitched blade turbines, were employed for agitation. The influence of feed concentration and position on crystal product properties was investigated by CFD simulation. The scale-up of these precipitators was systematically studied. Significant effect on the crystal properties was found for the scale-up under some conditions.Keywords simulation, scale up, precipitation, CFD(computational fluid dynamics)

  1. Global optimization based on metamodel construction app lied to design axial turbomachinery cascades using CFD

    Science.gov (United States)

    Raimunda da Silva, E.; Camacho, R. G. R.; Filho, N. M.

    2010-08-01

    It presents a methodology for global optimization with constraints of expensive functions using response surfaces models for aerodynamic cascade representing the turbomachine axial with profiles of family NACA65. For the calculation of flow, is used Fluent CFD software, which is on a local and global variations in the flow field. It has been verified that small geometric on the stagger angle, format airfoil and the spacing between the blades, can lead to changes in the efficiency of the blade. Accordingly, we intend to integrate the solution flow through CFD optimization programs based on the construction of metamodels, aiming to obtain considerable gains in computational time. Integration with the optimization programs is necessary to build "script" command to automatically generate the mesh, where the design variables that define the geometry of the blade cascade as stagger angle, pitch to chord and the camber be modified among pre-established limits based on optimization algorithms, in order to achieve an objective function pre-defined, how to obtain the maximum ratio of Cl/ Cd (lift/drag). This methodology for global optimization based on the construction of metamodels together with the random search algorithm controlled (CRSA) is based on iterative construction of response surfaces with radial basis functions (multiquadric) and the application of heuristic criteria to update the database during the optimization process. Cyclical patterns of search are iteratively used to determine the candidate points to be included in the database.

  2. Dicty_cDB: CFD579 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD579 (Link to dictyBase) - - - Contig-U16381-1 CFD579P (Link to Original site) CFD...579F 129 CFD579Z 319 CFD579P 448 - - Show CFD579 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-D/CFD579Q.Seq.d/ Representative seq. ID CFD...579P (Link to Original site) Representative DNA sequence >CFD579 (CFD579Q) /CSM/CF/CFD5-D/CFD5...alignments: (bits) Value CFD579 (CFD579Q) /CSM/CF/CFD5-D/CFD579Q.Seq.d/ 220 1e-56 CFD769 (CFD769Q) /CSM/CF/CFD7-C/CFD

  3. Evaluation of gas radiation models in CFD modeling of oxy-combustion

    International Nuclear Information System (INIS)

    Highlights: • CFD modeling of a typical industrial water tube boiler is conducted. • Different combustion processes were considered including air and oxy-fuel combustion. • SGG, EWBM, Leckner, Perry and WSGG radiation models were considered in the study. • EWBM is the most accurate model and it’s considered to be the benchmark model. • Characteristics of oxy-fuel combustion are compared to those of air–fuel combustion. - Abstract: Proper determination of the radiation energy is very important for proper predictions of the combustion characteristics inside combustion devices using CFD modeling. For this purpose, different gas radiation models were developed and applied in the present work. These radiation models vary in their accuracy and complexity according to the application. In this work, a CFD model for a typical industrial water tube boiler was developed, considering three different combustion environments. The combustion environments are air–fuel combustion (21% O2 and 79% N2), oxy-fuel combustion (21% O2 and 79% CO2) and oxy-fuel combustion (27% O2 and 73% CO2). Simple grey gas (SGG), exponential wide band model (EWBM), Leckner, Perry and weighted sum of grey gases (WSGG) radiation models were examined and their influences on the combustion characteristics were evaluated. Among those radiation models, the EWBM was found to provide close results to the experimental data for the present boiler combustion application. The oxy-fuel combustion characteristics were analyzed and compared with those of air–fuel combustion

  4. Dicty_cDB: CFD557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD557 (Link to dictyBase) - - - Contig-U16450-1 CFD557E (Link to Original site) CFD...557F 601 CFD557Z 707 CFD557P 1308 CFD557E 1253 Show CFD557 Library CF (Link to library) Clone ID CFD...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-C/CFD557Q.Seq.d/ Representative seq. ID CFD...557E (Link to Original site) Representative DNA sequence >CFD557 (CFD557Q) /CSM/CF/CFD5-C/CFD...ragtvsfyl spkmtsdapadpsqdvffqnsihsspfgnctkyyentnnatctacfdlpmdispglyilq ffwefnpkgi

  5. Wind Turbine Rotor Simulation via CFD Based Actuator Disc Technique Compared to Detailed Measurement

    Directory of Open Access Journals (Sweden)

    Esmail Mahmoodi

    2015-10-01

    Full Text Available In this paper, a generalized Actuator Disc (AD is used to model the wind turbine rotor of the MEXICO experiment, a collaborative European wind turbine project. The AD model as a combination of CFD technique and User Defined Functions codes (UDF, so-called UDF/AD model is used to simulate loads and performance of the rotor in three different wind speed tests. Distributed force on the blade, thrust and power production of the rotor as important designing parameters of wind turbine rotors are focused to model. A developed Blade Element Momentum (BEM theory as a code based numerical technique as well as a full rotor simulation both from the literature are included into the results to compare and discuss. The output of all techniques is compared to detailed measurements for validation, which led us to final conclusions.

  6. Knowledge Transfer from Detailed 3-D CFD Codes to System Simulation Tools – CCV Modeling in SI Engine

    Directory of Open Access Journals (Sweden)

    Vítek Oldřich

    2016-06-01

    Full Text Available The paper deals with CCV knowledge transfer from reference data (either experiments or 3-D CFD data into system simulation SW tools (based on 0-D/1-D CFD. It was verified that CCV phenomenon can be modeled by means of combustion model perturbations. The proposed methodology consists of two major steps. First, individual cycle data have to be matched with the 0-D/1-D model, i.e., combustion model parameters are varied to achieve the best possible match of in-cylinder pressure traces. Second, the combustion model parameters (obtained in previous step are statistically evaluated to obtain PDFs and cross-correlations. Then such information is imposed to the 0-D/1-D tool to mimic pressure traces CCV. Good correspondence with the reference data is achieved only if both PDFs and cross-correlations are imposed simultaneously.

  7. From Detailed Description of Chemical Reacting Carbon Particles to Subgrid Models for CFD

    Directory of Open Access Journals (Sweden)

    Schulze S.

    2013-04-01

    Full Text Available This work is devoted to the development and validation of a sub-model for the partial oxidation of a spherical char particle moving in an air/steam atmosphere. The particle diameter is 2 mm. The coal particle is represented by moisture- and ash-free nonporous carbon while the coal rank is implemented using semi-global reaction rate expressions taken from the literature. The submodel includes six gaseous chemical species (O2, CO2, CO, H2O, H2, N2. Three heterogeneous reactions are employed, along with two homogeneous semi-global reactions, namely carbon monoxide oxidation and the water-gas-shift reaction. The distinguishing feature of the subgrid model is that it takes into account the influence of homogeneous reactions on integral characteristics such as carbon combustion rates and particle temperature. The sub-model was validated by comparing its results with a comprehensive CFD-based model resolving the issues of bulk flow and boundary layer around the particle. In this model, the Navier-Stokes equations coupled with the energy and species conservation equations were used to solve the problem by means of the pseudo-steady state approach. At the surface of the particle, the balance of mass, energy and species concentration was applied including the effect of the Stefan flow and heat loss due to radiation at the surface of the particle. Good agreement was achieved between the sub-model and the CFD-based model. Additionally, the CFD-based model was verified against experimental data published in the literature (Makino et al. (2003 Combust. Flame 132, 743-753. Good agreement was achieved between numerically predicted and experimentally obtained data for input conditions corresponding to the kinetically controlled regime. The maximal discrepancy (10% between the experiments and the numerical results was observed in the diffusion-controlled regime. Finally, we discuss the influence of the Reynolds number, the ambient O2 mass fraction and the ambient

  8. CFD modeling of a spouted bed with a porous draft tube

    Institute of Scientific and Technical Information of China (English)

    Salar Azizi; Seyyed Hossein Hosseini; M. Moraveji; Goodarz Ahmadi

    2010-01-01

    Spouted bed with a porous draft tube is used for drying of grains and chemical products and thermal disinfestations process. This work provides a computational fluid dynamics (CFD) simulation of binary mixtures of glass particles in a spouted bed with a porous draft tube. The simulation used the multi-fluid Eulerian-Eulerian approach based on kinetic theory of granular flows, incorporating a kinetic-frictional constitutive model for dense assemblies of particulate solids and Gidaspow's drag model for the inter-action between gas and particles. Influences of solids mass fraction and inlet gas flow rate on pressure distribution, gas and particle velocities were studied. The modeling results were compared with the exper-imental work of Ishikura, Nagashima, and lde (2003) for the flow condition along the axis of the spouted bed. Good agreement between the modeling results and experimental data was observed.

  9. A 2.5D Single Passage CFD Model for Centrifugal Pumps

    Science.gov (United States)

    Nakamura S.; Ding, W.; Yano, K.

    1998-01-01

    This paper describes the single passage model based on CFD to analyze the flow in blade passages of a centrifugal pump. The model consists of the flow passage between two impeller blades and the spaces in the inlet eye as well as in the volute. The incompressible Navier-Stokes equations in the conservation form are solved by a finite difference method. The code is designed to investigate the velocity and pressure distributions and intended to investigate how the pump design affects fluid flow through the rotor as well as the pump performance. An early part of the paper investigates the behavior of the model as well as validity of the assumptions made in the model. Then, applications to a rotodynamic heart pump are presented.

  10. Validation of cfd and simplified models with experimental data for multiphase flow in bends

    NARCIS (Netherlands)

    Nennie, E.D.; Belfroid, S.P.C.; O'Mahoney, T.S.D.

    2013-01-01

    In this paper details of the measurement results of the forces on the bends in a 4" setup are compared to two models. The first model is a simple analytical model and is used to estimate the forces. In the second model, CFD is used. In the experiments only resulting forces, including upstream and do

  11. Validation of vortex code viscous models using lidar wake measurements and CFD

    DEFF Research Database (Denmark)

    Branlard, Emmanuel; Machefaux, Ewan; Gaunaa, Mac;

    2014-01-01

    with sheared inflow are used to compare the vortex code performance with CFD and lidar measurements. Laminar CFD computations are used to evaluate the performance of the viscous models. Consistent results between the vortex code and CFD tool are obtained up to three diameters downstream. The modelling......The newly implemented vortex code Omnivor coupled to the aero-servo-elastic tool hawc2 is described in this paper. Vortex wake improvements by the implementation of viscous effects are considered. Different viscous models are implemented and compared with each other. Turbulent flow fields...... of viscous boundaries appear more important than the modelling of viscosity in the wake. External turbulence and shear appear sufficient but their full potential flow modelling would be preferred....

  12. Two-phase CFD modeling of flow causing the heater vibration

    International Nuclear Information System (INIS)

    Vibrations of heater rods were observed in a heated annulus with water flow under boiling conditions. In order to find out the cause of such vibrations, CFD model of this annulus has been prepared in CFD code STAR-CCM+. Two-phase flow in the annulus was described using a two-fluid model with number of sub-models to describe the mass, momentum and energy transfer between phases. The model was validated using experimental data from reference. The validated model was used to perform a steady state calculation of flow parameters under different conditions. Results of CFD simulations were compared to experimentally detected vibration offset. It was found out that vibration increase caused by heating the channel is connected with the vibration offset. The results and their extension to nuclear safety were discussed. (author)

  13. Design of a decay tank for a pool type research reactor with a CFD model

    International Nuclear Information System (INIS)

    A conceptual primary cooling system (PCS) was designed for adequate cooling of the core of a research reactor. The primary coolant after passing through the reactor core contains many kinds of radio-nuclides. A decay tank provides a delayed transit time to ensure that the N-16 activity decreases enough before the coolant leaves the decay tank's shielding room. The size of the decay tank should be enlarged to provide sufficient transit time. However, there was a limitation: to minimize the tank size, it should be designed with an internal baffle, which affects the pressure loss in the system and net positive suction head (NPSH) of the PCS pump. Therefore, the decay tank should be optimized for size and the internal baffle. A vertical type decay tank was chosen to optimize the geometrical arrangement of PCS and the vertical internal baffle was installed to minimize the number of internal structures. The preliminary geometry of the tank and the internal baffle were determined to satisfy the required delayed transit time by calculating the maximum velocity and the flow path length of the circular and the annular sections of the tank. The commercially available CFD model, FLUENT, which solves the Navier-Stokes and turbulent models, was used to specifically design the decay tank with the preliminarily calculated geometry and the related flow rate. Several turbulence models, standard k-ε model, renormalization group (RNG) model, and realizable k-ε model, were conducted to isolate the root cause of these differences. By comparing the results of the velocity profile and the characteristics of each model, a detailed design study was simulated using the realizable k-ε model. A user-defined scalar equation was solved to estimate the delayed transit time. The size and the internal baffle that satisfy the required transit time were determined based on the CFD results. (author)

  14. CFD Model of Dense Gas-solid Systems in Jetting Fl uidized Beds

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A CFD code has been developed based on the conservation principles describing gas and solid flow in fluidized beds. This code is employed to simulate not only the spatiotemporal gas- and solid-phase velocities and voidage profiles in a two-dimensional bed but also fluid dynamics in the jet region. The computational results show that gas flow direction is upward in the entire bed accompanied with random local circulations, whilst solid flow direction is upward at the center and downward near the wall. The radical reason of strong back-mixing of solid particles and good transfer behavior between two phases is that the jet entrains solid particles. Numerical calculation indicates that gas velocity, solid velocity and pressure profile have a significant change when the voidage is 0. 8. The simulated time-averaged voidage profiles agree with the experimental results and simulated data reported by Gidaspow and Ettehadieh(1983). Therefore, CFD model can be regarded as a useful tool to study the jet characteristics in dense gas-solid fluidized beds.

  15. CFD Analysis of a Slug Mixing Experiment Conducted on a VVER-1000 Model

    Directory of Open Access Journals (Sweden)

    F. Moretti

    2009-01-01

    Full Text Available A commercial CFD code was applied, for validation purposes, to the simulation of a slug mixing experiment carried out at OKB “Gidropress” scaled facility in the framework of EC TACIS project R2.02/02: “Development of safety analysis capabilities for VVER-1000 transients involving spatial variations of coolant properties (temperature or boron concentration at core inlet.” Such experimental model reproduces a VVER-1000 nuclear reactor and is aimed at investigating the in-vessel mixing phenomena. The addressed experiment involves the start-up of one of the four reactor coolant pumps (the other three remaining idle, and the presence of a tracer slug on the starting loop, which is thus transported to the reactor pressure vessel where it mixes with the clear water. Such conditions may occur in a boron dilution scenario, hence the relevance of the addressed phenomena for nuclear reactor safety. Both a pretest and a posttest CFD simulations of the mentioned experiment were performed, which differ in the definition of the boundary conditions (based either on nominal quantities or on measured quantities, resp.. The numerical results are qualitatively and quantitatively analyzed and compared against the measured data in terms of space and time tracer distribution at the core inlet. The improvement of the results due to the optimization of the boundary conditions is evidenced, and a quantification of the simulation accuracy is proposed.

  16. CFD aided analysis of a scaled down model of the Brazilian Multipurpose Reactor (RMB) pool

    International Nuclear Information System (INIS)

    Research reactors are commonly built inside deep pools that provide radiological and thermal protection and easy access to its core. Reactors with thermal power in the order of MW usually use an auxiliary thermal-hydraulic circuit at the top of its pool to create a purified hot water layer (HWL). Thermal-hydraulic analysis of the flow configuration in the pool and HWL is paramount to insure radiological protection. A useful tool for these analyses is the application of CFD (Computational Fluid Dynamics). To obtain satisfactory results using CFD it is necessary the verification and validation of the CFD numerical model. Verification is divided in code and solution verifications. In the first one establishes the correctness of the CFD code implementation and in the former estimates the numerical accuracy of a particular calculation. Validation is performed through comparison of numerical and experimental results. This paper presents a dimensional analysis of the RMB (Brazilian Multipurpose Reactor) pool to determine a scaled down experimental installation able to aid in the HWL numerical investigation. Two CFD models were created one with the same dimensions and boundary conditions of the reactor prototype and the other with 1/10 proportion size and boundary conditions set to achieve the same inertial and buoyant forces proportions represented by Froude Number between the two models. Results comparing the HWL thickness show consistence between the prototype and the scaled down model behavior. (author)

  17. CFD aided analysis of a scaled down model of the Brazilian Multipurpose Reactor (RMB) pool

    Energy Technology Data Exchange (ETDEWEB)

    Schweizer, Fernando L.A.; Lima, Claubia P.B.; Costa, Antonella L.; Veloso, Maria A.F., E-mail: ando.schweizer@gmail.com, E-mail: claubia@nuclear.ufmg.br, E-mail: antonella@nuclear.ufmg.br, E-mail: mdora@nuclear.ufmg.br [Universidade Federal de Minas Gerais (DEN/UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Santos, Andre A.C.; Costa, Antonio C.L., E-mail: aacs@cdtn.br, E-mail: aclc@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN/-MG), Belo Horizonte, MG (Brazil)

    2013-07-01

    Research reactors are commonly built inside deep pools that provide radiological and thermal protection and easy access to its core. Reactors with thermal power in the order of MW usually use an auxiliary thermal-hydraulic circuit at the top of its pool to create a purified hot water layer (HWL). Thermal-hydraulic analysis of the flow configuration in the pool and HWL is paramount to insure radiological protection. A useful tool for these analyses is the application of CFD (Computational Fluid Dynamics). To obtain satisfactory results using CFD it is necessary the verification and validation of the CFD numerical model. Verification is divided in code and solution verifications. In the first one establishes the correctness of the CFD code implementation and in the former estimates the numerical accuracy of a particular calculation. Validation is performed through comparison of numerical and experimental results. This paper presents a dimensional analysis of the RMB (Brazilian Multipurpose Reactor) pool to determine a scaled down experimental installation able to aid in the HWL numerical investigation. Two CFD models were created one with the same dimensions and boundary conditions of the reactor prototype and the other with 1/10 proportion size and boundary conditions set to achieve the same inertial and buoyant forces proportions represented by Froude Number between the two models. Results comparing the HWL thickness show consistence between the prototype and the scaled down model behavior. (author)

  18. Diffusion-Based Coarse Graining in Hybrid Continuum--Discrete Solvers: Applications in CFD--DEM

    CERN Document Server

    Sun, Rui

    2014-01-01

    In this work, a coarse graining method previously proposed by the authors based on solving diffusion equations is applied to CFD--DEM simulations, where coarse graining is used to obtain solid volume fraction, particle phase velocity, and fluid--particle interaction forces. By examining the conservation requirements, the variables to solve diffusion equations for in CFD--DEM simulations are identified. The algorithm is then implemented to a CFD--DEM solver based on OpenFOAM and LAMMPS, the former being a general-purpose, three-dimensional CFD solver based on unstructured meshes. Numerical simulations are performed for a fluidized bed by using the CFD--DEM solver with the diffusion-based coarse graining algorithm. Converged results are obtained on successively refined meshes, even for meshes with cell sizes comparable to or smaller than the particle diameter. This is a critical advantage of the proposed method over many existing coarse graining methods, and would be particularly valuable when small cells are r...

  19. CFD Based Determination of Dynamic Stability Derivatives in Yaw for a Bird

    Institute of Scientific and Technical Information of China (English)

    M. A. Moelyadi; G. Sachs

    2007-01-01

    Dynamic yaw stability derivatives of a gull bird are determined using Computational Fluid Dynamics(CFD) method. Two kinds of motions are applied for calculating the dynamic yaw stability derivatives CNr and CNβ. The first one relates to a lateral translation and, separately, to a yaw rotation. The second one consists of a combined translational and rotational motion. To determine dynamic yaw stability derivatives, the simulation of an unsteady flow with a bird model showing a harmonic motion is performed. The flow solution for each time step is obtained by solving unsteady Euler equations based on a finite volume approach for a small reduced frequency. Then, an evaluation of unsteady forces and moments for one cycle is conducted using harmonic Fourier analysis. The results of the dynamic yaw stability derivatives for both simulations of the model show a good agreement.

  20. Towards CFD modeling of turbulent pipeline material transportation

    Science.gov (United States)

    Shahirpour, Amir; Herzog, Nicoleta; Egbers, Cristoph

    2013-04-01

    Safe and financially efficient pipeline transportation of carbon dioxide is a critical issue in the developing field of the CCS Technology. In this part of the process, carbon dioxide is transported via pipes with diameter of 1.5 m and entry pressure of 150 bar, with Reynolds number of 107 and viscosity of 8×10(-5) Pa.s as dense fluid [1]. Presence of large and small scale structures in the pipeline, high Reynolds numbers at which CO2 should be transferred, and 3 dimensional turbulence caused by local geometrical modifications, increase the importance of simulation of turbulent material transport through the individual components of the CO2 chain process. In this study, incompressible turbulent channel flow and pipe flow have been modeled using OpenFoam, an open source CFD software. In the first step, simulation of a turbulent channel flow has been considered using LES for shear Reynolds number of 395. A simple geometry has been chosen with cyclic fluid inlet and outlet boundary conditions to simulate a fully developed flow. The mesh is gradually refined towards the wall to provide values close enough to the wall for the wall coordinate (y+). Grid resolution study has been conducted for One-Equation model. The accuracy of the results is analyzed with respect to the grid smoothness in order to reach an optimized resolution for carrying out the next simulations. Furthermore, three LES models, One-Equation, Smagorinsky and Dynamic Smagorinsky are applied for the grid resolution of (60 × 100 × 80) in (x, y, z) directions. The results are then validated with reference to the DNS carried out by Moser et al.[2] for the similar geometry using logarithmic velocity profile (U+) and Reynolds stress tensor components. In the second step the similar flow is modeled using Reynolds averaged method. Several RANS models, like K-epsilon and Launder-Reece-Rodi are applied and validated against DNS and LES results in a similar fashion. In the most recent step, it has been intended

  1. SYSTEM FOR TORQUE CONVERTER DESIGN AND ANALYSIS BASED ON CAD/CFD INTEGRATED PLATFORM

    Institute of Scientific and Technical Information of China (English)

    WU Guangqiang; YAN Peng

    2008-01-01

    A 3D torque converter design system is developed based on numerical investigation into flow field and CAD technology. The 3D steady-state flow field simulation is undertaken by using time averaged Reynolds equation and k-epsilon turbulence model, with mixing-plane boundary conditions at three section interfaces. The blades are designed according to the flow field characteristics by using a reverse design method in the system. The accurateness of numerical analysis and the validity of design system are verified by the fluid field experiment of desingn example of the torque converter. This kind of design and analysis system for torque converter based on integration of comput ationol fluid dynamics (CFD) and CAD is a powerful tool for torque converter manufacturing, but also a prettg important significance for research and development.

  2. Parametric sensitivity of a CFD model concerning the hydrodynamics of trickle-bed reactor (TBR

    Directory of Open Access Journals (Sweden)

    Janecki Daniel

    2016-03-01

    Full Text Available The aim of the present study was to investigate the sensitivity of a multiphase Eulerian CFD model with respect to relations defining drag forces between phases. The mean relative error as well as standard deviation of experimental and computed values of pressure gradient and average liquid holdup were used as validation criteria of the model. Comparative basis for simulations was our own data-base obtained in experiments carried out in a TBR operating at a co-current downward gas and liquid flow. Estimated errors showed that the classical equations of Attou et al. (1999 defining the friction factors Fjk approximate experimental values of hydrodynamic parameters with the best agreement. Taking this into account one can recommend to apply chosen equations in the momentum balances of TBR.

  3. Computational Fluid Dynamics (CFD) Modeling for High Rate Pulverized Coal Injection (PCI) into the Blast Furnace

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Chenn Zhou

    2008-10-15

    Pulverized coal injection (PCI) into the blast furnace (BF) has been recognized as an effective way to decrease the coke and total energy consumption along with minimization of environmental impacts. However, increasing the amount of coal injected into the BF is currently limited by the lack of knowledge of some issues related to the process. It is therefore important to understand the complex physical and chemical phenomena in the PCI process. Due to the difficulty in attaining trus BF measurements, Computational fluid dynamics (CFD) modeling has been identified as a useful technology to provide such knowledge. CFD simulation is powerful for providing detailed information on flow properties and performing parametric studies for process design and optimization. In this project, comprehensive 3-D CFD models have been developed to simulate the PCI process under actual furnace conditions. These models provide raceway size and flow property distributions. The results have provided guidance for optimizing the PCI process.

  4. Improvement of AEP Predictions Using Diurnal CFD Modelling with Site-Specific Stability Weightings Provided from Mesoscale Simulation

    Science.gov (United States)

    Hristov, Y.; Oxley, G.; Žagar, M.

    2014-06-01

    The Bolund measurement campaign, performed by Danish Technical University (DTU) Wind Energy Department (also known as RISØ), provided significant insight into wind flow modeling over complex terrain. In the blind comparison study several modelling solutions were submitted with the vast majority being steady-state Computational Fluid Dynamics (CFD) approaches with two equation k-epsilon turbulence closure. This approach yielded the most accurate results, and was identified as the state-of-the-art tool for wind turbine generator (WTG) micro-siting. Based on the findings from Bolund, further comparison between CFD and field measurement data has been deemed essential in order to improve simulation accuracy for turbine load and long-term Annual Energy Production (AEP) estimations. Vestas Wind Systems A/S is a major WTG original equipment manufacturer (OEM) with an installed base of over 60GW in over 70 countries accounting for 19% of the global installed base. The Vestas Performance and Diagnostic Centre (VPDC) provides online live data to more than 47GW of these turbines allowing a comprehensive comparison between modelled and real-world energy production data. In previous studies, multiple sites have been simulated with a steady neutral CFD formulation for the atmospheric surface layer (ASL), and wind resource (RSF) files have been generated as a base for long-term AEP predictions showing significant improvement over predictions performed with the industry standard linear WAsP tool. In this study, further improvements to the wind resource file generation with CFD are examined using an unsteady diurnal cycle approach with a full atmospheric boundary layer (ABL) formulation, with the unique stratifications throughout the cycle weighted according to mesoscale simulated sectorwise stability frequencies.

  5. Improvement of AEP Predictions Using Diurnal CFD Modelling with Site-Specific Stability Weightings Provided from Mesoscale Simulation

    International Nuclear Information System (INIS)

    The Bolund measurement campaign, performed by Danish Technical University (DTU) Wind Energy Department (also known as RISØ), provided significant insight into wind flow modeling over complex terrain. In the blind comparison study several modelling solutions were submitted with the vast majority being steady-state Computational Fluid Dynamics (CFD) approaches with two equation k-ε turbulence closure. This approach yielded the most accurate results, and was identified as the state-of-the-art tool for wind turbine generator (WTG) micro-siting. Based on the findings from Bolund, further comparison between CFD and field measurement data has been deemed essential in order to improve simulation accuracy for turbine load and long-term Annual Energy Production (AEP) estimations. Vestas Wind Systems A/S is a major WTG original equipment manufacturer (OEM) with an installed base of over 60GW in over 70 countries accounting for 19% of the global installed base. The Vestas Performance and Diagnostic Centre (VPDC) provides online live data to more than 47GW of these turbines allowing a comprehensive comparison between modelled and real-world energy production data. In previous studies, multiple sites have been simulated with a steady neutral CFD formulation for the atmospheric surface layer (ASL), and wind resource (RSF) files have been generated as a base for long-term AEP predictions showing significant improvement over predictions performed with the industry standard linear WAsP tool. In this study, further improvements to the wind resource file generation with CFD are examined using an unsteady diurnal cycle approach with a full atmospheric boundary layer (ABL) formulation, with the unique stratifications throughout the cycle weighted according to mesoscale simulated sectorwise stability frequencies

  6. Accumulation and transport of microbial-size particles in a pressure protected model burn unit: CFD simulations and experimental evidence

    Directory of Open Access Journals (Sweden)

    Mimoun Maurice

    2011-03-01

    Full Text Available Abstract Background Controlling airborne contamination is of major importance in burn units because of the high susceptibility of burned patients to infections and the unique environmental conditions that can accentuate the infection risk. In particular the required elevated temperatures in the patient room can create thermal convection flows which can transport airborne contaminates throughout the unit. In order to estimate this risk and optimize the design of an intensive care room intended to host severely burned patients, we have relied on a computational fluid dynamic methodology (CFD. Methods The study was carried out in 4 steps: i patient room design, ii CFD simulations of patient room design to model air flows throughout the patient room, adjacent anterooms and the corridor, iii construction of a prototype room and subsequent experimental studies to characterize its performance iv qualitative comparison of the tendencies between CFD prediction and experimental results. The Electricité De France (EDF open-source software Code_Saturne® (http://www.code-saturne.org was used and CFD simulations were conducted with an hexahedral mesh containing about 300 000 computational cells. The computational domain included the treatment room and two anterooms including equipment, staff and patient. Experiments with inert aerosol particles followed by time-resolved particle counting were conducted in the prototype room for comparison with the CFD observations. Results We found that thermal convection can create contaminated zones near the ceiling of the room, which can subsequently lead to contaminate transfer in adjacent rooms. Experimental confirmation of these phenomena agreed well with CFD predictions and showed that particles greater than one micron (i.e. bacterial or fungal spore sizes can be influenced by these thermally induced flows. When the temperature difference between rooms was 7°C, a significant contamination transfer was observed to

  7. Application of CFD based wave loads in aeroelastic calculations

    DEFF Research Database (Denmark)

    Schløer, Signe; Paulsen, Bo Terp; Bredmose, Henrik

    2014-01-01

    realizations compare well with corresponding surface elevations from laboratory experiments. In aeroelastic calculations of an offshore wind turbine on a monopile foundation the hydrodynamic loads due to the potential flow solver and Morison’s equation and the hydrodynamic loads calculated by the coupled......Two fully nonlinear irregular wave realizations with different significant wave heights are considered. The wave realizations are both calculated in the potential flow solver Ocean-Wave3D and in a coupled domain decomposed potential-flow CFD solver. The surface elevations of the calculated wave...

  8. Towards a generic, reliable CFD modelling methodology for waste-fired grate boilers

    DEFF Research Database (Denmark)

    Rajh, Boštjan; Yin, Chungen; Samec, Niko;

    Computational Fluid Dynamics (CFD) is increasingly used in industry for detailed understanding of the combustion process and for appropriate design and optimization of Waste–to–Energy (WtE) plants. In this paper, CFD modelling of waste wood combustion in a 13 MW grate-fired boiler in a WtE plant is...... presented. To reduce the risk of slagging, optimize the temperature control and enhance turbulent mixing, part of the flue gas is recycled into the grate boiler. In the simulation, a 1D in–house bed model is developed to simulate the conversion of the waste wood in the fuel bed on the grate, which provides...

  9. Modeling chemical reactions in the indoor environment by CFD

    DEFF Research Database (Denmark)

    Sørensen, Dan Nørtoft; Weschler, Charles J.

    2002-01-01

    The concentrations of ozone and a terpene that react in the gas-phase to produce a hypothetical product were investigated by computational fluid dynamics (CFD) for two different air exchange rates. Ozone entered the room with the ventilation air. The terpenes were introduced as a localized source...... with an emission pattern similar to an air freshener; this was in contrast to an otherwise identical earlier study in which the terpene was introduced as a floor source with an emission pattern similar to a floor care product (Sørensen and Weschler, 2002). The results show that there are large concentration...

  10. Comparing different CFD wind turbine modelling approaches with wind tunnel measurements

    Science.gov (United States)

    Kalvig, Siri; Manger, Eirik; Hjertager, Bjørn

    2014-12-01

    The performance of a model wind turbine is simulated with three different CFD methods: actuator disk, actuator line and a fully resolved rotor. The simulations are compared with each other and with measurements from a wind tunnel experiment. The actuator disk is the least accurate and most cost-efficient, and the fully resolved rotor is the most accurate and least cost-efficient. The actuator line method is believed to lie in between the two ends of the scale. The fully resolved rotor produces superior wake velocity results compared to the actuator models. On average it also produces better results for the force predictions, although the actuator line method had a slightly better match for the design tip speed. The open source CFD tool box, OpenFOAM, was used for the actuator disk and actuator line calculations, whereas the market leading commercial CFD code, ANSYS/FLUENT, was used for the fully resolved rotor approach.

  11. Comparing different CFD wind turbine modelling approaches with wind tunnel measurements

    International Nuclear Information System (INIS)

    The performance of a model wind turbine is simulated with three different CFD methods: actuator disk, actuator line and a fully resolved rotor. The simulations are compared with each other and with measurements from a wind tunnel experiment. The actuator disk is the least accurate and most cost-efficient, and the fully resolved rotor is the most accurate and least cost-efficient. The actuator line method is believed to lie in between the two ends of the scale. The fully resolved rotor produces superior wake velocity results compared to the actuator models. On average it also produces better results for the force predictions, although the actuator line method had a slightly better match for the design tip speed. The open source CFD tool box, OpenFOAM, was used for the actuator disk and actuator line calculations, whereas the market leading commercial CFD code, ANSYS/FLUENT, was used for the fully resolved rotor approach

  12. Turbulence modeling needs of commercial CFD codes: Complex flows in the aerospace and automotive industries

    Science.gov (United States)

    Befrui, Bizhan A.

    1995-01-01

    This viewgraph presentation discusses the following: STAR-CD computational features; STAR-CD turbulence models; common features of industrial complex flows; industry-specific CFD development requirements; applications and experiences of industrial complex flows, including flow in rotating disc cavities, diffusion hole film cooling, internal blade cooling, and external car aerodynamics; and conclusions on turbulence modeling needs.

  13. FSI and CFD Modeling of Cerebral Aneurysm Model and Comparing to PIV Experiments

    Science.gov (United States)

    Wang, Zhaopeng; Hao, Qing

    2014-11-01

    Wall shear stress or strain is considered as an important factor for cerebral aneurysm growth and even rupture. The objective of present study is to evaluate wall shear stress in aneurysm sac and neck by Fluid Structure Interaction (FSI) and solid wall Computational Fluid Dynamics (CFD) approaches and compare the simulation results against Particle Image Velocimetry (PIV) experimental data from an elastic in vitro aneurysm model. The FSI and CFD simulation results showed that both approaches captured the flow patterns inside the aneurysm sac under pulsatile flow, that in diastole time period the flow inside the aneurysm sac was a stable circular clock-wise flow; when higher velocity entered into the aneurysm sac during systole and in a short diastole time period an anti-clock circular flow pattern emerged near the distal neck. Both approaches showed that the shear stress near the proximal neck experienced higher shear stress than the distal neck, while in the aneurysm dome the shear stress was always the lowest. In this study, we also showed that shear stress values at proximal neck and distal neck from FSI approach were lower than solid wall CFD approach.

  14. CFD simulations in the nuclear containment using the DES turbulence models

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Peng [School of Engineering, Sun Yat-Sen University, Guangzhou (China); Chen, Meilan [China Nuclear Power Technology Research Institute, Shenzhen (China); Li, Wanai, E-mail: liwai@mail.sysu.edu.cn [Sino-French Institute of Nuclear Engineering & Technology, Sun Yat-Sen University, Guangzhou (China); Liu, Yulan [School of Engineering, Sun Yat-Sen University, Guangzhou (China); Wang, Biao [Sino-French Institute of Nuclear Engineering & Technology, Sun Yat-Sen University, Guangzhou (China)

    2015-06-15

    Highlights: • The k-ε based DES model is used in the nuclear containment simulation. • The comparison of results between different turbulent models is obtained. • The superiority of DES models is analyzed. • The computational efficiency with the DES turbulence models is explained. - Abstract: Different species of gases would be released into the containment and cause unpredicted disasters during the nuclear severe accidents. It is important to accurately predict the transportation and stratification phenomena of these gas mixtures. CFD simulations of these thermal hydraulic issues in nuclear containment are investigated in this paper. The main work is to study the influence of turbulence model on the calculation of gas transportation and heat transfer. The k-ε based DES and other frequently used turbulence models are used in the steam and helium release simulation in THAI series experiment. This paper will show the superiority of the DES turbulence model in terms of computational efficiency and accuracy with the experimental results, and analyze the necessities of DES model to simulate the large-scale containment flows with both laminar and turbulence regions.

  15. Study on Numerical Simulation of Wind Energy Resources Based on WRF and CFD Models%基于WRF和CFD软件结合的风能资源数值模拟试验研究

    Institute of Scientific and Technical Information of China (English)

    方艳莹; 徐海明; 朱蓉; 王鹏; 何晓凤; Didier Delaunay; 付斌; 王黎

    2012-01-01

    运用中尺度数值模式WRF与法国CFD软件MeteodynwT相结合的方法(WRF/WT),进行了广东省海陵岛地区的水平分辨率100m×100m的风能资源数值模拟试验,采用海陵岛上7座测风塔观测资料对WRF/WT模式的模拟风场进行误差检验,并与WRF/WAsP模式系统对单点风能参数模拟误差进行对比,研究WRF/WT模式系统在风电场微观选址和分散式风电开发利用中应用的可行性。结果表明:中尺度模式与CFD软件结合的数值模拟方法对区域风能资源分布趋势的模拟比单纯应用CFD软件更准确;WRF/WT模式系统应用于复杂地形风能资源数值模拟评估是可行的,其对区域风能资源参数分布模拟的准确率与WRF/WAsP对2km范围内风能资源参数模拟的准确率相当;WRF/WT模式系统在风速频率分布不满足Weibull分布的情况下和陡峭地形条件下有较好的模拟效果,相对WRF/wAsP有明显优势。今后需进一步研究中尺度模式与CFD软件的衔接方法,以及对中尺度模式模拟结果的误差订正。%A combined model system (WRF/WT) of the mesoscale model WRF and the Meteodyn WT, a CFD model from France, was carried out the numerical simulation experiments of regional wind resources over Hailing Island of Guangdong Province with a horizontal resolution of 100 m × 100 m. The observa- tional data from 7 wind towers in Hailing Island were used to test the results modeled by WRF/WT, and compared with the simulated errors to the single-point wind parameters, thus studying the feasibility of WRF/WT model system in micro-siting for wind farm and the application of distributed development of wind power and utilization. The results showed that, the combined model system of mesoscale model and CFD model in simulating the trends of the regional wind energy resource distribution is more accurate than CFD model used only~ the WRF/WT model system used in complex terrain for wind

  16. A physical approach of the short-term wind power prediction based on CFD pre-calculated flow fields

    Institute of Scientific and Technical Information of China (English)

    LI Li; LIU Yong-qian; YANG Yong-ping; HAN Shuang; WANG Yi-mei

    2013-01-01

    A physical approach of the wind power prediction based on the CFD pre-calculated flow fields is proposed in this paper.The flow fields are obtained based on a steady CFD model with the discrete inflow wind conditions as the boundary conditions,and a database is established containing the important parameters including the inflow wind conditions,the flow fields and the corresponding wind power for each wind turbine.The power is predicted via the database by taking the Numerical Weather Prediction (NWP)wind as the input data.In order to evaluate the approach,the short-term wind power prediction for an actual wind farm is conducted as an example during the period of the year 2010.Compared with the measured power,the predicted results enjoy a high accuracy with the annual Root Mean Square Error (RMSE) of 15.2% and the annual MAE of 10.80%.A good performance is shown in predicting the wind power's changing trend.This approach is independent of the historical data and can be widely used for all kinds of wind farms including the newly-built wind farms.At the same time,it does not take much computation time while it captures the local air flows more precisely by the CFD model.So it is especially practical for engineering projects.

  17. Modelling of massive particulates for breakwater engineering using coupled FEMDEM and CFD

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The seaward slope of many breakwaters consists of thousands of interlocking units of rock or concrete comprising a massive granular system of large elements each weighing tens of tonnes.The dumped quarry materials in the core are protected by progressively coarser particulates.The outer armour layer of freely placed units is intended to both dissipate wave energy and remain structurally stable as strong flows are drawn in and out of the particulate core.Design guidance on the mass and shape of these units is based on empirical equations derived from sealed physical model tests.The main failure mode for armour layers exposed to severe storms is hydraulic instability where the armour units of concrete or rock are subjected to uplift and drag forces which can in turn lead to rocking,displacement and collisions sufficient to cause breakage of units.Recently invented armour unit designs making up such granular layered system owe much of their success to the desirable emergent properties of interlock and porosity and how these combine with individual unit structural strength and inertial mass. Fundamental understanding of the forces governing such wave-structure interaction remains poor.We use discrete element and combined finite-discrete element methods to model the granular solid skeleton of randomly packed units coupled to a CFD code which resolves the wave dynamics through an interface tracking technique.The CFD code exploits several methods including a compressive advection scheme, node movement, and general mesh optimization.We provide the engineering context and report progress towards the numerical modelling of instability in these massive granular systems.

  18. Well-posedness and convergence of cfd two-fluid model for bubbly flows

    Science.gov (United States)

    Vaidheeswaran, Avinash

    the presence of the wall boundaries need to be addressed in a CFD TFM. A near-wall modeling technique is proposed which takes into account the turbulent boundary conditions and void fraction distribution in the vicinity of the wall. An important consequence of using the proposed technique is that the need of wall force model, which is questionable when applied to air-water turbulent bubbly flows, is eliminated. Also the bubbly TFM near the wall becomes convergent. Finally, the well-posed CFD TFM developed in the present study is checked for grid convergence. Previous researchers have advocated the idea of fixing the minimum grid size based on bubble diameter. This has restricted a thorough verification exercise in the past. It is shown that the grid size criterion can be removed if the model is made well-posed, which also makes sense because a continuum model should be independent of grid size. It is observed that the solution from the coarse grid simulations is a limit cycle whereas upon grid refinement, the solution becomes chaotic which is characteristic of turbulent bubbly two-phase flows. Therefore the grid size restriction may have an unwanted consequence. FFT spectra and time averaged void fraction profiles are used to assess grid convergence since the solutions are chaotic. The energy spectra indicate the Kolmogorov -5/3 scaling commonly used to describe turbulent flows.

  19. High temperature gas-cooled pebble bed reactor steady state thermal-hydraulics analyses based on CFD method

    International Nuclear Information System (INIS)

    Background: Based on general purpose CFD code Fluent, the PBMR-400 full load nominal condition thermal-hydraulics performance was studied by applying local thermal non-equilibrium porous media model. Purpose: In thermal hydraulics study of the gas cooled pebble bed reactor, the core of the reactor can be treated as macroscopic porous media with strong inner heat source, and the original Fluent code can not handle it properly. Methods: By introducing a UDS in the calculation domain of the reactor core and subjoining a new resistance term, we develop a non-equilibrium porous media model which can give an accurate description of the core of the pebble bed. The mesh of CFD code is finer than that of the traditional pebble bed reactor thermal hydraulics analysis code such as THERMIX and TINTE, thus more information about coolant velocity fields, temperature field and solid phase temperature field can be acquired. Results: The nominal condition calculation results of the CFD code are compared to those of the well-established thermal-hydraulic code THERMIX and TINTE, and show a good consistency. Conclusion: The extended local thermal non-equilibrium model can be used to analyse thermal-hydraulics of high temperature pebble bed type reactor. (authors)

  20. A synergistic use of CFD, experiments and effective convectivity model to reduce uncertainty in BWR severe accident analysis

    International Nuclear Information System (INIS)

    In a previous work we presented an analysis approach developed to effectively and accurately assess thermal loads on vessel and structures in a Boiling Water Reactor (BWR) lower head during a severe accident. Central to the assessment is the Effective Convectivity Model (ECM) that makes use of experimental heat transfer correlations to capture the effect of turbulent natural convection in a volumetrically heated liquid pool, while retaining the pool three-dimensional energy splitting and ability to represent local heat transfer effects. Thanking to its features, the ECM is unique in enabling calculations of complex heat transfer phenomena during long severe accident transients that would not be otherwise feasible using higher-fidelity methods such as Computational Fluid Dynamics (CFD). Efficiency notwithstanding, the natural questions are: (i) how good are those ECM-calculated results, and, (ii) if required, what can be done (with the highest return-on-investment) to improve the quality of ECM prediction results. The approach refers to experiments and CFD simulations as the main resources to address (i) and (ii). However, validation of ECM against simulant-fluid experiments by itself does not reveal deficiencies (due to non-prototypicality factors). In the present work we focus on the use of CFD-based numerical 'experiments' to identify and quantify source of epistemic uncertainty in the calculated thermal loads due to modeling assumptions in ECM. Specifically, heat transfer correlations that underlie the ECM are obtained as surface-averaged (even though implemented as spatially distributed) and derived from experiments conducted at different geometries and using fluids that are not reactor prototypical (molten corium in the present case of severe accident). The CFD simulations exhibit so-called fluid Prandtl number effect on local peaking of the pool's downward heat flux for corium as working fluid. The main premise is a synergistic use of a fast-running model

  1. CFD modeling and experience of waste-to-energy plant burning waste wood

    OpenAIRE

    Rajh, B.; Yin, Chungen; Samec, N.; M. HRIBERSEK; Kokalj, F.

    2013-01-01

    Computational Fluid Dynamics (CFD) is being increasingly used in industry for in-depth understanding of the fundamental mixing, combustion, heat transfer and pollutant formation in combustion processes and for design and optimization of Waste-to-Energy (WtE) plants. In this paper, CFD modeling of waste wood combustion in a 13 MW grate-fired boiler in a WtE plant is presented. As a validation effort, the temperature profiles at a number of ports in the furnace are measured and the experimental...

  2. Dicty_cDB: CFD434 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD434 (Link to dictyBase) - - - Contig-U14176-1 CFD434E (Link to Original site) CFD...434F 639 CFD434Z 499 CFD434P 1138 CFD434E 968 Show CFD434 Library CF (Link to library) Clone ID CFD...inal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-B/CFD434Q.Seq.d/ Representative seq. ID CFD...434E (Link to Original site) Representative DNA sequence >CFD434 (CFD434Q) /CSM/CF/CFD4-B/CFD...0.0 CFK424 (CFK424Q) /CSM/CF/CFK4-A/CFK424Q.Seq.d/ 1003 0.0 CFD434 (CFD434Q) /CSM/CF/CFD4-B/CFD

  3. 3-D CFD Simulation and Validation of Oxygen-Rich Hydrocarbon Combustion in a Gas-Centered Swirl Coaxial Injector using a Flamelet-Based Approach

    Science.gov (United States)

    Richardson, Brian; Kenny, Jeremy

    2015-01-01

    Injector design is a critical part of the development of a rocket Thrust Chamber Assembly (TCA). Proper detailed injector design can maximize propulsion efficiency while minimizing the potential for failures in the combustion chamber. Traditional design and analysis methods for hydrocarbon-fuel injector elements are based heavily on empirical data and models developed from heritage hardware tests. Using this limited set of data produces challenges when trying to design a new propulsion system where the operating conditions may greatly differ from heritage applications. Time-accurate, Three-Dimensional (3-D) Computational Fluid Dynamics (CFD) modeling of combusting flows inside of injectors has long been a goal of the fluid analysis group at Marshall Space Flight Center (MSFC) and the larger CFD modeling community. CFD simulation can provide insight into the design and function of an injector that cannot be obtained easily through testing or empirical comparisons to existing hardware. However, the traditional finite-rate chemistry modeling approach utilized to simulate combusting flows for complex fuels, such as Rocket Propellant-2 (RP-2), is prohibitively expensive and time consuming even with a large amount of computational resources. MSFC has been working, in partnership with Streamline Numerics, Inc., to develop a computationally efficient, flamelet-based approach for modeling complex combusting flow applications. In this work, a flamelet modeling approach is used to simulate time-accurate, 3-D, combusting flow inside a single Gas Centered Swirl Coaxial (GCSC) injector using the flow solver, Loci-STREAM. CFD simulations were performed for several different injector geometries. Results of the CFD analysis helped guide the design of the injector from an initial concept to a tested prototype. The results of the CFD analysis are compared to data gathered from several hot-fire, single element injector tests performed in the Air Force Research Lab EC-1 test facility

  4. Evaluating the catching performance of aerodynamic rain gauges through field comparisons and CFD modelling

    Science.gov (United States)

    Pollock, Michael; Colli, Matteo; Stagnaro, Mattia; Lanza, Luca; Quinn, Paul; Dutton, Mark; O'Donnell, Greg; Wilkinson, Mark; Black, Andrew; O'Connell, Enda

    2016-04-01

    observed in the vicinity of the collector, compared to the standard gauge shapes. Both the air velocity and the turbulent kinetic energy fields present structures that may improve the interception of particles by the aerodynamic gauge collector. To provide empirical validation, a field-based experimental campaign was undertaken at four UK research stations to compare the results of aerodynamic and conventional gauges, mounted in juxtaposition. The reference measurement is recorded using a rain gauge pit, as specified by the WMO. The results appear to demonstrate how the effect of the wind on rainfall measurements is influenced by the gauge shape and the mounting height. Significant undercatch is observed compared to the reference measurement. Aerodynamic gauges mounted on the ground catch more rainfall than juxtaposed straight-sided gauges, in most instances. This appears to provide some preliminary validation of the CFD model. The indication that an aerodynamic profile improves the gauge catching capability could be confirmed by tracking the hydrometeor trajectories with a Lagrangian method, based on the available set of airflows; and investigating time-dependent aerodynamic features by means of dedicated CFD simulations. Furthermore, wind-tunnel tests could be carried out to provide more robust physical validation of the CFD model.

  5. CFD Simulations of a Regenerative Process for Carbon Dioxide Capture in Advanced Gasification Based Power Systems

    Energy Technology Data Exchange (ETDEWEB)

    Arastoopour, Hamid [Illinois Inst. of Technology, Chicago, IL (United States); Abbasian, Javad [Illinois Inst. of Technology, Chicago, IL (United States)

    2014-07-31

    This project describes the work carried out to prepare a highly reactive and mechanically strong MgO based sorbents and to develop a Population Balance Equations (PBE) approach to describe the evolution of the particle porosity distribution that is linked with Computational Fluid Dynamics (CFD) to perform simulations of the CO2 capture and sorbent regeneration. A large number of MgO-based regenerable sorbents were prepared using low cost and abundant dolomite as the base material. Among various preparation parameters investigated the potassium/magnesium (K/Mg) ratio was identified as the key variable affecting the reactivity and CO2 capacity of the sorbent. The optimum K/Mg ratio is about 0.15. The sorbent formulation HD52-P2 was identified as the “best” sorbent formulation and a large batch (one kg) of the sorbent was prepared for the detailed study. The results of parametric study indicate the optimum carbonation and regeneration temperatures are 360° and 500°C, respectively. The results also indicate that steam has a beneficial effect on the rate of carbonation and regeneration of the sorbent and that the reactivity and capacity of the sorbent decreases in the cycling process (sorbent deactivation). The results indicate that to achieve a high CO2 removal efficiency, the bed of sorbent should be operated at a temperature range of 370-410°C which also favors production of hydrogen through the WGS reaction. To describe the carbonation reaction kinetics of the MgO, the Variable Diffusivity shrinking core Model (VDM) was developed in this project, which was shown to accurately fit the experimental data. An important advantage of this model is that the changes in the sorbent conversion with time can be expressed in an explicit manner, which will significantly reduce the CFD computation time. A Computational Fluid Dynamic/Population Balance Equations (CFD/PBE) model was developed that accounts for the particle (sorbent) porosity distribution and a new version of

  6. Simulation of a MW rotor equipped with vortex generators using CFD and an actuator shape model

    DEFF Research Database (Denmark)

    Troldborg, Niels; Zahle, Frederik; Sørensen, Niels N.

    2015-01-01

    This article presents a comparison of CFD simulations of the DTU 10 MW reference wind turbine with and without vortex generators installed on the inboard part of the blades. The vortex generators are modelled by introducing body forces determined using a modified version of the so-called BAY mode...

  7. Integrated DEM–CFD modeling of the contact charging of pneumatically conveyed powders

    NARCIS (Netherlands)

    Korevaar, M.W.; Padding, J.T.; Hoef, van der M.A.; Kuipers, J.A.M.

    2014-01-01

    A model is proposed that incorporates contact charging (also known as triboelectric charging) of pneumatically conveyed powders in a DEM–CFD framework, which accounts for the electrostatic interactions, both between particles and between the particles and conducting walls. The simulation results rev

  8. Aspects of Using CFD for Wind Comfort Modeling Around Tall Buildings

    DEFF Research Database (Denmark)

    Rasmussen, Michael R.; Andersen, Lars

    2008-01-01

    The Light*House complex is investigated for uncomfortable wind climate and dangerous winds at pedestrian level. A CFD model is used for simulating the wind effect for 12 different directions and correlated to the wind statistics of a nearby meteorological station. Comparing to practical standards...

  9. Comparison of CFD Simulation of a Hyundai I20 Model with Four Different Turbulence Models

    Directory of Open Access Journals (Sweden)

    Vivekanandan

    2016-07-01

    Full Text Available This article describes the CFD analysis of a Hyundai i20 car Model. The focus of this study is to investigate the aerodynamics characteristics of Hyundai i20 car model and the flow obtained by solving the steady-state governing continuity equations as well as the momentum conservation equations combined with one of four turbulence models (1.Spalart-Allmaras 2.k-ε Standard 3.Transition k-kl-ω 4.Transition Shear Stress Transport (SST and the solutions obtained using these different models were compared. Except transition k-kl-ω model, other three models show nearly similar velocity variations plot. Pressure variation plot are almost similar with K-ε and transition-SST models. Eddy viscosity plot are almost similar with K-ε and transition k-kl-ω models

  10. CFD based propeller modelling and optimization

    OpenAIRE

    Greco, Luca; Testa, Claudio; Leone, Stefania; Salvatore, Francesco; Peri, Daniele; Mauro, Salvatore

    2012-01-01

    This report is written in fulfilment of deliverable D3.3 of the EU-FP7 project HyMAR. Aim of the project is to develop innovative hybrid drive train systems for small and medium size marine vehicles, by exploiting self-pitching propellers. In this context, the present report describes an automated optimal design procedure developed in the project and presents the results of applying this methodology to a practical self-pitching propeller design exercise. The proposed design procedure combines...

  11. Numerical modeling of immiscible two-phase flow in micro-models using a commercial CFD code

    Energy Technology Data Exchange (ETDEWEB)

    Crandall, Dustin; Ahmadia, Goodarz; Smith, Duane H.

    2009-01-01

    Off-the-shelf CFD software is being used to analyze everything from flow over airplanes to lab-on-a-chip designs. So, how accurately can two-phase immiscible flow be modeled flowing through some small-scale models of porous media? We evaluate the capability of the CFD code FLUENT{trademark} to model immiscible flow in micro-scale, bench-top stereolithography models. By comparing the flow results to experimental models we show that accurate 3D modeling is possible.

  12. CFD Simulations of a Regenerative Process for Carbon Dioxide Capture in Advanced Gasification Based Power Systems

    Energy Technology Data Exchange (ETDEWEB)

    Arastoopour, Hamid [Illinois Inst. of Technology, Chicago, IL (United States); Abbasian, Javad [Illinois Inst. of Technology, Chicago, IL (United States)

    2014-07-31

    This project describes the work carried out to prepare a highly reactive and mechanically strong MgO based sorbents and to develop a Population Balance Equations (PBE) approach to describe the evolution of the particle porosity distribution that is linked with Computational Fluid Dynamics (CFD) to perform simulations of the CO2 capture and sorbent regeneration. A large number of MgO-based regenerable sorbents were prepared using low cost and abundant dolomite as the base material. Among various preparation parameters investigated the potassium/magnesium (K/Mg) ratio was identified as the key variable affecting the reactivity and CO2 capacity of the sorbent. The optimum K/Mg ratio is about 0.15. The sorbent formulation HD52-P2 was identified as the “best” sorbent formulation and a large batch (one kg) of the sorbent was prepared for the detailed study. The results of parametric study indicate the optimum carbonation and regeneration temperatures are 360° and 500°C, respectively. The results also indicate that steam has a beneficial effect on the rate of carbonation and regeneration of the sorbent and that the reactivity and capacity of the sorbent decreases in the cycling process (sorbent deactivation). The results indicate that to achieve a high CO2 removal efficiency, the bed of sorbent should be operated at a temperature range of 370-410°C which also favors production of hydrogen through the WGS reaction. To describe the carbonation reaction kinetics of the MgO, the Variable Diffusivity shrinking core Model (VDM) was developed in this project, which was shown to accurately fit the experimental data. An important advantage of this model is that the changes in the sorbent conversion with time can be expressed in an explicit manner, which will significantly reduce the CFD computation time. A Computational Fluid Dynamic/Population Balance Equations (CFD/PBE) model was developed that accounts for the particle (sorbent) porosity distribution and a new version of

  13. COMPUTATIONAL FLUID DYNAMICS MODELING OF SCALED HANFORD DOUBLE SHELL TANK MIXING - CFD MODELING SENSITIVITY STUDY RESULTS

    Energy Technology Data Exchange (ETDEWEB)

    JACKSON VL

    2011-08-31

    The primary purpose of the tank mixing and sampling demonstration program is to mitigate the technical risks associated with the ability of the Hanford tank farm delivery and celtification systems to measure and deliver a uniformly mixed high-level waste (HLW) feed to the Waste Treatment and Immobilization Plant (WTP) Uniform feed to the WTP is a requirement of 24590-WTP-ICD-MG-01-019, ICD-19 - Interface Control Document for Waste Feed, although the exact definition of uniform is evolving in this context. Computational Fluid Dynamics (CFD) modeling has been used to assist in evaluating scaleup issues, study operational parameters, and predict mixing performance at full-scale.

  14. Numerical simulation and CFD-Based Correlation of Erosion Threshold Gas Velocity in Pipe Bends

    Directory of Open Access Journals (Sweden)

    K A Ibrahim1

    2010-04-01

    Full Text Available

    This paper presents numerical simulation of sand erosion phenomena in curved ducts. The Eulerian-Lagrangian approach is used to simulate the gas-solid two-phase flow while semi-empirical model is used to calculate the erosion rate. The effect of solid phase on the gas phase is included in the model. The model prediction is validated with the available experimental data and good agreement was obtained. Based on many predictions of the maximum penetration rate, a CFD based correlation is developed to calculate the penetration rate in bends. From this equation a model to predict the erosional velocity was developed. The present results showed that the flow velocity should be decreased as the mass loading ratio, particle size, pipe diameter increase in order to avoid failure.

  15. Development of a CFD Model for Secondary Final Settling Tanks in Water Pollution Control Plants

    Science.gov (United States)

    Gong, Minwei; Xanthos, Savvas; Ramalingam, Krish; Fillos, John

    2007-11-01

    To assess performance and evaluate alternatives to improve efficiency of the New York City the Wards Island Water Pollution Control Plant (WPCP) FSTs at peak loads, a 3D CFD model has been developed. Fluent was utilized as the base platform, where sub-models of the Suspended Solids (SS), settling characteristics, density currents and SS flocculation were incorporated. This was supplemented by field and bench scale experiments to quantify the coefficients integral to the sub-models. Model calibration and validation have been carried out by using the extensive set of data collected. The model can be used to evaluate different modes of operation, alternate hydraulic and solids loading rates, as well as addition of auxiliary components such as baffles to improve process performance. The model is being used to compare potential benefits for different alternatives of design and operation of the existing FSTs. After comparing series of inlet baffles, a baffle with 4 horizontal and 7 vertical slots has been recommended for installation in the FSTs. Additional baffle type, configurations and locations within the tank are also being evaluated to improve the performance of the FSTs especially during periods of poor settling and peak flow conditions.

  16. Multiphase CFD modeling of nearfield fate of sediment plumes

    DEFF Research Database (Denmark)

    Saremi, Sina; Hjelmager Jensen, Jacob

    2014-01-01

    . The two-phase mixture solution based on the drift-flux method is evaluated for 3D simulation of material disposal and overflow discharge from the hoppers. The model takes into account the hindrance and resistance mechanisms in the mixture and is capable of describing the flow details within the plumes...

  17. CFD modeling of methane distribution at a continuous miner face with various curtain setback distances

    Institute of Scientific and Technical Information of China (English)

    Zhou Lihong; Pritchard Christopher; Zheng Yi

    2015-01-01

    Knowledge of the airflow patterns and methane distributions at a continuous miner face under different ventilation conditions can minimize the risks of explosion and injury to miners by accurately forecasting potentially hazardous face methane levels. This study focused on validating a series of computational fluid dynamics (CFD) models using full-scale ventilation gallery data that assessed how curtain setback distance impacted airflow patterns and methane distributions at an empty mining face (no continuous miner present). Three CFD models of face ventilation with 4.6, 7.6 and 10.7 m (15, 25, and 35 ft) blowing curtain setback distances were constructed and validated with experimental data collected in a full-scale ventilation test facility. Good agreement was obtained between the CFD simulation results and this data. Detailed airflow and methane distribution information are provided. Elevated methane zones at the working faces were identified with the three curtain setback distances. Visualization of the setback dis-tance impact on the face methane distribution was performed by utilizing the post-processing capability of the CFD software.

  18. CFD modeling of the turbulent precipitation of plutonium oxalate in a vortex reactor

    International Nuclear Information System (INIS)

    Full text of publication follows:The nuclear fuel reprocessing, as it is done in La Hague COGEMA's plant, involves a precipitation in an un-baffled stirred tank to turn plutonium nitrate into plutonium oxalate prior to a calcination for using it in MOX fuel (Mixed Oxides). In every crystallization and precipitation (reactive crystallization), the key variable is sur-saturation, resulting from either a chemical reaction between two liquids, a liquid and a solid, a gas and a solid, or a decrease in the product solubility induced by temperature gradient or mixing of a solvent and an anti-solvent. According to the local sur-saturation degree, different mechanisms may occur leading to the solid dispersed phase: nucleation, growth and eventually aggregation, breakage and ripening. The challenge in that kind of modeling lies in the non linear behavior of the physical and chemical phenomenons, and in the different time and length scales involved which can not be solved without resorting to computational fluid dynamics (CFD). The modeling philosophy used here is divided in two parts: (1) a lower mesh statistical mixing model (FM-PDF) and a liquid energy spectrum model coupled to the RANS equations, for taking into account the continuous liquid phase mixing at various levels: reactor scale, turbulent dispersion and molecular diffusion; (2) a population balance model for the solid dispersed phase to link flow pattern to the morphology and chemical properties of particles. Many approaches have been developed so far to solve PBE but the recent breakthrough that allowed implementation of that equation in CFD codes is QMOM: quadrature method of moments, that represents the particle size distribution (PSD) in a finite number of delta functions, corresponding to abscissas and weights of the quadrature, which are used to calculate the mean particle size or whatever moment of the PSD. Part (1) has been successfully validated experimentally by means of an acid-base neutralization

  19. Dicty_cDB: CFD333 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD333 (Link to dictyBase) - - - Contig-U16560-1 CFD333P (Link to Original site) CFD...333F 126 CFD333Z 727 CFD333P 853 - - Show CFD333 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-B/CFD333Q.Seq.d/ Representative seq. ID CFD...333P (Link to Original site) Representative DNA sequence >CFD333 (CFD333Q) /CSM/CF/CFD3-B/CFD3...kiqd k*rl Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD333 (CFD333Q) /CSM/CF/CFD3-B/CFD

  20. Dicty_cDB: CFD143 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD143 (Link to dictyBase) - - - Contig-U12897-1 CFD143P (Link to Original site) CFD...143F 637 CFD143Z 415 CFD143P 1052 - - Show CFD143 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-B/CFD143Q.Seq.d/ Representative seq. ID CFD...143P (Link to Original site) Representative DNA sequence >CFD143 (CFD143Q) /CSM/CF/CFD1-B/CFD...equences producing significant alignments: (bits) Value CFD143 (CFD143Q) /CSM/CF/CFD1-B/CFD143Q.Seq.d/ 1491

  1. Dicty_cDB: CFD372 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD372 (Link to dictyBase) - - - Contig-U16560-1 CFD372P (Link to Original site) CFD...372F 119 CFD372Z 734 CFD372P 853 - - Show CFD372 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-C/CFD372Q.Seq.d/ Representative seq. ID CFD...372P (Link to Original site) Representative DNA sequence >CFD372 (CFD372Q) /CSM/CF/CFD3-C/CFD3...ki qdkegip Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD372 (CFD372Q) /CSM/CF/CFD3-C/CFD

  2. Dicty_cDB: CFD389 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD389 (Link to dictyBase) - - - Contig-U13875-1 CFD389P (Link to Original site) CFD...389F 614 CFD389Z 228 CFD389P 842 - - Show CFD389 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-D/CFD389Q.Seq.d/ Representative seq. ID CFD...389P (Link to Original site) Representative DNA sequence >CFD389 (CFD389Q) /CSM/CF/CFD3-D/CFD3...-cDNA Score E Sequences producing significant alignments: (bits) Value CFD389 (CFD389Q) /CSM/CF/CFD3-D/CFD38

  3. Dicty_cDB: CFD207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD207 (Link to dictyBase) - - - Contig-U16560-1 CFD207P (Link to Original site) CFD...207F 120 CFD207Z 579 CFD207P 699 - - Show CFD207 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-A/CFD207Q.Seq.d/ Representative seq. ID CFD...207P (Link to Original site) Representative DNA sequence >CFD207 (CFD207Q) /CSM/CF/CFD2-A/CFD2...t alignments: (bits) Value CFD207 (CFD207Q) /CSM/CF/CFD2-A/CFD207Q.Seq.d/ 1088 0.0 CHD396 (CHD396Q) /CSM/CH/

  4. Dicty_cDB: CFD536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD536 (Link to dictyBase) - - - Contig-U16361-1 CFD536P (Link to Original site) CFD...536F 552 CFD536Z 517 CFD536P 1069 - - Show CFD536 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-B/CFD536Q.Seq.d/ Representative seq. ID CFD...536P (Link to Original site) Representative DNA sequence >CFD536 (CFD536Q) /CSM/CF/CFD5-B/CFD...xsyhahniv Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD536 (CFD536Q) /CSM/CF/CFD5-B/CFD

  5. Dicty_cDB: CFD408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD408 (Link to dictyBase) - - - Contig-U16243-1 CFD408P (Link to Original site) CFD...408F 596 CFD408Z 618 CFD408P 1214 - - Show CFD408 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-A/CFD408Q.Seq.d/ Representative seq. ID CFD...408P (Link to Original site) Representative DNA sequence >CFD408 (CFD408Q) /CSM/CF/CFD4-A/CFD...significant alignments: (bits) Value CFD408 (CFD408Q) /CSM/CF/CFD4-A/CFD408Q.Seq.

  6. Dicty_cDB: CFD208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD208 (Link to dictyBase) - - - Contig-U15889-1 CFD208P (Link to Original site) CFD...208F 620 CFD208Z 562 CFD208P 1182 - - Show CFD208 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-A/CFD208Q.Seq.d/ Representative seq. ID CFD...208P (Link to Original site) Representative DNA sequence >CFD208 (CFD208Q) /CSM/CF/CFD2-A/CFD...DNA Score E Sequences producing significant alignments: (bits) Value CFD208 (CFD208Q) /CSM/CF/CFD2-A/CFD208Q

  7. Dicty_cDB: CFD247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD247 (Link to dictyBase) - - - Contig-U16273-1 CFD247P (Link to Original site) CFD...247F 623 CFD247Z 396 CFD247P 1019 - - Show CFD247 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-B/CFD247Q.Seq.d/ Representative seq. ID CFD...247P (Link to Original site) Representative DNA sequence >CFD247 (CFD247Q) /CSM/CF/CFD2-B/CFD... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD247 (CFD247Q) /CSM/CF/CFD2-B/CFD

  8. Dicty_cDB: CFD446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD446 (Link to dictyBase) - - - Contig-U16560-1 CFD446P (Link to Original site) CFD...446F 119 CFD446Z 725 CFD446P 844 - - Show CFD446 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-B/CFD446Q.Seq.d/ Representative seq. ID CFD...446P (Link to Original site) Representative DNA sequence >CFD446 (CFD446Q) /CSM/CF/CFD4-B/CFD4...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD446 (CFD446Q) /CSM/CF/CFD4-B/CFD

  9. Dicty_cDB: CFD483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD483 (Link to dictyBase) - - - Contig-U16339-1 CFD483P (Link to Original site) CFD...483F 622 CFD483Z 379 CFD483P 1001 - - Show CFD483 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-D/CFD483Q.Seq.d/ Representative seq. ID CFD...483P (Link to Original site) Representative DNA sequence >CFD483 (CFD483Q) /CSM/CF/CFD4-D/CFD...ducing significant alignments: (bits) Value CFD483 (CFD483Q) /CSM/CF/CFD4-D/CFD483Q.Seq.d/ 1717 0.0 SFJ650 (

  10. Dicty_cDB: CFD270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD270 (Link to dictyBase) - - - Contig-U16560-1 CFD270P (Link to Original site) CFD...270F 119 CFD270Z 712 CFD270P 831 - - Show CFD270 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-C/CFD270Q.Seq.d/ Representative seq. ID CFD...270P (Link to Original site) Representative DNA sequence >CFD270 (CFD270Q) /CSM/CF/CFD2-C/CFD2...cing significant alignments: (bits) Value CFD270 (CFD270Q) /CSM/CF/CFD2-C/CFD270Q.Seq.d/ 1328 0.0 AFB143 (AF

  11. Dicty_cDB: CFD349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD349 (Link to dictyBase) - - - Contig-U15323-1 CFD349P (Link to Original site) CFD...349F 461 CFD349Z 643 CFD349P 1104 - - Show CFD349 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-C/CFD349Q.Seq.d/ Representative seq. ID CFD...349P (Link to Original site) Representative DNA sequence >CFD349 (CFD349Q) /CSM/CF/CFD3-C/CFD...-cDNA Score E Sequences producing significant alignments: (bits) Value CFD349 (CFD349Q) /CSM/CF/CFD3-C/CFD

  12. Dicty_cDB: CFD223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD223 (Link to dictyBase) - - - Contig-U16452-1 CFD223P (Link to Original site) CFD...223F 595 CFD223Z 416 CFD223P 1011 - - Show CFD223 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-A/CFD223Q.Seq.d/ Representative seq. ID CFD...223P (Link to Original site) Representative DNA sequence >CFD223 (CFD223Q) /CSM/CF/CFD2-A/CFD...DNA Score E Sequences producing significant alignments: (bits) Value CFD223 (CFD223Q) /CSM/CF/CFD2-A/CFD223Q

  13. Dicty_cDB: CFD216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD216 (Link to dictyBase) - - - Contig-U16368-1 CFD216P (Link to Original site) CFD...216F 604 CFD216Z 406 CFD216P 1010 - - Show CFD216 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-A/CFD216Q.Seq.d/ Representative seq. ID CFD...216P (Link to Original site) Representative DNA sequence >CFD216 (CFD216Q) /CSM/CF/CFD2-A/CFD...Score E Sequences producing significant alignments: (bits) Value CFD216 (CFD216Q) /CSM/CF/CFD2-A/CFD216Q.Seq

  14. Dicty_cDB: CFD244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD244 (Link to dictyBase) - - - Contig-U16511-1 CFD244P (Link to Original site) CFD...244F 686 CFD244Z 674 CFD244P 1360 - - Show CFD244 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-B/CFD244Q.Seq.d/ Representative seq. ID CFD...244P (Link to Original site) Representative DNA sequence >CFD244 (CFD244Q) /CSM/CF/CFD2-B/CFD...FG6-D/SFG691Q.Seq.d/ 759 0.0 CFD244 (CFD244Q) /CSM/CF/CFD2-B/CFD244Q.Seq.d/ 759 0

  15. Dicty_cDB: CFD741 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD741 (Link to dictyBase) - - - Contig-U11551-1 CFD741P (Link to Original site) CFD...741F 646 CFD741Z 330 CFD741P 976 - - Show CFD741 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-B/CFD741Q.Seq.d/ Representative seq. ID CFD...741P (Link to Original site) Representative DNA sequence >CFD741 (CFD741Q) /CSM/CF/CFD7-B/CFD7...re E Sequences producing significant alignments: (bits) Value CFD741 (CFD741Q) /CSM/CF/CFD7-B/CFD

  16. Dicty_cDB: CFD229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD229 (Link to dictyBase) - - - Contig-U16287-1 CFD229P (Link to Original site) CFD...229F 583 CFD229Z 668 CFD229P 1251 - - Show CFD229 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-B/CFD229Q.Seq.d/ Representative seq. ID CFD...229P (Link to Original site) Representative DNA sequence >CFD229 (CFD229Q) /CSM/CF/CFD2-B/CFD...cing significant alignments: (bits) Value CFD229 (CFD229Q) /CSM/CF/CFD2-B/CFD229Q.Seq.d/ 2381 0.0 SLB722 (SL

  17. Dicty_cDB: CFD380 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD380 (Link to dictyBase) - - - Contig-U16381-1 CFD380P (Link to Original site) CFD...380F 124 CFD380Z 580 CFD380P 704 - - Show CFD380 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-D/CFD380Q.Seq.d/ Representative seq. ID CFD...380P (Link to Original site) Representative DNA sequence >CFD380 (CFD380Q) /CSM/CF/CFD3-D/CFD3...g significant alignments: (bits) Value CFD380 (CFD380Q) /CSM/CF/CFD3-D/CFD380Q.Seq.d/ 684 0.0 SLH820 (SLH820

  18. Dicty_cDB: CFD650 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD650 (Link to dictyBase) - - - Contig-U13873-1 CFD650P (Link to Original site) CFD...650F 516 CFD650Z 631 CFD650P 1147 - - Show CFD650 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-C/CFD650Q.Seq.d/ Representative seq. ID CFD...650P (Link to Original site) Representative DNA sequence >CFD650 (CFD650Q) /CSM/CF/CFD6-C/CFD...klkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD650 (CFD650Q) /CSM/CF/CFD6-C/CFD

  19. Dicty_cDB: CFD471 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD471 (Link to dictyBase) - - - Contig-U16241-1 CFD471P (Link to Original site) CFD...471F 641 CFD471Z 497 CFD471P 1138 - - Show CFD471 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-C/CFD471Q.Seq.d/ Representative seq. ID CFD...471P (Link to Original site) Representative DNA sequence >CFD471 (CFD471Q) /CSM/CF/CFD4-C/CFD...cDNA Score E Sequences producing significant alignments: (bits) Value CFD471 (CFD471Q) /CSM/CF/CFD4-C/CFD471

  20. Dicty_cDB: CFD826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD826 (Link to dictyBase) - - - Contig-U14187-1 CFD826P (Link to Original site) CFD...826F 546 CFD826Z 289 CFD826P 835 - - Show CFD826 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-B/CFD826Q.Seq.d/ Representative seq. ID CFD...826P (Link to Original site) Representative DNA sequence >CFD826 (CFD826Q) /CSM/CF/CFD8-B/CFD8...quences producing significant alignments: (bits) Value CFD826 (CFD826Q) /CSM/CF/CFD8-B/CFD826Q.Seq.d/ 985 0.

  1. Modeling flow inside an anaerobic digester by CFD techniques

    Directory of Open Access Journals (Sweden)

    Alexandra Martínez Mendoza, Tatiana Montoya Martínez, Vicente Fajardo Montañana, P. Amparo López Jiménez

    2011-11-01

    Full Text Available Anaerobic processes are used to treat high strength organic wastewater as well as for the treatment of primary and secondary sludge from conventional wastewater treatment plants. In these processes, heterotrophic microorganisms convert biodegradable organic matter to methane and carbon dioxide in the absence of dissolved oxygen and nitrate. Some of the most important aspects of the design of anaerobic digesters are related to hydraulic considerations. In spite of its important role in performance, hydraulics of flow inside digesters has not been quantified or adequately characterized. In this contribution a three-dimensional steady-state computational fluid dynamics (CFD simulation has been performed for a particular anaerobic digester, in order to visualize the flow patterns. Flow and velocities profiles have been represented inside the digester to identify possible dead zones or stratifications. The geometry of a real digester installed in Valencia Waste Water Treatment Plant (located in Quart-Benager, Valencia, Spain has been used in order to consider the proposed methodology.

  2. Modelling die filling with charged particles using DEM/CFD

    Institute of Scientific and Technical Information of China (English)

    Emmanuel Nkem Nwose; Chunlei Pei; Chuan-Yu Wu

    2012-01-01

    The effects of electrostatic charge on powder flow behaviour during die filling in a vacuum and in air were analysed using a coupled discrete element method and computational fluid dynamics (DEM/CFD) code,in which long range electrostatic interactions were implemented.The present 2D simulations revealed that both electrostatic charge and the presence of air can affect the powder flow behaviour during die filling.It was found that the electrostatic charge inhibited the flow of powders into the die and induced a loose packing structure.At the same filling speed,increasing the electrostatic charge led to a decrease in the fill ratio which quantifies the volumetric occupancy of powder in the die.In addition,increasing the shoe speed caused a further decrease in the fill ratio,which was characterised using the concept of critical filling speed.When the electrostatic charge was low,the air/particle interaction was strong so that a lower critical filling speed was obtained for die filling in air than in a vacuum.With high electrostatic charge,the electrostatic interactions became dominant.Consequently,similar fill ratio and critical filling speed were obtained for die filling in air and in a vacuum.

  3. Optimization of centrifugal pump cavitation performance based on CFD

    Science.gov (United States)

    Xie, S. F.; Wang, Y.; Liu, Z. C.; Zhu, Z. T.; Ning, C.; Zhao, L. F.

    2015-01-01

    In order to further improve the cavitation performance of a centrifugal pump, slots on impeller blade near inlet were studied and six groups of hydraulic model were designed. Base on cavitating flow feature inside a centrifugal pump, bubble growth and implosion are calculated from the Rayleigh-Plesset equation which describes the dynamic behavior of spherical bubble and RNG κ-epsilon model was employed to simulate and analyze the internal two-phase flow of the model pump under the same conditions. The simulation results show that slots on blade near inlet could improve the cavitation performance and cavitation performance improvement of the second group was more obvious. Under the same conditions, the pressure on the back of blade near inlet was higher than the pressure on the back of unmodified blade near inlet, and energy distribution in the flow channel between the two blades was more uniform with a small change of head.

  4. Application Of CFD To Modeling Of Squeeze Mode Magnetorheological Dampers

    Directory of Open Access Journals (Sweden)

    Gołdasz Janusz

    2015-09-01

    Full Text Available The so-called squeeze flow involves a magnetorheological (MR fluid sandwiched between two planar surfaces setting up a flow channel. The height of the channel varies according to a prescribed displacement or force profile. When exposed to a magnetic field of sufficient strength MR fluids develop a yield stress. In squeeze-mode devices the yield stress varies with both the magnetic field magnitude and the channel height. In this paper an unsteady flow model of an MR fluid in squeeze mode is proposed. The model is developed in Ansys Fluent R16. The MR material flow model is based on the apparent viscosity approach. In order to investigate the material's behaviour the authors prepared a model of an idealized squeeze-mode damper in which the fluid flow is enforced by varying the height of the channel. Using mesh animation, the model plate is excited, and as the mesh moves, the fluid is squeezed out of the gap. In the simulations the model is subjected to a range of displacement inputs of frequencies from 10 to 20 Hz, and local yield stress levels up to 30 kPa. The results are presented in the form of time histories of the normal force on the squeezing plate and loops of force vs. displacement (velocity.

  5. CFD modelling and validation of wall condensation in the presence of non-condensable gases

    Energy Technology Data Exchange (ETDEWEB)

    Zschaeck, G., E-mail: guillermo.zschaeck@ansys.com [ANSYS Germany GmbH, Staudenfeldweg 12, Otterfing 83624 (Germany); Frank, T. [ANSYS Germany GmbH, Staudenfeldweg 12, Otterfing 83624 (Germany); Burns, A.D. [ANSYS UK Ltd, 97 Milton Park, Abingdon, Oxfordshire OX14 4RY (United Kingdom)

    2014-11-15

    Highlights: • A wall condensation model was implemented and validated in ANSYS CFX. • Condensation rate is assumed to be controlled by the concentration boundary layer. • Validation was done using two laboratory scale experiments. • CFD calculations show good agreement with experimental data. - Abstract: The aim of this paper is to present and validate a mathematical model implemented in ANSYS CFD for the simulation of wall condensation in the presence of non-condensable substances. The model employs a mass sink at isothermal walls or conjugate heat transfer (CHT) domain interfaces where condensation takes place. The model was validated using the data reported by Ambrosini et al. (2008) and Kuhn et al. (1997)

  6. Dicty_cDB: CFD543 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD543 (Link to dictyBase) - - - Contig-U16450-1 CFD543F (Link to Original site) CFD...543F 628 - - - - - - Show CFD543 Library CF (Link to library) Clone ID CFD543 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-B/CFD543Q.Seq.d/ Representative seq. ID CFD54...3F (Link to Original site) Representative DNA sequence >CFD543 (CFD543Q) /CSM/CF/CFD5-B/CFD543Q.Seq.d/ GTTTT...*ihktipn*igsimwpstkkkffnyqsl*fktsngkfpswskdlptwparnhatal ragtvsfylspkmtsdapadpsrdvffqnsihsspfgnctkyyentnnatctacfd

  7. Dicty_cDB: CFD460 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD460 (Link to dictyBase) - - - Contig-U16450-1 CFD460F (Link to Original site) CFD...460F 627 - - - - - - Show CFD460 Library CF (Link to library) Clone ID CFD460 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-C/CFD460Q.Seq.d/ Representative seq. ID CFD46...0F (Link to Original site) Representative DNA sequence >CFD460 (CFD460Q) /CSM/CF/CFD4-C/CFD460Q.Seq.d/ AAATA...PQWPARNHATAL RAGTVSFYLSPKMTSDAPADPSQDVFFQNSIHSSPFGNCTKYYENTNNATCTACFDLPMD ISPGLYI

  8. A Simplified CFD Model for Simulation of the Suction Process Of Reciprocating Compressors

    OpenAIRE

    Pereira, Evandro L. L.; Santos, Claudio J.; Deschamps, Cesar J.; Kremer, Rodrigo

    2012-01-01

    The suction process in reciprocating compressors is strongly affected by the valve dynamics and the pulsating flow throughout the suction muffler. This paper describes a simplified computational fluid dynamics (CFD) model to simulate the flow through the muffler, suction valve and a small region inside the cylinder. The proposed method is applied to predict the suction process of a small reciprocating compressor and its adequacy is compared with a more time elaborate model in terms of accurac...

  9. CFD modeling of reaction and mass transfer through a single pellet:Catalytic oxidative coupling of methane

    Institute of Scientific and Technical Information of China (English)

    Siavash Seyednej adian; Nakisa Yaghobi; Ramin Maghrebi; Leila Vafajoo

    2011-01-01

    In this study a mathematical model of a small scale single pellet for the oxidative coupling of methane (OCM) over titanite pervoskité isdeveloped.The method is based on a computational fluid dynamics (CFD) code which known as Fluent may be adopted to model the reactions that take place inside the porous catalyst pellet.The steady state single pellet model is coupled with a kinetic model and the intra-pellet concentration profiles of species are provided.Subsequent to achieving this goal,a nonlinear reaction network consisting of nine catalytic reactions and one gas phase reaction as an external program is successfully implemented to CFD-code as a reaction term in solving the equations.This study is based on the experimental design which is conducted in a differential reactor with a Sn/BaTiO3 catalyst (7-8 mesh) at atmospheric pressure,GHSV of 12000 h-1,ratio of methane to oxygen of 2,and three different temperatures of 1023,1048 and 1073 K.The modeling results such as selectivity and conversion at the pellet exit are in good agreement with the experimental data.Therefore,it is suggested that to achieve high yield in OCM process the modeling of the single pellet should be considered as the heart of catalytic fixed bed reactor.

  10. CFD based performance analysis of a solar air heater duct provided with artificial roughness

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sharad; Saini, R.P. [Alternate Hydro Energy Centre, Indian Institute of Technology Roorkee, AHEC, Roorkee, Uttarakhand 247667 (India)

    2009-05-15

    In the present work the performance of a solar air heater duct provided with artificial roughness in the form of thin circular wire in arc shaped geometry has been analysed using Computational Fluid Dynamics (CFD). The effect of arc shaped geometry on heat transfer coefficient, friction factor and performance enhancement was investigated covering the range of roughness parameter (relative roughness height (e/D) from 0.0299 to 0.0426 and relative roughness angle ({alpha}/90) from 0.333 to 0.666) and working parameter (Reynolds number, Re from 6000 to 18,000 and solar radiation of 1000 W/m2). Different turbulent models have been used for the analysis and their results are compared. Renormalization-group (RNG) k-{epsilon} model based results have been found in good agreement and accordingly this model is used to predict heat transfer and friction factor in the duct. The overall enhancement ratio has been calculated in order to discuss the overall effect of the roughness and working parameters. A maximum value of overall enhancement ratio has been found to be as 1.7 for the range of parameters investigated. (author)

  11. Local CFD kinetic model of cadmium vaporization during fluid bed incineration of municipal solid waste

    Energy Technology Data Exchange (ETDEWEB)

    Soria, J. [Instituto Multidisciplinario de Investigación y Desarrollo de la Patagonia Norte (IDEPA, CONICET-UNCo) y Facultad de Ingeniería, Universidad Nacional del Comahue, Buenos Aires 1400, 8300 Neuquén (Argentina); Laboratoire Procédés, Matériaux et Energie Solaire (CNRS-PROMES), 7 Rue du Four Solaire, Odeillo, 66120 Font-Romeu (France); Gauthier, D., E-mail: Daniel.Gauthier@promes.cnrs.fr [Laboratoire Procédés, Matériaux et Energie Solaire (CNRS-PROMES), 7 Rue du Four Solaire, Odeillo, 66120 Font-Romeu (France); Falcoz, Q.; Flamant, G. [Laboratoire Procédés, Matériaux et Energie Solaire (CNRS-PROMES), 7 Rue du Four Solaire, Odeillo, 66120 Font-Romeu (France); Mazza, G. [Instituto Multidisciplinario de Investigación y Desarrollo de la Patagonia Norte (IDEPA, CONICET-UNCo) y Facultad de Ingeniería, Universidad Nacional del Comahue, Buenos Aires 1400, 8300 Neuquén (Argentina)

    2013-03-15

    Highlights: ► A 2-D local CFD model for simulating the Cd vaporization process is presented. ► It includes a kinetic expression of Cd vaporization into the incineration process. ► Pyrolysis, volatiles’ combustion and residual carbon combustion are also taken into account. ► It fits very well the experimental results obtained on a lab-scale fluidized bed reported in literature. ► It also compares favorably with a model developed previously by the group. -- Abstract: The emissions of heavy metals during incineration of Municipal Solid Waste (MSW) are a major issue to health and the environment. It is then necessary to well quantify these emissions in order to accomplish an adequate control and prevent the heavy metals from leaving the stacks. In this study the kinetic behavior of Cadmium during Fluidized Bed Incineration (FBI) of artificial MSW pellets, for bed temperatures ranging from 923 to 1073 K, was modeled. FLUENT 12.1.4 was used as the modeling framework for the simulations and implemented together with a complete set of user-defined functions (UDFs). The CFD model combines the combustion of a single solid waste particle with heavy metal (HM) vaporization from the burning particle, and it takes also into account both pyrolysis and volatiles’ combustion. A kinetic rate law for the Cd release, derived from the CFD thermal analysis of the combusting particle, is proposed. The simulation results are compared with experimental data obtained in a lab-scale fluidized bed incinerator reported in literature, and with the predicted values from a particulate non-isothermal model, formerly developed by the authors. The comparison shows that the proposed CFD model represents very well the evolution of the HM release for the considered range of bed temperature.

  12. A CFD numerical model for the flow distribution in a MTR fuel element

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Delvonei Alves de; Santos, Pedro Henrique Di Giovanni; Oliveira, Fabio Branco Vaz de; Torres, Walmir Maximo; Umbehaun, Pedro Ernesto; Souza, Jose Antonio Batista de; Belchior Junior, Antonio; Sabundjian, Gaiane; Prado, Adelk de Carvalho, E-mail: acprado@ipen.br, E-mail: delvonei@ipen.br, E-mail: dpedro_digiovanni_s@hotmail.com, E-mail: fabio@ipen.br, E-mail: wmtorres@ipen.br, E-mail: umbehaun@ipen.br, E-mail: jasouza@ipen.br, E-mail: abelchior@ipen.br, E-mail: gdjian@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Engenharia Nuclear; Angelo, Edvaldo, E-mail: eangelo@mackenzie.br [Universidade Presbiteriana Mackenzie, Sao Paulo, SP (Brazil); Angelo, Gabriel, E-mail: gangelo@fei.edu.br [Fundacao Educacional Inaciana (FEI), Sao Bernardo do Campo, SP (Brazil)

    2015-07-01

    Previously, an instrumented dummy fuel element (DMPV-01), with the same geometric characteristics of a MTR fuel element, was designed and constructed for pressure drop and flow distribution measurement experiments at the IEA-R1 reactor core. This dummy element was also used to measure the flow distribution among the rectangular flow channels formed by element fuel plates. A CFD numerical model was developed to complement the studies. This work presents the proposed CFD model as well as a comparison between numerical and experimental results of flow rate distribution among the internal flow channels. Numerical results show that the model reproduces the experiments very well and can be used for the studies as a more convenient and complementary tool. (author)

  13. Numerical estimation of wall friction ratio near the pseudo-critical point with CFD-models

    International Nuclear Information System (INIS)

    In this paper, the STAR-CCM+ CFD code is used in the attempt to reproduce the values of friction factor observed in experimental data at supercritical pressures at various operating conditions. A short survey of available data and correlations for smooth pipe friction in circular pipes puts the basis for the discussion, reporting observed trends of friction factor in the liquid-like and the gas-like regions and within the transitional region across the pseudo-critical temperature. For smooth pipes, a general decrease of the friction factor in the transitional region is reported, constituting one of the relevant effects to be predicted by the computational fluid-dynamic models. A limited number of low-Reynolds number models are adopted, making use of refined near-wall discretisation as required by the constraint y+ < 1 at the wall. In particular, the Lien k–ε and the SST k–ω models are considered. The values of the wall shear stress calculated by the code are then post-processed on the basis of bulk fluid properties to obtain the Fanning and then the Darcy–Weisbach friction factors, based on their classical definitions. The obtained values are compared with those provided by experimental tests and correlations, finding a reasonable qualitative agreement. Expectedly, the agreement is better in the gas-like and liquid-like regions, where fluid property changes are moderate, than in the transitional region, where the trends provided by available correlations are reproduced only in a qualitative way

  14. A CFD model for biomass combustion in a packed bed furnace

    Science.gov (United States)

    Karim, Md. Rezwanul; Ovi, Ifat Rabbil Qudrat; Naser, Jamal

    2016-07-01

    Climate change has now become an important issue which is affecting environment and people around the world. Global warming is the main reason of climate change which is increasing day by day due to the growing demand of energy in developed countries. Use of renewable energy is now an established technique to decrease the adverse effect of global warming. Biomass is a widely accessible renewable energy source which reduces CO2 emissions for producing thermal energy or electricity. But the combustion of biomass is complex due its large variations and physical structures. Packed bed or fixed bed combustion is the most common method for the energy conversion of biomass. Experimental investigation of packed bed biomass combustion is difficult as the data collection inside the bed is challenging. CFD simulation of these combustion systems can be helpful to investigate different operational conditions and to evaluate the local values inside the investigation area. Available CFD codes can model the gas phase combustion but it can't model the solid phase of biomass conversion. In this work, a complete three-dimensional CFD model is presented for numerical investigation of packed bed biomass combustion. The model describes the solid phase along with the interface between solid and gas phase. It also includes the bed shrinkage due to the continuous movement of the bed during solid fuel combustion. Several variables are employed to represent different parameters of solid mass. Packed bed is considered as a porous bed and User Defined Functions (UDFs) platform is used to introduce solid phase user defined variables in the CFD. Modified standard discrete transfer radiation method (DTRM) is applied to model the radiation heat transfer. Preliminary results of gas phase velocity and pressure drop over packed bed have been shown. The model can be useful for investigation of movement of the packed bed during solid fuel combustion.

  15. Massive separation around bluff bodies: comparisons among different cfd solvers and turbulence models

    Science.gov (United States)

    Armenio, Vincenzo; Fakhari, Ahmad; Petronio, Andrea; Padovan, Roberta; Pittaluga, Chiara; Caprino, Giovanni

    2015-11-01

    Massive flow separation is ubiquitous in industrial applications, ruling drag and hydrodynamic noise. In spite of considerable efforts, its numerical prediction still represents a challenge for CFD models in use in engineering. Aside commercial software, over the latter years the opensource software OpenFOAMR (OF) has emerged as a valid tool for prediction of complex industrial flows. In the present work, we simulate two flows representative of a class of situations occurring in industrial problems: the flow around sphere and that around a wall-mounted square cylinder at Re = 10000 . We compare the performance two different tools, namely OF and ANSYS CFX 15.0 (CFX) using different unstructured grids and turbulence models. The grids have been generated using SNAPPYHEXMESH and ANSYS ICEM CFD 15.0 with different near wall resolutions. The codes have been run in a RANS mode using k - ɛ model (OF) and SST - k - ω (CFX) with and without wall-layer models. OF has been also used in LES, WMLES and DES mode. Regarding the sphere, RANS models were not able to catch separation, while good prediction of separation and distribution of stresses over the surface were obtained using LES, WMLES and DES. Results for the second test case are currently under analysis. Financial support from COSMO ``cfd open source per opera mortta'' PAR FSC 2007-2013, Friuli Venezia Giulia.

  16. Local CFD kinetic model of cadmium vaporization during fluid bed incineration of municipal solid waste.

    Science.gov (United States)

    Soria, J; Gauthier, D; Falcoz, Q; Flamant, G; Mazza, G

    2013-03-15

    The emissions of heavy metals during incineration of Municipal Solid Waste (MSW) are a major issue to health and the environment. It is then necessary to well quantify these emissions in order to accomplish an adequate control and prevent the heavy metals from leaving the stacks. In this study the kinetic behavior of Cadmium during Fluidized Bed Incineration (FBI) of artificial MSW pellets, for bed temperatures ranging from 923 to 1073 K, was modeled. FLUENT 12.1.4 was used as the modeling framework for the simulations and implemented together with a complete set of user-defined functions (UDFs). The CFD model combines the combustion of a single solid waste particle with heavy metal (HM) vaporization from the burning particle, and it takes also into account both pyrolysis and volatiles' combustion. A kinetic rate law for the Cd release, derived from the CFD thermal analysis of the combusting particle, is proposed. The simulation results are compared with experimental data obtained in a lab-scale fluidized bed incinerator reported in literature, and with the predicted values from a particulate non-isothermal model, formerly developed by the authors. The comparison shows that the proposed CFD model represents very well the evolution of the HM release for the considered range of bed temperature. PMID:23410804

  17. Semi-analytical and 3D CFD DPAL modeling: feasibility of supersonic operation

    Science.gov (United States)

    Rosenwaks, Salman; Barmashenko, Boris D.; Waichman, Karol

    2014-02-01

    The feasibility of operating diode pumped alkali lasers (DPALs) with supersonic expansion of the gaseous laser mixture, consisting of alkali atoms, He atoms and (frequently) hydrocarbon molecules, is explored. Taking into account fluid dynamics and kinetic processes, both semi-analytical and three-dimensional (3D) computational fluid dynamics (CFD) modeling of supersonic DPALs is reported. Using the semi-analytical model, the operation of supersonic DPALs is compared with that measured and modeled in subsonic lasers for both Cs and K. The maximum power of supersonic Cs and K lasers is found to be higher than that of subsonic lasers with the same resonator and alkali density at the laser inlet by 25% and 70%, respectively. Using the 3D CFD model, the flow pattern and spatial distributions of the pump and laser intensities in the resonator are calculated for Cs DPALs. Comparison between the semi-analytical and 3D CFD models for Cs shows that the latter predicts much larger maximum achievable laser power than the former. These results indicate that for scaling-up the power of DPALs, supersonic expansion should be considered.

  18. Dicty_cDB: CFD525 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD525 (Link to dictyBase) - - - Contig-U16366-1 CFD525P (Link to Original site) CFD5...25F 531 CFD525Z 540 CFD525P 1071 - - Show CFD525 Library CF (Link to library) Clone ID CFD5...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-B/CFD525Q.Seq.d/ Representative seq. ID CFD5...25P (Link to Original site) Representative DNA sequence >CFD525 (CFD525Q) /CSM/CF/CFD5-B/CFD5...kfqhlnllrvi pp Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD525 (CFD525Q) /CSM/CF/CFD5

  19. Dicty_cDB: CFD791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD791 (Link to dictyBase) - - - Contig-U16368-1 CFD791P (Link to Original site) CFD...791F 599 CFD791Z 357 CFD791P 956 - - Show CFD791 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-D/CFD791Q.Seq.d/ Representative seq. ID CFD...791P (Link to Original site) Representative DNA sequence >CFD791 (CFD791Q) /CSM/CF/CFD7-D/CFD7...lasmic reticulum >> prediction for CFD791 is exc 5' end seq. ID CFD791F 5' end seq. >CFD

  20. CFD modelling of an open core downdraft moving bed biomass gasifier; Modelado de un gasificador estratificado de lecho movil de biomasa, utilizando CFD

    Energy Technology Data Exchange (ETDEWEB)

    Rogel-Ramirez, A [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)]. E-mail: ARogelR@iingen.unam.mx

    2008-10-15

    This paper contains the description of a bidimensional Computational Fluid Dynamics (CFD), model Developer to simulate the flow and reaction in a stratified downdraft biomass gasifier, whereby Eulerian conservation equations are solved for particle and gas phase components, velocities and specific enthalpies. The model is based on the PHOENICS package and represents a tool which can be used in gasifier analysis and design. Contributions of chemical kinetics and the mixing rate using the EBU approach are considered in the gas phase global homogeneous reactions. The harmonic blending of chemical kinetics and mass transfer effects, determine the global heterogeneous reactions between char and O{sub 2}, CO{sub 2} and H{sub 2}O. The turbulence effect in the gas phase is accounted by the standard {kappa}-{epsilon} approach. The model provides information of the producer gas composition, velocities and temperature at the outlet, and allows different operating parameters and feed properties to be changed. Finally, a comparison with experimental data available in literature was done, which showed satisfactory agreement from a qualitative point of view, though further validation is required. [Spanish] Este estudio describe un modelo numerico bidimensional, basado en Dinamica de Fluidos Computacional (CFD), desarrollado para simular el flujo y las reacciones que ocurren en un gasificador estratificado de flujos paralelos, en el que se resuelven ecuaciones de conservacion Eulerianas para los componentes de la fase gaseosa, la fase solida, velocidades y entalpias especificas. El modelo esta basado en el codigo PHOENICS y representa una herramienta que puede ser utilizada en el analisis y diseno de gasificadores. En las reacciones globales homogeneas se consideran las contribuciones de la cinetica quimica y la rapidez de mezclado, usando el modelo Eddy Brake-UP (EBU). La medida harmonica de la cinetica quimica y la transferencia de masa, determinan las velocidades globales de

  1. A CFD model for analysis of performance, water and thermal distribution, and mechanical related failure in PEM fuel cells

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi

    2016-07-01

    Full Text Available This paper presents a comprehensive three–dimensional, multi–phase, non-isothermal model of a Proton Exchange Membrane (PEM fuel cell that incorporates significant physical processes and key parameters affecting the fuel cell performance. The model construction involves equations derivation, boundary conditions setting, and solution algorithm flow chart. Equations in gas flow channels, gas diffusion layers (GDLs, catalyst layers (CLs, and membrane as well as equations governing cell potential and hygro-thermal stresses are described. The algorithm flow chart starts from input of the desired cell current density, initialization, iteration of the equations solution, and finalizations by calculating the cell potential. In order to analyze performance, water and thermal distribution, and mechanical related failure in the cell, the equations are solved using a computational fluid dynamic (CFD code. Performance analysis includes a performance curve which plots the cell potential (Volt against nominal current density (A/cm2 as well as losses. Velocity vectors of gas and liquid water, liquid water saturation, and water content profile are calculated. Thermal distribution is then calculated together with hygro-thermal stresses and deformation. The CFD model was executed under boundary conditions of 20°C room temperature, 35% relative humidity, and 1 MPA pressure on the lower surface. Parameters values of membrane electrode assembly (MEA and other base conditions are selected. A cell with dimension of 1 mm x 1 mm x 50 mm is used as the object of analysis. The nominal current density of 1.4 A/cm2 is given as the input of the CFD calculation. The results show that the model represents well the performance curve obtained through experiment. Moreover, it can be concluded that the model can help in understanding complex process in the cell which is hard to be studied experimentally, and also provides computer aided tool for design and optimization of PEM

  2. Validation of Hydrodynamic Load Models Using CFD for the OC4-DeepCwind Semisubmersible: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Benitz, M. A.; Schmidt, D. P.; Lackner, M. A.; Stewart, G. M.; Jonkman, J.; Robertson, A.

    2015-03-01

    Computational fluid dynamics (CFD) simulations were carried out on the OC4-DeepCwind semi-submersible to obtain a better understanding of how to set hydrodynamic coefficients for the structure when using an engineering tool such as FAST to model the system. The focus here was on the drag behavior and the effects of the free-surface, free-ends and multi-member arrangement of the semi-submersible structure. These effects are investigated through code-to-code comparisons and flow visualizations. The implications on mean load predictions from engineering tools are addressed. The work presented here suggests that selection of drag coefficients should take into consideration a variety of geometric factors. Furthermore, CFD simulations demonstrate large time-varying loads due to vortex shedding, which FAST's hydrodynamic module, HydroDyn, does not model. The implications of these oscillatory loads on the fatigue life needs to be addressed.

  3. Validation and Analysis of Forward Osmosis CFD Model in Complex 3D Geometries

    Directory of Open Access Journals (Sweden)

    Lars Yde

    2012-11-01

    Full Text Available In forward osmosis (FO, an osmotic pressure gradient generated across a semi-permeable membrane is used to generate water transport from a dilute feed solution into a concentrated draw solution. This principle has shown great promise in the areas of water purification, wastewater treatment, seawater desalination and power generation. To ease optimization and increase understanding of membrane systems, it is desirable to have a comprehensive model that allows for easy investigation of all the major parameters in the separation process. Here we present experimental validation of a computational fluid dynamics (CFD model developed to simulate FO experiments with asymmetric membranes. Simulations are compared with experimental results obtained from using two distinctly different complex three-dimensional membrane chambers. It is found that the CFD model accurately describes the solute separation process and water permeation through membranes under various flow conditions. It is furthermore demonstrated how the CFD model can be used to optimize membrane geometry in such as way as to promote the mass transfer.

  4. Modeling and Simulation of Hamburger Cooking Process Using Finite Difference and CFD Methods

    Directory of Open Access Journals (Sweden)

    J. Sargolzaei

    2011-01-01

    Full Text Available Unsteady-state heat transfer in hamburger cooking process was modeled using one dimensional finite difference (FD and three dimensional computational fluid dynamic (CFD models. A double-sided cooking system was designed to study the effect of pressure and oven temperature on the cooking process. Three different oven temperatures (114, 152, 204°C and three different pressures (20, 332, 570 pa were selected and 9 experiments were performed. Applying pressure to hamburger increases the contact area of hamburger with heating plate and hence the heat transfer rate to the hamburger was increased and caused the weight loss due to water evaporation and decreasing cooking time, while increasing oven temperature led to increasing weight loss and decreasing cooking time. CFD predicted results were in good agreement with the experimental results than the finite difference (FD ones. But considering the long time needed for CFD model to simulate the cooking process (about 1 hour, using the finite difference model would be more economic.

  5. ZEUS-DO: A Design Oriented CFD-Based Unsteady Aerodynamic Capability for Flight Vehicle Multidisciplinary Configuration Shape Optimization Project

    Data.gov (United States)

    National Aeronautics and Space Administration — CFD-based design-oriented (DO) steady/unsteady aerodynamic analysis tools for Aeroelastic / Aeroservoelastic (AE/ASE) evaluation lag significantly behind other...

  6. Numerical modelling in building thermo-aeraulics: from CFD modelling to an hybrid finite volume / zonal approach; Modelisation numerique de la thermoaeraulique du batiment: des modeles CFD a une approche hybride volumes finis / zonale

    Energy Technology Data Exchange (ETDEWEB)

    Bellivier, A.

    2004-05-15

    For 3D modelling of thermo-aeraulics in building using field codes, it is necessary to reduce the computing time in order to model increasingly larger volumes. The solution suggested in this study is to couple two modelling: a zonal approach and a CFD approach. The first part of the work that was carried out is the setting of a simplified CFD modelling. We propose rules for use of coarse grids, a constant effective viscosity law and adapted coefficients for heat exchange in the framework of building thermo-aeraulics. The second part of this work concerns the creation of fluid Macro-Elements and their coupling with a calculation of CFD finite volume type. Depending on the boundary conditions of the problem, a local description of the driving flow is proposed via the installation and use of semi-empirical evolution laws. The Macro-Elements is then inserted in CFD computation: the values of velocity calculated by the evolution laws are imposed on the CFD cells corresponding to the Macro-Element. We use these two approaches on five cases representative of thermo-aeraulics in buildings. The results are compared with experimental data and with traditional RANS simulations. We highlight the significant gain of time that our approach allows while preserving a good quality of numerical results. (author)

  7. CFD and Ventilation Research

    DEFF Research Database (Denmark)

    Li, Y.; Nielsen, Peter V.

    2011-01-01

    of scientific research and engineering development of complex air distribution and ventilation systems in buildings. This review discusses the major and specific challenges of CFD in terms of turbulence modelling, numerical approximation, and boundary conditions relevant to building ventilation. We emphasize...... the growing need for CFD verification and validation, suggest on-going needs for analytical and experimental methods to support the numerical solutions, and discuss the growing capacity of CFD in opening up new research areas. We suggest that CFD has not become a replacement for experiment and theoretical......There has been a rapid growth of scientific literature on the application of computational fluid dynamics (CFD) in the research of ventilation and indoor air science. With a 1000–10,000 times increase in computer hardware capability in the past 20 years, CFD has become an integral part...

  8. Low Reynolds turbulence model CFD simulation for complex electronic system: an industrial point of view

    Science.gov (United States)

    Giannuzzi, M.

    2014-07-01

    In electronic systems the presence of bluff bodies, sharp corners and bends are the cause of flow separation and large recirculation bubbles. Since the recirculation vortices develop they encapsulate the heat from an electronic component becoming one of the major contributors of malfunction. Going in depth in this, some numerical simulations of conjugate heat transfer for a heat wall-mounted cube have been performed using the commercial CFD code scSTREAM V11 by Software Cradle Co, Ltd. It is well known that the reliability of CFD analysis depends heavily on the turbulent model employed together with the wall functions implemented. The three low- Reynolds k - epsilon turbulent models developed by Abe-Nagano-Kondoh have been validated against experimental data consisting mainly of velocity profiles and surface temperature distributions provided in literature. The performed validation shows a satisfactory agreement between the measured and simulated data. The turbulent model chosen is then used for the CFD simulation of a complex electronic system.

  9. Low Reynolds turbulence model CFD simulation for complex electronic system: an industrial point of view

    International Nuclear Information System (INIS)

    In electronic systems the presence of bluff bodies, sharp corners and bends are the cause of flow separation and large recirculation bubbles. Since the recirculation vortices develop they encapsulate the heat from an electronic component becoming one of the major contributors of malfunction. Going in depth in this, some numerical simulations of conjugate heat transfer for a heat wall-mounted cube have been performed using the commercial CFD code scSTREAM V11 by Software Cradle Co, Ltd. It is well known that the reliability of CFD analysis depends heavily on the turbulent model employed together with the wall functions implemented. The three low- Reynolds k – ε turbulent models developed by Abe-Nagano-Kondoh have been validated against experimental data consisting mainly of velocity profiles and surface temperature distributions provided in literature. The performed validation shows a satisfactory agreement between the measured and simulated data. The turbulent model chosen is then used for the CFD simulation of a complex electronic system.

  10. A review of Computational Fluid Dynamics (CFD) airflow modelling over aeolian landforms

    Science.gov (United States)

    Smyth, Thomas A. G.

    2016-09-01

    Aeolian landforms occur on all earths' continents as well as on Mars, Titan and Venus and are typically formed where sediment is eroded and/or deposited by near surface wind flow. As wind flow approaches an aeolian landform, secondary flow patterns are created that cause wind to deviate in both speed and direction, producing complex patterns of sediment erosion, deposition and transportation. Computational Fluid Dynamics (CFD) modelling of wind flow has become a common tool to predict and understand secondary wind flow and resulting sediment transport. Its use has progressed from simulating wind flow over simple two dimensional dune shapes, to calculating a multitude of flow parameters over a range of increasingly complex landforms. Analysis of 25 peer reviewed journal articles, found that CFD has been crucial to providing additional insight to flow dynamics on the stoss slope of dunes, the structure and nature of wind flow separation in the lee of landforms and information on localised wind flow variations in large-scale dune fields. The findings of this assay demonstrate that further research is required regarding the parameterisation and modelling of surface roughness, the incorporation of accurate sediment transport to wind flow models, and the prediction of topographic surface changes. CFD is anticipated to be increasingly utilised in aeolian geomorphology and this work aims to be a starting point for aeolian geomorphologists wishing to better understand and review the utilisation of the technique to date.

  11. Application of CFD techniques toward the validation of nonlinear aerodynamic models

    Science.gov (United States)

    Schiff, L. B.; Katz, J.

    1985-01-01

    Applications of computational fluid dynamics (CFD) methods to determine the regimes of applicability of nonlinear models describing the unsteady aerodynamic responses to aircraft flight motions are described. The potential advantages of computational methods over experimental methods are discussed and the concepts underlying mathematical modeling are reviewed. The economic and conceptual advantages of the modeling procedure over coupled, simultaneous solutions of the gas dynamic equations and the vehicle's kinematic equations of motion are discussed. The modeling approach, when valid, eliminates the need for costly repetitive computation of flow field solutions. For the test cases considered, the aerodynamic modeling approach is shown to be valid.

  12. CFD simulation of neutral ABL flows

    OpenAIRE

    Zhang, Xiaodong

    2009-01-01

    This work is to evaluate the CFD prediction of Atmospheric Boundary Layer flow field over different terrains employing Fluent 6.3 software. How accurate the simulation could achieve depend on following aspects: viscous model, wall functions, agreement of CFD model with inlet wind velocity profile and top boundary condition. Fluent employ wall function roughness modifications based on data from experiments with sand grain roughened pipes and channels, describe wall adjacent zone with Roughness...

  13. A workflow for patient-individualized virtual angiogram generation based on CFD simulation.

    Science.gov (United States)

    Endres, Jürgen; Kowarschik, Markus; Redel, Thomas; Sharma, Puneet; Mihalef, Viorel; Hornegger, Joachim; Dörfler, Arnd

    2012-01-01

    Increasing interest is drawn on hemodynamic parameters for classifying the risk of rupture as well as treatment planning of cerebral aneurysms. A proposed method to obtain quantities such as wall shear stress, pressure, and blood flow velocity is to numerically simulate the blood flow using computational fluid dynamics (CFD) methods. For the validation of those calculated quantities, virtually generated angiograms, based on the CFD results, are increasingly used for a subsequent comparison with real, acquired angiograms. For the generation of virtual angiograms, several patient-specific parameters have to be incorporated to obtain virtual angiograms which match the acquired angiograms as best as possible. For this purpose, a workflow is presented and demonstrated involving multiple phantom and patient cases. PMID:23193428

  14. A Workflow for Patient-Individualized Virtual Angiogram Generation Based on CFD Simulation

    Directory of Open Access Journals (Sweden)

    Jürgen Endres

    2012-01-01

    Full Text Available Increasing interest is drawn on hemodynamic parameters for classifying the risk of rupture as well as treatment planning of cerebral aneurysms. A proposed method to obtain quantities such as wall shear stress, pressure, and blood flow velocity is to numerically simulate the blood flow using computational fluid dynamics (CFD methods. For the validation of those calculated quantities, virtually generated angiograms, based on the CFD results, are increasingly used for a subsequent comparison with real, acquired angiograms. For the generation of virtual angiograms, several patient-specific parameters have to be incorporated to obtain virtual angiograms which match the acquired angiograms as best as possible. For this purpose, a workflow is presented and demonstrated involving multiple phantom and patient cases.

  15. CFD simulation of hemodynamics in sequential and individual coronary bypass grafts based on multislice CT scan datasets.

    Science.gov (United States)

    Hajati, Omid; Zarrabi, Khalil; Karimi, Reza; Hajati, Azadeh

    2012-01-01

    There is still controversy over the differences in the patency rates of the sequential and individual coronary artery bypass grafting (CABG) techniques. The purpose of this paper was to non-invasively evaluate hemodynamic parameters using complete 3D computational fluid dynamics (CFD) simulations of the sequential and the individual methods based on the patient-specific data extracted from computed tomography (CT) angiography. For CFD analysis, the geometric model of coronary arteries was reconstructed using an ECG-gated 64-detector row CT. Modeling the sequential and individual bypass grafting, this study simulates the flow from the aorta to the occluded posterior descending artery (PDA) and the posterior left ventricle (PLV) vessel with six coronary branches based on the physiologically measured inlet flow as the boundary condition. The maximum calculated wall shear stress (WSS) in the sequential and the individual models were estimated to be 35.1 N/m(2) and 36.5 N/m(2), respectively. Compared to the individual bypass method, the sequential graft has shown a higher velocity at the proximal segment and lower spatial wall shear stress gradient (SWSSG) due to the flow splitting caused by the side-to-side anastomosis. Simulated results combined with its surgical benefits including the requirement of shorter vein length and fewer anastomoses advocate the sequential method as a more favorable CABG method. PMID:23365974

  16. Dynamic analysis of the pump system based on MOC–CFD coupled method

    International Nuclear Information System (INIS)

    Highlights: • MOC–CFD coupled method was proposed to get the pump internal and external characteristics. • The coupled strategy and procedure were explained. • Some typical simulation cases were made for different factors. • The pump head deviation grows with the severity of the transient. • Valve closure law in linear and longer pipeline will cause higher pump head deviation. - Abstract: The dynamic characteristics of pump response to transient events were investigated by combining the Method of Characteristic (MOC) and Computational Fluid Dynamics (CFD) together. In a typical pump–pipeline–valve system, similar to the reactor system, the pump is treated as three-dimensional CFD model using Fluent code, whereas the rest is represented by one-dimensional components using MOC. A description of the coupling theory and procedure ensuring proper communication within the two codes is given. Several transient flow operations have been carried out. In the initial steady-state simulation, the coupled method could accurately find the operating condition of the pump when the valve is fully open. When the valve is closed rapidly, preliminary comparative calculations demonstrate that the coupled method is efficient in simulating the dynamic behavior of the pump and capable of getting detailed fluid field evolutions inside the pump. Deviation between the dynamic pump head and the value given by the steady-state curve at the same instantaneous flow-rate was established, and the cause of the deviation was further explained by the comparison of pump internal and external characteristics. Furthermore, it was found that the deviation grows with the severity of the transient. In addition, the effects of valve closure laws and pipe length on the pump dynamic performances were evaluated. All the results showed that MOC–CFD is an efficient and promising way for simulating the interaction between pump model and piping system

  17. Combining CFD simulations with blockoriented heatflow-network model for prediction of photovoltaic energy-production

    Science.gov (United States)

    Haber, I. E.; Farkas, I.

    2011-01-01

    The exterior factors which influencing the working circumstances of photovoltaic modules are the irradiation, the optical air layer (Air Mass - AM), the irradiation angle, the environmental temperature and the cooling effect of the wind. The efficiency of photovoltaic (PV) devices is inversely proportional to the cell temperature and therefore the mounting of the PV modules can have a big affect on the cooling, due to wind flow-around and naturally convection. The construction of the modules could be described by a heatflow-network model, and that can define the equation which determines the cells temperature. An equation like this can be solved as a block oriented model with hybrid-analogue simulator such as Matlab-Simulink. In view of the flow field and the heat transfer, witch was calculated numerically, the heat transfer coefficients can be determined. Five inflow rates were set up for both pitched and flat roof cases, to let the trend of the heat transfer coefficient know, while these functions can be used for the Matlab/Simulink model. To model the free convection flows, the Boussinesq-approximation were used, integrated into the Navier-Stokes equations and the energy equation. It has been found that under a constant solar heat gain, the air velocity around the modules and behind the pitched-roof mounted module is increasing, proportionately to the wind velocities, and as result the heat transfer coefficient increases linearly, and can be described by a function in both cases. To the block based model the meteorological parameters and the results of the CFD simulations as single functions were attached. The final aim was to make a model that could be used for planning photovoltaic systems, and define their accurate performance for better sizing of an array of modules.

  18. Electrical capacitance tomography (ECT) and gamma radiation meter for comparison with and validation and tuning of computational fluid dynamics (CFD) modeling of multiphase flow

    International Nuclear Information System (INIS)

    The electrical capacitance tomographic (ECT) approach is increasingly seen as attractive for measurement and control applications in the process industries. Recently, there is increased interest in using the tomographic details from ECT for comparing with and validating and tuning CFD models of multiphase flow. Collaboration with researchers working in the field of computational fluid dynamics (CFD) modeling of multiphase flows gives valuable information for both groups of researchers in the field of ECT and CFD. By studying the ECT tomograms of multiphase flows under carefully monitored inflow conditions of the different media and by obtaining the capacitance values, C(i, j, t) with i = 1…N, j = 1, 2,…N and i ≠ j obtained from ECT modules with N electrodes, it is shown how the interface heights in a pipe with stratified flow of oil and air can be fruitfully compared to the values of those obtained from ECT and gamma radiation meter (GRM) for improving CFD modeling. Monitored inflow conditions in this study are flow rates of air, water and oil into a pipe which can be positioned at varying inclinations to the horizontal, thus emulating the pipelines laid in subsea installations. It is found that ECT-based tomograms show most of the features seen in the GRM-based visualizations with nearly one-to-one correspondence to interface heights obtained from these two methods, albeit some anomalies at the pipe wall. However, there are some interesting features the ECT manages to capture: features which the GRM or the CFD modeling apparently do not show, possibly due to parameters not defined in the inputs to the CFD model or much slower response of the GRM. Results presented in this paper indicate that a combination of ECT and GRM and preferably with other modalities with enhanced data fusion and analysis combined with CFD modeling can help to improve the modeling, measurement and control of multiphase flow in the oil and gas industries and in the process industries

  19. Modelling Thermal Environmental Performance In Top-lit Malaysian Atrium Using Computational Fluid Dynamics (CFD

    Directory of Open Access Journals (Sweden)

    A.H. Abdullah

    2009-12-01

    Full Text Available Computational Fluid Dynamics (CFD programs are powerful design tools that can predict detailed flow movement, temperature distribution, and contaminant dispersion. This paper reports the steady-state 3-D CFD modelling of air movement and temperature distribution due to thermal buoyancy within top-lit three-storey representative Malaysian atrium forms using the computer code PHOENICS. Details of temperature distribution, airflow patterns and other comfort parameters would provide a better picture of the resultant thermal performance within the atrium in response to the changes of design variables. The CFD modelling studies were to investigate quantitatively the effects of varying inlet to outlet opening area ratios and also the outlet’s arrangement on the atrium’s thermal environmental performance in relation to occupants’ thermal comfort. The simulation results have revealed that sufficiently higher inlet to outlet opening area ratio (i.e. n>1 can improve the thermal performance on the occupied levels; while with an equal inlet to outlet opening area ratio (i.e. n=1, changing the outlet’s arrangement (i.e. location and configuration has not significantly affected the atrium’s thermal performance.

  20. Rockslide and Impulse Wave Modelling in the Vajont Reservoir by DEM-CFD Analyses

    Science.gov (United States)

    Zhao, T.; Utili, S.; Crosta, G. B.

    2016-06-01

    This paper investigates the generation of hydrodynamic water waves due to rockslides plunging into a water reservoir. Quasi-3D DEM analyses in plane strain by a coupled DEM-CFD code are adopted to simulate the rockslide from its onset to the impact with the still water and the subsequent generation of the wave. The employed numerical tools and upscaling of hydraulic properties allow predicting a physical response in broad agreement with the observations notwithstanding the assumptions and characteristics of the adopted methods. The results obtained by the DEM-CFD coupled approach are compared to those published in the literature and those presented by Crosta et al. (Landslide spreading, impulse waves and modelling of the Vajont rockslide. Rock mechanics, 2014) in a companion paper obtained through an ALE-FEM method. Analyses performed along two cross sections are representative of the limit conditions of the eastern and western slope sectors. The max rockslide average velocity and the water wave velocity reach ca. 22 and 20 m/s, respectively. The maximum computed run up amounts to ca. 120 and 170 m for the eastern and western lobe cross sections, respectively. These values are reasonably similar to those recorded during the event (i.e. ca. 130 and 190 m, respectively). Therefore, the overall study lays out a possible DEM-CFD framework for the modelling of the generation of the hydrodynamic wave due to the impact of a rapid moving rockslide or rock-debris avalanche.

  1. CFD analysis and flow model reduction for surfactant production in helix reactor

    Directory of Open Access Journals (Sweden)

    Nikačević N.M.

    2015-01-01

    Full Text Available Flow pattern analysis in a spiral Helix reactor is conducted, for the application in the commercial surfactant production. Step change response curves (SCR were obtained from numerical tracer experiments by three-dimensional computational fluid dynamics (CFD simulations. Non-reactive flow is simulated, though viscosity is treated as variable in the direction of flow, as it increases during the reaction. The design and operating parameters (reactor diameter, number of coils and inlet velocity are varied in CFD simulations, in order to examine the effects on the flow pattern. Given that 3D simulations are not practical for fast computations needed for optimization, scale-up and control, CFD flow model is reduced to one-dimensional axial dispersion (AD model with spatially variable dispersion coefficient. Dimensionless dispersion coefficient (Pe is estimated under different conditions and results are analyzed. Finally, correlation which relates Pe number with Reynolds number and number of coils from the reactor entrance is proposed for the particular reactor application and conditions.

  2. Energy configuration optimization of submerged propeller in oxidation ditch based on CFD

    International Nuclear Information System (INIS)

    The submerged propeller is presented as an important dynamic source in oxidation ditch. In order to guarantee the activated sludge not deposit, it is necessary to own adequate drive power. Otherwise, it will cause many problems such as the awful mixed flow and the great consuming of energy. At present, carrying on the installation optimization of submerged propeller in oxidation ditch mostly depends on experience. So it is necessary to use modern design method to optimize the installation position and number of submerged propeller, and to research submerged propeller flow field characteristics. The submerged propeller internal flow is simulated by using CFD software FLUENT6.3. Based on Navier-Stokes equations and standard k − ε turbulence model, the flow was simulated by using a SIMPLE algorithm. The results indicate that the submerged propeller installation position change could avoid the condition of back mixing, which caused by the strong drive. Besides, the problem of sludge deposit and the low velocity in the bend which caused by the drive power attenuation could be solved. By adjusting the submerged propeller number, the least power density that the mixing drive needed could be determined and saving energy purpose could be achieved. The study can provide theoretical guidance for optimize the submerged propeller installation position and determine submerged propeller number.

  3. CFD Modeling of Airflow in a Livestock Building

    DEFF Research Database (Denmark)

    Rong, Li; Elhadidi, B.; Khalifa, H. E.;

    2010-01-01

    In this paper, a 2D simulation for a typical livestock building is performed to assess the ammonia emission removal rate to the atmosphere. Two geometry models are used and compared in order to represent the slatted floor. In the first model the floor is modeled as a slatted floor and in the second...... model the traditional porous media is used. The results show that the porous floor modeling over predicts the ammonia emission by a factor of 2 compared to the slatted floor modeling. The results also show different velocity distribution under slatted floor. This suggests that modeling the slatted floor...... the accuracy of the porous jump assumption by comparing the velocity, and ammonia concentration in a 2D simulation, heated solid bodies are added to represent the livestock in the following simulations. The results of simulations with heat source also indicate that modeling the slatted floor with slats...

  4. Examining the Impact of Greenspace Patterns on Land Surface Temperature by Coupling LiDAR Data with a CFD Model

    Directory of Open Access Journals (Sweden)

    Weizhong Su

    2014-09-01

    Full Text Available Understanding the link between greenspace patterns and land surface temperature is very important for mitigating the urban heat island (UHI effect and is also useful for planners and decision-makers for providing a sustainable design for urban greenspace. Although coupling remote sensing data with a computational fluid dynamics (CFD model has widely been used to examine interactions between UHI and greenspace patterns, the paper aims to examine the impact of five theoretical models of greenspace patterns on land surface temperature based on the improvement of the accuracy of CFD modeling by the combination of LiDAR data with remote sensing images to build a 3D urban model. The simulated results demonstrated that the zonal pattern always had the obvious cooling effects when there are no large buildings or terrain obstacles. For ambient environments, the building or terrain obstacles and the type of greenspace have the hugest influence on mitigating the UHI, but the greenspace area behaves as having the least cooling effect. A dotted greenspace pattern shows the best cooling effect in the central area or residential district within a city, while a radial and a wedge pattern may result in a “cold source” for the urban thermal environment.

  5. Modern multicore and manycore architectures: Modelling, optimisation and benchmarking a multiblock CFD code

    Science.gov (United States)

    Hadade, Ioan; di Mare, Luca

    2016-08-01

    Modern multicore and manycore processors exhibit multiple levels of parallelism through a wide range of architectural features such as SIMD for data parallel execution or threads for core parallelism. The exploitation of multi-level parallelism is therefore crucial for achieving superior performance on current and future processors. This paper presents the performance tuning of a multiblock CFD solver on Intel SandyBridge and Haswell multicore CPUs and the Intel Xeon Phi Knights Corner coprocessor. Code optimisations have been applied on two computational kernels exhibiting different computational patterns: the update of flow variables and the evaluation of the Roe numerical fluxes. We discuss at great length the code transformations required for achieving efficient SIMD computations for both kernels across the selected devices including SIMD shuffles and transpositions for flux stencil computations and global memory transformations. Core parallelism is expressed through threading based on a number of domain decomposition techniques together with optimisations pertaining to alleviating NUMA effects found in multi-socket compute nodes. Results are correlated with the Roofline performance model in order to assert their efficiency for each distinct architecture. We report significant speedups for single thread execution across both kernels: 2-5X on the multicore CPUs and 14-23X on the Xeon Phi coprocessor. Computations at full node and chip concurrency deliver a factor of three speedup on the multicore processors and up to 24X on the Xeon Phi manycore coprocessor.

  6. CFD investigation of turbulence models for mechanical agitation of non-Newtonian fluids in anaerobic digesters.

    Science.gov (United States)

    Wu, Binxin

    2011-02-01

    This study evaluates six turbulence models for mechanical agitation of non-Newtonian fluids in a lab-scale anaerobic digestion tank with a pitched blade turbine (PBT) impeller. The models studied are: (1) the standard k-ɛ model, (2) the RNG k-ɛ model, (3) the realizable k-ɛ model, (4) the standard k-ω model, (5) the SST k-ω model, and (6) the Reynolds stress model. Through comparing power and flow numbers for the PBT impeller obtained from computational fluid dynamics (CFD) with those from the lab specifications, the realizable k-ɛ and the standard k-ω models are found to be more appropriate than the other turbulence models. An alternative method to calculate the Reynolds number for the moving zone that characterizes the impeller rotation is proposed to judge the flow regime. To check the effect of the model setup on the predictive accuracy, both discretization scheme and numerical approach are investigated. The model validation is conducted by comparing the simulated velocities with experimental data in a lab-scale digester from literature. Moreover, CFD simulation of mixing in a full-scale digester with two side-entry impellers is performed to optimize the installation. PMID:21216428

  7. Aerosol-CFD modelling of ultrafine and black carbon particle emission, dilution, and growth near roadways

    Science.gov (United States)

    Huang, L.; Gong, S. L.; Gordon, M.; Liggio, J.; Staebler, R. M.; Stroud, C. A.; Lu, G.; Mihele, C.; Brook, J. R.; Jia, C. Q.

    2014-05-01

    Many studies have shown that on-road vehicle emissions are the dominant source of ultrafine particles (UFP; diameter advance our knowledge on the complex interactions and competition among atmospheric dilution, dispersion and dynamics of UFPs, an aerosol dynamics-CFD coupled model is developed and validated against field measurements. A unique approach of applying periodic boundary conditions is proposed to model pollutant dispersion and dynamics in one unified domain from the tailpipe level to the ambient near-road environment. This approach significantly reduces the size of the computational domain, and therefore, allows fast simulation of multiple scenarios. The model is validated against measured turbulent kinetic energy (TKE) and pollution gradients near a major highway. Through a model sensitivity analysis, the relative importance of individual aerosol dynamical processes on the total particle number concentration (N) and particle number-size distribution (PSD) near a highway is investigated. The results demonstrate that (1) coagulation has a negligible effect on N and particle growth, (2) binary homogeneous nucleation (BHN) of H2SO4-H2O is likely responsible for elevated N closest to the road, (3) N and particle growth are very sensitive to the condensation of semi-volatile organics (SVOCs), particle dry deposition, and the interaction between these processes. The results also indicate that, without the proper treatment of atmospheric boundary layer (i.e. its wind profile and turbulence quantities), the nucleation rate would be underestimated by a factor of 5 in the vehicle wake region due to overestimated mixing. Therefore, introducing ABL conditions to activity-based emission models may potentially improve their performance in estimating UFP traffic emissions.

  8. Modernization of vertical Pelton turbines with the help of CFD and model testing

    International Nuclear Information System (INIS)

    The modernization of water turbines bears a high potential of increasing the already installed hydropower capacity. In many projects the existing waterways allow a substantial increase of the available flow capacity and with it the energy output. But also the upgrading onto a state of the art hydraulic, mechanical and electrical design will increase the available power considerably after the rehabilitation. The two phase nature of the flow in Pelton turbines requires for the hydraulic refurbishment special care in the application of the available design methods. Where the flow in the high pressure section of the turbine is mainly of one phase nature, CFD has been used as a standard tool for many years. Also the jet quality, and with it the exploration of the source of flow disturbances that cause poor free surface quality can be investigated with CFD. The interaction of the jet with the buckets of the runner is also examined by means of CFD. However, its accuracy with respect to hydraulic efficiency is, because of the two phase flow and the transient flow process, in very few cases good enough for a reliable and accurate prediction of absolute numbers. The optimization of hydraulic bucket profiles is therefore always checked with measurements in homologous scaled model turbines. A similar situation exists for the housing flow after the water is discharged from the runner. Here also CFD techniques are available to explore the general mechanisms. However, due to the two phase flow nature, where only a very small space is filled with moving water, the experimental setup in a model turbine is always the final proof for optimizations of housing inserts and modifications. The hydraulic design of a modernization project for a power station equipped with vertical Pelton turbines of two different designs is described in the proposed paper. It will be shown, how CFD is applied to determine the losses in the high pressure section and how these results are combined with the

  9. A New Single-blade Based Hybrid CFD Method for Hovering and Forward-flight Rotor Computation

    Institute of Scientific and Technical Information of China (English)

    SHI Yongjie; ZHAO Qijun; FAN Feng; XU Guohua

    2011-01-01

    A hybrid Euler/full potential/Lagrangian wake method, based on single-blade simulation, for predicting unsteady aerodynamic flow around helicopter rotors in hover and forward flight has been developed. In this method, an Euler solver is used to model the near wake evolution and transonic flow phenomena in the vicinity of the blade, and a full potential equation (FPE) is used to model the isentropic potential flow region far away from the rotor, while the wake effects of other blades and the far wake are incorporated into the flow solution as an induced inflow distribution using a Lagrangian based wake analysis. To further reduce the execution time, the computational fluid dynamics (CFD) solution and rotor wake analysis (including induced velocity update) are conducted parallelly, and a load balancing strategy is employed to account for the information exchange between two solvers. By the developed method, several hover and forward-flight cases on Caradonna-Tung and Helishape 7A rotors are performed. Good agreements of the loadings on blade surface with available measured data demonstrate the validation of the method. Also, the CPU time required for different computation runs is compared in the paper, and the results show that the present hybrid method is superior to conventional CFD method in time cost, and will be more efficient with the number of blades increasing.

  10. Dicty_cDB: CFD250 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD250 (Link to dictyBase) - - - Contig-U16455-1 CFD250P (Link to Original site) CFD...250F 566 CFD250Z 716 CFD250P 1282 - - Show CFD250 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-C/CFD250Q.Seq.d/ Representative seq. ID CFD...250P (Link to Original site) Representative DNA sequence >CFD250 (CFD250Q) /CSM/CF/CFD2-C/CFD...hqinrqespr*sr**ercccxskxeinx*k k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD250 (CFD

  11. Dicty_cDB: CFD196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD196 (Link to dictyBase) - - - Contig-U15664-1 CFD196Z (Link... to Original site) - - CFD196Z 567 - - - - Show CFD196 Library CF (Link to library) Clone ID CFD196 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-D/CFD196Q.Seq.d/ Representative seq. ID CFD19...6Z (Link to Original site) Representative DNA sequence >CFD196 (CFD196Q) /CSM/CF/CFD1-D/CFD196Q.Seq.d/ XXXXX...lenkv Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD196 (CFD196Q) /CSM/CF/CFD1-D/CFD

  12. Dicty_cDB: CFD743 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD743 (Link to dictyBase) - - - Contig-U11615-1 CFD743F (Link to Original site) CFD...743F 655 - - - - - - Show CFD743 Library CF (Link to library) Clone ID CFD743 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-B/CFD743Q.Seq.d/ Representative seq. ID CFD74...3F (Link to Original site) Representative DNA sequence >CFD743 (CFD743Q) /CSM/CF/CFD7-B/CFD743Q.Seq.d/ ATGGA...mology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD743 (CFD743Q) /CSM/CF/CFD7-B/CFD

  13. Dicty_cDB: CFD559 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD559 (Link to dictyBase) - - - Contig-U11472-1 CFD559F (Link to Original site) CFD...559F 615 - - - - - - Show CFD559 Library CF (Link to library) Clone ID CFD559 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-C/CFD559Q.Seq.d/ Representative seq. ID CFD55...9F (Link to Original site) Representative DNA sequence >CFD559 (CFD559Q) /CSM/CF/CFD5-C/CFD559Q.Seq.d/ CTAAA...TDQTLDN--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD559 (CFD559Q) /CSM/CF/CFD5-C/CFD

  14. Dicty_cDB: CFD107 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD107 (Link to dictyBase) - - - Contig-U16347-1 CFD107Z (Link... to Original site) - - CFD107Z 654 - - - - Show CFD107 Library CF (Link to library) Clone ID CFD107 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-A/CFD107Q.Seq.d/ Representative seq. ID CFD10...7Z (Link to Original site) Representative DNA sequence >CFD107 (CFD107Q) /CSM/CF/CFD1-A/CFD107Q.Seq.d/ XXXXX...ogy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD107 (CFD107Q) /CSM/CF/CFD1-A/CFD

  15. Dicty_cDB: CFD881 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD881 (Link to dictyBase) - - - Contig-U14953-1 CFD881F (Link to Original site) CFD...881F 652 - - - - - - Show CFD881 Library CF (Link to library) Clone ID CFD881 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-D/CFD881Q.Seq.d/ Representative seq. ID CFD88...1F (Link to Original site) Representative DNA sequence >CFD881 (CFD881Q) /CSM/CF/CFD8-D/CFD881Q.Seq.d/ AAATG...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD881 (CFD881Q) /CSM/CF/CFD8-D/CFD

  16. Dicty_cDB: CFD843 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD843 (Link to dictyBase) - - - Contig-U15554-1 CFD843P (Link to Original site) CFD...843F 551 CFD843Z 529 CFD843P 1080 - - Show CFD843 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-B/CFD843Q.Seq.d/ Representative seq. ID CFD...843P (Link to Original site) Representative DNA sequence >CFD843 (CFD843Q) /CSM/CF/CFD8-B/CFD...ei*k*mv*i**s*chrtyr*ry*ktfrww*fpyll Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD843 (CFD

  17. Dicty_cDB: CFD440 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD440 (Link to dictyBase) - - - Contig-U10797-1 CFD440P (Link to Original site) CFD...440F 648 CFD440Z 431 CFD440P 1079 - - Show CFD440 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-B/CFD440Q.Seq.d/ Representative seq. ID CFD...440P (Link to Original site) Representative DNA sequence >CFD440 (CFD440Q) /CSM/CF/CFD4-B/CFD...IALVEI SKLNHYTGRNEPNVIT*inkf**tkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD440 (CFD

  18. Dicty_cDB: CFD632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD632 (Link to dictyBase) - - - Contig-U15640-1 CFD632F (Link to Original site) CFD...632F 603 - - - - - - Show CFD632 Library CF (Link to library) Clone ID CFD632 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-B/CFD632Q.Seq.d/ Representative seq. ID CFD63...2F (Link to Original site) Representative DNA sequence >CFD632 (CFD632Q) /CSM/CF/CFD6-B/CFD632Q.Seq.d/ AAAAG....Seq.d/ 66 7e-10 CFH442 (CFH442Q) /CSM/CF/CFH4-B/CFH442Q.Seq.d/ 66 7e-10 CFD632 (CFD632Q) /CSM/CF/CFD6-B/CFD

  19. Dicty_cDB: CFD360 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD360 (Link to dictyBase) - - - Contig-U16465-1 CFD360Z (Link... to Original site) - - CFD360Z 474 - - - - Show CFD360 Library CF (Link to library) Clone ID CFD360 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-C/CFD360Q.Seq.d/ Representative seq. ID CFD36...0Z (Link to Original site) Representative DNA sequence >CFD360 (CFD360Q) /CSM/CF/CFD3-C/CFD360Q.Seq.d/ XXXXX...E Sequences producing significant alignments: (bits) Value CFD360 (CFD360Q) /CSM/CF/CFD3-C/CFD360Q.Seq.d/ 94

  20. Dicty_cDB: CFD318 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD318 (Link to dictyBase) - - - Contig-U11167-1 CFD318F (Link to Original site) CFD...318F 611 - - - - - - Show CFD318 Library CF (Link to library) Clone ID CFD318 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-A/CFD318Q.Seq.d/ Representative seq. ID CFD31...8F (Link to Original site) Representative DNA sequence >CFD318 (CFD318Q) /CSM/CF/CFD3-A/CFD318Q.Seq.d/ TAAAT...- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD318 (CFD318Q) /CSM/CF/CFD3-A/CFD

  1. Dicty_cDB: CFD648 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD648 (Link to dictyBase) - - - Contig-U16368-1 CFD648F (Link to Original site) CFD...648F 552 - - - - - - Show CFD648 Library CF (Link to library) Clone ID CFD648 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-B/CFD648Q.Seq.d/ Representative seq. ID CFD64...8F (Link to Original site) Representative DNA sequence >CFD648 (CFD648Q) /CSM/CF/CFD6-B/CFD648Q.Seq.d/ ATTCA...Sequences producing significant alignments: (bits) Value CFD648 (CFD648Q) /CSM/CF/CFD6-B/CFD648Q.Seq.d/ 954

  2. Dicty_cDB: CFD860 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD860 (Link to dictyBase) - - - Contig-U11146-1 CFD860F (Link to Original site) CFD...860F 608 - - - - - - Show CFD860 Library CF (Link to library) Clone ID CFD860 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-C/CFD860Q.Seq.d/ Representative seq. ID CFD86...0F (Link to Original site) Representative DNA sequence >CFD860 (CFD860Q) /CSM/CF/CFD8-C/CFD860Q.Seq.d/ AAAAA...ogy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD860 (CFD860Q) /CSM/CF/CFD8-C/CFD

  3. Dicty_cDB: CFD696 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD696 (Link to dictyBase) - - - Contig-U15456-1 CFD696F (Link to Original site) CFD...696F 553 - - - - - - Show CFD696 Library CF (Link to library) Clone ID CFD696 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-D/CFD696Q.Seq.d/ Representative seq. ID CFD69...6F (Link to Original site) Representative DNA sequence >CFD696 (CFD696Q) /CSM/CF/CFD6-D/CFD696Q.Seq.d/ AATTT...F810Q) /CSM/CF/CFF8-A/CFF810Q.Seq.d/ 1055 0.0 CFD696 (CFD696Q) /CSM/CF/CFD6-D/CFD696Q.Seq.d/ 1055 0.0 CFB887

  4. Dicty_cDB: CFD785 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD785 (Link to dictyBase) - - - Contig-U15635-1 CFD785F (Link to Original site) CFD...785F 595 - - - - - - Show CFD785 Library CF (Link to library) Clone ID CFD785 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-D/CFD785Q.Seq.d/ Representative seq. ID CFD78...5F (Link to Original site) Representative DNA sequence >CFD785 (CFD785Q) /CSM/CF/CFD7-D/CFD785Q.Seq.d/ AAAAT...F/SFB4-D/SFB492Q.Seq.d/ 1066 0.0 CHA557 (CHA557Q) /CSM/CH/CHA5-C/CHA557Q.Seq.d/ 1066 0.0 CFD785 (CFD785Q) /CSM/CF/CFD7-D/CFD

  5. Dicty_cDB: CFD371 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD371 (Link to dictyBase) - - - Contig-U15889-1 CFD371Z (Link... to Original site) - - CFD371Z 550 - - - - Show CFD371 Library CF (Link to library) Clone ID CFD371 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-C/CFD371Q.Seq.d/ Representative seq. ID CFD37...1Z (Link to Original site) Representative DNA sequence >CFD371 (CFD371Q) /CSM/CF/CFD3-C/CFD371Q.Seq.d/ XXXXX...nces producing significant alignments: (bits) Value CFD371 (CFD371Q) /CSM/CF/CFD3-C/CFD371Q.Seq.d/ 1049 0.0

  6. Dicty_cDB: CFD619 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD619 (Link to dictyBase) - - - Contig-U10064-1 CFD619F (Link to Original site) CFD...619F 692 - - - - - - Show CFD619 Library CF (Link to library) Clone ID CFD619 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-A/CFD619Q.Seq.d/ Representative seq. ID CFD61...9F (Link to Original site) Representative DNA sequence >CFD619 (CFD619Q) /CSM/CF/CFD6-A/CFD619Q.Seq.d/ AGCTA...M/VF/VFD7-C/VFD756Q.Seq.d/ 1372 0.0 VFB639 (VFB639Q) /CSM/VF/VFB6-B/VFB639Q.Seq.d/ 1372 0.0 CFD619 (CFD619Q) /CSM/CF/CFD6-A/CFD

  7. Dicty_cDB: CFD711 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD711 (Link to dictyBase) - - - Contig-U15331-1 CFD711P (Link to Original site) CFD...711F 573 CFD711Z 239 CFD711P 812 - - Show CFD711 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-A/CFD711Q.Seq.d/ Representative seq. ID CFD...711P (Link to Original site) Representative DNA sequence >CFD711 (CFD711Q) /CSM/CF/CFD7-A/CFD7...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD711 (CFD

  8. Dicty_cDB: CFD882 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD882 (Link to dictyBase) - - - Contig-U16511-1 CFD882Z (Link... to Original site) - - CFD882Z 315 - - - - Show CFD882 Library CF (Link to library) Clone ID CFD882 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-D/CFD882Q.Seq.d/ Representative seq. ID CFD88...2Z (Link to Original site) Representative DNA sequence >CFD882 (CFD882Q) /CSM/CF/CFD8-D/CFD882Q.Seq.d/ XXXXX...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD882 (CFD882Q) /CSM/CF/CFD8-D/CFD

  9. Dicty_cDB: CFD586 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD586 (Link to dictyBase) - - - Contig-U12859-1 CFD586F (Link to Original site) CFD...586F 579 - - - - - - Show CFD586 Library CF (Link to library) Clone ID CFD586 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-D/CFD586Q.Seq.d/ Representative seq. ID CFD58...6F (Link to Original site) Representative DNA sequence >CFD586 (CFD586Q) /CSM/CF/CFD5-D/CFD586Q.Seq.d/ AATTT...FE647 (CFE647Q) /CSM/CF/CFE6-B/CFE647Q.Seq.d/ 1082 0.0 CFD586 (CFD586Q) /CSM/CF/CFD5-D/CFD586Q.Seq.d/ 1082 0

  10. Dicty_cDB: CFD456 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD456 (Link to dictyBase) - - - Contig-U15606-1 CFD456F (Link to Original site) CFD...456F 553 - - - - - - Show CFD456 Library CF (Link to library) Clone ID CFD456 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-C/CFD456Q.Seq.d/ Representative seq. ID CFD45...6F (Link to Original site) Representative DNA sequence >CFD456 (CFD456Q) /CSM/CF/CFD4-C/CFD456Q.Seq.d/ ATTAT...E Sequences producing significant alignments: (bits) Value CFD456 (CFD456Q) /CSM/CF/CFD4-C/CFD456Q.Seq.d/ 86

  11. Dicty_cDB: CFD319 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD319 (Link to dictyBase) - - - Contig-U16511-1 CFD319Z (Link... to Original site) - - CFD319Z 485 - - - - Show CFD319 Library CF (Link to library) Clone ID CFD319 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-A/CFD319Q.Seq.d/ Representative seq. ID CFD31...9Z (Link to Original site) Representative DNA sequence >CFD319 (CFD319Q) /CSM/CF/CFD3-A/CFD319Q.Seq.d/ XXXXX...mology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD319 (CFD319Q) /CSM/CF/CFD3-A/CFD

  12. Dicty_cDB: CFD113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD113 (Link to dictyBase) - - - Contig-U15664-1 CFD113Z (Link... to Original site) - - CFD113Z 542 - - - - Show CFD113 Library CF (Link to library) Clone ID CFD113 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-A/CFD113Q.Seq.d/ Representative seq. ID CFD11...3Z (Link to Original site) Representative DNA sequence >CFD113 (CFD113Q) /CSM/CF/CFD1-A/CFD113Q.Seq.d/ XXXXX...ificant alignments: (bits) Value CFD113 (CFD113Q) /CSM/CF/CFD1-A/CFD113Q.Seq.d/ 1063 0.0 AFA127 (AFA127Q) /C

  13. Dicty_cDB: CFD459 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD459 (Link to dictyBase) - - - Contig-U16368-1 CFD459F (Link to Original site) CFD...459F 356 - - - - - - Show CFD459 Library CF (Link to library) Clone ID CFD459 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-C/CFD459Q.Seq.d/ Representative seq. ID CFD45...9F (Link to Original site) Representative DNA sequence >CFD459 (CFD459Q) /CSM/CF/CFD4-C/CFD459Q.Seq.d/ ATTCA... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD459 (CFD459Q) /CSM/CF/CFD4-C/CFD

  14. Dicty_cDB: CFD442 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD442 (Link to dictyBase) - - - Contig-U16447-1 CFD442F (Link to Original site) CFD...442F 629 - - - - - - Show CFD442 Library CF (Link to library) Clone ID CFD442 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-B/CFD442Q.Seq.d/ Representative seq. ID CFD44...2F (Link to Original site) Representative DNA sequence >CFD442 (CFD442Q) /CSM/CF/CFD4-B/CFD442Q.Seq.d/ AATTC.../CSM/CF/CFK2-D/CFK279Q.Seq.d/ 1247 0.0 CFD442 (CFD442Q) /CSM/CF/CFD4-B/CFD442Q.Seq.d/ 1247 0.0 own update 20

  15. Dicty_cDB: CFD847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD847 (Link to dictyBase) - - - Contig-U16254-1 CFD847P (Link to Original site) CFD...847F 645 CFD847Z 133 CFD847P 778 - - Show CFD847 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-B/CFD847Q.Seq.d/ Representative seq. ID CFD...847P (Link to Original site) Representative DNA sequence >CFD847 (CFD847Q) /CSM/CF/CFD8-B/CFD8...igslvgly*elsqaissnv Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD847 (CFD

  16. Dicty_cDB: CFD588 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD588 (Link to dictyBase) - - - Contig-U11056-1 CFD588F (Link to Original site) CFD...588F 564 - - - - - - Show CFD588 Library CF (Link to library) Clone ID CFD588 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-D/CFD588Q.Seq.d/ Representative seq. ID CFD58...8F (Link to Original site) Representative DNA sequence >CFD588 (CFD588Q) /CSM/CF/CFD5-D/CFD588Q.Seq.d/ ATATT...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD588 (CFD588Q) /CSM/CF/CFD5-D/CFD

  17. Dicty_cDB: CFD331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD331 (Link to dictyBase) - - - Contig-U16347-1 CFD331Z (Link... to Original site) - - CFD331Z 589 - - - - Show CFD331 Library CF (Link to library) Clone ID CFD331 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-B/CFD331Q.Seq.d/ Representative seq. ID CFD33...1Z (Link to Original site) Representative DNA sequence >CFD331 (CFD331Q) /CSM/CF/CFD3-B/CFD331Q.Seq.d/ XXXXX...gnificant alignments: (bits) Value CFD331 (CFD331Q) /CSM/CF/CFD3-B/CFD331Q.Seq.d/ 1098 0.0 CFE201 (CFE201Q)

  18. Dicty_cDB: CFD616 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD616 (Link to dictyBase) - - - Contig-U12597-1 CFD616F (Link to Original site) CFD...616F 105 - - - - - - Show CFD616 Library CF (Link to library) Clone ID CFD616 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-A/CFD616Q.Seq.d/ Representative seq. ID CFD61...6F (Link to Original site) Representative DNA sequence >CFD616 (CFD616Q) /CSM/CF/CFD6-A/CFD616Q.Seq.d/ AATAA...M/CF/CFH8-C/CFH861Q.Seq.d/ 82 2e-15 CFG565 (CFG565Q) /CSM/CF/CFG5-C/CFG565Q.Seq.d/ 82 2e-15 CFD616 (CFD616Q) /CSM/CF/CFD6-A/CFD

  19. Dicty_cDB: CFD831 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD831 (Link to dictyBase) - - - Contig-U07842-1 CFD831F (Link to Original site) CFD...831F 597 - - - - - - Show CFD831 Library CF (Link to library) Clone ID CFD831 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-B/CFD831Q.Seq.d/ Representative seq. ID CFD83...1F (Link to Original site) Representative DNA sequence >CFD831 (CFD831Q) /CSM/CF/CFD8-B/CFD831Q.Seq.d/ ATTTA...quences producing significant alignments: (bits) Value CFD831 (CFD831Q) /CSM/CF/CFD8-B/CFD831Q.Seq.d/ 1183 0

  20. Effective Thermal Property Estimation of Unitary Pebble Beds Based on a CFD-DEM Coupled Method for a Fusion Blanket

    Science.gov (United States)

    Chen, Lei; Chen, Youhua; Huang, Kai; Liu, Songlin

    2015-12-01

    Lithium ceramic pebble beds have been considered in the solid blanket design for fusion reactors. To characterize the fusion solid blanket thermal performance, studies of the effective thermal properties, i.e. the effective thermal conductivity and heat transfer coefficient, of the pebble beds are necessary. In this paper, a 3D computational fluid dynamics discrete element method (CFD-DEM) coupled numerical model was proposed to simulate heat transfer and thereby estimate the effective thermal properties. The DEM was applied to produce a geometric topology of a prototypical blanket pebble bed by directly simulating the contact state of each individual particle using basic interaction laws. Based on this geometric topology, a CFD model was built to analyze the temperature distribution and obtain the effective thermal properties. The current numerical model was shown to be in good agreement with the existing experimental data for effective thermal conductivity available in the literature. supported by National Special Project for Magnetic Confined Nuclear Fusion Energy of China (Nos. 2013GB108004, 2015GB108002, 2014GB122000 and 2014GB119000), and National Natural Science Foundation of China (No. 11175207)

  1. Modeling HCCI using CFD and Detailed Chemistry with Experimental Validation and a Focus on CO Emissions

    Energy Technology Data Exchange (ETDEWEB)

    Hessel, R; Foster, D; Aceves, S; Flowers, D; Pitz, B; Dec, J; Sjoberg, M; Babajimopoulos, A

    2007-04-23

    Multi-zone CFD simulations with detailed kinetics were used to model engine experiments performed on a diesel engine that was converted for single cylinder, HCCI operation, here using iso-octane as the fuel. The modeling goals were to validate the method (multi-zone combustion modeling) and the reaction mechanism (LLNL 857 species iso-octane), both of which performed very well. The purpose of this paper is to document the validation findings and to set the ground work for further analysis of the results by first looking at CO emissions characteristics with varying equivalence ratio.

  2. CFD Approaches for Modelling Bubble Entrainment by an Impinging Jet

    Directory of Open Access Journals (Sweden)

    Martin Schmidtke

    2009-01-01

    Full Text Available This contribution presents different approaches for the modeling of gas entrainment under water by a plunging jet. Since the generation of bubbles happens on a scale which is smaller than the bubbles, this process cannot be resolved in meso-scale simulations, which include the full length of the jet and its environment. This is why the gas entrainment has to be modeled in meso-scale simulations. In the frame of a Euler-Euler simulation, the local morphology of the phases has to be considered in the drag model. For example, the gas is a continuous phase above the water level but bubbly below the water level. Various drag models are tested and their influence on the gas void fraction below the water level is discussed. The algebraic interface area density (AIAD model applies a drag coefficient for bubbles and a different drag coefficient for the free surface. If the AIAD model is used for the simulation of impinging jets, the gas entrainment depends on the free parameters included in this model. The calculated gas entrainment can be adapted via these parameters. Therefore, an advanced AIAD approach could be used in future for the implementation of models (e.g., correlations for the gas entrainment.

  3. CFD Modeling of Non-Neutral Atmospheric Boundary Layer Conditions

    DEFF Research Database (Denmark)

    Koblitz, Tilman

    For wind resource assessment, the wind industry is increasingly relying on Computational Fluid Dynamics models that focus on modeling the airflow in a neutrally stratified surface-layer. Physical processes like the Coriolis force, buoyancy forces and heat transport, that are important to the atmo......For wind resource assessment, the wind industry is increasingly relying on Computational Fluid Dynamics models that focus on modeling the airflow in a neutrally stratified surface-layer. Physical processes like the Coriolis force, buoyancy forces and heat transport, that are important...... to the atmospheric boundary-layer, are mostly ignored so far. In order to decrease the uncertainty of wind resource assessment, the present work focuses on atmospheric flows that include atmospheric stability and the Coriolis effect. Within the present work a RANS model framework is developed and implemented...

  4. A comparison of actuator disc and BEM models in CFD simulations for the prediction of offshore wake losses

    International Nuclear Information System (INIS)

    In this paper computational fluid dynamics (CFD) simulations are performed using ANSYS CFX to compare wake interaction results obtained from two rotor modelling methodologies: the standard actuator disc and the blade element momentum model (BEM). The unsteady simulations embed Coriolis forces and neutral stability conditions in the surface layer and stable conditions in the free stream. The BEM method is implemented in the CFD code through a pre-processing set of files that employs look-up tables. The control system for the wind turbines is considered through look-up tables that are constructed based on operational wind farm data. Simulations using the actuator disc and BEM methodologies have been performed using a number of different turbulence models in order to compare the wind turbine wake structure results. The use of URANS and LES numerical methods, coupled with the two different methodologies of representing the turbine, enables an assessment to be made of the details required for varying degrees of accuracy in computing the wake structures. The findings stress the importance of including the rotation of the wake and the non-uniform load on the rotor in LES simulations to account for more accurate turbulence intensity levels in the near wake

  5. A comparison of actuator disc and BEM models in CFD simulations for the prediction of offshore wake losses

    Science.gov (United States)

    Lavaroni, Luca; Watson, Simon J.; Cook, Malcolm J.; Dubal, Mark R.

    2014-06-01

    In this paper computational fluid dynamics (CFD) simulations are performed using ANSYS CFX to compare wake interaction results obtained from two rotor modelling methodologies: the standard actuator disc and the blade element momentum model (BEM). The unsteady simulations embed Coriolis forces and neutral stability conditions in the surface layer and stable conditions in the free stream. The BEM method is implemented in the CFD code through a pre-processing set of files that employs look-up tables. The control system for the wind turbines is considered through look-up tables that are constructed based on operational wind farm data. Simulations using the actuator disc and BEM methodologies have been performed using a number of different turbulence models in order to compare the wind turbine wake structure results. The use of URANS and LES numerical methods, coupled with the two different methodologies of representing the turbine, enables an assessment to be made of the details required for varying degrees of accuracy in computing the wake structures. The findings stress the importance of including the rotation of the wake and the non-uniform load on the rotor in LES simulations to account for more accurate turbulence intensity levels in the near wake.

  6. CFD Optimization on Network-Based Parallel Computer System

    Science.gov (United States)

    Cheung, Samson H.; VanDalsem, William (Technical Monitor)

    1994-01-01

    Combining multiple engineering workstations into a network-based heterogeneous parallel computer allows application of aerodynamic optimization with advance computational fluid dynamics codes, which is computationally expensive in mainframe supercomputer. This paper introduces a nonlinear quasi-Newton optimizer designed for this network-based heterogeneous parallel computer on a software called Parallel Virtual Machine. This paper will introduce the methodology behind coupling a Parabolized Navier-Stokes flow solver to the nonlinear optimizer. This parallel optimization package has been applied to reduce the wave drag of a body of revolution and a wing/body configuration with results of 5% to 6% drag reduction.

  7. Comparison of Engineering Wake Models with CFD Simulations

    DEFF Research Database (Denmark)

    Andersen, Søren Juhl; Sørensen, Jens Nørkær; Ivanell, S.;

    2014-01-01

    The engineering wake models by Jensen [1] and Frandsen et al. [2] are assessed for different scenarios simulated using Large Eddy Simulation and the Actuator Line method implemented in the Navier-Stokes equations. The scenarios include the far wake behind a single wind turbine, a long row...... of turbines in an atmospheric boundary layer, idealised cases of an infinitely long row of wind turbines and infinite wind farms with three different spacings. Both models include a wake expansion factor, which is calibrated to fit the simulated wake velocities. The analysis highlights physical deficiencies...... in the ability of the models to universally predict the wake velocities, as the expansion factor can be fitted for a given case, but with not apparent transition between the cases....

  8. CFD modeling of pulsatile hemodynamics in the total cavopulmonary connection

    Science.gov (United States)

    Zobaer, S. M. Tareq; Hasan, A. B. M. Toufique

    2016-07-01

    Total cavopulmonary connection is a blood flow pathway which is created surgically by an operation known as Fontan procedure, performed on children with single ventricle heart defects. Recent studies have shown that the hemodynamics in the connection can be strongly influenced by the presence of pulsatile flow. The aim of this paper is model the pulsatile flow patterns, and to calculate the vorticity field and power losses in an idealized 1.5D offset model of Total Cavopulmonary Connection. A three-dimensional polyhedral mesh was constructed for the numerical simulation. The rheological properties of blood were considered as Newtonian, and flow in the connection was assumed to be laminar. The results demonstrated complex flow patterns in the connection. The outcomes of the simulation showed reasonable agreement with the results available in the literature for a similar model.

  9. Comparison of Engineering Wake Models with CFD Simulations

    Science.gov (United States)

    Andersen, S. J.; Sørensen, J. N.; Ivanell, S.; Mikkelsen, R. F.

    2014-06-01

    The engineering wake models by Jensen [1] and Frandsen et al. [2] are assessed for different scenarios simulated using Large Eddy Simulation and the Actuator Line method implemented in the Navier-Stokes equations. The scenarios include the far wake behind a single wind turbine, a long row of turbines in an atmospheric boundary layer, idealised cases of an infinitely long row of wind turbines and infinite wind farms with three different spacings. Both models include a wake expansion factor, which is calibrated to fit the simulated wake velocities. The analysis highlights physical deficiencies in the ability of the models to universally predict the wake velocities, as the expansion factor can be fitted for a given case, but with not apparent transition between the cases.

  10. CFD Modelling of Flow and Solids Distribution in Carbon-in-Leach Tanks

    Directory of Open Access Journals (Sweden)

    Divyamaan Wadnerkar

    2015-10-01

    Full Text Available The Carbon-in-Leach (CIL circuit plays an important role in the economics of a gold refinery. The circuit uses multiphase stirred tanks in series, in which problems such as dead zones, short-circuiting, and presence of unsuspended solids are detrimental to its efficiency. Therefore, the hydrodynamics of such a system is critical for improving the performance. The hydrodynamics of stirred tanks can be resolved using computational fluid dynamics (CFD. While the flow generated by the impellers in the CIL tanks is complex and modelling it in the presence of high solid concentration is challenging, advances in CFD models, such as turbulence and particle-fluid interactions, have made modelling of such flows feasible. In the present study, the hydrodynamics of CIL tanks was investigated by modelling it using CFD. The models used in the simulations were validated using experimental data at high solid loading of 40 wt. % in a lab scale tank. The models were further used for examining the flow generated by pitched blade turbine and HA-715 Mixtec impellers in lab scale CIL tanks with 50 wt. % solids. The effect of design and operating parameters such as off-bottom clearance, impeller separation, impeller speed, scale-up, and multiple-impeller configuration on flow field and solid concentrations profiles was examined. For a given impeller speed, better solids suspension is observed with dual impeller and triple impeller configurations. The results presented in the paper are useful for understanding the hydrodynamics and influence of design and operating parameters on industrial CIL tanks.

  11. Prediction of steam condensation in the presence of noncondensable gases using a CFD-based approach

    Energy Technology Data Exchange (ETDEWEB)

    Dehbi, A., E-mail: abdel.dehbi@psi.ch [Laboratory for Thermal-Hydraulics, Paul Scherrer Institut, Villigen 5232 (Switzerland); Janasz, F., E-mail: filip.janasz@psi.ch [Laboratory for Thermal-Hydraulics, Paul Scherrer Institut, Villigen 5232 (Switzerland); Bell, B., E-mail: brian.bell@ansys.com [ANSYS Inc., Lebanon, NH 03766 (United States)

    2013-05-15

    Highlights: ► A model of condensation with noncondensable gases is integrated in the Fluent code. ► Condensation is modeled as sink terms in the conservation equations. ► A best-estimate parameter is proposed for heat transfer enhancement due to suction. ► Validation is conducted for a wide range of flow conditions and geometries. ► Predictions are in good agreement with experimental correlations. -- Abstract: We integrate in the ANSYS CFD code Fluent a model for wall condensation from a vapor–noncondensable gas mixture. The condensation phenomenon is modeled from first principles as sink terms for the mass, momentum, species and energy conservation equations. The condensation rate is obtained by requiring the condensate–gas interface to be impermeable to the noncondensable gas. The model assumes in addition that the thermal resistance of the liquid film is negligible, and hence the predictions are only valid for relatively large mass fractions of the noncondensable gas (above 0.1). When the condensation rates are high, a best-estimate suction correction factor is proposed for CFD codes that impose the no-slip boundary conditions at the wall surfaces. In such a way, the enhancement in the heat transfer due to suction is accounted for. We first simulate condensation in laminar and turbulent forced flows along a cold flat plate. More challenging simulations are subsequently conducted for the case where vapor is introduced into closed vessels containing a noncondensable gas and in which stand condensing surfaces held at constant cold temperature. The flow transient is computed until steady conditions are reached, at which point the condensation flow rate equals the injected steam flow rate. Overall, the predicted heat transfer rates are in good agreement with available analytical solutions as well as experimental correlations. CFD Best Practice Guidelines are followed to a large extent. In particular, a hierarchy of grids is used to ensure mesh

  12. Application of a pressure based CFD code with mass transfer model based on the Rayleigh equation for the numerical simulation of the cavitating flow around a hydrofoil with circular leading edge

    Directory of Open Access Journals (Sweden)

    Deimel Christian

    2014-03-01

    Full Text Available The most common method for simulating cavitating flows is using the governing flow equations in a form with a variable density and treats both phases as incompressible in combination with a transport equation for the vapour volume fraction. This approach is commonly referred to as volume of fluid method (VoF. To determine the transition of the liquid phase to vapour and vice versa, a relation for the mass transfer is needed. Several models exist, based on slightly differing physical assumptions, for example derivation from the dynamics of single bubbles or large bubble clusters. In our simulation, we use the model of Sauer and Schnerr which is based on the Rayleigh equation. One common problem of all mass transfer models is the use of model constants which often need to be tuned with regard to the examined problem. Furthermore, these models often overpredict the turbulent dynamic viscosity in the two-phase region which counteracts the development of transient shedding behaviour and is compensated by the modification proposed by Reboud. In the presented study, we vary the parameters of the Sauer-Schnerr model with Reboud modification that we implemented into an OpenFOAM solver to match numerical to experimental data.

  13. Application of a pressure based CFD code with mass transfer model based on the Rayleigh equation for the numerical simulation of the cavitating flow around a hydrofoil with circular leading edge

    Science.gov (United States)

    Deimel, Christian; Günther, Markus; Skoda, Romuald

    2014-03-01

    The most common method for simulating cavitating flows is using the governing flow equations in a form with a variable density and treats both phases as incompressible in combination with a transport equation for the vapour volume fraction. This approach is commonly referred to as volume of fluid method (VoF). To determine the transition of the liquid phase to vapour and vice versa, a relation for the mass transfer is needed. Several models exist, based on slightly differing physical assumptions, for example derivation from the dynamics of single bubbles or large bubble clusters. In our simulation, we use the model of Sauer and Schnerr which is based on the Rayleigh equation. One common problem of all mass transfer models is the use of model constants which often need to be tuned with regard to the examined problem. Furthermore, these models often overpredict the turbulent dynamic viscosity in the two-phase region which counteracts the development of transient shedding behaviour and is compensated by the modification proposed by Reboud. In the presented study, we vary the parameters of the Sauer-Schnerr model with Reboud modification that we implemented into an OpenFOAM solver to match numerical to experimental data.

  14. RELIABLE VALIDATION BASED ON OPTICAL FLOW VISUALIZATION FOR CFD SIMULATIONS

    Institute of Scientific and Technical Information of China (English)

    姜宗林

    2003-01-01

    A reliable validation based on the optical flow visualization for numerical simula-tions of complex flowfields is addressed in this paper. Several test cases, including two-dimensional,axisymmetric and three-dimensional flowfields, were presented to demonstrate the effectiveness of the validation and gain credibility of numerical solutions of complex flowfields. In the validation, imagesof these flowfields were constructed from numerical results based on the principle of the optical flowvisualization, and compared directly with experimental interferograms. Because both experimental and numerical results axe of identical physical representation, the agreement between them can be evaluatedeffectively by examining flow structures as well as checking discrepancies in density. The study shows that the reliable validation can be achieved by using the direct comparison between numerical and experiment results without any loss of accuracy in either of them.

  15. Efficient Functional-Based Adaptation for CFD Applications

    CERN Document Server

    Tyson, William C

    2015-01-01

    Adjoint methods have gained popularity in recent years for driving adaptation procedures which aim to reduce error in solution functionals. While adjoint methods have been proven effective for functional-based adaptation, the practical implementation of an adjoint method can be quite burdensome since code developers constantly need to ensure and maintain a dual consistent discretization as updates are made. Also, since most engineering problems consider multiple functionals, an adjoint solution must be obtained for each functional of interest which can increase the overall computational cost significantly. In this paper, an alternative to adjoints is presented which uses a sparse approximate inverse of the Jacobian of the residual to obtain approximate adjoint sensitivities for functional-based adaptation indicators. Since the approximate inverse need only be computed once, it can be recycled for any number of functionals making the new approach more efficient than a conventional adjoint method. This new meth...

  16. RELIABLE VALIDATION BASED ON OPTICAL FLOW VISUALIZATION FOR CFD SIMULATIONS

    Institute of Scientific and Technical Information of China (English)

    姜宗林

    2003-01-01

    A reliable validation based on the optical flow visualization for numerical simulations of complex flowfields is addressed in this paper.Several test cases,including two-dimensional,axisymmetric and three-dimensional flowfields,were presented to demonstrate the effectiveness of the validation and gain credibility of numerical solutions of complex flowfields.In the validation,images of these flowfields were constructed from numerical results based on the principle of the optical flow visualization,and compared directly with experimental interferograms.Because both experimental and numerical results are of identical physical representation,the agreement between them can be evaluated effectively by examining flow structures as well as checking discrepancies in density.The study shows that the reliable validation can be achieved by using the direct comparison between numerical and experiment results without any loss of accuracy in either of them.

  17. Numerical estimation of wall friction ratio near the pseudo-critical point with CFD-models

    Energy Technology Data Exchange (ETDEWEB)

    Angelucci, M. [University of Pisa, Dipartimento di Ingegneria Meccanica Nucleare e della Produzione (Italy); Ambrosini, W., E-mail: w.ambrosini@ing.unipi.it [University of Pisa, Dipartimento di Ingegneria Meccanica Nucleare e della Produzione (Italy); Forgione, N. [University of Pisa, Dipartimento di Ingegneria Meccanica Nucleare e della Produzione (Italy)

    2013-11-15

    In this paper, the STAR-CCM+ CFD code is used in the attempt to reproduce the values of friction factor observed in experimental data at supercritical pressures at various operating conditions. A short survey of available data and correlations for smooth pipe friction in circular pipes puts the basis for the discussion, reporting observed trends of friction factor in the liquid-like and the gas-like regions and within the transitional region across the pseudo-critical temperature. For smooth pipes, a general decrease of the friction factor in the transitional region is reported, constituting one of the relevant effects to be predicted by the computational fluid-dynamic models. A limited number of low-Reynolds number models are adopted, making use of refined near-wall discretisation as required by the constraint y{sup +} < 1 at the wall. In particular, the Lien k–ε and the SST k–ω models are considered. The values of the wall shear stress calculated by the code are then post-processed on the basis of bulk fluid properties to obtain the Fanning and then the Darcy–Weisbach friction factors, based on their classical definitions. The obtained values are compared with those provided by experimental tests and correlations, finding a reasonable qualitative agreement. Expectedly, the agreement is better in the gas-like and liquid-like regions, where fluid property changes are moderate, than in the transitional region, where the trends provided by available correlations are reproduced only in a qualitative way.

  18. Prediction of wall friction for fluids at supercritical pressure with CFD models

    Energy Technology Data Exchange (ETDEWEB)

    Angelucci, M.; Ambrosini, W.; Forgione, N., E-mail: w.ambrosini@ing.unipi.it, E-mail: n.forgione@ing.unipi.it [Univ. of Pisa, Dipartimento di Ingegneria Meccanica Nucleare e della Produzione (Italy)

    2011-07-01

    In this paper, the STAR-CCM+ CFD code is used in the attempt to reproduce the values of friction factor observed in experimental data at supercritical pressures at various operating conditions. A short survey of available data and correlations for smooth pipe friction in circular pipes puts the basis for the discussion, reporting observed trends of friction factor in the liquid-like and the gas-like regions and within the transitional region around the pseudo-critical temperature. For smooth pipes, a general decrease of the friction factor in the transitional region is reported, constituting one of the relevant effects to be predicted by the computational fluid-dynamic models. A limited number of low-Reynolds number models is adopted, making use of refined near-wall discretisations as required by the constraint y{sup +} < 1 at the wall. In particular, the Lien k-ε and the SST k-ω models are considered. The values of the wall shear stress calculated by the code are then post-processed on the basis of bulk fluid properties to obtain the Fanning and then the Darcy-Weisbach friction factors, basing on their classical definitions. The obtained values are compared with those provided by experimental tests and correlations, finding a reasonable qualitative agreement. Expectedly, the agreement is better in the gas-like and liquid-like regions, where fluid property changes are moderate, than in the transitional region, where the trends provided by available correlations are reproduced only in a qualitative way. (author)

  19. Prediction of wall friction for fluids at supercritical pressure with CFD models

    International Nuclear Information System (INIS)

    In this paper, the STAR-CCM+ CFD code is used in the attempt to reproduce the values of friction factor observed in experimental data at supercritical pressures at various operating conditions. A short survey of available data and correlations for smooth pipe friction in circular pipes puts the basis for the discussion, reporting observed trends of friction factor in the liquid-like and the gas-like regions and within the transitional region around the pseudo-critical temperature. For smooth pipes, a general decrease of the friction factor in the transitional region is reported, constituting one of the relevant effects to be predicted by the computational fluid-dynamic models. A limited number of low-Reynolds number models is adopted, making use of refined near-wall discretisations as required by the constraint y+ < 1 at the wall. In particular, the Lien k-ε and the SST k-ω models are considered. The values of the wall shear stress calculated by the code are then post-processed on the basis of bulk fluid properties to obtain the Fanning and then the Darcy-Weisbach friction factors, basing on their classical definitions. The obtained values are compared with those provided by experimental tests and correlations, finding a reasonable qualitative agreement. Expectedly, the agreement is better in the gas-like and liquid-like regions, where fluid property changes are moderate, than in the transitional region, where the trends provided by available correlations are reproduced only in a qualitative way. (author)

  20. CFD-modelling of natural convection in a groundwater-filled borehole heat exchanger

    OpenAIRE

    Gustafsson, A-M.; Westerlund, L.; Hellström, G.

    2009-01-01

    Abstract In design of ground-source energy systems the thermal erformance of the borehole heat exchangers is important. In Scandinavia, boreholes are usually not grouted but left with groundwater to fill the space between heat exchanger pipes and borehole wall. The common U-pipe arrangement in a groundwater-filled BHE has been studied by a three-dimensional, steady-state CFD model. The model consists of a three meter long borehole containing a single U-pipe with surrounding bedrock...

  1. The difficult challenge of a two-phase CFD modelling for all flow regimes

    International Nuclear Information System (INIS)

    Highlights: • The theoretical difficulties for modelling all flow regimes at CFD scale are identified. • The choice of the number of fields and of the time and space averaging or filtering are discussed and clarified. • Closure issues related to an all flow regime CFD model are listed and the main difficulties are identified. - Abstract: System thermalhydraulic codes model all two-phase flow regimes but they are limited to a macroscopic description. Two-phase CFD tools predict two-phase flow with a much finer space resolution but the current modelling capabilities are limited to dispersed bubbly or droplet flow and separate-phase flow. Much less experience exists on more complex flow regimes which combine the existence of dispersed fields with the presence of large interfaces such as a free surface or a film surface. A list of possible reactor issues which might benefit from an “all flow regime CFD model” is given. The first difficulty is to identify the various types of local flow configuration. It is shown that a 4-field model has much better capabilities than a two-fluid approach to identify most complex regimes. Then the choice between time averaging, space averaging, or even ensemble averaging is discussed. It is shown that only the RANS-2-fluid and a space-filtered 4-field model may be reasonably envisaged. The latter has the capabilities to identify all types of interfaces and should be privileged if a good accuracy is expected or if time fluctuations in intermittent flow have to be predicted while the former may be used when a high accuracy is not necessary and if time fluctuations in intermittent flow are not of interest. Finally the closure issue is presented including wall transfers, interfacial transfers, mass transfers between dispersed and continuous fields, and turbulent transfers. An important effort is required to model all interactions between sub-filter phenomena and the transfers from the sub-filter domain to the simulated domain. The

  2. Decompression wave speed in CO2 mixtures: CFD modelling with the GERG-2008 equation of state

    International Nuclear Information System (INIS)

    Highlights: • CFD models for decompression simulation of CO2 mixtures. • Incorporation of GERG-2008 EOS into CFD code for decompression modelling. • Predicted decompression wave speed validated by measurements. • Studies of effects of initial temperature and impurities on decompression wave speed. - Abstract: The development of CO2 pipelines for Carbon Capture and Storage (CCS) raises new questions regarding the control of ductile fracture propagation and fracture arrest toughness criteria. The decompression behaviour in the fluid must be determined accurately in order to estimate the proper pipe toughness. However, anthropogenic CO2 may contain impurities that can modify the fluid decompression characteristics quite significantly. To determine the decompression wave speed in CO2 mixtures, the thermodynamic properties of these mixtures must be determined by using an accurate equation of state. In this paper we present a new decompression model developed using the Computational Fluid Dynamics (CFD) package ANSYS Fluent. The GERG-2008 Equation of State (EOS) was implemented into this model through User Defined Functions (UDF) to predict the thermodynamic properties of CO2 mixtures. The model predictions were in good agreement with the experimental data of two ‘shock tube’ tests. A range of representative CO2 mixtures was examined in terms of the changes in fluid properties from the initial conditions, with time and distance, immediately after a sudden pipeline opening at one end. Phase changes that may occur within the fluid due to condensation of ‘impurities’ in the fluid were also investigated. Simulations were also conducted to examine how the initial temperature and impurities would affect the decompression wave speed

  3. Modeling strategies to compute natural circulation using CFD in a VHTR after a LOFA

    International Nuclear Information System (INIS)

    Highlights: • CFD analysis was performed of natural circulation in a block VHTR after a loss of flow accident. • Multiple strategies were investigated to perform CFD analysis to estimate strength of natural circulation. • Symmetry considerations allowed fine mesh application of CFD to reactor core. • Results extrapolated to whole core to estimate heat loss due to natural circulation. • CFD shows promise for use in nuclear reactor design and analysis. - Abstract: A prismatic gas-cooled very high temperature reactor (VHTR) is being developed under the next generation nuclear plant program (NGNP) of the U.S. Department of Energy, Office of Nuclear Energy. In the design of the prismatic VHTR, hexagonal shaped graphite blocks are drilled to allow insertion of fuel pins, made of compacted tristructural-isotropic (TRISO) fuel particles, and coolant channels for the helium coolant. One of the concerns for the reactor design is the effects of a loss of flow accident (LOFA) where the coolant circulators are lost for some reason, causing a loss of forced coolant flow through the core. In such an event, it is desired to know what happens to the (reduced) heat still being generated in the core and if it represents a problem for the fuel compacts, the graphite core or the reactor vessel (RV) walls. One of the mechanisms for the transport of heat out of the core is by the natural circulation of the coolant, which is still present. It is desired to know how much heat may be transported by natural circulation through the core and upwards to the top of the upper plenum. It is beyond current capability for a computational fluid dynamics (CFD) analysis to perform a calculation on the whole RV with a sufficiently refined mesh to examine the full potential of natural circulation in the vessel. The present paper reports the investigation of several strategies to model the flow and heat transfer in the RV. It is found that it is necessary to employ representative geometries of

  4. Assessment of Nucleation Site Density Models for CFD Simulations of Subcooled Flow Boiling

    International Nuclear Information System (INIS)

    The framework of a CFD simulation of subcooled flow boiling basically includes a block of wall boiling models communicating with governing equations of a two-phase flow via parameters like temperature, rate of phasic change, etc. In the block of wall boiling models, a heat flux partitioning model, which describes how the heat is taken away from a heated surface, is combined with models quantifying boiling parameters, i.e. nucleation site density, and bubble departure diameter and frequency. It is realized that the nucleation site density is an important parameter for predicting the subcooled flow boiling. The number of nucleation sites per unit area decides the influence region of each heat transfer mechanism. The variation of the nucleation site density will mutually change the dynamics of vapor bubbles formed at these sites. In addition, the nucleation site density is needed as one initial and boundary condition to solve the interfacial area transport equation. A lot of effort has been devoted to mathematically formulate the nucleation site density. As a consequence, numerous correlations of the nucleation site density are available in the literature. These correlations are commonly quite different in their mathematical form as well as application range. Some correlations of the nucleation site density have been applied successfully to CFD simulations of several specific subcooled boiling flows, but in combination with different correlations of the bubble departure diameter and frequency. In addition, the values of the nucleation site density, and bubble departure diameter and frequency obtained from simulations for a same problem are relatively different, depending on which models are used, even when global characteristics, e.g., void fraction and mean bubble diameter, agree well with experimental values. It is realized that having a good CFD simulations of the subcooled flow boiling requires a detailed validations of all the models used. Owing to the importance

  5. CFD Modeling of Melt Spreading on the Reactor Cavity Floor

    Energy Technology Data Exchange (ETDEWEB)

    Yeon, Wan Sik; Bang, Kwang Hyun [Korea Maritime University, Busan (Korea, Republic of); Cho, Young Jo; Lee, Jae Gon [Korea Hydro and Nuclear Power Co., Daejeon (Korea, Republic of)

    2010-05-15

    In the very unlikely event of a severe reactor accident involving core melt and reactor pressure vessel failure, it is important to provide an accident management strategy that would allow the molten core material to cool down, resolidify and bring the core debris to a stable coolable state for Light Water Reactors (LWRs). One approach to achieve a stable coolable state is to quench the core melt after its relocation from the reactor pressure vessel into the reactor cavity. This approach typically requires a large cavity floor area on which a large amount of core melt spreads well and forms a shallow melt thickness for small thermal resistance across the melt pool. Spreading of high temperature (approx3000 K), low superheat (approx200 K) core melt over a wide cavity floor has been a key question to the success of the ex-vessel core coolability and it has brought a number of experimental work (CORINE, ECOKATS, VULCANO) and analytical work (CORFLOW, MELTSPREAD, THEMA). These computational models are currently able to predict well the spreading of stimulant materials but yet have shown a limitation for prototypic core melt of UO{sub 2}+ZrO{sub 2} mixture. A computational model for the melt spreading requires a multiphase treatment of liquid melt, solidified melt, and air. Also solidification and thermal radiation physics should be included. The present work uses ANSYS-CFX code to simulate core melt spreading on the reactor cavity. The CFX code is a general-purpose multiphase code and the present work is focused on exploring the code's capability to model melt spreading problem in a step by step approach

  6. A CFD Model for Wave Transformation and Breaking in the Surf Zone

    Science.gov (United States)

    Chopakatla, S. C.; Lippmann, T. C.; Richardson, J. E.; Thornton, E. B.; Holman, R. A.

    2002-12-01

    Wind-generated surface gravity waves are the major driving force for nearshore circulation and sediment transport. As waves shoal in shallow coastal waters, spectra evolve strongly owing to refraction, nonlinear energy transfers, and dissipation caused by wave breaking and bottom friction. Although considerable progress has been made in modeling wave propagation over complex bottom topography, the dissipation mechanisms are still poorly understood. As a consequence, wave transformation models for the surf zone use crude descriptions of the wave breaking process based on simple saturation criteria or empirical probability distributions that do not always work well for the range of bathymetric and wave conditions commonly observed in nature. In this report, we will discuss the results of studies made with the commercially available Computational Fluid Dynamics (CFD) software system known as FLOW-3D (Flow Science, Inc., Sante Fe, NM). FLOW-3D is designed to solve transient, free surface flow problems based on the solution of the Navier-Stokes equations in three-dimensions. As part of FLOW-3D's formulation, the dissipation of energy is determined by use of coupled turbulence closure schemes (e.g., closure schemes based on the solution of turbulent kinetic energy transport equations). In this study, fine scale pressures and velocities are computed over a two-dimensional beach profile measured during the 1990 Delilah experiment. The model is driven by observed wave spectra obtained in 8 meter water depths, and results compared with a cross-shore array of pressure sensors and current meters spanning the width of the surf zone. In the calculations, wave breaking is a natural consequence of the fluid dynamics and does not require the use of empirical formulations, or breaking criteria. The spatial and temporal variability in the wave breaking locations will be compared with video observations obtained during the experiment. Good comparison between modeled and observed wave

  7. CFD-Based Design Optimization for Single Element Rocket Injector

    Science.gov (United States)

    Vaidyanathan, Rajkumar; Tucker, Kevin; Papila, Nilay; Shyy, Wei

    2003-01-01

    To develop future Reusable Launch Vehicle concepts, we have conducted design optimization for a single element rocket injector, with overall goals of improving reliability and performance while reducing cost. Computational solutions based on the Navier-Stokes equations, finite rate chemistry, and the k-E turbulence closure are generated with design of experiment techniques, and the response surface method is employed as the optimization tool. The design considerations are guided by four design objectives motivated by the consideration in both performance and life, namely, the maximum temperature on the oxidizer post tip, the maximum temperature on the injector face, the adiabatic wall temperature, and the length of the combustion zone. Four design variables are selected, namely, H2 flow angle, H2 and O2 flow areas with fixed flow rates, and O2 post tip thickness. In addition to establishing optimum designs by varying emphasis on the individual objectives, better insight into the interplay between design variables and their impact on the design objectives is gained. The investigation indicates that improvement in performance or life comes at the cost of the other. Best compromise is obtained when improvements in both performance and life are given equal importance.

  8. QM-400 CFD 自然对流模型研究及验证%Research and Validation on CFD Natural Convection Model of QM-400

    Institute of Scientific and Technical Information of China (English)

    左巧林; 干富军; 朱丽兵

    2016-01-01

    The spent fuel dry storage facility named QM-400 module for Third Qinshan Nuclear Power Co.Ltd.(TQNPC)is the first commercial dry storage facility in opera-tion in China.The heat transfer in QM-400 mainly consists of natural convention,con-duction,conjugate heat transfer and radiation,etc.The decay heat of each fuel basket was calculated accurately at typical surrounding temperature.Mesh sensitivity analysis was performed using commercial computational fluid dynamics (CFD)code FLUENT 14.0. A set of CFD simulation models on natural convection of QM-400 were developed.The results show that the distributions of the pressure and temperature on the cylinder sur-face meet the rules of natural convection.Good agreements are achieved between the simulated temperature and the measured temperature at the measured points and the simulated temperature trend varying with surrounding temperature agree well with the measured trend,which demonstrates the correctness of the calculation method of natural convection in this paper.This work can be the reference of the further CFD simulation on temperature distributions of dry storage facility without thermal insulation panels.%秦山第三核电厂乏燃料干式贮存模块 QM-400是我国第一座投入商业运行的干式贮存设施,模块内的热量交换主要包括自然对流、热传导、耦合传热和辐射换热等。本文精确计算了典型环境温度下每个燃料篮的衰变热,运用商用计算流体动力学(CFD)软件 FLUENT 14.0开展了网格敏感性分析,并建立了 QM-400存储模块的自然对流 CFD 分析模型。结果表明,模块顶面、侧面以及贮存筒表面压力和温度分布符合自然对流规律,计算的测点温度与现场的实测温度符合良好,测点温度随环境温度的变化趋势也与实测趋势符合良好,证明了建立的 CFD 自然对流计算方法的正确性。本文结果为后续采用CFD 方法进行取消绝热板后的温度场计算奠定了基础。

  9. CFD modelling approach for dam break flow studies

    Directory of Open Access Journals (Sweden)

    C. Biscarini

    2010-04-01

    Full Text Available This paper presents numerical simulations of free surface flows induced by a dam break comparing the shallow water approach to fully three-dimensional simulations. The latter are based on the solution of the complete set of Reynolds-Averaged Navier-Stokes (RANS equations coupled to the Volume of Fluid (VOF method.

    The methods assessment and comparison are carried out on a dam break over a flat bed without friction, a dam break over a triangular bottom sill and a dam break flow over a 90° bend. Experimental and numerical literature data are compared to present results.

    The results demonstrate that the shallow water approach, even if able to sufficiently reproduce the main aspects of the fluid flows, loses some three-dimensional phenomena, due to the incorrect shallow water idealization that neglects the three-dimensional aspects related to the gravity force.

  10. Bonneville Powerhouse 2 Fish Guidance Efficiency Studies: CFD Model of the Forebay

    Energy Technology Data Exchange (ETDEWEB)

    Rakowski, Cynthia L.; Serkowski, John A.; Richmond, Marshall C.

    2012-07-01

    In ongoing work, U.S. Army Corps of Engineers, Portland District (CENWP) is seeking to better understand and improve the conditions within the Bonneville Powerhouse 2 (B2) turbine intakes to improve survival of downstream migrant salmonid smolt. In this study, the existing B2 forebay computational fluid dynamics (CFD) model was modified to include a more detailed representation of all B2 turbine intakes. The modified model was validated to existing field-measured forebay ADCP velocities. The initial CFD model scenarios tested a single project operation and the impact of adding the Behavior Guidance System (BGS) or Corner Collector. These structures had impacts on forebay flows. Most notable was that the addition of the BGS and Corner Collector reduced the lateral extent of the recirculation areas on the Washington shore and Cascade Island and reduced the flow velocity parallel to the powerhouse in front of Units 11 and 12. For these same cases, at the turbine intakes across the powerhouse, there was very little difference in the flow volume into the gatewell for the clean forebay, and the forebay with the BGS in place and/or the Corner Collector operating. The largest differences were at Units 11 to 13. The CFD model cases testing the impact of the gatewell slot fillers showed no impact to the forebay flows, but large differences within the gatewells. With the slot fillers, the flow above the standard traveling screen and into the gatewell increased (about 100 cfs at each turbine intake) and the gap flow decreased across the powerhouse for all cases. The increased flow up the gatewell was further enhanced with only half the units operating. The flow into the gatewell slot was increased about 35 cfs for each bay of each intake across the powerhouse; this change was uniform across the powerhouse. The flows in the gatewell of Unit 12, the most impacted unit for the scenarios, was evaluated. In front of the vertical barrier screen, the CFD model with slot fillers

  11. CFD modelling approach for dam break flow studies

    Directory of Open Access Journals (Sweden)

    C. Biscarini

    2009-11-01

    Full Text Available This paper presents numerical simulations of free surface flows induced by a dam break comparing the shallow water approach to fully three-dimensional simulations. The latter are based on the solution of the complete set of Reynolds-Averaged Navier-Stokes (RANS equations coupled to the Volume of Fluid (VOF method.

    The methods assessment and comparison are carried out on a dam break over a flat bed without friction and a dam break over a triangular bottom sill. Experimental and numerical literature data are compared to present results.

    The results demonstrate that the shallow water approach loses some three-dimensional phenomena, which may have a great impact when evaluating the downstream wave propagation. In particular, water wave celerity and water depth profiles could be underestimated due to the incorrect shallow water idealization that neglects the three-dimensional aspects due to the gravity force, especially during the first time steps of the motion.

  12. A two-dimensional CFD model of a refrigerated display case

    Energy Technology Data Exchange (ETDEWEB)

    Stribling, D.; Tassou, S.A. [Brunel Univ., Uxbridge (United Kingdom). Dept. of Mechanical Engineering; Marriott, D. [Safeway Stores plc, Middlesex (United Kingdom)

    1997-12-31

    The discomfort caused by the cold air overspill from vertical refrigerated display cases in supermarkets is widely accepted as being a problem to customers. This, together with the adverse effect on case performance caused by heat and moisture transfer across the air curtain, suggests that there may be room for improvement in the design and fundamental operation of these display fixtures. This paper presents a two-dimensional computational fluid dynamics (CFD) model of a vertical dairy display case that could be used in the design and optimization of such equipment. Comparisons are also made with experimentally obtained values of velocity and temperature measured around the case in order to assess the accuracy and viability of such a model. Parameters of the computer model, such as the size of the calculation grid, the turbulence model, and the discretization scheme, were also varied to determine their effect on the converged solution, and these results are presented. The CFD model showed good qualitative agreement with measured values and requires only fine tuning to make it quantitatively accurate.

  13. A hydrodynamics-reaction kinetics coupled model for evaluating bioreactors derived from CFD simulation.

    Science.gov (United States)

    Wang, Xu; Ding, Jie; Guo, Wan-Qian; Ren, Nan-Qi

    2010-12-01

    Investigating how a bioreactor functions is a necessary precursor for successful reactor design and operation. Traditional methods used to investigate flow-field cannot meet this challenge accurately and economically. Hydrodynamics model can solve this problem, but to understand a bioreactor in sufficient depth, it is often insufficient. In this paper, a coupled hydrodynamics-reaction kinetics model was formulated from computational fluid dynamics (CFD) code to simulate a gas-liquid-solid three-phase biotreatment system for the first time. The hydrodynamics model is used to formulate prediction of the flow field and the reaction kinetics model then portrays the reaction conversion process. The coupled model is verified and used to simulate the behavior of an expanded granular sludge bed (EGSB) reactor for biohydrogen production. The flow patterns were visualized and analyzed. The coupled model also demonstrates a qualitative relationship between hydrodynamics and biohydrogen production. The advantages and limitations of applying this coupled model are discussed. PMID:20727741

  14. Dicty_cDB: CFD155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD155 (Link to dictyBase) - - - Contig-U16255-1 CFD155Z (Link... to Original site) - - CFD155Z 527 - - - - Show CFD155 Library CF (Link to library) Clone ID CFD155 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-C/CFD155Q.Seq.d/ Representative seq. ID CFD15...5Z (Link to Original site) Representative DNA sequence >CFD155 (CFD155Q) /CSM/CF/CFD1-C/CFD155Q.Seq.d/ XXXXX... CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD155 (CFD155Q) /CSM/CF/CFD

  15. Dicty_cDB: CFD833 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD833 (Link to dictyBase) - - - Contig-U16560-1 CFD833F (Link to Original site) CFD...833F 120 - - - - - - Show CFD833 Library CF (Link to library) Clone ID CFD833 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-B/CFD833Q.Seq.d/ Representative seq. ID CFD83...3F (Link to Original site) Representative DNA sequence >CFD833 (CFD833Q) /CSM/CF/CFD8-B/CFD833Q.Seq.d/ AAAAT...4.0 %: peroxisomal >> prediction for CFD833 is cyt 5' end seq. ID CFD833F 5' end seq. >CFD

  16. Dicty_cDB: CFD283 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD283 (Link to dictyBase) - - - Contig-U10672-1 CFD283P (Link to Original site) CFD...283F 569 CFD283Z 547 CFD283P 1116 - - Show CFD283 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-D/CFD283Q.Seq.d/ Representative seq. ID CFD...283P (Link to Original site) Representative DNA sequence >CFD283 (CFD283Q) /CSM/CF/CFD2-D/CFD...GXSYFISTIN *fit Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD

  17. Dicty_cDB: CFD409 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD409 (Link to dictyBase) - - - Contig-U12865-1 CFD409Z (Link... to Original site) - - CFD409Z 196 - - - - Show CFD409 Library CF (Link to library) Clone ID CFD409 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-A/CFD409Q.Seq.d/ Representative seq. ID CFD40...9Z (Link to Original site) Representative DNA sequence >CFD409 (CFD409Q) /CSM/CF/CFD4-A/CFD409Q.Seq.d/ XXXXX...kx*cqtkny sr*ip** Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD409 (CFD409Q) /CSM/CF/CFD

  18. Dicty_cDB: CFD327 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD327 (Link to dictyBase) - - - Contig-U16560-1 CFD327F (Link to Original site) CFD...327F 113 - - - - - - Show CFD327 Library CF (Link to library) Clone ID CFD327 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-B/CFD327Q.Seq.d/ Representative seq. ID CFD32...7F (Link to Original site) Representative DNA sequence >CFD327 (CFD327Q) /CSM/CF/CFD3-B/CFD327Q.Seq.d/ ATTTT....0 %: peroxisomal >> prediction for CFD327 is cyt 5' end seq. ID CFD327F 5' end seq. >CFD

  19. Dicty_cDB: CFD580 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD580 (Link to dictyBase) - - - Contig-U16368-1 CFD580F (Link to Original site) CFD...580F 516 - - - - - - Show CFD580 Library CF (Link to library) Clone ID CFD580 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-D/CFD580Q.Seq.d/ Representative seq. ID CFD58...0F (Link to Original site) Representative DNA sequence >CFD580 (CFD580Q) /CSM/CF/CFD5-D/CFD580Q.Seq.d/ AAATA...: vacuolar 4.0 %: mitochondrial 4.0 %: nuclear >> prediction for CFD580 is exc 5' end seq. ID CFD580F 5' end seq. >CFD

  20. Dicty_cDB: CFD807 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD807 (Link to dictyBase) - - - Contig-U10800-1 CFD807F (Link to Original site) CFD...807F 570 - - - - - - Show CFD807 Library CF (Link to library) Clone ID CFD807 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-A/CFD807Q.Seq.d/ Representative seq. ID CFD80...7F (Link to Original site) Representative DNA sequence >CFD807 (CFD807Q) /CSM/CF/CFD8-A/CFD807Q.Seq.d/ ATTAA...pisiillsl--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD807 (CFD807Q) /CSM/CF/CFD

  1. Dicty_cDB: CFD654 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD654 (Link to dictyBase) - - - Contig-U16602-1 CFD654F (Link to Original site) CFD...654F 570 - - - - - - Show CFD654 Library CF (Link to library) Clone ID CFD654 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-C/CFD654Q.Seq.d/ Representative seq. ID CFD65...4F (Link to Original site) Representative DNA sequence >CFD654 (CFD654Q) /CSM/CF/CFD6-C/CFD654Q.Seq.d/ AATTC... system 4.0 %: peroxisomal >> prediction for CFD654 is cyt 5' end seq. ID CFD654F 5' end seq. >CFD

  2. Dicty_cDB: CFD623 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD623 (Link to dictyBase) - - - Contig-U16450-1 CFD623P (Link to Original site) CFD...623F 533 CFD623Z 404 CFD623P 937 - - Show CFD623 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-A/CFD623Q.Seq.d/ Representative seq. ID CFD...623P (Link to Original site) Representative DNA sequence >CFD623 (CFD623Q) /CSM/CF/CFD6-A/CFD6...luding cell wall 24.0 %: cytoplasmic 16.0 %: mitochondrial 8.0 %: vacuolar 8.0 %: nuclear 4.0 %: cytoskeletal >> prediction for CFD

  3. Dicty_cDB: CFD726 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD726 (Link to dictyBase) - - - Contig-U11642-1 CFD726P (Link to Original site) CFD...726F 545 CFD726Z 570 CFD726P 1115 - - Show CFD726 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-B/CFD726Q.Seq.d/ Representative seq. ID CFD...726P (Link to Original site) Representative DNA sequence >CFD726 (CFD726Q) /CSM/CF/CFD7-B/CFD...x *ncflcxqlin* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD

  4. Dicty_cDB: CFD508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD508 (Link to dictyBase) - - - Contig-U15817-1 CFD508F (Link to Original site) CFD...508F 516 - - - - - - Show CFD508 Library CF (Link to library) Clone ID CFD508 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-A/CFD508Q.Seq.d/ Representative seq. ID CFD50...8F (Link to Original site) Representative DNA sequence >CFD508 (CFD508Q) /CSM/CF/CFD5-A/CFD508Q.Seq.d/ ATAGT...ic reticulum >> prediction for CFD508 is cyt 5' end seq. ID CFD508F 5' end seq. >CFD508F.Seq ATAGTTATTTAAATA

  5. Dicty_cDB: CFD130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD130 (Link to dictyBase) - G03006 DDB0191258 Contig-U16598-1 CFD...130P (Link to Original site) CFD130F 529 CFD130Z 445 CFD130P 974 - - Show CFD130 Library CF (Link to library) Clone ID CFD...ontig-U16598-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-B/CFD...130Q.Seq.d/ Representative seq. ID CFD130P (Link to Original site) Representative DNA sequence >CFD130 (CFD130Q) /CSM/CF/CFD...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD130 (CFD

  6. Dicty_cDB: CFD684 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD684 (Link to dictyBase) - - - Contig-U12597-1 CFD684F (Link to Original site) CFD...684F 128 - - - - - - Show CFD684 Library CF (Link to library) Clone ID CFD684 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-D/CFD684Q.Seq.d/ Representative seq. ID CFD68...4F (Link to Original site) Representative DNA sequence >CFD684 (CFD684Q) /CSM/CF/CFD6-D/CFD684Q.Seq.d/ ATATA...: cytoskeletal 8.0 %: mitochondrial 8.0 %: cytoplasmic >> prediction for CFD684 is nuc 5' end seq. ID CFD684F 5' end seq. >CFD

  7. Dicty_cDB: CFD758 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD758 (Link to dictyBase) - - - Contig-U16455-1 CFD758F (Link to Original site) CFD...758F 570 - - - - - - Show CFD758 Library CF (Link to library) Clone ID CFD758 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-C/CFD758Q.Seq.d/ Representative seq. ID CFD75...8F (Link to Original site) Representative DNA sequence >CFD758 (CFD758Q) /CSM/CF/CFD7-C/CFD758Q.Seq.d/ AAATT...qrsfifh*k--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD758 (CFD758Q) /CSM/CF/CFD

  8. Dicty_cDB: CFD131 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD131 (Link to dictyBase) - - - Contig-U09897-1 CFD131P (Link to Original site) CFD...131F 581 CFD131Z 205 CFD131P 786 - - Show CFD131 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-B/CFD131Q.Seq.d/ Representative seq. ID CFD...131P (Link to Original site) Representative DNA sequence >CFD131 (CFD131Q) /CSM/CF/CFD1-B/CFD1...QKKLIXFKVPKKIIITDNFPKTASGKIQRR FIADXLLKQQ Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD

  9. CFD modeling using PDF approach for investigating the flame length in rotary kilns

    Science.gov (United States)

    Elattar, H. F.; Specht, E.; Fouda, A.; Bin-Mahfouz, Abdullah S.

    2016-02-01

    Numerical simulations using computational fluid dynamics (CFD) are performed to investigate the flame length characteristics in rotary kilns using probability density function (PDF) approach. A commercial CFD package (ANSYS-Fluent) is employed for this objective. A 2-D axisymmetric model is applied to study the effect of both operating and geometric parameters of rotary kiln on the characteristics of the flame length. Three types of gaseous fuel are used in the present work; methane (CH4), carbon monoxide (CO) and biogas (50 % CH4 + 50 % CO2). Preliminary comparison study of 2-D modeling outputs of free jet flames with available experimental data is carried out to choose and validate the proper turbulence model for the present numerical simulations. The results showed that the excess air number, diameter of kiln air entrance, radiation modeling consideration and fuel type have remarkable effects on the flame length characteristics. Numerical correlations for the rotary kiln flame length are presented in terms of the studied kiln operating and geometric parameters within acceptable error.

  10. CFD model simulation of dispersion from chlorine railcar releases in industrial and urban areas

    Science.gov (United States)

    Hanna, Steven R.; Hansen, Olav R.; Ichard, Mathieu; Strimaitis, David

    To assist in emergency response decisions and planning in case of releases of pressurized liquefied chlorine from railroad tank cars in industrial sites and cities, the FLACS Computational Fluid Dynamics (CFD) model has been used to simulate the transport and dispersion of the dense chlorine cloud. Two accident locations are studied: an actual railcar accident at an industrial site in Festus, MO, and a hypothetical railcar accident at a rail junction in the Chicago urban area. The results show that transport of a large dense gas release at ground level in an industrial site or large city could initially extend a hundred meters or more in the upwind and crosswind directions. The dense cloud may follow terrain drainage, such as river channels. Near the source, the obstacles tend to slow down the dense gas cloud and may constrain it and cause increased concentrations. Farther downwind, the obstacles may cause enhanced mixing and dilution once the cloud has grown larger. In some cases, significant amounts of cloud mass may become "trapped" in obstacle wakes for many minutes after the main cloud has passed. Although the CFD model can account for the details of the flow and dispersion much better than standard widely-used simple dense gas models, many similarities are found among the various models in their simulated variations with downwind distance of the maximum cloud centerline concentration.

  11. Dicty_cDB: CFD641 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD641 (Link to dictyBase) - - - - CFD641P (Link to Original site) CFD641F 591 CFD...641Z 405 CFD641P 996 - - Show CFD641 Library CF (Link to library) Clone ID CFD641 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD...6-B/CFD641Q.Seq.d/ Representative seq. ID CFD641P (Link to ...Original site) Representative DNA sequence >CFD641 (CFD641Q) /CSM/CF/CFD6-B/CFD641Q.Seq.d/ ATTATTGTTAAAATAAG

  12. Dicty_cDB: CFD217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD217 (Link to dictyBase) - - - - CFD217P (Link to Original site) CFD217F 882 CFD...217Z 869 CFD217P 1751 - - Show CFD217 Library CF (Link to library) Clone ID CFD217 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD...2-A/CFD217Q.Seq.d/ Representative seq. ID CFD217P (Link to... Original site) Representative DNA sequence >CFD217 (CFD217Q) /CSM/CF/CFD2-A/CFD217Q.Seq.d/ TTTACATATTAATTAA

  13. Dicty_cDB: CFD455 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD455 (Link to dictyBase) - G21745 DDB0216753 Contig-U11207-1 | Contig-U15871-1 CFD...455P (Link to Original site) CFD455F 581 CFD455Z 154 CFD455P 735 - - Show CFD455 Libra...ry CF (Link to library) Clone ID CFD455 (Link to dictyBase) Atlas ID - NBRP ID G21745 dictyBase ID DDB021675...cdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-C/CFD455Q.Seq.d/ Representative seq. ID CFD455P (Link to Original site) R...epresentative DNA sequence >CFD455 (CFD455Q) /CSM/CF/CFD4-C/CFD455Q.Seq.d/ AACAACAATAATACCAACAATAATAATCAAAGA

  14. Dicty_cDB: CFD261 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD261 (Link to dictyBase) - G22821 DDB0191648 Contig-U00762-1 | Contig-U16408-1 CFD...261P (Link to Original site) CFD261F 599 CFD261Z 360 CFD261P 959 - - Show CFD261 Libra...ry CF (Link to library) Clone ID CFD261 (Link to dictyBase) Atlas ID - NBRP ID G22821 dictyBase ID DDB019164...cdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-C/CFD261Q.Seq.d/ Representative seq. ID CFD261P (Link to Original site) R...epresentative DNA sequence >CFD261 (CFD261Q) /CSM/CF/CFD2-C/CFD261Q.Seq.d/ ATACTTACCTGTCAATATTAATATGTGATCACA

  15. Dicty_cDB: CFD339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD339 (Link to dictyBase) - - - - CFD339P (Link to Original site) CFD339F 636 CFD...339Z 631 CFD339P 1267 - - Show CFD339 Library CF (Link to library) Clone ID CFD339 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD...3-B/CFD339Q.Seq.d/ Representative seq. ID CFD339P (Link to... Original site) Representative DNA sequence >CFD339 (CFD339Q) /CSM/CF/CFD3-B/CFD339Q.Seq.d/ GGTGGTGGTACATTTG

  16. Dicty_cDB: CFD815 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD815 (Link to dictyBase) - - - - CFD815P (Link to Original site) CFD815F 638 CFD...815Z 327 CFD815P 965 - - Show CFD815 Library CF (Link to library) Clone ID CFD815 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD...8-A/CFD815Q.Seq.d/ Representative seq. ID CFD815P (Link to ...Original site) Representative DNA sequence >CFD815 (CFD815Q) /CSM/CF/CFD8-A/CFD815Q.Seq.d/ AATATATTCACACAACA

  17. Comparison of CFD and operational dispersion models in an urban-like environment

    Science.gov (United States)

    Antonioni, G.; Burkhart, S.; Burman, J.; Dejoan, A.; Fusco, A.; Gaasbeek, R.; Gjesdal, T.; Jäppinen, A.; Riikonen, K.; Morra, P.; Parmhed, O.; Santiago, J. L.

    2012-02-01

    Chemical plants, refineries, transportation of hazardous materials are some of the most attractive facilities for external attacks aimed at the release of toxic substances. Dispersion of these substances into the atmosphere forms a concentration distribution of airborne pollutants with severe consequences for exposed individuals. For emergency preparedness and management, the availability of assessed/validated dispersion models, which can be able to predict concentration distribution and thus dangerous zones for exposed individuals, is of primary importance. Air quality models, integral models and analytical models predict the transport and the turbulent dispersion of gases or aerosols after their release without taking into account in detail the presence of obstacles. Obstacles can modify the velocity field and in turn the concentration field. The Computational Fluid Dynamics (CFD) models on the other hand are able to describe such phenomena, but they need to be correctly set up, tested and validated in order to obtain reliable results. Within the project Europa-ERG1 TA 113.034 "NBC Modelling and Simulation" several different approaches in CFD modelling of turbulent dispersion in closed, semi-confined and urban-like environment were adopted and compared with experimental data and with operational models. In this paper the results of a comparison between models describing the dispersion of a neutral gas in an idealized urban-like environment are presented and discussed. Experimental data available in the literature have been used as a benchmark for assessing statistical performance for each model. Selected experimental trials include some water channel tests, that were performed by Coanda at 1:205 scale, and one full-scale case that was tested in the fall of 2001 at the Dugway Proving Grounds in Utah, using an array of shipping containers. The paper also suggests the adoption of improved statistical parameters in order to better address differences between models

  18. Base Flow Model Validation Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The innovation is the systematic "building-block" validation of CFD/turbulence models employing a GUI driven CFD code (RPFM) and existing as well as new data sets...

  19. Experimental Analysis and Simultaneous Heat and Moisture Transfer with Coupled CFD Model for Convective Drying of Moist Object

    Science.gov (United States)

    Chandramohan, V. P.

    2016-01-01

    Convective drying of rectangular-shaped moist object has been analyzed both experimentally and numerically. Transient mass of the potato sample is measured experimentally. Moisture content, diffusivity, and density of the object are calculated at different drying air temperatures from 40°C to 70°C with an air velocity of 2 m/s. A three-dimensional (3D) finite volume method (FVM) based numerical model is developed to predict the temperature and moisture distribution. A computational fluid dynamics (CFD) code is used for predicting heat and mass transfer coefficients required in the boundary conditions of the heat and mass transfer model. The experimental and numerical data are compared and good agreement is observed.

  20. Hydrogen production in a zigzag and straight catalytic wall coated micro channel reactor by CFD modeling

    Energy Technology Data Exchange (ETDEWEB)

    Fazeli, Ali; Behnam, Mohsen [Gas Research Division, Research Institute of Petroleum Industry (RIPI), P.O. Box 14665-137, Tehran (Iran)

    2010-09-15

    Hydrogen production from steam reforming of methanol for fuel cell application was modeled in a wall coated micro channel reactor by CFD approach. Heat of steam reforming (SR) was supplied from catalytic total oxidation (TOX) of methanol on Cu/ZnO/Al{sub 2}O{sub 3} catalyst and Heat conducts from TOX to SR zone through Steel divider wall between two channels. Heat integration was compared in zigzag and straight geometry of microreactor by CFD modeling. The model is two dimensional, steady state and containing five zones: TOX fluid, TOX catalyst layer, steel wall of the channel, SR catalyst layer and SR fluid. Set of partial differential equations (PDEs) including x and y momentum balance, continuity, partial mass balances and energy balance was solved by finite volume method. Stiff reaction rates were considered for methanol total oxidation (TOX), methanol steam reforming (SR), water gas shift (WGS) and methanol decomposition (MD) reactions. The results show that zigzag geometry is better than straight one because heat and mass transfer in zigzag reactor are more than straight. Conversion of methanol in zigzag geometry is greater than straight one. In the outlet of zigzag micro channels, carbon monoxide selectivity is less and hydrogen mole fraction is more than straight one. (author)

  1. CFD Modeling of Wall Steam Condensation: Two-Phase Flow Approach versus Homogeneous Flow Approach

    Directory of Open Access Journals (Sweden)

    S. Mimouni

    2011-01-01

    Full Text Available The present work is focused on the condensation heat transfer that plays a dominant role in many accident scenarios postulated to occur in the containment of nuclear reactors. The study compares a general multiphase approach implemented in NEPTUNE_CFD with a homogeneous model, of widespread use for engineering studies, implemented in Code_Saturne. The model implemented in NEPTUNE_CFD assumes that liquid droplets form along the wall within nucleation sites. Vapor condensation on droplets makes them grow. Once the droplet diameter reaches a critical value, gravitational forces compensate surface tension force and then droplets slide over the wall and form a liquid film. This approach allows taking into account simultaneously the mechanical drift between the droplet and the gas, the heat and mass transfer on droplets in the core of the flow and the condensation/evaporation phenomena on the walls. As concern the homogeneous approach, the motion of the liquid film due to the gravitational forces is neglected, as well as the volume occupied by the liquid. Both condensation models and compressible procedures are validated and compared to experimental data provided by the TOSQAN ISP47 experiment (IRSN Saclay. Computational results compare favorably with experimental data, particularly for the Helium and steam volume fractions.

  2. Validating CFD Models of Multiphase Mixing in the Waste Treatment Plant at the Hanford Site

    International Nuclear Information System (INIS)

    The Columbia River in Washington State is threatened by the radioactive legacy of the cold war. Two hundred thousand cubic meters (fifty-three million US gallons) of radioactive waste is stored in 177 underground tanks (60% of the Nation's radioactive waste). A vast complex of waste treatment facilities is being built to convert this waste into stable glass (vitrification). The waste in these underground tanks is a combination of sludge, slurry, and liquid. The waste will be transported to a pre-treatment facility where it will be processed before vitrification. It is necessary to keep the solids in suspension during processing. The mixing devices selected for this task are known as pulse-jet mixers (PJMs). PJMs cyclically empty and refill with the contents of the vessel to keep it mixed. The transient operation of the PJMs has been proven successful in a number of applications, but needs additional evaluation to be proven effective for the slurries and requirements at the Waste Treatment Plant (WTP). Computational fluid dynamic (CFD) models of mixing vessels have been developed to demonstrate the ability of the PJMs to meet mixing criteria. Experimental studies have been performed to validate these models. These tests show good agreement with the transient multiphase CFD models developed for this engineering challenge. (authors)

  3. Propulsion Simulations Using Advanced Turbulence Models with the Unstructured Grid CFD Tool, TetrUSS

    Science.gov (United States)

    Abdol-Hamid, Khaled S.; Frink, Neal T.; Deere, Karen A.; Pandya, Mohangna J.

    2004-01-01

    A computational investigation has been completed to assess the capability of TetrUSS for exhaust nozzle flows. Three configurations were chosen for this study (1) an axisymmetric supersonic jet, (2) a transonic axisymmetric boattail with solid sting operated at different Reynolds number and Mach number, and (3) an isolated non-axisymmetric nacelle with a supersonic cruise nozzle. These configurations were chosen because existing experimental data provided a means for measuring the ability of TetrUSS for simulating complex nozzle flows. The main objective of this paper is to validate the implementation of advanced two-equation turbulence models in the unstructured-grid CFD code USM3D for propulsion flow cases. USM3D is the flow solver of the TetrUSS system. Three different turbulence models, namely, Menter Shear Stress Transport (SST), basic k epsilon, and the Spalart-Allmaras (SA) are used in the present study. The results are generally in agreement with other implementations of these models in structured-grid CFD codes. Results indicate that USM3D provides accurate simulations for complex aerodynamic configurations with propulsion integration.

  4. Numerical predictions of flow boiling characteristics: Current status, model setup and CFD modeling for different non-uniform heating profiles

    International Nuclear Information System (INIS)

    A detailed analysis of two-phase flow boiling characteristics inside high pressure systems is presented focusing on non-uniform axial heating profiles. For this purpose, a detailed numerical model has been developed after presenting the current status of the use of CFD techniques in flow boiling predictions. User defined functions written in C++ were compiled and hooked to the software in order to account for mass interaction between phases using the Eulerian multiphase flow model. The modeled domain is a 2 m long stainless steel pipe with inside and outside diameters of 15.4 mm, 25.4 mm, respectively. The base imposed uniform heat flux was 345.6 kW/m2, for mass flow rate of water of 0.161 kg/s and at a temperature of 200 °C. The model was validated against range of experimental data and the results are very promising for the use of CFD in flow boiling characterization. Effects of increasing uniform heat flux were considered for different increments of 30, 50 and 75% as reference to the basic applied heat flux. The influences of heat flux profile in the axial direction were investigated while maintaining the same total power. Different heat flux profiles of linearly increasing, linearly decreasing, sine, and cosine shapes were considered. - Highlights: • Current status of CHF predictions using CFD modeling technique. • State of the art, flow boiling 2D-model for the applications of high pressure systems. • Validation of the model using the available experimental data in the literature. • Investigation of flow boiling in real systems for non-uniform heating profile. • Analysis of keeping the system away from the CHF conditions for non-uniform heating

  5. Evaluation of source model coupled computational fluid dynamics (CFD) simulation of the dispersion of airborne contaminants in a work environment.

    Science.gov (United States)

    Salim, S M; Viswanathan, Shekar; Ray, Madhumita Bhowmick

    2006-12-01

    Dispersion of airborne contaminants in indoor air was evaluated employing physical measurement, empirical models, and computer simulation methods. Field data collected from a tray of evaporating solvent in the laboratory were compared with computational fluid dynamics (CFD) simulations coupled with evaporation models. The results indicated that mathematical models of evaporation can be coupled with CFD simulations to produce reasonable qualitative predictions of airborne contaminant levels. The airflow pattern within a room is primarily determined by the room layout and the position of the air supply diffusers. Variations in ventilation rate did not alter the airflow pattern, thus generating a characteristic concentration profile of the airborne contaminants. PMID:17050350

  6. 3D CFD Electrochemical and Heat Transfer Model of an Integrated-Planar Solid Oxide Electrolysis Cells

    Energy Technology Data Exchange (ETDEWEB)

    Grant Hawkes; James E. O' Brien

    2008-10-01

    A three-dimensional computational fluid dynamics (CFD) electrochemical model has been created to model high-temperature electrolysis cell performance and steam electrolysis in a new novel integrated planar porous-tube supported solid oxide electrolysis cell (SOEC). The model is of several integrated planar cells attached to a ceramic support tube. This design is being evaluated with modeling at the Idaho National Laboratory. Mass, momentum, energy, and species conservation and transport are provided via the core features of the commercial CFD code FLUENT. A solid-oxide fuel cell (SOFC) model adds the electrochemical reactions and loss mechanisms and computation of the electric field throughout the cell. The FLUENT SOFC user-defined subroutine was modified for this work to allow for operation in the SOEC mode. Model results provide detailed profiles of temperature, Nernst potential, operating potential, activation over-potential, anode-side gas composition, cathode-side gas composition, current density and hydrogen production over a range of stack operating conditions. Mean per-cell area-specific-resistance (ASR) values decrease with increasing current density. Predicted mean outlet hydrogen and steam concentrations vary linearly with current density, as expected. Effects of variations in operating temperature, gas flow rate, cathode and anode exchange current density, and contact resistance from the base case are presented. Contour plots of local electrolyte temperature, current density, and Nernst potential indicated the effects of heat transfer, reaction cooling/heating, and change in local gas composition. Results are discussed for using this design in the electrolysis mode. Discussion of thermal neutral voltage, enthalpy of reaction, hydrogen production, cell thermal efficiency, cell electrical efficiency, and Gibbs free energy are discussed and reported herein.

  7. Validation of a loss of vacuum accident (LOVA) Computational Fluid Dynamics (CFD) model

    Energy Technology Data Exchange (ETDEWEB)

    Bellecci, C.; Gaudio, P. [EURATOM-Faculty of Engineering, University of Rome ' Tor Vergata' Via del Politecnico 1, 00133 Rome (Italy); Lupelli, I., E-mail: ivan.lupelli@uniroma2.it [EURATOM-Faculty of Engineering, University of Rome ' Tor Vergata' Via del Politecnico 1, 00133 Rome (Italy); Malizia, A. [EURATOM-Faculty of Engineering, University of Rome ' Tor Vergata' Via del Politecnico 1, 00133 Rome (Italy); Porfiri, M.T. [ENEA Nuclear Fusion Tecnologies, Via Enrico Fermi, 45 I-00044 Frascati (Italy); Quaranta, R.; Richetta, M. [EURATOM-Faculty of Engineering, University of Rome ' Tor Vergata' Via del Politecnico 1, 00133 Rome (Italy)

    2011-10-15

    Intense thermal loads in fusion devices occur during plasma disruptions, Edge Localized Modes (ELM) and Vertical Displacement Events (VDE). They will result in macroscopic erosion of the plasma facing materials and consequent accumulation of activated dust into the ITER Vacuum Vessel (VV). A recognized safety issue for future fusion reactors fueled with deuterium and tritium is the generation of sizeable quantities of dust. In case of LOVA, air inlet occurs due to the pressure difference between the atmospheric condition and the internal condition. It causes mobilization of the dust that can exit the VV threatening public safety because it may contain tritium, may be radioactive from activation products, and may be chemically reactive and/or toxic (Sharpe et al.; Sharpe and Humrickhouse). Several experiments have been conducted with STARDUST facility in order to reproduce a low pressurization rate (300 Pa/s) LOVA event in ITER due to a small air leakage for two different positions of the leak, at the equatorial port level and at the divertor port level, in order to evaluate the velocity magnitude in case of a LOVA that is strictly connected with dust mobilization phenomena. A two-dimensional (2D) modelling of STARDUST, made with the CFD commercial code FLUENT, has been carried out. The results of these simulations were compared against the experimental data for CFD code validation. For validation purposes, the CFD simulation data were extracted at the same locations as the experimental data were collected. In this paper, the authors present and discuss the computer-simulation data and compare them with data collected during the laboratory studies at the University of Rome 'Tor Vergata' Quantum Electronics and Plasmas lab.

  8. CFD based simulation of thoron ((220)Rn) concentration in a delay chamber for mitigation application.

    Science.gov (United States)

    Agarwal, T K; Sahoo, B K; Gaware, J J; Joshi, M; Sapra, B K

    2014-10-01

    The release of (220)Rn gas (conventionally referred to as thoron) is an issue of concern from the radiological point of view for occupational environments pertaining to the thorium fuel cycle. Studies for understanding its release and developing systems to control it are crucial for exposure control research. A thorough study of the "Delay Volume Technique" for mitigation of (220)Rn has been carried out. Experiments have been carried out with (220)Rn source and associated measurement system in a cubical chamber (delay chamber) of 0.5 m(3) volume. For different flow conditions and inlet-outlet positions, (220)Rn transmission factor has been obtained. Computational Fluid Dynamics (CFD) technique has been employed for these experimental conditions and the simulated transmission factors have been compared. The results show that the flow and the position of the inlet and outlet play an imperative role in the transportation, mixing and subsequent mitigation of thoron inside the chamber. Predictive capability of CFD technique for such delay volume experiments has been validated in this work. A comparison has been made with uniform mixing model and it is found that the results of simulation differ appreciably from that of uniform mixing model at the tested flow regime. PMID:24860913

  9. CFD Modelling of Biomass Combustion in Small-Scale Boilers. Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Xue-Song Bai; Griselin, Niklas; Klason, Torbern; Nilsson, Johan [Lund Inst. of Tech. (Sweden). Dept. of Heat and Power Engineering

    2002-10-01

    This project deals with CFD modeling of combustion of wood in fixed bed boilers. A flamelet model for the interaction between turbulence and chemical reactions is developed and applied to study small-scale boiler. The flamelet chemistry employs 43 reactive species and 174 elementary reactions. It gives detailed distributions of important species such as CO and NO{sub x} in the flow field and flue gas. Simulation of a small-scale wood fired boiler measured at SP Boraas (50 KW) shows that the current flamelet model yields results agreeable to the available experimental data. A detailed chemical kinetic model is developed to study the bed combustion process. This model gives boundary conditions for the CFD analysis of gas phase volatile oxidation in the combustion chambers. The model combines a Functional Group submodel with a Depolymerisation, Vaporisation and Crosslinking submodel. The FG submodel simulates how functional groups decompose and form light gas species. The DVC submodell predicts depolymerisation and vaporisation of the macromolecular network and this includes bridge breaking and crosslinking processes, where the wood structure breaks down to fragments. The light fragments form tar and the heavy ones form metaplast. Two boilers firing wood log/chips are studied using the FG-DVC model, one is the SP Boraas small-scale boiler (50 KW) and the other is the Sydkraft Malmoe Vaerme AB's Flintraennan large-scale boiler (55 MW). The fix bed is assumed to be two zones, a partial equilibrium drying/devolatilisation zone and an equilibrium zone. Three typical biomass conversion modes are simulated, a lean fuel combustion mode, a near-stoichiometric combustion and a fuel rich gasification mode. Detailed chemical species and temperatures at different modes are obtained. Physical interpretation is provided. Comparison of the computational results with experimental data shows that the model can reasonably simulate the fixed bed biomass conversion process. CFD

  10. CFD Recombiner Modelling and Validation on the H2-Par and Kali-H2 Experiments

    Directory of Open Access Journals (Sweden)

    Stéphane Mimouni

    2011-01-01

    Full Text Available A large amount of Hydrogen gas is expected to be released within the dry containment of a pressurized water reactor (PWR, shortly after the hypothetical beginning of a severe accident leading to the melting of the core. According to local gas concentrations, the gaseous mixture of hydrogen, air and steam can reach the flammability limit, threatening the containment integrity. In order to prevent mechanical loads resulting from a possible conflagration of the gas mixture, French and German reactor containments are equipped with passive autocatalytic recombiners (PARs which preventively oxidize hydrogen for concentrations lower than that of the flammability limit. The objective of the paper is to present numerical assessments of the recombiner models implemented in CFD solvers NEPTUNE_CFD and Code_Saturne. Under the EDF/EPRI agreement, CEA has been committed to perform 42 tests of PARs. The experimental program named KALI-H2, consists checking the performance and behaviour of PAR. Unrealistic values for the gas temperature are calculated if the conjugate heat transfer and the wall steam condensation are not taken into account. The combined effects of these models give a good agreement between computational results and experimental data.

  11. A CFD-based analysis of the 14-Bis aircraft aerodynamics and stability

    Directory of Open Access Journals (Sweden)

    Leonardo Ostan Bitencourt

    2011-05-01

    Full Text Available The work reported in the present paper was performed to honor the centennial of the flight by Alberto Santos Dumont with his 14-Bis aircraft. The paper describes results for a computational fluid dynamics (CFD analysis of the 14-Bis aircraft aerodynamics and flight stability. The 14-Bis aircraft geometry was generated from historical sources and observations. CFD computations were performed using well-established commercial codes for calculation of the historical flight conditions. Simulations considered a Reynolds-averaged Navier-Stokes formulation, in which turbulence closure was achieved by using Menter's model. The flight conditions investigated were primarily concerned with historical observations regarding flight speeds and the need for a more powerful engine, as well as flight stability characteristics of the 14-Bis airplane, which are unknown up to the present day. The results led to qualitative agreement with historical reports, although quite interesting conclusions could be drawn with regard to the actual aerodynamic flight speeds and the aircraft stability parameters.

  12. Development of a GUI Based Front End for Open Source CFD Program, OpenFOAM

    Energy Technology Data Exchange (ETDEWEB)

    Han, Samhee; Lee, Youngjin; Kim, Hyongchol; Park, Sunbyung; Kim, Hyunjik [Nuclear Safety Evaluation, Daejeon (Korea, Republic of)

    2013-05-15

    OpenFOAM is sorely lacking in user friendliness as it runs in console mode under Li nux. Run{sub F}OAM was developed to greatly simplify the task of running an OpenFOAM calculation under Windows OS. Run{sub F}OAM was written using Delphi object pascal language, and GLScene package was used for the 3D graphics. Verification of Run{sub F}OAM was carried out by performing some OpenFOAM CFD calculations provided in OpenFOAM package, and these showed that the use of Run{sub F}OAM is simple whilst providing sufficient allowances in user modifications. Run{sub F}oam, a GUI based front end program to simplify running Open Foam CFD cases, has been developed. By incorporating numerous GUI in the program, Run{sub F}oam has demonstrated that running an Open Foam case can be easily accomplished. There is a potential for further development as the Open Foam has the great advantage of being free to develop and to use. There is also a potential to couple or interface the Open Foam with the systems analysis code such as Relap5.

  13. Development of a GUI Based Front End for Open Source CFD Program, OpenFOAM

    International Nuclear Information System (INIS)

    OpenFOAM is sorely lacking in user friendliness as it runs in console mode under Li nux. RunFOAM was developed to greatly simplify the task of running an OpenFOAM calculation under Windows OS. RunFOAM was written using Delphi object pascal language, and GLScene package was used for the 3D graphics. Verification of RunFOAM was carried out by performing some OpenFOAM CFD calculations provided in OpenFOAM package, and these showed that the use of RunFOAM is simple whilst providing sufficient allowances in user modifications. RunFoam, a GUI based front end program to simplify running Open Foam CFD cases, has been developed. By incorporating numerous GUI in the program, RunFoam has demonstrated that running an Open Foam case can be easily accomplished. There is a potential for further development as the Open Foam has the great advantage of being free to develop and to use. There is also a potential to couple or interface the Open Foam with the systems analysis code such as Relap5

  14. Actuator forces in CFD: RANS and LES modeling in OpenFOAM

    International Nuclear Information System (INIS)

    Wind turbine wakes are a very challenging topic for scientific computations, but modern CFD frameworks and latest HPC centers allow setting up numerical computations on the wake induced by the wind turbine. The main issues is that the correct modeling of the wake is related to the correct modeling of the interaction between the blade and the incoming flow. The aim of the proposed work is to estimate the aerodynamic forces acting on the blades in order to correctly generate the rotor wake applying equivalent aerodynamic force source on the flow. The definition of a blade forces is done developing a model able to correctly estimate this aerodynamic forces as a function of the local flow seen by the blade during its revolution

  15. The CFD Investigation of Two Non-Aligned Turbines Using Actuator Disk Model and Overset Grids

    International Nuclear Information System (INIS)

    In this study flow over two axially non-aligned wind turbines is investigated via 3-D CFD analysis by solving Navier-Stokes equations. This setting is the test case geometry for the NTNU's ''Blind-Test'' Workshop 3 (BT3) and it aims to predict the performance of the wind turbines and their wake development under asymmetrical flow conditions. The performance of the turbine in the wake of the other turbine is numerically studied for different tip speed ratios. The measurements of velocity profile which is severely disturbed by both turbines are also carried out at the several locations of the wind tunnel. The computational results for NTNU wind turbine test case were obtained by 3-D CFD simulations with two different approaches. The first approach is to employ the actuator disk model, which is used in order to approximate the pressure jump across the rotor disk to simulate the impact of the wind turbines. At the second approach, the actual geometry of the turbine rotor was used, and the rotor blades were rotated using an overset grid methodology over the background grids. The thrust coefficients and the velocity profiles are calculated with two different approaches and the results are compared to experimental data presented in BT3

  16. CFD Analysis for Optimum Thermal Design of Carbon Nanotube Based Micro-Channel Heatsink

    Directory of Open Access Journals (Sweden)

    M. Mahbub

    2011-10-01

    Full Text Available Carbon nanotube (CNT is considered as an ideal material for thermal management in electronic packaging because of its extraordinary high thermal conductivity. Fabricated onto a silicon substrate to form micro-channels, the CNT based cooling fins show high heat dissipation efficiency. A series of 2D and 3D CFD simulations have been carried out for CNT based micro-channel cooling architectures based on one and two dimensional fin array in this paper using COMSOL 4.0a software. Micro-channels are generally regarded as an effective method for the heat transfer in electronic products. The influence of various fluids, micro-fin structures, fluid velocity and heating powers on cooling effects have been simulated and compared in this study. Steady-state thermal stress analyses for the forced convection heat transfer are also performed to determine maximum allowable stress and deflections for the different types of cooling assembly.

  17. Dicty_cDB: CFD665 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD665 (Link to dictyBase) - - - Contig-U16255-1 CFD665Z (Link... to Original site) - - CFD665Z 426 - - - - Show CFD665 Library CF (Link to library) Clone ID CFD665 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-C/CFD665Q.Seq.d/ Representative seq. ID CFD66...5Z (Link to Original site) Representative DNA sequence >CFD665 (CFD665Q) /CSM/CF/CFD6-C/CFD665Q.Seq.d/ XXXXX...oskeletal >> prediction for CFD665 is nuc 5' end seq. ID - 5' end seq. - Length of 5' end seq. - 3' end seq. ID CFD

  18. Dicty_cDB: CFD710 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD710 (Link to dictyBase) - - - Contig-U16381-1 CFD710F (Link to Original site) CFD...710F 121 - - - - - - Show CFD710 Library CF (Link to library) Clone ID CFD710 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-A/CFD710Q.Seq.d/ Representative seq. ID CFD71...0F (Link to Original site) Representative DNA sequence >CFD710 (CFD710Q) /CSM/CF/CFD7-A/CFD710Q.Seq.d/ GTAGT...233,276 protein update 2009. 5.13 PSORT - 5' end seq. ID CFD710F 5' end seq. >CFD710F.Seq GTAGTATTTTGTTCATAT

  19. Dicty_cDB: CFD302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD302 (Link to dictyBase) - - - Contig-U16381-1 CFD302F (Link to Original site) CFD...302F 124 - - - - - - Show CFD302 Library CF (Link to library) Clone ID CFD302 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-A/CFD302Q.Seq.d/ Representative seq. ID CFD30...2F (Link to Original site) Representative DNA sequence >CFD302 (CFD302Q) /CSM/CF/CFD3-A/CFD302Q.Seq.d/ ATTGT...3 PSORT - 5' end seq. ID CFD302F 5' end seq. >CFD302F.Seq ATTGTAGTATTTTGTTCATATTCAAATTAAATATCAATACAATTAAAAAA

  20. Dicty_cDB: CFD509 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD509 (Link to dictyBase) - G22822 DDB0188045 Contig-U14185-1 CFD...509Z (Link to Original site) - - CFD509Z 312 - - - - Show CFD509 Library CF (Link to library) Clone ID CFD...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-A/CFD509Q.Seq.d/ ...Representative seq. ID CFD509Z (Link to Original site) Representative DNA sequence >CFD509 (CFD509Q) /CSM/CF/CFD5-A/CFD...YMMKKDTRLKQNK*inkitk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD509 (CFD

  1. Dicty_cDB: CFD856 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD856 (Link to dictyBase) - G21749 DDB0218152 Contig-U03176-1 CFD...856F (Link to Original site) CFD856F 237 - - - - - - Show CFD856 Library CF (Link to library) Clone ID CFD...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-C/CFD856Q.Seq.d/ ...Representative seq. ID CFD856F (Link to Original site) Representative DNA sequence >CFD856 (CFD856Q) /CSM/CF/CFD8-C/CFD...n*k*k*klc** kikkrtkkkgtkgnqkpk--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD856 (CFD

  2. Dicty_cDB: CFD316 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD316 (Link to dictyBase) - - - Contig-U16358-1 CFD316F (Link to Original site) CFD...316F 585 - - - - - - Show CFD316 Library CF (Link to library) Clone ID CFD316 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-A/CFD316Q.Seq.d/ Representative seq. ID CFD31...6F (Link to Original site) Representative DNA sequence >CFD316 (CFD316Q) /CSM/CF/CFD3-A/CFD316Q.Seq.d/ ACAAA...lular, including cell wall 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for CFD316 is cyt 5' end seq. ID CFD

  3. Dicty_cDB: CFD642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD642 (Link to dictyBase) - - - Contig-U12597-1 CFD642F (Link to Original site) CFD...642F 130 - - - - - - Show CFD642 Library CF (Link to library) Clone ID CFD642 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-B/CFD642Q.Seq.d/ Representative seq. ID CFD64...2F (Link to Original site) Representative DNA sequence >CFD642 (CFD642Q) /CSM/CF/CFD6-B/CFD642Q.Seq.d/ ATATA...ear 8.0 %: cytoskeletal 8.0 %: mitochondrial 8.0 %: cytoplasmic >> prediction for CFD642 is nuc 5' end seq. ID CFD

  4. Dicty_cDB: CFD837 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD837 (Link to dictyBase) - - - Contig-U10808-1 CFD837F (Link to Original site) CFD...837F 654 - - - - - - Show CFD837 Library CF (Link to library) Clone ID CFD837 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-B/CFD837Q.Seq.d/ Representative seq. ID CFD83...7F (Link to Original site) Representative DNA sequence >CFD837 (CFD837Q) /CSM/CF/CFD8-B/CFD837Q.Seq.d/ AAATT...0.0 SFC341 (SFC341Q) /CSM/SF/SFC3-B/SFC341Q.Seq.d/ 1128 0.0 CFE266 (CFE266Q) /CSM/CF/CFE2-C/CFE266Q.Seq.d/ 1128 0.0 CFD837 (CFD

  5. Dicty_cDB: CFD422 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD422 (Link to dictyBase) - - - Contig-U16381-1 CFD422F (Link to Original site) CFD...422F 124 - - - - - - Show CFD422 Library CF (Link to library) Clone ID CFD422 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-A/CFD422Q.Seq.d/ Representative seq. ID CFD42...2F (Link to Original site) Representative DNA sequence >CFD422 (CFD422Q) /CSM/CF/CFD4-A/CFD422Q.Seq.d/ ATTGT...DB: 74,169,940 protein update 2009. 5.13 PSORT - 5' end seq. ID CFD422F 5' end seq. >CFD422F.Seq ATTGTAGTATT

  6. Dicty_cDB: CFD188 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD188 (Link to dictyBase) - - - Contig-U16255-1 CFD188Z (Link... to Original site) - - CFD188Z 198 - - - - Show CFD188 Library CF (Link to library) Clone ID CFD188 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-D/CFD188Q.Seq.d/ Representative seq. ID CFD18...8Z (Link to Original site) Representative DNA sequence >CFD188 (CFD188Q) /CSM/CF/CFD1-D/CFD188Q.Seq.d/ XXXXX...****il*vityr yvderkil Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD188 (CFD

  7. Dicty_cDB: CFD875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD875 (Link to dictyBase) - - - Contig-U16456-1 CFD875F (Link to Original site) CFD...875F 582 - - - - - - Show CFD875 Library CF (Link to library) Clone ID CFD875 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD8-D/CFD875Q.Seq.d/ Representative seq. ID CFD87...5F (Link to Original site) Representative DNA sequence >CFD875 (CFD875Q) /CSM/CF/CFD8-D/CFD875Q.Seq.d/ AAGGA...0 CFK206 (CFK206Q) /CSM/CF/CFK2-A/CFK206Q.Seq.d/ 1112 0.0 CFF387 (CFF387Q) /CSM/CF/CFF3-D/CFF387Q.Seq.d/ 1112 0.0 CFD875 (CFD

  8. Dicty_cDB: CFD433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD433 (Link to dictyBase) - - - Contig-U14183-1 CFD433Z (Link... to Original site) - - CFD433Z 329 - - - - Show CFD433 Library CF (Link to library) Clone ID CFD433 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-B/CFD433Q.Seq.d/ Representative seq. ID CFD43...3Z (Link to Original site) Representative DNA sequence >CFD433 (CFD433Q) /CSM/CF/CFD4-B/CFD433Q.Seq.d/ XXXXX...ifiyqkiypevlssidfknfkpyqlitnqdln Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD433 (CFD

  9. Derivation of airfoil characteristics for the LM 19.1 blade based on 3D CFD rotor calculations

    Energy Technology Data Exchange (ETDEWEB)

    Bak, C.; Soerensen, N.N.; Madsen, H.A. [Risoe National Lab., Roskilde (Denmark)

    1999-03-01

    Airfoil characteristics for the LM 19.1 blade are derived from 3D CFD computations on a full-scale 41-m rotor. Based on 3D CFD the force distributions on the blades are determined, from which airfoil characteristics are derived using the momentum theory. The final airfoil characteristics are constructed using both wind tunnel measurements and 3D CFD. Compared to 2D wind tunnel measurements they show a low lift in stall for the airfoil sections at the tip. At the airfoil sections at the inner part of the blade, they show a high lift in stall. At about 60% radius the lift agrees well to 2D wind tunnel measurements. Aero-elastic calculations using the final airfoil characteristics show good agreement to measured power and flap moments. Furthermore, a fatigue load analysis shows a reduction of up to 15% of the load compared to commonly used data. (au)

  10. Validation and analysis of forward osmosis CFD model in complex 3D geometries

    DEFF Research Database (Denmark)

    Gruber, Mathias F.; Johnson, Carl J.; Tang, Chuyang;

    2012-01-01

    , seawater desalination and power generation. To ease optimization and increase understanding of membrane systems, it is desirable to have a comprehensive model that allows for easy investigation of all the major parameters in the separation process. Here we present experimental validation of a computational...... separation process and water permeation through membranes under various flow conditions. It is furthermore demonstrated how the CFD model can be used to optimize membrane geometry in such as way as to promote the mass transfer. © 2012 by the authors; licensee MDPI, Basel, Switzerland.......In forward osmosis (FO), an osmotic pressure gradient generated across a semi-permeable membrane is used to generate water transport from a dilute feed solution into a concentrated draw solution. This principle has shown great promise in the areas of water purification, wastewater treatment...

  11. CFD model of thermal and velocity conditions in a particular indoor environment

    Energy Technology Data Exchange (ETDEWEB)

    Mora Perez, Miguel; Lopez Patino, Gonzalo; Lopez Jimenez, P. Amparo [Hydraulic and Environmental Engineering Department, Universitat Politecnica de Valencia (Spain); Guillen Guillamon, Ignacio [Applied Physics Department, Universitat Politecnica de Valencia (Spain)

    2013-07-01

    The demand for maintaining high indoor environmental quality (IEQ) with the minimum energy consumption is rapidly increasing. In the recent years, several studies have been completed to investigate the impact of indoor environment factors on human comfort, health and energy efficiency. Therefore, the design of the thermal environment in any sort of room, specially offices, has huge economic consequences. In this paper, a particular analysis on the air temperature in a multi-task room environment is modeled, in order to represent the velocities and temperatures inside the room by using Computational Fluid Dynamics (CFD) techniques. This model will help to designers to analyze the thermal comfort regions inside the studied air volume and to visualize the whole temperatures inside the room, determining the effect of the fresh external incoming air in the internal air temperature.

  12. Explosion characteristics of methane for CFD modeling and simulation of turbulent gas flow behavior during explosion

    Science.gov (United States)

    Skřínský, Jan; Vereš, Ján; Peer, Václav; Friedel, Pavel

    2016-06-01

    The effect of initial concentration on the explosion behavior of a stoichiometric CH4/O2/N2 mixture under air-combustion conditions was studied. Two mathematical models were used with the aim at simulating the gas explosion in the middle scale explosion vessel, and the associated effects of the temperature for different gas/air concentrations. Peak pressure, maximum rate of pressure rise and laminar burning velocity were measured from pressure time records of explosions occurring in a 1 m3 closed cylindrical vessel. The results of the models were validated considering a set of data (pressure time histories and root mean square velocity). The obtained results are relevant to the practice of gas explosion testing and the interpretation of test results and, they should be taken as the input data for CFD simulation to improve the conditions for standard tests.

  13. Unstructured mesh based multi-physics interface for CFD code coupling in the Serpent 2 Monte Carlo code

    International Nuclear Information System (INIS)

    This paper presents an unstructured mesh based multi-physics interface implemented in the Serpent 2 Monte Carlo code, for the purpose of coupling the neutronics solution to component-scale thermal hydraulics calculations, such as computational fluid dynamics (CFD). The work continues the development of a multi-physics coupling scheme, which relies on the separation of state-point information from the geometry input, and the capability to handle temperature and density distributions by a rejection sampling algorithm. The new interface type is demonstrated by a simplified molten-salt reactor test case, using a thermal hydraulics solution provided by the CFD solver in OpenFOAM. (author)

  14. Correlations Based on CFD and Their Applications in Optimization for Staggered and Parallel Plate Fin Heatsinks

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Both parallel and staggered plate fin arrays have shown promise for use in high performance heatsinks regard of its individual manufacturing costs. The geometrical and operational parameters are very important to their cooling performance as heatsinks in practical applications. Fluent 5.0 commercial CFD (computational fluid dynamic) code is used to simulate the flow and heat transfer of those heatsinks of different realistic parameters. Based on those simulations, two correlations, concerning Nusselt number and friction factor as the functions of geometrical and operational parameters, FB (fin-base area ratio), PR (ratio of spanwise pitch to lengthwise pitch) and Re, were developed. From the both, the performance comparisons for optimizing geometrical and operational parameters of a fixed dimension heatsink are shown at constant pumping power and constant thermal resistance. Several optimized parameters were obtained with the discussion to various goals in real application. It demonstrates that in some particular situations, the parallel plate fin heatsinks can out perform the staggered ones.

  15. A CFD based approach for thermal hydraulic design of main vessel cooling system of pool type fast reactors

    International Nuclear Information System (INIS)

    Highlights: ► We study thermal hydraulic design of main vessel cooling system of fast reactors. ► A CFD based approach is proposed for determination of coolant flow rate. ► Effect of cooling system ovality on temperature asymmetry is quantified. ► Suitable flow distribution device is identified to achieve acceptable flow field. ► To compare efficacy of various devices, a flow mal-distribution index is defined. - Abstract: A computational fluid dynamics (CFDs) based approach is proposed for the thermal hydraulic design of the main vessel cooling system for pool type sodium cooled reactors. Usage of the proposed method is demonstrated by applying it to a future Indian commercial fast breeder reactor. Towards quantifying the amount of sodium flow rate for the main vessel cooling system, two-dimensional CFD investigations have been performed. The conjugate conduction–convection models adopted for this purpose are validated against sodium experiments available in literature. The required flow fraction has been determined to be 2.6% of core flow, which is 175.6 kg/s at full power conditions. The heat loss from the hot pool to the cold pool through the main vessel cooling system is estimated to be 10.6 MW at full power and 3.7 MW at 20% power conditions. By detailed three-dimensional CFD studies, the effect of ovality in the main vessel cooling annuli due to manufacturing tolerances has been assessed and the associated circumferential temperature difference in the main vessel is determined to be 14 °C, which is less than the permissible upper limit of 30 °C. The uniformity of sodium flow in the cooling annulus has been investigated by a three-dimensional hydraulic analysis with a view to identify a suitable passive device that can render a uniform velocity distribution. To compare the effectiveness of various devices, a flow mal-distribution index is defined. Detailed parametric studies have been carried out to identify an appropriate porous jet breaker

  16. Coupling scales for modelling heavy metal vaporization from municipal solid waste incineration in a fluid bed by CFD

    Energy Technology Data Exchange (ETDEWEB)

    Soria, José, E-mail: jose.soria@probien.gob.ar [Institute for Research and Development in Process Engineering, Biotechnology and Alternative Energies (PROBIEN, CONICET – UNCo), 1400 Buenos Aires St., 8300 Neuquén (Argentina); Gauthier, Daniel; Flamant, Gilles [Processes, Materials and Solar Energy Laboratory (PROMES-CNRS, UPR 8521), 7 Four Solaire Street, Odeillo, 66120 Font-Romeu (France); Rodriguez, Rosa [Chemical Engineering Institute, National University of San Juan, 1109 Libertador (O) Avenue, 5400 San Juan (Argentina); Mazza, Germán [Institute for Research and Development in Process Engineering, Biotechnology and Alternative Energies (PROBIEN, CONICET – UNCo), 1400 Buenos Aires St., 8300 Neuquén (Argentina)

    2015-09-15

    Highlights: • A CFD two-scale model is formulated to simulate heavy metal vaporization from waste incineration in fluidized beds. • MSW particle is modelled with the macroscopic particle model. • Influence of bed dynamics on HM vaporization is included. • CFD predicted results agree well with experimental data reported in literature. • This approach may be helpful for fluidized bed reactor modelling purposes. - Abstract: Municipal Solid Waste Incineration (MSWI) in fluidized bed is a very interesting technology mainly due to high combustion efficiency, great flexibility for treating several types of waste fuels and reduction in pollutants emitted with the flue gas. However, there is a great concern with respect to the fate of heavy metals (HM) contained in MSW and their environmental impact. In this study, a coupled two-scale CFD model was developed for MSWI in a bubbling fluidized bed. It presents an original scheme that combines a single particle model and a global fluidized bed model in order to represent the HM vaporization during MSW combustion. Two of the most representative HM (Cd and Pb) with bed temperatures ranging between 923 and 1073 K have been considered. This new approach uses ANSYS FLUENT 14.0 as the modelling platform for the simulations along with a complete set of self-developed user-defined functions (UDFs). The simulation results are compared to the experimental data obtained previously by the research group in a lab-scale fluid bed incinerator. The comparison indicates that the proposed CFD model predicts well the evolution of the HM release for the bed temperatures analyzed. It shows that both bed temperature and bed dynamics have influence on the HM vaporization rate. It can be concluded that CFD is a rigorous tool that provides valuable information about HM vaporization and that the original two-scale simulation scheme adopted allows to better represent the actual particle behavior in a fluid bed incinerator.

  17. Coupling scales for modelling heavy metal vaporization from municipal solid waste incineration in a fluid bed by CFD

    International Nuclear Information System (INIS)

    Highlights: • A CFD two-scale model is formulated to simulate heavy metal vaporization from waste incineration in fluidized beds. • MSW particle is modelled with the macroscopic particle model. • Influence of bed dynamics on HM vaporization is included. • CFD predicted results agree well with experimental data reported in literature. • This approach may be helpful for fluidized bed reactor modelling purposes. - Abstract: Municipal Solid Waste Incineration (MSWI) in fluidized bed is a very interesting technology mainly due to high combustion efficiency, great flexibility for treating several types of waste fuels and reduction in pollutants emitted with the flue gas. However, there is a great concern with respect to the fate of heavy metals (HM) contained in MSW and their environmental impact. In this study, a coupled two-scale CFD model was developed for MSWI in a bubbling fluidized bed. It presents an original scheme that combines a single particle model and a global fluidized bed model in order to represent the HM vaporization during MSW combustion. Two of the most representative HM (Cd and Pb) with bed temperatures ranging between 923 and 1073 K have been considered. This new approach uses ANSYS FLUENT 14.0 as the modelling platform for the simulations along with a complete set of self-developed user-defined functions (UDFs). The simulation results are compared to the experimental data obtained previously by the research group in a lab-scale fluid bed incinerator. The comparison indicates that the proposed CFD model predicts well the evolution of the HM release for the bed temperatures analyzed. It shows that both bed temperature and bed dynamics have influence on the HM vaporization rate. It can be concluded that CFD is a rigorous tool that provides valuable information about HM vaporization and that the original two-scale simulation scheme adopted allows to better represent the actual particle behavior in a fluid bed incinerator

  18. CFD of mixing of multi-phase flow in a bioreactor using population balance model.

    Science.gov (United States)

    Sarkar, Jayati; Shekhawat, Lalita Kanwar; Loomba, Varun; Rathore, Anurag S

    2016-05-01

    Mixing in bioreactors is known to be crucial for achieving efficient mass and heat transfer, both of which thereby impact not only growth of cells but also product quality. In a typical bioreactor, the rate of transport of oxygen from air is the limiting factor. While higher impeller speeds can enhance mixing, they can also cause severe cell damage. Hence, it is crucial to understand the hydrodynamics in a bioreactor to achieve optimal performance. This article presents a novel approach involving use of computational fluid dynamics (CFD) to model the hydrodynamics of an aerated stirred bioreactor for production of a monoclonal antibody therapeutic via mammalian cell culture. This is achieved by estimating the volume averaged mass transfer coefficient (kL a) under varying conditions of the process parameters. The process parameters that have been examined include the impeller rotational speed and the flow rate of the incoming gas through the sparger inlet. To undermine the two-phase flow and turbulence, an Eulerian-Eulerian multiphase model and k-ε turbulence model have been used, respectively. These have further been coupled with population balance model to incorporate the various interphase interactions that lead to coalescence and breakage of bubbles. We have successfully demonstrated the utility of CFD as a tool to predict size distribution of bubbles as a function of process parameters and an efficient approach for obtaining optimized mixing conditions in the reactor. The proposed approach is significantly time and resource efficient when compared to the hit and trial, all experimental approach that is presently used. © 2016 American Institute of Chemical Engineers Biotechnol. Prog., 32:613-628, 2016. PMID:26850863

  19. CFD analysis of a cask for spent fuel dry storage: Model fundamentals and sensitivity studies

    International Nuclear Information System (INIS)

    Highlights: • A dry storage cask has been evaluated by a CFD code, FLUENT 14. • An alternative methodology for thermal-fluid dynamic modeling has been performed. • Fuel maximum temperature obtained is around 50 K below the regulation limit (673 K). • Even in the most unfavorable heat load distribution temperature increase is smaller than 4%. - Abstract: Dry storage technology must ensure spent fuel cooling under any conditions. This turns thermo-fluid dynamics within dry storage casks a key aspect to investigate, as it would heavily affect fuel rod temperatures. This paper introduces a Computational Fluid Dynamic (CFD) model and analyses of a HI-STORM 100S cask with FLUENT 14.0. Fuel assemblies have been modeled as a porous medium characterized by a thermal conductivity and pressure drop that have been derived from specific approximations, algorithms and methods. This approach has been verified by comparing its results to those published by Holtec International for the HI-STORM cask. The application of the 3D model to HI-STORM 100S cask type under normal conditions, confirms that fuel maximum temperatures more than about 50 K below the regulation limit (673 K) should be expected. In addition, the effect on these results of aspects such as cask design (inlet/outlet orientation), heat load (regionalization) and local climate (external temperature), have been explored. The results indicate that the most relevant factor is heat load distribution and that, even in the most unfavorable regionalization feasible, temperature increase is smaller than 4%. Nonetheless, it should be highlighted that thermal margin to regulatory setting might be reduced down to around 40%

  20. Application of CFD modelling at a full-scale ozonation plant for the removal of micropollutants from secondary effluent.

    Science.gov (United States)

    Launer, M; Lyko, S; Fahlenkamp, H; Jagemann, P; Ehrhard, P

    2013-01-01

    Since November 2009, Germany's first full-scale ozonation plant for tertiary treatment of secondary effluent is in continuous operation. A kinetic model was developed and combined with the commercial computational fluid dynamics (CFD) software ANSYS(®) CFX(®) to simulate the removal of micropollutants from secondary effluents. Input data like reaction rate constants and initial concentrations of bulk components of the effluent organic matter (EfOM) were derived from experimental batch tests. Additionally, well-known correlations for the mass transfer were implemented into the simulation model. The CFD model was calibrated and validated by full-scale process data and by analytical measurements for micropollutants. The results show a good consistency of simulated values and measured data. Therewith, the validated CFD model described in this study proved to be suited for the application of secondary effluent ozonation. By implementing site-specific ozone exposition and the given reactor geometry the described CFD model can be easily adopted for similar applications. PMID:24056432

  1. Numerical aerodynamic analysis of bluff bodies at a high Reynolds number with three-dimensional CFD modeling

    Science.gov (United States)

    Bai, YuGuang; Yang, Kai; Sun, DongKe; Zhang, YuGuang; Kennedy, David; Williams, Fred; Gao, XiaoWei

    2013-02-01

    This paper focuses on numerical simulations of bluff body aerodynamics with three-dimensional CFD (computational fluid dynamics) modeling, where a computational scheme for fluid-structure interactions is implemented. The choice of an appropriate turbulence model for the computational modeling of bluff body aerodynamics using both two-dimensional and three-dimensional CFD numerical simulations is also considered. An efficient mesh control method which employs the mesh deformation technique is proposed to achieve better simulation results. Several long-span deck sections are chosen as examples which were stationary and pitching at a high Reynolds number. With the proposed CFD method and turbulence models, the force coefficients and flutter derivatives thus obtained are compared with the experimental measurement results and computed values completely from commercial software. Finally, a discussion on the effects of oscillation amplitude on the flutter instability of a bluff body is carried out with extended numerical simulations. These numerical analysis results demonstrate that the proposed three-dimensional CFD method, with proper turbulence modeling, has good accuracy and significant benefits for aerodynamic analysis and computational FSI studies of bluff bodies.

  2. Issues in the validation of CFD modelling of semi-solid metal forming

    International Nuclear Information System (INIS)

    Modelling of die filling during semi-solid metal processing (thixoforming) places particular demands on the CFD package being used. Not only are the velocities of the metal slurry in the die very high, the viscosity is too. Furthermore, the viscosity changes with shear rate (i.e. with changes in cross sectional area of the region the slurry travels through) and with time, as the injected material is thixotropic. The CFD software therefore requires good free surface tracking, accurate implicit solutions of the flow equations (as the CPU times for explicit solutions at high viscosities are impractical) and a model that adequately describes the slurry thixotropy. Finally, reliable, experimentally determined viscosity data are required. This paper describes the experiments on tin-lead and aluminium alloy slurries using compressive tests and rotating cylinder viscometry, followed by modelling using FLOW-3D. This package is known for its ability to track free surfaces accurately. Compressive tests allow rapid changes in shear rate to be imparted to the slurry, without wall slip, while the simple geometry of the viscometer makes it possible to compare analytical and numerical solutions. It is shown that the implicit viscous solver in its original form can reproduce the general trends found in the compressive and viscometry tests. However, sharp changes in shear rate lead to overestimation of pressure gradients in the slurry, making it difficult to separate these effects from those due to thixotropic breakdown. In order to achieve this separation, it is necessary to implement a more accurate implicit solver, which is currently under development. (author)

  3. Numerical analysis on noise of rotor with unconventional blade tips based on CFD/Kirchhoff method

    Institute of Scientific and Technical Information of China (English)

    Wang Bo; Zhao Qijun; Xu Guohua; Ye Liang; Wang Junyi

    2013-01-01

    A solver is developed aiming at efficiently predicting rotor noise in hover and forward flight.In this solver,the nonlinear near-field solutions are calculated by a hybrid approach which includes the Navier-Stokes and Euler equations based on a moving-embedded grid system and adaptive grid methodology.A combination of the third-order upwind scheme and flux-difference splitting scheme,instead of the second-order center-difference scheme which may cause larger wake dissipation,has been employed in the present computational fluid dynamics (CFD) method.The sound pressure data in the near field can be calculated directly by solving the Navier-Stokes equations,and the sound propagation can be predicted by the Kirchhoffmethod.A harmonic expansion approach is presented for rotor far-field noise prediction,which gives an analytical expression for the integral function in the Kirchhoff formula.As a result,the interpolation process is simplified and the efficiency and accuracy of the interpolation are improved.Then,the high-speed impulsive (HIS) noise of a helicopter rotor at different tip Mach numbers and on different observers is calculated and analyzed in hover and forward flight,which shows a highly directional characteristic of the rotor HIS noise with a maximum value in the rotor plane,and the HSI noise weakens rapidly with the increasing of the directivity angle.In order to investigate the effects of the rotor blade-tip shape on its aeroacoustic characteristics,four kinds of blade tips are designed and their noise characteristics have been simulated.At last,a new unconventional CLOR-Ⅱ blade tip has been designed,and the noise characteristics of the presented CLOR-Ⅱ model rotor have been simulated and measured compared to the reference rotors with a rectangular or swept-back platform blade tip.The results demonstrate that the unconventional CLOR-Ⅱblade tip can significantly reduce the HSI noise of a rotor.

  4. CFD Simulation and Experimental Validation of Fluid Flow and Particle Transport in a Model of Alveolated Airways.

    Science.gov (United States)

    Ma, Baoshun; Ruwet, Vincent; Corieri, Patricia; Theunissen, Raf; Riethmuller, Michel; Darquenne, Chantal

    2009-05-01

    Accurate modeling of air flow and aerosol transport in the alveolated airways is essential for quantitative predictions of pulmonary aerosol deposition. However, experimental validation of such modeling studies has been scarce. The objective of this study is to validate CFD predictions of flow field and particle trajectory with experiments within a scaled-up model of alveolated airways. Steady flow (Re = 0.13) of silicone oil was captured by particle image velocimetry (PIV), and the trajectories of 0.5 mm and 1.2 mm spherical iron beads (representing 0.7 to 14.6 mum aerosol in vivo) were obtained by particle tracking velocimetry (PTV). At twelve selected cross sections, the velocity profiles obtained by CFD matched well with those by PIV (within 1.7% on average). The CFD predicted trajectories also matched well with PTV experiments. These results showed that air flow and aerosol transport in models of human alveolated airways can be simulated by CFD techniques with reasonable accuracy. PMID:20161301

  5. TADS: A CFD-based turbomachinery and analysis design system with GUI. Volume 2: User's manual

    Science.gov (United States)

    Myers, R. A.; Topp, D. A.; Delaney, R. A.

    1995-01-01

    The primary objective of this study was the development of a computational fluid dynamics (CFD) based turbomachinery airfoil analysis and design system, controlled by a graphical user interface (GUI). The computer codes resulting from this effort are referred to as the Turbomachinery Analysis and Design System (TADS). This document is intended to serve as a user's manual for the computer programs which comprise the TADS system. TADS couples a throughflow solver (ADPAC) with a quasi-3D blade-to-blade solver (RVCQ3D) in an interactive package. Throughflow analysis capability was developed in ADPAC through the addition of blade force and blockage terms to the governing equations. A GUI was developed to simplify user input and automate the many tasks required to perform turbomachinery analysis and design. The coupling of various programs was done in a way that alternative solvers or grid generators could be easily incorporated into the TADS framework.

  6. Enlarging the operation range of a centrifugal compressor by cutting vanes based on CFD

    Science.gov (United States)

    Mo, J. T.; Gu, C. H.; Pan, X. H.; Y Zheng, S.

    2013-12-01

    Many centrifugal compressors are liable to insufficient operation range. The purpose of this paper is to enlarge the operation range of a centrifugal compressor used in turbocharger by cutting vanes. Some numerical works have been done based on CFD. The comparison of the calculated and measured results shows good agreement. The overall performance characteristics of the centrifugal compressor with different cutted vanes are observed and analyzed. The performance characteristic curves show that cutting vanes can increase the operation range by more than 50% with the loss of the highest efficiency limited in 1%. The flow fields are also shown in this paper and related explanations about the change of the performance characteristics curves are given. Shock wave is also detected in the simulation, and some related characteristics are summed up.

  7. Study of water intakes for oncomelania control based on information of oncomelania behavior and CFD results

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Schistosomiasis is a parasitic disease. They propagate in the Yangtze River valley of Chi-na. The spread of the disease is solely through a middle-agent named oncomelania, so the spread ofschistosomiasis by oncomelania can be controlled by properly designing water intakes which preventoncomelania from entering the farming land or residential areas. In this paper, a successful design pro-cess is reported and a new oncomelania-free intake device is demonstrated in the laboratory. The de-sign of the new intake is based on a sound research program in which an extensive experimental stud-ies have been carried out to gain knowledge of oncomelania eco-hydraulic behaviors and a detailed flowfield information is obtained through CFD simulation.

  8. Modeling of sand-water slurry flow through horizontal pipe using CFD

    Directory of Open Access Journals (Sweden)

    Kumar Gopaliya Manoj

    2016-09-01

    Full Text Available The paper presents three-dimensional CFD analysis of two-phase (sand-water slurry flows through 263 mm diameter pipe in horizontal orientation for mixture velocity range of 3.5-4.7 m/s and efflux concentration range of 9.95-34% with three particle sizes viz. 0.165 mm, 0.29 mm and 0.55 mm with density 2650 kg/m3. RNG k-ε turbulence closure equations with Eulerian multi-phase model is used to simulate various slurry flows. The simulated values of local solid concentration are compared with the experimental data and are found to be in good agreement for all particle sizes. Effects of particle size on various slurry flow parameters such as pressure drop, solid phase velocity distribution, friction factor, granular pressure, turbulent viscosity, turbulent kinetic energy and its dissipation have been analyzed.

  9. Effects of moisture release and radiation properties in pulverized fuel combustion: A CFD modelling study

    DEFF Research Database (Denmark)

    Yin, Chungen

    2016-01-01

    to improve the plant efficiency and is also expected to affect the combustion process. Thermal radiation is the principal mode of heat transfer in combustion. In PF furnaces, radiation consists of contribution from both participating gases and solid particles, in which gas and particle radiation properties......Pulverized fuels (PF) prepared and fired in utility boilers always contain some moisture. For some fuels with high moisture contents (e.g., brown coals), the share of the evaporation enthalpy is quite significant compared to the heat released during combustion, which often needs to be reclaimed...... and impacts via a computational fluid dynamics (CFD) study of a 609 MWe pulverized coal-fired utility boiler. Overall speaking, it is suggested to add the free moisture in the fuel to the primary air stream while lump the bound moisture with volatiles in PF combustion modelling, although different methods...

  10. Inviscid and viscous flow modelling of complex aircraft configurations using the CFD simulation system sauna

    Science.gov (United States)

    Peace, Andrew J.; May, Nicholas E.; Pocock, Mark F.; Shaw, Jonathon A.

    1994-04-01

    This paper is concerned with the flow modelling capabilities of an advanced CFD simulation system known by the acronym SAUNA. This system is aimed primarily at complex aircraft configurations and possesses a unique grid generation strategy in its use of block-structured, unstructured or hybrid grids, depending on the geometric complexity of the addressed configuration. The main focus of the paper is in demonstrating the recently developed multi-grid, block-structured grid, viscous flow capability of SAUNA, through its evaluation on a number of configurations. Inviscid predictions are also presented, both as a means of interpreting the viscous results and with a view to showing more completely the capabilities of SAUNA. It is shown that accuracy and flexibility are combined in an efficient manner, thus demonstrating the value of SAUNA in aerodynamic design.

  11. Mitigation of turbidity currents in reservoirs with passive retention systems: validation of CFD modeling

    Science.gov (United States)

    Ferreira, E.; Alves, E.; Ferreira, R. M. L.

    2012-04-01

    Sediment deposition by continuous turbidity currents may affect eco-environmental river dynamics in natural reservoirs and hinder the maneuverability of bottom discharge gates in dam reservoirs. In recent years, innovative techniques have been proposed to enforce the deposition of turbidity further upstream in the reservoir (and away from the dam), namely, the use of solid and permeable obstacles such as water jet screens , geotextile screens, etc.. The main objective of this study is to validate a computational fluid dynamics (CFD) code applied to the simulation of the interaction between a turbidity current and a passive retention system, designed to induce sediment deposition. To accomplish the proposed objective, laboratory tests were conducted where a simple obstacle configuration was subjected to the passage of currents with different initial sediment concentrations. The experimental data was used to build benchmark cases to validate the 3D CFD software ANSYS-CFX. Sensitivity tests of mesh design, turbulence models and discretization requirements were performed. The validation consisted in comparing experimental and numerical results, involving instantaneous and time-averaged sediment concentrations and velocities. In general, a good agreement between the numerical and the experimental values is achieved when: i) realistic outlet conditions are specified, ii) channel roughness is properly calibrated, iii) two equation k - ɛ models are employed iv) a fine mesh is employed near the bottom boundary. Acknowledgements This study was funded by the Portuguese Foundation for Science and Technology through the project PTDC/ECM/099485/2008. The first author thanks the assistance of Professor Moitinho de Almeida from ICIST and to all members of the project and of the Fluvial Hydraulics group of CEHIDRO.

  12. MODELING OF MESO-SCALE STRUCTURES IN PARTICLE-FLUID SYSTEMS: THE EMMS/CFD APPROACH

    Institute of Scientific and Technical Information of China (English)

    Ning Yang; Wei Wang; Wei Ge; Jinghai Li

    2005-01-01

    Meso-scale structures existing in the form of particle-rich clusters, streamers or strands in circulating fluidized beds, and of ascending bubble plumes and descending liquid-rich vortices in bubble columns and slurry-bed reactors, as commonly observed, have played an important role in the macro-scale behavior of particle-fluid systems. These meso-scale structures span a wide range of length and time scales, and their origin, evolution and influence are still far from being well understood.Recent decades have witnessed the emergence of computer simulation of particle-fluid systems based on computational fluid dynamic (CFD) models. However, strictly speaking these models are far from mature and the complex nature of particle-fluid systems arising from the meso-scale structures has been posing great challenges to investigators. The reason may be that the current two-fluid models (TFM) are derived either from continuum mechanics by using different kinds of averaging techniques for the conservation equations of single-phase flow, or from the kinetic theory of gases in which the assumption of molecular chaos is employed, thereby losing sight of the meso-scale heterogeneity at the scale of computational cells and leading to inaccurate calculation of the interaction force between particles and fluids. For example, the overall drag force for particles in a cell is usually calculated from the empirical Wen & Yu/Ergun correlations,which should be suspected since these correlations were originally derived from homogeneous systems.Schemes to solve this problem for gas-particles systems may be classified into four categories. First, one could capture the detailed meso-scale structure information at the cell scale by employing the so-called direct numerical simulation (DNS) (Hu, 1996), the pseudo-particle modeling (PPM) (Ge & Li, 2003), or the Lattice-Boltzmann method (LBM) to track the interface between gas and particles. Second, refinement of the computational meshes may

  13. CFD methods for wind turbines

    Science.gov (United States)

    Suatean, Bogdan; Colidiuc, Alexandra; Galetuse, Slelian

    2012-11-01

    The purpose of this paper is to present different CFD models used to determine the aerodynamic performance of horizontal axis wind turbine (HAWT). The models presented have various levels of complexity to calculate the aerodynamic performances of HAWT, starting with a simple model, the actuator line method, and ending with a CFD approach.

  14. Dicty_cDB: CFD348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD348 (Link to dictyBase) - - - Contig-U16347-1 CFD348Z (Link... to Original site) - - CFD348Z 456 - - - - Show CFD348 Library CF (Link to library) Clone ID CFD348 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-B/CFD348Q.Seq.d/ Representative seq. ID CFD34...8Z (Link to Original site) Representative DNA sequence >CFD348 (CFD348Q) /CSM/CF/CFD3-B/CFD348Q.Seq.d/ XXXXX...cytoskeletal 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for CFD348 is cy

  15. Dicty_cDB: CFD668 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD668 (Link to dictyBase) - - - Contig-U16445-1 CFD668F (Link to Original site) CFD...668F 583 - - - - - - Show CFD668 Library CF (Link to library) Clone ID CFD668 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-C/CFD668Q.Seq.d/ Representative seq. ID CFD66...8F (Link to Original site) Representative DNA sequence >CFD668 (CFD668Q) /CSM/CF/CFD6-C/CFD668Q.Seq.d/ AATTT...vtl*ef*l*vtqpipth*lppvmhqi ltqnvslp*lv*i--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD

  16. Dicty_cDB: CFD596 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD596 (Link to dictyBase) - - - Contig-U14178-1 CFD596F (Link to Original site) CFD...596F 367 - - - - - - Show CFD596 Library CF (Link to library) Clone ID CFD596 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-D/CFD596Q.Seq.d/ Representative seq. ID CFD59...6F (Link to Original site) Representative DNA sequence >CFD596 (CFD596Q) /CSM/CF/CFD5-D/CFD596Q.Seq.d/ ATTAA...) /CSM/CH/CHL6-D/CHL689Q.Seq.d/ 539 e-152 CHB303 (CHB303Q) /CSM/CH/CHB3-A/CHB303Q.Seq.d/ 539 e-152 CFD

  17. Dicty_cDB: CFD340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD340 (Link to dictyBase) - - - Contig-U12597-1 CFD340F (Link to Original site) CFD...340F 113 - - - - - - Show CFD340 Library CF (Link to library) Clone ID CFD340 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD3-B/CFD340Q.Seq.d/ Representative seq. ID CFD34...0F (Link to Original site) Representative DNA sequence >CFD340 (CFD340Q) /CSM/CF/CFD3-B/CFD340Q.Seq.d/ ATTTA...Seq.d/ 90 8e-18 CFJ371 (CFJ371Q) /CSM/CF/CFJ3-C/CFJ371Q.Seq.d/ 90 8e-18 CFG565 (CFG565Q) /CSM/CF/CFG5-C/CFG565Q.Seq.d/ 90 8e-18 CFD

  18. Dicty_cDB: CFD135 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD135 (Link to dictyBase) - - - Contig-U16397-1 CFD135Z (Link... to Original site) - - CFD135Z 519 - - - - Show CFD135 Library CF (Link to library) Clone ID CFD135 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-B/CFD135Q.Seq.d/ Representative seq. ID CFD13...5Z (Link to Original site) Representative DNA sequence >CFD135 (CFD135Q) /CSM/CF/CFD1-B/CFD135Q.Seq.d/ XXXXX...vesicles of secretory system >> prediction for CFD135 is nuc 5' end seq. ID - 5' end seq. - Length of 5' end

  19. Use of CFD modeling for estimating spatial representativeness of urban air pollution monitoring sites and suitability of their locations

    International Nuclear Information System (INIS)

    A methodology to estimate the spatial representativeness of air pollution monitoring sites is applied to two urban districts. This methodology is based on high resolution maps of air pollution computed by using Computational Fluid Dynamics (CFD) modelling tools. Traffic-emitted NO2 dispersion is simulated for several meteorological conditions taking into account the effect of the buildings on air flow and pollutant dispersion and using a steady state CFD-RANS approach. From these results, maps of average pollutant concentrations for January -May 2011 are computed as a combination of the simulated scenarios. Two urban districts of Madrid City were simulated. Spatial representativeness areas for 32 different sites within the same district (including the site of the operative air quality stations) have been estimated by computing the portion of the domains with average NO2 concentration differing less than a 20% of the concentration at each candidate monitoring site. New parameters such as the ratio AR between the representativeness area and the whole domain area or the representativeness index (IR) has been proposed to discuss and compare the representativeness areas. Significant differences between the spatial representativeness of the candidate sites of both studied districts have been found. The sites of the Escuelas Aguirre district have generally smaller representativeness areas than those of the Plaza de Castilla. More stations are needed to cover the Escuelas Aguirre district than for the Plaza de Castilla one. The operative air quality station of the Escuelas Aguirre district is less representative than the station of the Plaza de Castilla district. The cause of these differences seems to be the differences in urban structure of both districts prompting different ventilation. (Author)

  20. Predicting self-pollution inside school buses using a CFD and multi-zone coupled model

    Science.gov (United States)

    Li, Fei; Lee, Eon S.; Liu, Junjie; Zhu, Yifang

    2015-04-01

    The in-cabin environment of a school bus is important for children's health. The pollutants from a bus's own exhaust contribute to children's overall exposure to air pollutants inside the school bus cabin. In this study, we adapted a coupled model originally developed for indoor environment to determine the relative contribution of the bus own exhaust to the in-cabin pollutant concentrations. The coupled model uses CFD (computational fluent dynamics) model to simulate outside concentration and CONTAM (a multi-zone model) for inside the school bus. The model was validated with experimental data in the literature. Using the validated model, we analyzed the effects of vehicle speed and tailpipe location on self-pollution inside the bus cabin. We confirmed that the pollution released from the tailpipe can penetrate into the bus cabin through gaps in the back emergency door. We found the pollution concentration inside school buses was the highest when buses were driven at a medium speed. In addition, locating the tailpipe on the side, behind the rear axle resulted in less self-pollution since there is less time for the suction effect to take place. The developed theoretical framework can be generalized to study other types of buses. These findings can be used in developing policy recommendations for reducing human exposure to air pollution inside buses.

  1. Implementation into a CFD code of neutron kinetics and fuel pin models for nuclear reactor transient analyses

    International Nuclear Information System (INIS)

    Safety analysis is an important tool for justifying the safety of nuclear reactors. The traditional method for nuclear reactor safety analysis is performed by means of system codes, which use one-dimensional lumped-parameter method to model real reactor systems. However, there are many multi-dimensional thermal-hydraulic phenomena cannot be predicated using traditional one-dimensional system codes. This problem is extremely important for pool-type nuclear systems. Computational fluid dynamics (CFD) codes are powerful numerical simulation tools to solve multi-dimensional thermal-hydraulics problems, which are widely used in industrial applications for single phase flows. In order to use general CFD codes to solve nuclear reactor transient problems, some additional models beyond general ones are required. Neutron kinetics model for power calculation and fuel pin model for fuel pin temperature calculation are two important models of these additional models. The motivation of this work is to develop an advance numerical simulation method for nuclear reactor safety analysis by implementing neutron kinetics model and fuel pin model into general CFD codes. In this paper, the Point Kinetics Model (PKM) and Fuel Pin Model (FPM) are implemented into a general CFD code FLUENT. The improved FLUENT was called as FLUENT/PK. The mathematical models and implementary method of FLUENT/PK are descripted and two demonstration application cases, e.g. the unprotected transient overpower (UTOP) accident of a Liquid Metal cooled Fast Reactor (LMFR) and the unprotected beam overpower (UBOP) accident of an Accelerator Driven System (ADS), are presented. (author)

  2. Simulation of multi-deck medium temperature display cabinets with the integration of CFD and cooling coil models

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Y.T.; Tassou, S.A.; Hadawey, A. [Mechanical Engineering, School of Engineering and Design, Brunel University, Uxbridge, Middlesex, UB8 3PH (United Kingdom)

    2010-10-15

    In this paper, the model for the multi-deck medium temperature display cabinets is developed with the integration of CFD and cooling coil sub-models. The distributed method is used to develop the cooling coil model with the airside inputs from the outputs of the CFD model. Inversely, the airside outputs from the cooling coil model are used to update the boundary conditions of the CFD model. To validate this cabinet model, a multi-deck medium temperature display cabinet refrigerated with a secondary refrigerant cooling coil was selected as a prototype and mounted in an air conditioned chamber. Extensive tests were conducted at constant space air temperature and varied relative humilities. The cabinet model has been validated by comparing with the test results for the parameters of air at different locations of the flow path, and temperatures of refrigerant and food product, etc. The validated model is therefore used to explore and analyse the cabinet performance and control strategies at various operating and design conditions. (author)

  3. CFD SIMULATION OF THE HEAT TRANSFER PROCESS IN A CHEVRON PLATE HEAT EXCHANGER USING THE SST TURBULENCE MODEL

    Directory of Open Access Journals (Sweden)

    Jan Skočilas

    2015-08-01

    Full Text Available This paper deals with a computational fluid dynamics (CFD simulation of the heat transfer process during turbulent hot water flow between two chevron plates in a plate heat exchanger. A three-dimensional model with the simplified geometry of two cross-corrugated channels provided by chevron plates, taking into account the inlet and outlet ports, has been designed for the numerical study. The numerical model was based on the shear-stress transport (SST k-! model. The basic characteristics of the heat exchanger, as values of heat transfer coefficient and pressure drop, have been investigated. A comparative analysis of analytical calculation results, based on experimental data obtained from literature, and of the results obtained by numerical simulation, has been carried out. The coefficients and the exponents in the design equations for the considered plates have been arranged by using simulation results. The influence on the main flow parameters of the corrugation inclination angle relative to the flow direction has been taken into account. An analysis of the temperature distribution across the plates has been carried out, and it has shown the presence of zones with higher heat losses and low fluid flow intensity.

  4. CFD Applications in Energy and Environment Sectors: Volume 1

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi and Hashim R. Abdol Hamid

    2012-01-01

    Full Text Available Chapter 1: Simulation and Modelling of Oxygen Coal Combustion with Flue Gas Recirculation. Chaouki Ghenai Chapter 2: The Choice of the Best Air Distribution Concept in Air-Conditioned Auditorium by Means of CFD Numerical Prediction. Barbara Lipska, Piotr Koper Chapter 3: CFD Applications in Natural Ventilation of Buildings and Air Quality Dispersion. N. Nikolopoulos, A. Nikolopoulos, I. Papadakis, K.-S. P. Nikas Chapter 4: CFD Modeling of Air Pollutant Transport and Dispersion. Labovský Juraj, Jelemenský Ľudovít Chapter 5: CFD Modeling of Multiphase Flow in Environmental Engineering. Masroor Mohajerani, Mehrab Mehrvar, Farhad Ein-Mozaffari Chapter 6: CFD Study on the Roles of Trees on Airflow and Pollutant Dispersion within Urban Street Canyons. Salim Mohamed Salim, Andrew Chan, Riccardo Buccolieri, Silvana Di Sabatino Chapter 7: Energy Efficiency and Air Quality in Hospitals Design. Essam E. Khalil Chapter 8: Application of CFD in Pulverized Fuel Combustion. M. Tayyeb Javed, Tahira Sultana Chapter 9: A Heat Transfer Model For Fluids Based on Cellular Automaton Application to an Air Conditioning of A Building. Andrés Saiz Martínez Chapter 10: CFD Application in Power Plants. Essam E. Khalil Chapter 11: Analysis and Computation of the Heat Charge/Discharge Behavior in Packed Bed Thermal Storage Systems. Pei-Wen Li, Jon Van Lew, Wafaa Karaki, Cho Lik Chan, Jake Stephens

  5. Modelling of Underground Coal Gasification Process Using CFD Methods / Modelowanie Procesu Podziemnego Zgazowania Węgla Kamiennego Z Zastosowaniem Metod CFD

    Science.gov (United States)

    Wachowicz, Jan; Łączny, Jacek Marian; Iwaszenko, Sebastian; Janoszek, Tomasz; Cempa-Balewicz, Magdalena

    2015-09-01

    The results of model studies involving numerical simulation of underground coal gasification process are presented. For the purpose of the study, the software of computational fluid dynamics (CFD) was selected for simulation of underground coal gasification. Based on the review of the literature, it was decided that ANSYS-Fluent will be used as software for the performance of model studies. The ANSYS- -Fluent software was used for numerical calculations in order to identify the distribution of changes in the concentration of syngas components as a function of duration of coal gasification process. The nature of the calculations was predictive. A geometric model has been developed based on construction data of the georeactor used during the researches in Experimental Mine "Barbara" and Coal Mine "Wieczorek" and it was prepared by generating a numerical grid. Data concerning the georeactor power supply method and the parameters maintained during the process used to define the numerical model. Some part of data was supplemented based on the literature sources. The main assumption was to base the simulation of the georeactor operation on a mathematical models describing reactive fluid flow. Components of the process gas and the gasification agent move along the gasification channel and simulate physicochemical phenomena associated with the transfer of mass and energy as well as chemical reactions (together with the energy effect). Chemical reactions of the gasification process are based on a kinetic equation which determines the course of a particular type of equation of chemical coal gasification. The interaction of gas with the surrounding coal layer has also been described as a part of the model. The description concerned the transport of thermal energy. The coal seam and the mass rock are treated as a homogeneous body. Modelling studies assumed the coal gasification process is carried out with the participation of separately oxygen and air as a gasification agent

  6. Validation of CFD Simulations of Cerebral Aneurysms With Implication of Geometric Variations

    OpenAIRE

    Hoi, Yiemeng; Woodward, Scott H.; Kim, Minsuok; Taulbee, Dale B.; Meng, Hui

    2006-01-01

    Computational fluid dynamics (CFD) simulations using medical-image-based anatomical vascular geometry are now gaining clinical relevance. This study aimed at validating the CFD methodology for studying cerebral aneurysms by using particle image velocimetry (PIV) measurements, with a focus on the effects of small geometric variations in aneurysm models on the flow dynamics obtained with CFD. Method of Approach. An experimental phantom was fabricated out of silicone elastomer to best mimic a sp...

  7. Higher Order Chemistry Models in the CFD Simulation of Laser-Ablated Carbon Plumes

    Science.gov (United States)

    Scott, C. D.; Greendyke, R. B.; Creel, J. R.; Payne, B. T.

    2005-01-01

    Production of single-walled carbon nanotubes (SWNT) has taken place for a number of years and by a variety of methods such-as laser ablation, chemical vapor deposition, and arc-jet ablation. Yet, little is actually understood about the exact chemical kinetics and processes that occur in SWNT formation. In recent time, NASA Johnson Space Center has devoted a considerable effort to the experimental evaluation of the laser ablation production process for SWNT originally developed at Rice University. To fully understand the nature of the laser ablation process it is necessary to understand the development of the carbon plume dynamics within the laser ablation oven. The present work is a continuation of previous studies into the efforts to model plume dynamics using computational fluid dynamics (CFD). The ultimate goal of the work is to improve understanding of the laser ablation process, and through that improved understanding, refine the laser ablation production of SWNT. Fig. 1 shows a basic schematic of the laser-ablation oven at NASA-JSC. Construction of the facility is simple in concept. Two concentric quartz tubes of 1.5 mm thickness form the inner and outer tubes with inside diameters of 2.2 and 5.08 cm respectively. At one end of the inner tube are located two 60 Hz pulsed lasers operating at 1064 nm and 532 nm wavelength with beam diameters of 5 mm aligned coaxially with the longitudinal axis of the inner quartz tube. For standard nanotube production runs, a 10 ns 532 nm pulse is followed 50 ns later by a 10 ns 1064 nm pulse. Each pulse is of 300 mJ energy. A target of carbon graphite with approximately 1% nickel and cobalt catalysts is located at the other end of the inner quartz tube. In the ordinary processing of SWNT, a base flow of 100 sccm of argon is maintained from the laser location and exits past the carbon target at a pressure of 66.7 kPa. These conditions yield a baseline mass flow through the chamber of 2.723x10(exp -6)kg/s of argon. The whole

  8. Investigation on the Use of a Multiphase Eulerian CFD solver to simulate breaking waves

    DEFF Research Database (Denmark)

    Tomaselli, Pietro D.; Christensen, Erik Damgaard

    2015-01-01

    investigation on a CFD model capable of handling this problem. The model is based on a solver, available in the open-source CFD toolkit OpenFOAM, which combines the Eulerian multi-fluid approach for dispersed flows with a numerical interface sharpening method. The solver, enhanced with additional formulations...

  9. Extending the capabilities of CFD codes to assess ash related problems

    DEFF Research Database (Denmark)

    Kær, Søren Knudsen; Rosendahl, Lasse Aistrup; Baxter, B. B.

    2004-01-01

    This paper discusses the application of FLUENT? in theanalysis of grate-fired biomass boilers. A short description of theconcept used to model fuel conversion on the grate and the couplingto the CFD code is offered. The development and implementation ofa CFD-based deposition model is presented in...

  10. Coarse Grid CFD for underresolved simulation

    Science.gov (United States)

    Class, Andreas G.; Viellieber, Mathias O.; Himmel, Steffen R.

    2010-11-01

    CFD simulation of the complete reactor core of a nuclear power plant requires exceedingly huge computational resources so that this crude power approach has not been pursued yet. The traditional approach is 1D subchannel analysis employing calibrated transport models. Coarse grid CFD is an attractive alternative technique based on strongly under-resolved CFD and the inviscid Euler equations. Obviously, using inviscid equations and coarse grids does not resolve all the physics requiring additional volumetric source terms modelling viscosity and other sub-grid effects. The source terms are implemented via correlations derived from fully resolved representative simulations which can be tabulated or computed on the fly. The technique is demonstrated for a Carnot diffusor and a wire-wrap fuel assembly [1]. [4pt] [1] Himmel, S.R. phd thesis, Stuttgart University, Germany 2009, http://bibliothek.fzk.de/zb/berichte/FZKA7468.pdf

  11. CFD modeling of liquid-solid fluidization: Effect of drag correlation and added mass force

    Institute of Scientific and Technical Information of China (English)

    Xiao yan Huang

    2011-01-01

    Computational fluid dynamics (CFD) has been widely used to study the hydrodynamics of gas-solid fluidization; however,its applications in liquid-solid fluidization are relatively rare.In this study,CFD simulations of a liquid-solid fluidized bed are carried out,focusing on the effect of drag correlation and added mass force on the hydrodynamics of liquid-solid fluidization.It is shown that drag correlation has a significant effect on the simulation results and the correlation proposed by Beetstra et al.(2007) gives the best agreement with experimental data.We further show that the added mass force does play an important role in CFD simulation of liquid-solid fluidization,and therefore should not be ignored in CFD simulations.

  12. DEVELOPMENT OF CFD SIMULATION APPLICATIONS FOR LOCAL-SCALE AREAS AND POTENTIAL INTERFACE WITH MESOSCALE MODELS

    Science.gov (United States)

    The presentation summarizes developments of ongoing applications of fine-scale (geometry specific) CFD simulations to urban areas within atmospheric boundary layers. Enabling technology today and challenges for the future are discussed. There is a challenging need to develop a ...

  13. REVIEW OF EXPERIMENTAL CAPABILITIES AND HYDRODYNAMIC DATA FOR VALIDATION OF CFD BASED PREDICTIONS FOR SLURRY BUBBLE COLUMN REACTORS

    Energy Technology Data Exchange (ETDEWEB)

    Donna Post Guillen; Daniel S. Wendt

    2007-11-01

    The purpose of this paper is to document the review of several open-literature sources of both experimental capabilities and published hydrodynamic data to aid in the validation of a Computational Fluid Dynamics (CFD) based model of a slurry bubble column (SBC). The review included searching the Web of Science, ISI Proceedings, and Inspec databases, internet searches as well as other open literature sources. The goal of this study was to identify available experimental facilities and relevant data. Integral (i.e., pertaining to the SBC system), as well as fundamental (i.e., separate effects are considered), data are included in the scope of this effort. The fundamental data is needed to validate the individual mechanistic models or closure laws used in a Computational Multiphase Fluid Dynamics (CMFD) simulation of a SBC. The fundamental data is generally focused on simple geometries (i.e., flow between parallel plates or cylindrical pipes) or custom-designed tests to focus on selected interfacial phenomena. Integral data covers the operation of a SBC as a system with coupled effects. This work highlights selected experimental capabilities and data for the purpose of SBC model validation, and is not meant to be an exhaustive summary.

  14. REVIEW OF EXPERIMENTAL CAPABILITIES AND HYDRODYNAMIC DATA FOR VALIDATION OF CFD-BASED PREDICTIONS FOR SLURRY BUBBLE COLUMN REACTORS

    Energy Technology Data Exchange (ETDEWEB)

    Donna Post Guillen; Daniel S. Wendt; Steven P. Antal; Michael Z. Podowski

    2007-11-01

    The purpose of this paper is to document the review of several open-literature sources of both experimental capabilities and published hydrodynamic data to aid in the validation of a Computational Fluid Dynamics (CFD) based model of a slurry bubble column (SBC). The review included searching the Web of Science, ISI Proceedings, and Inspec databases, internet searches as well as other open literature sources. The goal of this study was to identify available experimental facilities and relevant data. Integral (i.e., pertaining to the SBC system), as well as fundamental (i.e., separate effects are considered), data are included in the scope of this effort. The fundamental data is needed to validate the individual mechanistic models or closure laws used in a Computational Multiphase Fluid Dynamics (CMFD) simulation of a SBC. The fundamental data is generally focused on simple geometries (i.e., flow between parallel plates or cylindrical pipes) or custom-designed tests to focus on selected interfacial phenomena. Integral data covers the operation of a SBC as a system with coupled effects. This work highlights selected experimental capabilities and data for the purpose of SBC model validation, and is not meant to be an exhaustive summary.

  15. Coupling of FVCOM and CFD Model for Simulation of Multiscale Coastal Flows

    Science.gov (United States)

    Tang, H.; Qu, K.

    2013-12-01

    In correspondence with the need to simulate many emerging problems, especially those in nearshore regions such as deepwater oil spill, it is necessary to develop capabilities to predict small-scale, fully 3D phenomena in coastal ocean flows. A feasible as well as effective approach for the development is a hybrid method that couples different models designed for physics at different scales. We have developed a two-way coupling between a fully 3D CFD model and the FVCOM, in which the former captures small-scale 3D flows and the latter predicts large-scale background currents. In this presentation, a few new applications of such approach will be illustrated. The following figures show a result on tidal flow in a bay and past bridge peers. Tests and analysis are made on solution accuracy and computation efficiency, and discussions are presented on how to achieve seamless solution transition at the model interfaces. Computed large-scale background flow Simulated flow past a brigde

  16. Numerical simulation of the pulsing air separation field based on CFD

    Institute of Scientific and Technical Information of China (English)

    He Jingfeng; He Yaqun; Zhao Yuemin; Duan Chenlong; Ye Cuiling

    2012-01-01

    The flow field of pulsing air separation is normally in an unsteady turbulence state.With the application of the basic principles of multiphase turbulent flows,we established the dynamical computational model,which shows a remarkable variation of the unstable pulsing air flow field.CFD (computational fluid dynamics) was used to conduct the numerical simulation of the actual geometric model of the classifier.The inside velocity of the flowing fields was analyzed later.The simulation results indicate that the designed structure of the active pulsing air classifier provided a favorable environment for the separation of the particles with different physical characters by density.We shot the movement behaviors of the typical tracer grains in the active pulsing flow field using a high speed dynamic camera.The displacement and velocity curves of the particles in the continuous impulse periods were then analyzed.The experimental results indicate that the effective separation by density of the particles with the same settling velocity and different ranges of the density and particle size can be achieved in the active pulsing airflow field.The experimental results provide an agreement with the simulation results.

  17. Simulation on Tire Hydroplaning Based on CFD%轮胎滑水特性的CFD分析

    Institute of Scientific and Technical Information of China (English)

    王国林; 邓元; 金梁; 梁晨

    2013-01-01

    以205/50R16子午线轮胎为研究对象,建立带有纵向花纹沟的轮胎有限元模型(FEM)和计算流体动力学(CFD)模型.基于流固耦合的FEM模拟轮胎滑水产生的过程,采用重整规化群和流体体积组分方法的CFD模型得到轮胎接地区域内的水膜流场分布.两种模型计算结果对比表明,CFD模型能够用来分析胎面微花纹沟内流体流动特性.随着水膜厚度的增大,轮胎受到的流体压力也变大,容易出现滑水现象.%The finite element model(FEM) and the computational fluid dynamics(CFD) model of 205/50R16 radial tire with longitudinal tread groove pattern were developed.The process of hydroplaning was simulated by fluid-solid coupled FEM,and the fluid flow field in tire contact region was obtained by using CFD model with RNG(renormalization group) and VOF(volume of fluid) methods.The comparison results of two models showed that the CFD model could be used to effectively analyze the fluid flow characteristics in micro grooves,and as the thickness of water film increased,the fluid pressure increased,which would most likely cause dynamic hydroplaning.

  18. Dicty_cDB: CFD732 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD732 (Link to dictyBase) - - - Contig-U16560-1 CFD732F (Link to Original site) CFD...732F 113 - - - - - - Show CFD732 Library CF (Link to library) Clone ID CFD732 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-B/CFD732Q.Seq.d/ Representative seq. ID CFD73...2F (Link to Original site) Representative DNA sequence >CFD732 (CFD732Q) /CSM/CF/CFD7-B/CFD732Q.Seq.d/ ATTTT...clear 8.0 %: plasma membrane 8.0 %: endoplasmic reticulum 4.0 %: vesicles of secretory system 4.0 %: peroxis

  19. Experimental Study and CFD modeling of high speed water jets in air

    Science.gov (United States)

    Guha, Anirban; Barron, R. M.; Balachandar, R.

    2007-11-01

    High speed turbulent water jets are extensively used in industrial cleaning applications. They interact vigorously with the surrounding air and loose mass in the form of water droplets which moves along with the entrained air stream. The transfer of momentum to the surroundings reduces the jet velocity and thus the pressure at the impinging surface is significantly lower than the supply pressure. Laser Doppler Anemometer (LDA) measurements of velocity field and pressure measurements at different axial and radial locations were performed. The potential core of the jet was found to extend to around 100 nozzle diameters. The dynamic pressure along the centerline was found to decay linearly, which can be used to estimate the decay of water volume fraction along the centerline. An empirical formulation of mass transfer (in the form of droplets) from water phase to the surroundings has been developed and incorporated into the commercial CFD code FLUENT. The flow was simulated using the RNG k-ɛ turbulence model and Eulerian-Eulerian multiphase model. The predicted pressure distribution at the impinging surface was found to match closely with the experimental findings.

  20. Modeling and simulation of PEM fuel cell's flow channels using CFD techniques

    Energy Technology Data Exchange (ETDEWEB)

    Cunha, Edgar F.; Andrade, Alexandre B.; Robalinho, Eric; Bejarano, Martha L.M.; Linardi, Marcelo [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)]. E-mails: efcunha@ipen.br; abodart@ipen.br; eric@ipen.br; mmora@ipen.br; mlinardi@ipen.br; Cekinski, Efraim [Instituto de Pesquisas Tecnologicas (IPT-SP), Sao Paulo, SP (Brazil)]. E-mail: cekinski@ipt.br

    2007-07-01

    Fuel cells are one of the most important devices to obtain electrical energy from hydrogen. The Proton Exchange Membrane Fuel Cell (PEMFC) consists of two important parts: the Membrane Electrode Assembly (MEA), where the reactions occur, and the flow field plates. The plates have many functions in a fuel cell: distribute reactant gases (hydrogen and air or oxygen), conduct electrical current, remove heat and water from the electrodes and make the cell robust. The cost of the bipolar plates corresponds up to 45% of the total stack costs. The Computational Fluid Dynamic (CFD) is a very useful tool to simulate hydrogen and oxygen gases flow channels, to reduce the costs of bipolar plates production and to optimize mass transport. Two types of flow channels were studied. The first type was a commercial plate by ELECTROCELL and the other was entirely projected at Programa de Celula a Combustivel (IPEN/CNEN-SP) and the experimental data were compared with modelling results. Optimum values for each set of variables were obtained and the models verification was carried out in order to show the feasibility of this technique to improve fuel cell efficiency. (author)

  1. CFD analysis of municipal solid waste combustion using detailed chemical kinetic modelling.

    Science.gov (United States)

    Frank, Alex; Castaldi, Marco J

    2014-08-01

    Nitrogen oxides (NO x ) emissions from the combustion of municipal solid waste (MSW) in waste-to-energy (WtE) facilities are receiving renewed attention to reduce their output further. While NO x emissions are currently 60% below allowed limits, further reductions will decrease the air pollution control (APC) system burden and reduce consumption of NH3. This work combines the incorporation of the GRI 3.0 mechanism as a detailed chemical kinetic model (DCKM) into a custom three-dimensional (3D) computational fluid dynamics (CFD) model fully to understand the NO x chemistry in the above-bed burnout zones. Specifically, thermal, prompt and fuel NO formation mechanisms were evaluated for the system and a parametric study was utilized to determine the effect of varying fuel nitrogen conversion intermediates between HCN, NH3 and NO directly. Simulation results indicate that the fuel nitrogen mechanism accounts for 92% of the total NO produced in the system with thermal and prompt mechanisms accounting for the remaining 8%. Results also show a 5% variation in final NO concentration between HCN and NH3 inlet conditions, demonstrating that the fuel nitrogen intermediate assumed is not significant. Furthermore, the conversion ratio of fuel nitrogen to NO was 0.33, revealing that the majority of fuel nitrogen forms N2. PMID:25005043

  2. Comparative Study for Modeling Reactor Internal Geometry in CFD Simulation of PHWR Internal Flow

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Gong Hee; Woo, Sweng Woong; Cheong, Ae Ju [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2013-10-15

    The main objective of the present study is to compare the results predicted by using either the real geometry of tubes or porous medium assumption and to assess the prediction performance of both methods. Estimating the local subcooling of the moderator in a CANDU calandria under transient conditions is one of the major concerns in the CANDU safety analysis. Therefore extensive CFD analyses have been performed for predicting the moderator temperature in a CANDU calandria or its similar shape. However most of previous studies used a porous medium assumption instead of considering the real geometry of calandria tube. A porous medium assumption has some possible weaknesses; The increased production of turbulence due to vortex shedding in the wake of the individual tubes is not considered in the turbulence model. It is difficult to identify the true effects of the outer ring of calandria tubes on the generation of the highly non-uniform flows in the reflector region. It is not clear how well the pressure loss models quantitatively represent the three-dimensional effects of the turbulent flows through the calandria tubes.

  3. MODELING OF MESO-SCALE STRUCTURES IN PARTICLE-FLUID SYSTEMS: THE EMMS/CFD APPROACH

    Institute of Scientific and Technical Information of China (English)

    Ning; Yang; Wei; Wang; Wei; Ge; Jinghai; Li

    2005-01-01

    Meso-scale structures existing in the form of particle-rich clusters, streamers or strands in circulating fluidized beds, and of ascending bubble plumes and descending liquid-rich vortices in bubble columns and slurry-bed reactors, as commonly observed, have played an important role in the macro-scale behavior of particle-fluid systems. These meso-scale structures span a wide range of length and time scales, and their origin, evolution and influence are still far from being well understood.Recent decades have witnessed the emergence of computer simulation of particle-fluid systems based on computational fluid dynamic (CFD) models. However, strictly speaking these models are far from mature and the complex nature of particle-fluid systems arising from the meso-scale structures has been posing great challenges to investigators. The reason may be that the current two-fluid models (TFM) are derived either from continuum mechanics by using different kinds of averaging techniques for the conservation equations of single-phase flow, or from the kinetic theory of gases in which the assumption of molecular chaos is employed, thereby losing sight of the meso-scale heterogeneity at the scale of computational cells and leading to inaccurate calculation of the interaction force between particles and fluids. For example, the overall drag force for particles in a cell is usually calculated from the empirical Wen & Yu/Ergun correlations,which should be suspected since these correlations were originally derived from homogeneous systems.Schemes to solve this problem for gas-particles systems may be classified into four categories. First, one could capture the detailed meso-scale structure information at the cell scale by employing the so-called direct numerical simulation (DNS) (Hu, 1996), the pseudo-particle modeling (PPM) (Ge & Li, 2003), or the Lattice-Boltzmann method (LBM) to track the interface between gas and particles. Second, refinement of the computational meshes may

  4. CFD评估框架的进展及其最佳实践: QNET-CFD知识库%The Development of a Framework for CFD Validation and Best Practice: The QNET-CFD Knowledge Base

    Institute of Scientific and Technical Information of China (English)

    Charles HIRSCH

    2006-01-01

    QNET-CFD is a thematic network on quality and trust for the industrial applications of Computational Fluid Dynamics (CFD), developed under the European Union R&D program. The main objectives of QNET-CFD were to collect CFD and experimental data in a systematic and quality controlled way and to set the basis for a consistent Knowledge Base in support of CFD guidance and validation. The QNET-CFD activity was organized around six Thematic Areas (TAs) covering the following industry sectors: external aerodynamics; combustion & heat transfer; chemical process, thermal hydraulics and nuclear safety; civil construction & HVAC; environment; turbomachinery internal flows. The main outcome of the QNET-CFD actions is the Knowledge Base (KB) with contains in a user oriented interface, extensive experimental and CFD data for a large number of test cases subdivided into 53 Application Challenges (AC) and 43 Underlying Flow Regimes (UFR). The KB contains, in addition to state-of-the-art reviews for each of the six thematic areas, Best Practice Advice (BPA) in the use of CFD for most of AC. This is considered as a significant contribution form the QNET-CFD activities and it is expected that the level of the thrust and quality in CFD will hereby be improved.%QNET-CFD是欧盟R&D项目开发的一个主题网络,该网络讨论了计算流体力学(CFD)供工业应用应具有的品质和可信度,其主要目的是以系统和质量控制的方式收集CFD和实验数据,建立两者相容的知识库(KB),以此为基础,支持对CFD进行指导和评估.QNET-CFD围绕覆盖下述工业部门的6个主题(TA)组成:外流空气动力学; 燃烧和传热; 化学过程、热水力学和核安全; 土木建筑和HVAC; 环境; 涡轮机内流.其主要成果是建立了具有面向用户界面及丰富的实验和CFD数据的知识库,这些数据来自于大量实验数据,分为53种应用挑战(AC)和43种基本流动状态(UFR).除对上述6个主题领域中每一个的科学发

  5. Sensitivity study on a CFD model for the analysis of moderator fluid flow and heat transfer inside CANDU calandria

    International Nuclear Information System (INIS)

    In this paper, sensitivity study on a CFD model for the accurate analysis of moderator fluid flow and heat transfer inside calandria is conducted. Two main items, i.e. porous medium assumption and turbulence model, are considered for in-line tube bank and Sheridan Park Engineering Laboratory (SPEL) experiment. Using the commercial flow solver, FLUENT, the prediction to consider the real geometry of fuel channels is compared to previous results conducted with the porous medium assumption using the isotropic pressure loss model. Also, the prediction performance of various turbulence models (e.g. k-ε model, Reynolds stress model, etc.) is assessed. (author)

  6. Statistical Analysis of Detailed 3-D CFD LES Simulations with Regard to CCV Modeling

    Directory of Open Access Journals (Sweden)

    Vítek Oldřich

    2016-06-01

    Full Text Available The paper deals with statistical analysis of large amount of detailed 3-D CFD data in terms of cycle-to-cycle variations (CCVs. These data were obtained by means of LES calculations of many consecutive cycles. Due to non-linear nature of Navier-Stokes equation set, there is a relatively significant CCV. Hence, every cycle is slightly different – this leads to requirement to perform statistical analysis based on ensemble averaging procedure which enables better understanding of CCV in ICE including its quantification. The data obtained from the averaging procedure provides results on different space resolution levels. The procedure is applied locally, i.e., in every cell of the mesh. Hence there is detailed CCV information on local level – such information can be compared with RANS simulations. Next, volume/mass averaging provides information at specific locations – e.g., gap between electrodes of a spark plug. Finally, volume/mass averaging of the whole combustion chamber leads to global information which can be compared with experimental data or results of system simulation tools (which are based on 0-D/1-D approach.

  7. CFD simulation of neutral ABL flows

    DEFF Research Database (Denmark)

    Zhang, Xiaodong

    and top boundary condition. Fluent employ wall function roughness modifications based on data from experiments with sand grain roughened pipes and channels, describe wall adjacent zone with Roughness Height (Ks) instead of Roughness Length (z0). In a CFD simulation of ABL flow, the mean wind velocity...... ABL and the measurements are best documented until now. Comparison with measured data shows that the CFD model can well predict the velocity field and relative turbulence kinetic energy field. Furthermore, a series of artificial complex terrains are designed, and some of the main simulation results...

  8. A study on the dependency between turbulent models and mesh configurations of CFD codes

    Energy Technology Data Exchange (ETDEWEB)

    Bang, Jungjin; Heo, Yujin; Jerng, Dong-Wook [CAU, Seoul (Korea, Republic of)

    2015-10-15

    This paper focuses on the analysis of the behavior of hydrogen mixing and hydrogen stratification, using the GOTHIC code and the CFD code. Specifically, we examined the mesh sensitivity and how the turbulence model affects hydrogen stratification or hydrogen mixing, depending on the mesh configuration. In this work, sensitivity analyses for the meshes and the turbulence models were conducted for missing and stratification phenomena. During severe accidents in a nuclear power plants, the generation of hydrogen may occur and this will complicate the atmospheric condition of the containment by causing stratification of air, steam, and hydrogen. This could significantly impact containment integrity analyses, as hydrogen could be accumulated in local region. From this need arises the importance of research about stratification of gases in the containment. Two computation fluid dynamics code, i.e. GOTHIC and STAR-CCM+ were adopted and the computational results were benchmarked against the experimental data from PANDA facility. The main findings observed through the present work can be summarized as follows: 1) In the case of the GOTHIC code, it was observed that the aspect ratio of the mesh was found more important than the mesh size. Also, if the number of the mesh is over 3,000, the effects of the turbulence models were marginal. 2) For STAR-CCM+, the tendency is quite different from the GOTHIC code. That is, the effects of the turbulence models were small for fewer number of the mesh, however, as the number of mesh increases, the effects of the turbulence models becomes significant. Another observation is that away from the injection orifice, the role of the turbulence models tended to be important due to the nature of mixing process and inducted jet stream.

  9. Hydraulic performance improvement of the bidirectional pit pump installation based on CFD

    Science.gov (United States)

    Chen, H. X.; Zhou, D. Q.

    2013-12-01

    At present, the efficiency of bidirectional pit pump installation with lift under 2m is still low because of lack of research on it in the past. In the paper, the CFD numerical method and experimental test were applied to study flow characteristic of bidirectional pit pump installation under positive and reverse condition. Through changing airfoil type and position of blade and stay vane, the comprehensive performance of improved model were obtained by calculating many different models. The results showed that when improved model is obtained with type A runner with 4 blades that is 0.7D away from pit exit and unsymmetrical guide vane 0.25dh which away from the impeller outlet, and the flow pattern of the improved solution is steady with high efficiency. Compared with the original scheme, the efficiency of positive and reverse design condition reach to 67.23% and 58.32% respectively, which is increased 6% more than original model on the design condition and 5% on the optimum operating condition, and it achieved the purpose of improvement. According to the runner blade angle of the optimization solution, model synthetic characteristic curve was drawn and internal flow field characteristics was analyzed under optimal positive and reverse conditions. The numerical calculation shows that owing to the lack of stay vane to recycle the energy in outlet runner chamber, the water flow regime is not steady enough in the outlet passage, and that is the main reason for lower efficiency at reverse condition than that at positive condition.

  10. cfd modelling and experimental study on the fluid flow and heat transfer in copper heat sink design

    OpenAIRE

    Karimpourian, Bijan

    2007-01-01

    Abstract This thesis is studying the heatsinks new designs for copper heatsinks which utilizes modelling and simulation by CFD, construction of prototypes and experimental works. Challenges and complications in manufacturing of copper heatsinks are expressed and finding the solutions to these hindrances involve in this work. Numerical efforts supported by fluent are made to promote investigation and approaching the goal in which serves the new opportunities for wider application of copper mat...

  11. Analysis of the performances of an axial flow tandem pump based on CFD computations

    Science.gov (United States)

    Zhao, Y.; Bai, Z. Y.; Zhang, M. D.; Wang, G. Y.

    2012-11-01

    Tandem pump, compared with multistage pump, goes without guide vanes between impellers. Significant reduction of the axial geometry scale, resulting from lack of guide vanes, makes great sense to high-speed propulsion. Direct interactions between front and rear impellers may lead to special flows, which are different from those in a multistage pump. There are few studies of these differences. In this article, CFD computations of flows in an axial flow tandem pump are conducted to predict the performances. FBM turbulence model, which is introduced to commercial software, is used for the simulations. Circulation coefficient is defined to help analyze energy characteristics. The results demonstrate that power of the tandem pump increases slowly as discharge is getting larger. The tandem pump has better adaptability under large discharge conditions. The head of the rear impeller is not sensitive to discharge's change, which results from that the front impeller weakens the influence of discharge's change on the rear impeller, so pump's energy characteristics may be improved.

  12. Reynolds Number Effects Investigation of Supercritical Airfoil Based on EFD and CFD

    Directory of Open Access Journals (Sweden)

    Da-Wei Liu

    2013-12-01

    Full Text Available This study aimed to investigate the transonic Reynolds number effects of supercritical airfoil by EFD and CFD method. An experiment was conducted in NF-6 wind tunnel, to obtain the pressure distribution and aerodynamic coefficients of a typical supercritical airfoil through pressure measuring, with Reynolds numbers varied from 3.5×106 to 1.0×107 per airfoil chord, Mach numbers from 0.6 to 0.8, angles of attack from 0° to 8°. Also, flows over the supercritical airfoil were numerically studied; the two-dimensional Navier-Stokes equations were solved with structure grids by utilizing the Spalart-Allmaras (S-A turbulence model, with Reynolds numbers varied from 2.0×106 to 50×10 6 per airfoil chord and Mach numbers from 0.6 to 0.8. Computational results compared well with experimental results. It is shown that the upper surface pressure distribution of supercritical airfoil including the location and intensity of shock wave and trailing-edge pressure coefficient, changed apparently with variable Reynolds numbers, when shock-induced trailing-edge separation existed. It is also noticed that the lift coefficient increased, drag and pitching moment coefficient decreased as Reynolds number increasing. Results implied that Reynolds number effects should be considered during the early designing stage and optimization of large aircrafts applied supercritical airfoil.

  13. Methodology for experimental validation of a CFD model for predicting noise generation in centrifugal compressors

    International Nuclear Information System (INIS)

    Highlights: • A DES of a turbocharger compressor working at peak pressure point is performed. • In-duct pressure signals are measured in a steady flow rig with 3-sensor arrays. • Pressure spectra comparison is performed as a validation for the numerical model. • A suitable comparison methodology is developed, relying on pressure decomposition. • Whoosh noise at outlet duct is detected in experimental and numerical spectra. - Abstract: Centrifugal compressors working in the surge side of the map generate a broadband noise in the range of 1–3 kHz, named as whoosh noise. This noise is perceived at strongly downsized engines operating at particular conditions (full load, tip-in and tip-out maneuvers). A 3-dimensional CFD model of a centrifugal compressor is built to analyze fluid phenomena related to whoosh noise. A detached eddy simulation is performed with the compressor operating at the peak pressure point of 160 krpm. A steady flow rig mounted on an anechoic chamber is used to obtain experimental measurements as a means of validation for the numerical model. In-duct pressure signals are obtained in addition to standard averaged global variables. The numerical simulation provides global variables showing excellent agreement with experimental measurements. Pressure spectra comparison is performed to assess noise prediction capability of numerical model. The influence of the type and position of the virtual pressure probes is evaluated. Pressure decomposition is required by the simulations to obtain meaningful spectra. Different techniques for obtaining pressure components are analyzed. At the simulated conditions, a broadband noise in 1–3 kHz frequency band is detected in the experimental measurements. This whoosh noise is also captured by the numerical model

  14. CFD Study of NOx Emissions in a Model Commercial Aircraft Engine Combustor

    Institute of Scientific and Technical Information of China (English)

    ZHANG Man; FU Zhenbo; LIN Yuzhen; LI Jibao

    2012-01-01

    Air worthiness requirements of the aircraft engine emission bring new challenges to the combustor research and design.With the motivation to design high performance and clean combustor,computational fluid dynamics (CFD) is utilized as the powerful design approach.In this paper,Reynolds averaged Navier-Stokes (RANS) equations of reactive two-phase flow in an experimental low emission combustor is performed.The numerical approach uses an implicit compressible gas solver together with a Lagrangian liquid-phase tracking method and the extended coherent flamelet model for turbulence-combustion interaction.The NOx formation is modeled by the concept of post-processing,which resolves the NOx transport equation with the assumption of frozen temperature distribution.Both turbulence-combustion interaction model and NOx formation model are firstly evaluated by the comparison of experimental data published in open literature of a lean direct injection (LDI) combustor.The test rig studied in this paper is called low emission stirred swirl (LESS) combustor,which is a two-stage model combustor,fueled with liquid kerosene (RP-3) and designed by Beihang University (BUAA).The main stage of LESS combustor employs the principle of lean prevaporized and premixed (LPP) concept to reduce pollutant,and the pilot stage depends on a diffusion flame for flame stabilization.Detailed numerical results including species distribution,turbulence performance and burning performance are qualitatively and quantitatively evaluated.Numerical prediction of NOx emission shows a good agreement with test data at both idle condition and full power condition of LESS combustor.Preliminary results of the flame structure are shown in this paper.The flame stabilization mechanism and NOx reduction effort are also discussed with in-depth analysis.

  15. Simulation of hydrogen mitigation in catalytic recombiner. Part-II: Formulation of a CFD model

    Energy Technology Data Exchange (ETDEWEB)

    Prabhudharwadkar, Deoras M. [Department of Mechanical Engineering, Indian Institute of Technology-Bombay, Powai, Mumbai 400076 (India); Iyer, Kannan N., E-mail: kiyer@me.iitb.ac.i [Department of Mechanical Engineering, Indian Institute of Technology-Bombay, Powai, Mumbai 400076 (India)

    2011-05-15

    Research highlights: Hydrogen transport in containment with recombiners is a multi-scale problem. A novel methodology worked out to lump the recombiner characteristics. Results obtained using commercial code FLUENT are cast in the form of correlations. Hence, coarse grids can obtain accurate distribution of H{sub 2} in containment. Satisfactory working of the methodology is clearly demonstrated. - Abstract: This paper aims at formulation of a model compatible with CFD code to simulate hydrogen distribution and mitigation using a Passive Catalytic Recombiner in the Nuclear power plant containments. The catalytic recombiner is much smaller in size compared to the containment compartments. In order to fully resolve the recombination processes during the containment simulations, it requires the geometric details of the recombiner to be modelled and a very fine mesh size inside the recombiner channels. This component when integrated with containment mixing calculations would result in a large number of mesh elements which may take large computational times to solve the problem. This paper describes a method to resolve this simulation difficulty. In this exercise, the catalytic recombiner alone was first modelled in detail using the best suited option to describe the reaction rate. A detailed parametric study was conducted, from which correlations for the heat of reaction (hence the rate of reaction) and the heat transfer coefficient were obtained. These correlations were then used to model the recombiner channels as single computational cells providing necessary volumetric sources/sinks to the energy and species transport equations. This avoids full resolution of these channels, thereby allowing larger mesh size in the recombiners. The above mentioned method was successfully validated using both steady state and transient test problems and the results indicate very satisfactory modelling of the component.

  16. Rocket-Based Combined Cycle Engine Technology Development: Inlet CFD Validation and Application

    Science.gov (United States)

    DeBonis, J. R.; Yungster, S.

    1996-01-01

    A CFD methodology has been developed for inlet analyses of Rocket-Based Combined Cycle (RBCC) Engines. A full Navier-Stokes analysis code, NPARC, was used in conjunction with pre- and post-processing tools to obtain a complete description of the flow field and integrated inlet performance. This methodology was developed and validated using results from a subscale test of the inlet to a RBCC 'Strut-Jet' engine performed in the NASA Lewis 1 x 1 ft. supersonic wind tunnel. Results obtained from this study include analyses at flight Mach numbers of 5 and 6 for super-critical operating conditions. These results showed excellent agreement with experimental data. The analysis tools were also used to obtain pre-test performance and operability predictions for the RBCC demonstrator engine planned for testing in the NASA Lewis Hypersonic Test Facility. This analysis calculated the baseline fuel-off internal force of the engine which is needed to determine the net thrust with fuel on.

  17. Film Cooled Recession of SiC/SiC Ceramic Matrix Composites: Test Development, CFD Modeling and Experimental Observations

    Science.gov (United States)

    Zhu, Dongming; Sakowski, Barbara A.; Fisher, Caleb

    2014-01-01

    SiCSiC ceramic matrix composites (CMCs) systems will play a crucial role in next generation turbine engines for hot-section component applications because of their ability to significantly increase engine operating temperatures, reduce engine weight and cooling requirements. However, the environmental stability of Si-based ceramics in high pressure, high velocity turbine engine combustion environment is of major concern. The water vapor containing combustion gas leads to accelerated oxidation and corrosion of the SiC based ceramics due to the water vapor reactions with silica (SiO2) scales forming non-protective volatile hydroxide species, resulting in recession of the ceramic components. Although environmental barrier coatings are being developed to help protect the CMC components, there is a need to better understand the fundamental recession behavior of in more realistic cooled engine component environments.In this paper, we describe a comprehensive film cooled high pressure burner rig based testing approach, by using standardized film cooled SiCSiC disc test specimen configurations. The SiCSiC specimens were designed for implementing the burner rig testing in turbine engine relevant combustion environments, obtaining generic film cooled recession rate data under the combustion water vapor conditions, and helping developing the Computational Fluid Dynamics (CFD) film cooled models and performing model validation. Factors affecting the film cooled recession such as temperature, water vapor concentration, combustion gas velocity, and pressure are particularly investigated and modeled, and compared with impingement cooling only recession data in similar combustion flow environments. The experimental and modeling work will help predict the SiCSiC CMC recession behavior, and developing durable CMC systems in complex turbine engine operating conditions.

  18. Scavenging Process Analysis in a 2-Stroke Engine by CFD Approach for a Parametric 0D Model Development

    OpenAIRE

    Cagin, Stéphanie; Bourabaa, Nachida; Delacourt, Eric; Morin, Céline; Fischer, Xavier; Coutellier, Daniel; Carré, Bertrand; Loumé, Sylvain

    2015-01-01

    International audience This paper presents a method to improve cylinder design of 2-stroke auto-ignition engine based on a CFD (Computational Fluid Dynamics) study of internal flows in the chamber and an unsteady global 0D parametric approach. In 2-stroke engine, scavenging process plays an important role regarding engine efficiency and pollutant emissions. Several geometrical and environmental parameters (like piston velocity and inlet/outlet thermofluid conditions) impact the scavenging ...

  19. Investigation of mucus transport in an idealized lung airway model using multiphase CFD analysis

    Science.gov (United States)

    Rajendran, Rahul; Banerjee, Arindam

    2015-11-01

    Mucus, a Bingham fluid is transported in the pulmonary airways by consistent beating of the cilia and exhibits a wide range of physical properties in response to the core air flow and various pathological conditions. A better understanding of the interfacial instability is required as it plays a crucial role in gas transport, mixing, mucus clearance and drug delivery. In the current study, mucus is modelled as a Newtonian fluid and the two phase gas-liquid flow in the airways is investigated using an inhomogeneous Eulerian-Eulerian approach. The complex interface between the phases is tracked using the conventional VOF (Volume of Fluid) method. Results from our CFD simulations which are performed in idealized single and double bifurcation geometries will be presented and the influence of airflow rate, mucus layer thickness, mucus viscosity, airway geometry (branching & diameter) and surface tension on mucus flow behavior will be discussed. Mean mucus layer thickness, pressure drop due to momentum transfer & increased airway resistance, mucus transport speed and the flow morphology will be compared to existing experimental and theoretical data.

  20. CFD Modeling of Sodium-Oxide Deposition in Sodium-Cooled Fast Reactor Compact Heat Exchangers

    Energy Technology Data Exchange (ETDEWEB)

    Tatli, Emre; Ferroni, Paolo; Mazzoccoli, Jason

    2015-09-02

    The possible use of compact heat exchangers (HXs) in sodium-cooled fast reactors (SFR) employing a Brayton cycle is promising due to their high power density and resulting small volume in comparison with conventional shell-and-tube HXs. However, the small diameter of their channels makes them more susceptible to plugging due to Na2O deposition during accident conditions. Although cold traps are designed to reduce oxygen impurity levels in the sodium coolant, their failure, in conjunction with accidental air ingress into the sodium boundary, could result in coolant oxygen levels that are above the saturation limit in the cooler parts of the HX channels. This can result in Na2O crystallization and the formation of solid deposits on cooled channel surfaces, limiting or even blocking coolant flow. The development of analysis tools capable of modeling the formation of these deposits in the presence of sodium flow will allow designers of SFRs to properly size the HX channels so that, in the scenario mentioned above, the reactor operator has sufficient time to detect and react to the affected HX. Until now, analytical methodologies to predict the formation of these deposits have been developed, but never implemented in a high-fidelity computational tool suited to modern reactor design techniques. This paper summarizes the challenges and the current status in the development of a Computational Fluid Dynamics (CFD) methodology to predict deposit formation, with particular emphasis on sensitivity studies on some parameters affecting deposition.

  1. Combining a 2-D multiphase CFD model with a Response Surface Methodology to optimize the gasification of Portuguese biomasses

    International Nuclear Information System (INIS)

    Highlights: • A multiphase CFD model was combined with RSM. • Gasification optimal operating conditions were found in a pilot scale reactor. • Syngas quality indices were optimized in a biomass gasification process. • Propagation of error methodology was combined with a CFD model and RSM. - Abstract: This paper presents a study to evaluate the potential of Portuguese biomasses (coffee husks, forest residues and vine pruning residues) to produce syngas for different applications. By using a 2-D Eulerian–Eulerian approach within the CFD framework, a design of several computer experiments was developed and were used as analysis tools the response surface method (RSM) and the propagation of error (POE) approach. The CFD model was validated under experimental results collected at a semi-industrial reactor. For design purposes, temperature, steam to biomass ratio (SBR) and the type of biomass were selected as input factors. The responses were the H2 generation, the H2/CO ratio, the CH4/H2 ratio, the carbon conversion and the cold gas efficiency. It was concluded that after an optimization procedure to determine the operating conditions, vine pruning residues could show very promising results considering some of the typical syngas indice standards for commercial purposes. From the optimization procedure, it was also concluded that forest residues are preferable for domestic natural gas applications and vine pruning residues for fuel cells and integrated gasification systems application. By using the RSM combined with POE, it was verified that the operating conditions to get higher performances do not always coincide with those necessary to obtain a stable syngas composition

  2. Integrated detoxification methodology of hazardous phenolic wastewaters in environmentally based trickle-bed reactors: Experimental investigation and CFD simulation

    Energy Technology Data Exchange (ETDEWEB)

    Lopes, Rodrigo J.G., E-mail: rodrigo@eq.uc.pt [Centro de Investigacao em Engenharia dos Processos Quimicos e Produtos da Floresta (CIEPQPF), GERSE - Group on Environmental, Reaction and Separation Engineering, Department of Chemical Engineering, University of Coimbra, Rua Silvio Lima, Polo II - Pinhal de Marrocos, 3030-790 Coimbra (Portugal); Almeida, Teresa S.A.; Quinta-Ferreira, Rosa M. [Centro de Investigacao em Engenharia dos Processos Quimicos e Produtos da Floresta (CIEPQPF), GERSE - Group on Environmental, Reaction and Separation Engineering, Department of Chemical Engineering, University of Coimbra, Rua Silvio Lima, Polo II - Pinhal de Marrocos, 3030-790 Coimbra (Portugal)

    2011-05-15

    Centralized environmental regulations require the use of efficient detoxification technologies for the secure disposal of hazardous wastewaters. Guided by federal directives, existing plants need reengineering activities and careful analysis to improve their overall effectiveness and to become environmentally friendly. Here, we illustrate the application of an integrated methodology which encompasses the experimental investigation of catalytic wet air oxidation and CFD simulation of trickle-bed reactors. As long as trickle-bed reactors are determined by the flow environment coupled with chemical kinetics, first, on the optimization of prominent numerical solution parameters, the CFD model was validated with experimental data taken from a trickle bed pilot plant specifically designed for the catalytic wet oxidation of phenolic wastewaters. Second, several experimental and computational runs were carried out under unsteady-state operation to evaluate the dynamic performance addressing the TOC concentration and temperature profiles. CFD computations of total organic carbon conversion were found to agree better with experimental data at lower temperatures. Finally, the comparison of test data with simulation results demonstrated that this integrated framework was able to describe the mineralization of organic matter in trickle beds and the validated consequence model can be exploited to promote cleaner remediation technologies of contaminated waters.

  3. Integrated detoxification methodology of hazardous phenolic wastewaters in environmentally based trickle-bed reactors: Experimental investigation and CFD simulation.

    Science.gov (United States)

    Lopes, Rodrigo J G; Almeida, Teresa S A; Quinta-Ferreira, Rosa M

    2011-05-15

    Centralized environmental regulations require the use of efficient detoxification technologies for the secure disposal of hazardous wastewaters. Guided by federal directives, existing plants need reengineering activities and careful analysis to improve their overall effectiveness and to become environmentally friendly. Here, we illustrate the application of an integrated methodology which encompasses the experimental investigation of catalytic wet air oxidation and CFD simulation of trickle-bed reactors. As long as trickle-bed reactors are determined by the flow environment coupled with chemical kinetics, first, on the optimization of prominent numerical solution parameters, the CFD model was validated with experimental data taken from a trickle bed pilot plant specifically designed for the catalytic wet oxidation of phenolic wastewaters. Second, several experimental and computational runs were carried out under unsteady-state operation to evaluate the dynamic performance addressing the TOC concentration and temperature profiles. CFD computations of total organic carbon conversion were found to agree better with experimental data at lower temperatures. Finally, the comparison of test data with simulation results demonstrated that this integrated framework was able to describe the mineralization of organic matter in trickle beds and the validated consequence model can be exploited to promote cleaner remediation technologies of contaminated waters. PMID:21377790

  4. Numerical Modeling and Analysis of Small Gas Turbine Engine : Part I: Analytical Model and Compressor CFD

    OpenAIRE

    Nawaz AHMAD

    2009-01-01

    The thesis work aims at devising analytical thermodynamic model and numerical modeling of the compressor of a small gas turbine to be operated on producer gas with lower heating contents. The turbine will serve as a component of “EXPLORE-Biomass Based Polygeneration” project to meet the internal electrical power requirements of 2-5 KW. The gas turbine engine is of radial type (one stage radial compressor, one stage radial turbine). Small gas turbines give less electrical efficiencies especial...

  5. Possible User-Dependent CFD Predictions of Transitional Flow in Building Ventilation

    DEFF Research Database (Denmark)

    Peng, Lei; Nielsen, Peter Vilhelm; Wang, Xiaoxue;

    2016-01-01

    (CFD) codes/software, turbulence models, boundary conditions, numerical schemes and convergent criteria were adopted based on the own CFD experience of each participating team. The largest coefficient of variation is larger than 50% and the largest relative maximum difference of penetration length...

  6. Effect of longwall face advance rate on spontaneous heating process in the gob area - CFD modelling

    Energy Technology Data Exchange (ETDEWEB)

    Boleslav Taraba; Zdenek Michalec [University of Ostrava, Ostrava (Czech Republic). Dept. of Chemistry

    2011-08-15

    A commercial CFD software programme, FLUENT, was used to study the oxidation process of coal in the mined-out longwall (gob) area. A three-dimensional, single-phase model with a continuously advancing longwall face has been developed. For the model, the gob longwall area was designed on the basis of the actual longwall panel operating in the Ostrava-Karvina Coal Mines (OKD, Czech Republic). The behaviour of the coal to oxygen was modelled using the results arising mainly from the former laboratory-scale experiments with Czech bituminous coals. Basically, the technique of pulse flow calorimetry and measurements at a continuous airflow reactor were applied during the laboratory investigations. In the contribution, the main focus was to understand the effect of the longwall face advancing speed on the oxidation heat production as well as evolution of the gases in the gob area. Simultaneously, the effect of coal crushing in the mined-out area on the spontaneous heating process was examined. Numerical simulations confirmed the existence of a 'favourable' zone for the onset and development of the spontaneous heating process in the gob area. The location and the maximal temperature reached in the 'favourable' zone were found to be significantly affected by the advancing rate of the coalface. The slower the advancing rate is, the higher the maximal temperature and smaller the depth of the 'favourable' zone in the gob area are. When the rate drops to a certain 'critical' value, spontaneous heating turns to flammable combustion of the coal. The value of the 'critical' advancing rate was confirmed to increase if the grain size of the coal left in the gob decreases. Numerical examinations of carbon monoxide concentrations then proved that small incidents of spontaneous heating could occur in the gob area that need not be detected in the airflow of the longwall tail gate. 46 refs., 8 figs., 2 tabs.

  7. Investigations of Fluid-Structure-Coupling and Turbulence Model Effects on the DLR Results of the Fifth AIAA CFD Drag Prediction Workshop

    Science.gov (United States)

    Keye, Stefan; Togiti, Vamish; Eisfeld, Bernhard; Brodersen, Olaf P.; Rivers, Melissa B.

    2013-01-01

    The accurate calculation of aerodynamic forces and moments is of significant importance during the design phase of an aircraft. Reynolds-averaged Navier-Stokes (RANS) based Computational Fluid Dynamics (CFD) has been strongly developed over the last two decades regarding robustness, efficiency, and capabilities for aerodynamically complex configurations. Incremental aerodynamic coefficients of different designs can be calculated with an acceptable reliability at the cruise design point of transonic aircraft for non-separated flows. But regarding absolute values as well as increments at off-design significant challenges still exist to compute aerodynamic data and the underlying flow physics with the accuracy required. In addition to drag, pitching moments are difficult to predict because small deviations of the pressure distributions, e.g. due to neglecting wing bending and twisting caused by the aerodynamic loads can result in large discrepancies compared to experimental data. Flow separations that start to develop at off-design conditions, e.g. in corner-flows, at trailing edges, or shock induced, can have a strong impact on the predictions of aerodynamic coefficients too. Based on these challenges faced by the CFD community a working group of the AIAA Applied Aerodynamics Technical Committee initiated in 2001 the CFD Drag Prediction Workshop (DPW) series resulting in five international workshops. The results of the participants and the committee are summarized in more than 120 papers. The latest, fifth workshop took place in June 2012 in conjunction with the 30th AIAA Applied Aerodynamics Conference. The results in this paper will evaluate the influence of static aeroelastic wing deformations onto pressure distributions and overall aerodynamic coefficients based on the NASA finite element structural model and the common grids.

  8. 基于 CFD 的 HL129转轮改造研究%CFD-based Study on Renovation of HL129 Runner

    Institute of Scientific and Technical Information of China (English)

    张东利

    2013-01-01

    基于改型优化方法,以某电站混流式水轮机模型机为基础,对HL129转轮进行改造。并建立从蜗壳进口到尾水管出口的全流道计算模型,采用CFD方法对其内部流动进行三维黏性数值计算,以获得水轮机内部流动特性。结果表明:优化后的转轮能够较好改善叶片表面压力分布,提高了低压区的压力值。优化后,尾水管内水力损失减小,流态顺畅,因而能量特性和空化性能都得到了改善。%HL129 runner is renovated in accordance with outline -renovating /optimizing method and with the model of mixed-flow tur-bine of one hydropower station.The calculation model for the whole flow passage from spiral case inlet to draft tube outlet is established and CFD method is applied for 3D calculation of viscose value of the internal flow so as to obtain the internal flow property of the turbine. The study shows that the optimized runner can improve the pressure distribution on the vane surface and increase the pressure value at the lower-pressure range.In the draft tube, after the runner is optimized, loss of the hydraulic pressure is reduced and the flow pattern is smooth.Accordingly, both energy performance and cavitation are improved.

  9. Multi-scale Model Coupling for CFD Simulations of Discharge Dispersion in the Sea

    Science.gov (United States)

    Robinson, D.; Wood, M.; Piggott, M. D.; Gorman, G.

    2014-12-01

    The processes that influence the dispersion of effluent discharges in the sea occur over a wide range of length and time scales. The distance that effluent can travel before it is considered mixed can be several kilometres, whereas the turbulent eddies that affect the near-field mixing of a discharge can be as small as a few centimetres. The range of scales that are involved mean that it is not generally practical to include all influencing physical phenomena within one model. Typically, the modelling of effluent dispersion is performed using two separate numerical models: a local model of the outlet(s), including the near-field effects of momentum, buoyancy and turbulence; and a larger scale model that can include the far-field effects of tidal-, wind- and wave-driven-currents, water depth variations, atmospheric fluxes, and Coriolis forces. The boundary between the two models is often not strictly defined, but is usually placed at the transition from where the behaviour of the effluent is dominated by the ambient environment, rather than the discharge characteristics and outfall configuration. In most real applications, this transition line varies considerably in time and space. This paper presents the findings of collaborative research between the Applied Modelling and Computation Group (AMCG) at Imperial College London, UK, and HR Wallingford Ltd. Results are presented using a range of coupling methods to link the near- and far-field mixing regions. An idealised domain and tidal conditions are used, with the outfall and ambient conditions typical of those found at small coastal desalination plants. Open-source CFD code Fluidity is used for both the near-field and far-field modelling. Fluidity scales well when run in parallel on large numbers of cores. It also has an anisotropic adaptive mesh capability which allows local control over solution accuracy throughout the domain. This combination means that accuracy can be achieved without excessive time costs, with

  10. On the wind-induced undercatch in rainfall measurement using CFD-based simulations

    Science.gov (United States)

    Colli, Matteo; Lanza, Luca

    2016-04-01

    The reliability of liquid atmospheric precipitation measurements is a basic requirement since rainfall data represent the fundamental input variables of many scientific applications (hydrologic models, weather forecasting data assimilation, climate change studies, calibration of weather radar, etc.). The scientific community and the National Meteorological Services worldwide are facing the issue of improving the accuracy of precipitation measurements, with an increased focus on retrieving the information at a high temporal resolution. The rainfall intensity is indeed fundamental information for the precise quantification of the markedly time-varying behavior of precipitation events. Environmental conditions have a relevant impact on the rain collection/sensing efficiency. Among other effects, wind is recognized as a major source of underestimation since it reduces the collection efficiency of the catching-type gauges (Nespor and Sevruk, 1999), the most common type of instruments used worldwide in the national observation networks. The collection efficiency is usually obtained by comparing the rainfall amounts measured by the gauge with the reference, which was defined by EN-13798 standard (CEN, 2002) as a gauge placed below the ground level inside a pit. A lot of scatter can be observed for a given wind speed, which is mainly caused by comparability issues among the tested gauges. An additional source of uncertainty is the drops size distribution (DSD) of the rain, which varies on an event-by-event basis. The goal of this study is to understand the role of the physical characteristics of precipitation particles on the wind-induced rainfall underestimation observed for catching-type gauges. To address this issue, a detailed analysis of the flow field in the vicinity of the gauge is conducted using time-averaged computational fluid dynamics (CFD) simulations (Colli et al., 2015). Using a Lagrangian model, which accounts for the hydrodynamic behavior of liquid

  11. CFD model of air movement in ventilated façade: comparison between natural and forced air flow

    Directory of Open Access Journals (Sweden)

    Miguel Mora Pérez, Gonzalo López Patiño, P. Amparo López Jiménez

    2013-01-01

    Full Text Available This study describes computational fluid dynamics (CFD modeling of ventilated façade. Ventilated façades are normal façade but it has an extra channel between the concrete wall and the (double skin façade. Several studies found in the literature are carried out with CFD simulations about the behavior of the thermodynamic phenomena of the double skin façades systems. These studies conclude that the presence of the air gap in the ventilated façade affects the temperature in the building skin, causing a cooling effect, at least in low-rise buildings. One of the most important factors affecting the thermal effects of ventilated façades is the wind velocity. In this contribution, a CFD analysis applied on two different velocity assumptions for air movement in the air gap of a ventilated façade is presented. A comparison is proposed considering natural wind induced velocity with forced fan induced velocity in the gap. Finally, comparing temperatures in the building skin, the differences between both solutions are described determining that, related to the considered boundary conditions, there is a maximum height in which the thermal effect of the induced flow is significantly observed.

  12. CFD modelling and wind tunnel validation of airflow through plant canopies using 3D canopy architecture

    International Nuclear Information System (INIS)

    The efficiency of pesticide application to agricultural fields and the resulting environmental contamination highly depend on atmospheric airflow. A computational fluid dynamics (CFD) modelling of airflow within plant canopies using 3D canopy architecture was developed to understand the effect of the canopy to airflow. The model average air velocity was validated using experimental results in a wind tunnel with two artificial model trees of 24 cm height. Mean air velocities and their root mean square (RMS) values were measured on a vertical plane upstream and downstream sides of the trees in the tunnel using 2D hotwire anemometer after imposing a uniform air velocity of 10 m s-1 at the inlet. 3D virtual canopy geometries of the artificial trees were modelled and introduced into a computational fluid domain whereby airflow through the trees was simulated using Reynolds-Averaged Navier-Stokes (RANS) equations and k-ε turbulence model. There was good agreement of the average longitudinal velocity, U between the measurements and the simulation results with relative errors less than 2% for upstream and 8% for downstream sides of the trees. The accuracy of the model prediction for turbulence kinetic energy k and turbulence intensity I was acceptable within the tree height when using a roughness length (y0 = 0.02 mm) for the surface roughness of the tree branches and by applying a source model in a porous sub-domain created around the trees. The approach was applied for full scale orchard trees in the atmospheric boundary layer (ABL) and was compared with previous approaches and works. The simulation in the ABL was made using two groups of full scale orchard trees; short (h = 3 m) with wider branching and long (h = 4 m) with narrow branching. This comparison showed good qualitative agreements on the vertical profiles of U with small local differences as expected due to the spatial disparities in tree architecture. This work was able to show airflow within and above the

  13. Integration of Engine, Plume, and CFD Analyses in Conceptual Design of Low-Boom Supersonic Aircraft

    Science.gov (United States)

    Li, Wu; Campbell, Richard; Geiselhart, Karl; Shields, Elwood; Nayani, Sudheer; Shenoy, Rajiv

    2009-01-01

    This paper documents an integration of engine, plume, and computational fluid dynamics (CFD) analyses in the conceptual design of low-boom supersonic aircraft, using a variable fidelity approach. In particular, the Numerical Propulsion Simulation System (NPSS) is used for propulsion system cycle analysis and nacelle outer mold line definition, and a low-fidelity plume model is developed for plume shape prediction based on NPSS engine data and nacelle geometry. This model provides a capability for the conceptual design of low-boom supersonic aircraft that accounts for plume effects. Then a newly developed process for automated CFD analysis is presented for CFD-based plume and boom analyses of the conceptual geometry. Five test cases are used to demonstrate the integrated engine, plume, and CFD analysis process based on a variable fidelity approach, as well as the feasibility of the automated CFD plume and boom analysis capability.

  14. CFD analysis and flow model reduction for surfactant production in helix reactor = CFD analiza i redukcija modela strujanja za proizvodnju surfaktanta u helix reaktoru

    NARCIS (Netherlands)

    Nikačević, N.M.; Thielen, L.; Twerda, A.; Hof, P.M.J. van den

    2015-01-01

    Flow pattern analysis in a spiral Helix reactor is conducted, for the application in commercial surfactant production. Step change response curves (SCR) were obtained from numerical tracer experiments by three-dimensional computational fluid dynamics (CFD) simulations. Non-reactive flow is simulated

  15. An automatic CFD-based flow diverter optimization principle for patient-specific intracranial aneurysms.

    Science.gov (United States)

    Janiga, Gábor; Daróczy, László; Berg, Philipp; Thévenin, Dominique; Skalej, Martin; Beuing, Oliver

    2015-11-01

    The optimal treatment of intracranial aneurysms using flow diverting devices is a fundamental issue for neuroradiologists as well as neurosurgeons. Due to highly irregular manifold aneurysm shapes and locations, the choice of the stent and the patient-specific deployment strategy can be a very difficult decision. To support the therapy planning, a new method is introduced that combines a three-dimensional CFD-based optimization with a realistic deployment of a virtual flow diverting stent for a given aneurysm. To demonstrate the feasibility of this method, it was applied to a patient-specific intracranial giant aneurysm that was successfully treated using a commercial flow diverter. Eight treatment scenarios with different local compressions were considered in a fully automated simulation loop. The impact on the corresponding blood flow behavior was evaluated qualitatively as well as quantitatively, and the optimal configuration for this specific case was identified. The virtual deployment of an uncompressed flow diverter reduced the inflow into the aneurysm by 24.4% compared to the untreated case. Depending on the positioning of the local stent compression below the ostium, blood flow reduction could vary between 27.3% and 33.4%. Therefore, a broad range of potential treatment outcomes was identified, illustrating the variability of a given flow diverter deployment in general. This method represents a proof of concept to automatically identify the optimal treatment for a patient in a virtual study under certain assumptions. Hence, it contributes to the improvement of virtual stenting for intracranial aneurysms and can support physicians during therapy planning in the future.

  16. A Transient 3D-CFD Model Incorporating Biological Processes for Use in Tissue Engineering

    DEFF Research Database (Denmark)

    Krühne, Ulrich; Wendt, D.; Martin, I.;

    2010-01-01

    after 2, 8 and 13 days. The development of the cells is compared to the simulated growth of cells and it is attempted to draw a conclusion about the impact of the shear stress on the cell growth. Keyword: Computational fluid dynamics (CFD),Micro pores,Scaffold,Bioreactor,Fluid structure interaction,Tissue...... engineering...

  17. CFD analysis and flow model reduction for surfactant production in helix reactor

    NARCIS (Netherlands)

    Nikačević, N.M.; Thielen, L.; Twerda, A.; Hof, P.M.J. van den

    2014-01-01

    Flow pattern analysis in a spiral Helix reactor is conducted, for the application in the commercial surfactant production. Step change response curves (SCR) were obtained from numerical tracer experiments by three-dimensional computational fluid dynamics (CFD) simulations. Non-reactive flow is simul

  18. Physical characterization of biomass fuels prepared for suspension firing in utility boilers for CFD modelling

    DEFF Research Database (Denmark)

    Rosendahl, Lasse; Yin, Chungen; Kær, Søren Knudsen;

    2007-01-01

    shapes. The sample is subdivided by straw type, and coherent size, type and mass distribution parameters are reported for the entire sample. This type of data is necessary in order to use CFD reliably as a design and retrofit tool for co-firing biomass with fossil fuels, as the combustion processes...

  19. CFD activities in support of thermal-hydraulic modeling of SFR fuel bundles

    International Nuclear Information System (INIS)

    Extensive testing and validation work is being performed to assess and validate Computational Fluid Dynamics (CFD) applicability to the simulation of SFR fuel assemblies. The demonstrated robustness of the method allows extending the CFD analysis to distorted fuel configurations, which will inevitably occur during extended fuel operation. The subchannel code COBRA-IV-I-MIT is adopted to evaluate the range of applicability of lumped parameter methods. Comparisons of mixing simulations show some intrinsic limitation in the subchannel methods, but allow confirming its overall applicability to nominal and mildly deformed assembly configurations. For significantly deformed geometries CFD is the recommend approach and is applied in this work. Deformed geometries considered include duct swelling, rod swelling, rod bowing, rod twisting, and various combinations of the simple deformations. While not derived from the realistic analysis of the in-core fuel behavior, the distorted geometries have been designed to embrace all conceptual worst case scenarios. The work focuses on the evaluation of the influence of the deformation on the fuel behavior, rather than on the actual fuel performance. Such approach is driven by the objective of deriving general understanding, and evaluating the applicability of subchannel analysis codes to long life fuel design, possibly in combination with distorted-channel factors derived from the CFD analyses. (author)

  20. CFD simulation of highly transient flows

    OpenAIRE

    Denton, G. S.

    2009-01-01

    This thesis describes the fundamental extension and extensive testing of a robust CFD model for predicting outflow following the failure of pressurised hydrocarbon pipelines. The main thrust of the study involves the extension of the basic outflow model to account for complex pipeline systems, improvements of the theoretical basis and numerical stability. The basic model, based on the numerical solution of conservation equations using the method of characteristics, incorporates a suitabl...

  1. CFD for Better Understanding of Wind Tunnel Tests

    OpenAIRE

    Qin, N.

    2003-01-01

    In this paper, we discuss how CFD may be used for better understanding of wind tunnel tests. Three examples are used to illustrate the potential use of CFD to help the understanding of phenomena observed in the wind tunnel tests, to extend/derive simple aerodynamic criteria based on CFD, and to use CFD to improve the accuracy of wind tunnel measurements.

  2. Investigation of the Optimal Omni-Direction-Guide-Vane Design for Vertical Axis Wind Turbines Based on Unsteady Flow CFD Simulation

    Directory of Open Access Journals (Sweden)

    Behzad Shahizare

    2016-03-01

    Full Text Available With soaring energy demands, the desire to explore alternate and renewable energy resources has become the focal point of various active research fronts. Therefore, the scientific community is revisiting the notion to tap wind resources in more rigorous and novel ways. In this study, a two-dimensional computational investigation of the vertical axis wind turbine (VAWT with omni-direction-guide-vane (ODGV is proposed to determine the effects of this guide vane. In addition, the mesh and time step (dt size dependency test, as well as the effect of the different turbulence models on results accuracy are investigated. Eight different shape ratios (R of the omni-direction-guide-vane were also examined in this study. Further, the CFD model is validated by comparing the numerical results with the experimental data. Validation results show a good agreement in terms of shape and trend in CFD simulation. Based on these results, all the shape ratios, except two ratios including 0.3 and 0.4 at TSR of 1.3 to 3, have a positive effect on the power and torque coefficient improvement. Moreover, results show that the best case has a shape ratio of 0.55, which improves the power coefficient by 48% and the torque coefficient up to 58%.

  3. Coupling scales for modelling heavy metal vaporization from municipal solid waste incineration in a fluid bed by CFD.

    Science.gov (United States)

    Soria, José; Gauthier, Daniel; Flamant, Gilles; Rodriguez, Rosa; Mazza, Germán

    2015-09-01

    Municipal Solid Waste Incineration (MSWI) in fluidized bed is a very interesting technology mainly due to high combustion efficiency, great flexibility for treating several types of waste fuels and reduction in pollutants emitted with the flue gas. However, there is a great concern with respect to the fate of heavy metals (HM) contained in MSW and their environmental impact. In this study, a coupled two-scale CFD model was developed for MSWI in a bubbling fluidized bed. It presents an original scheme that combines a single particle model and a global fluidized bed model in order to represent the HM vaporization during MSW combustion. Two of the most representative HM (Cd and Pb) with bed temperatures ranging between 923 and 1073K have been considered. This new approach uses ANSYS FLUENT 14.0 as the modelling platform for the simulations along with a complete set of self-developed user-defined functions (UDFs). The simulation results are compared to the experimental data obtained previously by the research group in a lab-scale fluid bed incinerator. The comparison indicates that the proposed CFD model predicts well the evolution of the HM release for the bed temperatures analyzed. It shows that both bed temperature and bed dynamics have influence on the HM vaporization rate. It can be concluded that CFD is a rigorous tool that provides valuable information about HM vaporization and that the original two-scale simulation scheme adopted allows to better represent the actual particle behavior in a fluid bed incinerator. PMID:26050934

  4. Evolutionary algorithm based optimization of hydraulic machines utilizing a state-of-the-art block coupled CFD solver and parametric geometry and mesh generation tools

    Science.gov (United States)

    S, Kyriacou; E, Kontoleontos; S, Weissenberger; L, Mangani; E, Casartelli; I, Skouteropoulou; M, Gattringer; A, Gehrer; M, Buchmayr

    2014-03-01

    An efficient hydraulic optimization procedure, suitable for industrial use, requires an advanced optimization tool (EASY software), a fast solver (block coupled CFD) and a flexible geometry generation tool. EASY optimization software is a PCA-driven metamodel-assisted Evolutionary Algorithm (MAEA (PCA)) that can be used in both single- (SOO) and multiobjective optimization (MOO) problems. In MAEAs, low cost surrogate evaluation models are used to screen out non-promising individuals during the evolution and exclude them from the expensive, problem specific evaluation, here the solution of Navier-Stokes equations. For additional reduction of the optimization CPU cost, the PCA technique is used to identify dependences among the design variables and to exploit them in order to efficiently drive the application of the evolution operators. To further enhance the hydraulic optimization procedure, a very robust and fast Navier-Stokes solver has been developed. This incompressible CFD solver employs a pressure-based block-coupled approach, solving the governing equations simultaneously. This method, apart from being robust and fast, also provides a big gain in terms of computational cost. In order to optimize the geometry of hydraulic machines, an automatic geometry and mesh generation tool is necessary. The geometry generation tool used in this work is entirely based on b-spline curves and surfaces. In what follows, the components of the tool chain are outlined in some detail and the optimization results of hydraulic machine components are shown in order to demonstrate the performance of the presented optimization procedure.

  5. 基于CFD的电子主板模块散热模拟%Heat Transfer Simulation for an Electronic Cabinet Based on CFD

    Institute of Scientific and Technical Information of China (English)

    吴德理; 刘泽; 饶国燃

    2015-01-01

    针对一种机柜内部主板模块的散热系统进行CFD散热模拟,采用Flotherm软件进行散热系统的仿真并对比实验进行分析,结果表明基于Flotherm软件平台对主板散热系统进行散热模拟的结果与实验比较接近,而且可以更直观地得到实验所不能详细测得的速度场和温度场,散热模型的正确建立能指导散热结构的后续优化设计。%In this paper, a simulation based on CFD for an cooling structure of a motherboard was carried out to study the heat transfer. The simulation is performed using the software of Flotherm,and the result is compared with the experimental analysis. The results show that the simulation base on Flotherm is closer to the experimental result, and it can be obtained more directly with the velocity field and the temperature field witch the experimental analysis cannot do. The correct CFD model can be used to the optimization design of heat dissipation structure.

  6. Evolutionary algorithm based optimization of hydraulic machines utilizing a state-of-the-art block coupled CFD solver and parametric geometry and mesh generation tools

    International Nuclear Information System (INIS)

    An efficient hydraulic optimization procedure, suitable for industrial use, requires an advanced optimization tool (EASY software), a fast solver (block coupled CFD) and a flexible geometry generation tool. EASY optimization software is a PCA-driven metamodel-assisted Evolutionary Algorithm (MAEA (PCA)) that can be used in both single- (SOO) and multiobjective optimization (MOO) problems. In MAEAs, low cost surrogate evaluation models are used to screen out non-promising individuals during the evolution and exclude them from the expensive, problem specific evaluation, here the solution of Navier-Stokes equations. For additional reduction of the optimization CPU cost, the PCA technique is used to identify dependences among the design variables and to exploit them in order to efficiently drive the application of the evolution operators. To further enhance the hydraulic optimization procedure, a very robust and fast Navier-Stokes solver has been developed. This incompressible CFD solver employs a pressure-based block-coupled approach, solving the governing equations simultaneously. This method, apart from being robust and fast, also provides a big gain in terms of computational cost. In order to optimize the geometry of hydraulic machines, an automatic geometry and mesh generation tool is necessary. The geometry generation tool used in this work is entirely based on b-spline curves and surfaces. In what follows, the components of the tool chain are outlined in some detail and the optimization results of hydraulic machine components are shown in order to demonstrate the performance of the presented optimization procedure

  7. Comprehensive Aerodynamic Analysis of a 10 MW Wind Turbine Rotor Using 3D CFD

    DEFF Research Database (Denmark)

    Zahle, Frederik; Bak, Christian; Sørensen, Niels N.;

    2014-01-01

    This article describes a comprehensive aerodynamic analysis carried out on the DTU 10 MW Reference Wind Turbine (DTU 10MW RWT), in which 3D CFD simulations were used to analyse the rotor performance and derive airfoil aerodynamic characteristics for use in aero-elastic simulation tools. The 3D CFD...... airfoil data derived using the Azimuthal Averaging Technique (AAT) was compared to airfoil data based on 2D CFD simulations on airfoil sections in combination with an array of 3D-correction engineering models, which indicated that the model by Chaviaropoulos and Hansen was in best agreement with the 3D...... CFD predictions. BEM simulations on the DTU 10MW RWT using the AAT-based airfoil data were carried out and compared to BEM simulations using the original airfoil data and the 3D CFD results, which showed clear improvements, particularly on the inner part of the rotor. Finally, 3D unsteady Detached...

  8. Computational Fluid Dynamics (CFD Analysis of Natural Convection of Convergent-Divergent Fins in Marine Environments

    Directory of Open Access Journals (Sweden)

    K. Alawadhi

    2014-12-01

    Full Text Available Computational Fluid Dynamics (CFD analysis was carried out for the convergent-divergent fins arranged inline and staggered on the base plate as per the experimental setup provided in the technical paper [1]. This paper reports on the validation of results of modeling and simulation in CFD. The simulation was carried out using the ANSYS 12.0 as the CFD modeling software. The main objective of the CFD analysis was to calculate the temperature distribution on the surface of the base plate and surface of the convergent-divergent fins for the given inline and staggered arrangement of fins due to the effect of natural convection heat transfer for different heat power inputs, and also to compare the CFD results with the experimental results.

  9. Aeroelastic simulation of vortex-induced vibration and flutter based on CFD/CSD coupling solution%基于 CFD 和 CSD 耦合的涡激振和颤振气弹模拟

    Institute of Scientific and Technical Information of China (English)

    李永乐; 朱佳琪; 唐浩俊

    2015-01-01

    Taking advantage of the software FLUENT and using the numerical solution of differential equation and the dynamic mesh model,a CFD/CSD coupling solution based on loose coupling was realized by embedding the Newmark method into FLUNT with the help of UDF function.A 2D-square cylinder model was established to investigate the change of Strouhal number and the maximum vertical vortex-excited amplitude of the square cylinder under different wind speed. The lock-in phenomenon of vortex-excited resonance was observed in the process of simulation and it was compared with the result of static square cylinder.A 2D flat plate model with vertical and torsional degrees of freedom was established to identify the flutter derivatives of the flat plate and to determine the flutter critical wind speed of flutter.The simulation result agrees well with the critical wind speeds of flutter calculated by using the Scanlan's formula and Selberg's formula.%以 FLUENT 为研究工具,利用微分方程的数值解法和动网格技术,基于松耦合方法将 Newmark 算法通过UDF 嵌入 Fluent 软件中,实现了 CFD 和 CSD 耦合的分析方法。通过建立二维方柱绕流模型,计算了竖向单自由度振动方柱在不同风速下的斯托罗哈数和最大振幅的变化情况,模拟了涡激共振锁定现象,并与静态绕流的结果进行了对比。建立了具有竖向振动和扭转振动二自由度的薄平板模型,并识别了该平板的颤振导数,进一步对其弯扭耦合颤振临界风速进行了逼近计算,本方法得到的颤振临界风速与 Scanlan 理论公式和 Selberg 理论公式吻合较好。

  10. Source strength and dispersion of CO2 releases from high-pressure pipelines: CFD model using real gas equation of state

    International Nuclear Information System (INIS)

    Highlights: • Validated CFD models for decompression and dispersion of CO2 releases from pipelines. • Incorporation of real gas EOS into CFD code for source strength estimation. • Demonstration of better performance of SST k–ω turbulence model for jet flow. • Demonstration of better performance of real gas EOS compared to ideal gas EOS. • Demonstration of superiority of CFD models over a commercial risk assessment package. - Abstract: Transportation of CO2 in high-pressure pipelines forms a crucial link in the ever-increasing application of Carbon Capture and Storage (CCS) technologies. An unplanned release of CO2 from a pipeline presents a risk to human and animal populations and the environment. Therefore it is very important to develop a deeper understanding of the atmospheric dispersion of CO2 before the deployment of CO2 pipelines, to allow the appropriate safety precautions to be taken. This paper presents a two-stage Computational Fluid Dynamics (CFD) study developed (1) to estimate the source strength, and (2) to simulate the subsequent dispersion of CO2 in the atmosphere, using the source strength estimated in stage (1). The Peng–Robinson (PR) EOS was incorporated into the CFD code. This enabled accurate modelling of the CO2 jet to achieve more precise source strength estimates. The two-stage simulation approach also resulted in a reduction in the overall computing time. The CFD models were validated against experimental results from the British Petroleum (BP) CO2 dispersion trials, and also against results produced by the risk management package Phast. Compared with the measurements, the CFD simulation results showed good agreement in both source strength and dispersion profile predictions. Furthermore, the effect of release direction on the dispersion was studied. The presented research provides a viable method for the assessment of risks associated with CCS

  11. Influence of operation parameters on flash smelting furnace based on CFD

    Institute of Scientific and Technical Information of China (English)

    Xinfeng Li; Shiheng Peng; Xiangli Han; Chi Mei; Tianyuan Xiao

    2004-01-01

    The influence of three important operation parameters in Jinlong flash smelting furnace, including the distributing blast speed, the oxygen enrichment rate of process air and the ratio of central oxygen to overall oxygen (Oc/Oo), has been investigated using a virtual simulation system on copper flash smelting furnace. The core of this virtual simulation system is a numerical simulation of CFD (computational fluid dynamics), and this system incorporates coupling momentum transport, heat transport, mass transport,reaction kinetics between gas and particles and chemical reactions between gas and gas. A set of numerical predicted data were obtained. The CFD simulation shows that there is a sensitive zone of the distributing blast speed, and the dust content ascends when the speed exceeds 180 m-s-1. Increasing the oxygen concentration of processing air benefits the efficient production of the flash smelting furnace.

  12. Modeling industrial thickener using computational fluid dynamics (CFD), a case study:Tailing thickener in the Sarcheshmeh copper mine

    Institute of Scientific and Technical Information of China (English)

    Majid Ebrahimzadeh Gheshlaghi; Ataallah Soltani Goharrizi; Alireza Aghajani Shahrivar; Hadi Abdollahi

    2013-01-01

    Separation of particles from liquid in the large gravitational tanks is widely used in mining and industrial wastewater treatment process. Thickener is key unit in the operational processes of hydrometallurgy and is used to separate solid from liquid. In this study, population balance models were combined with com-putational fluid dynamics (CFD) for modeling the tailing thickener. Parameters such as feed flow rate, flocculant dosage, inlet solid percent and feedwell were investigated. CFD was used to simulate the industrial tailing thickener with settled bed of 120 m diameter which is located in the Sarcheshmeh cop-per mine. Important factor of drag force that defines the rake torque of rotating paddles on the bed was also determined. Two phases turbulence model of Eulerian/Eulerian in accordance with turbulence model of k-e was used in the steady-state. Also population balance model consists of 15 groups of particle sizes with Luo and Lehr kernel was used for aggregation/breakage kernel. The simulation results showed good agreement with the operational data.

  13. 轴流式血泵流体特性 CFD 研究%Research on fluid properties of the anxial flow blood pump based on CFD

    Institute of Scientific and Technical Information of China (English)

    谢雄; 谭建平; 刘云龙

    2014-01-01

    在轴流式血泵的研发中,通常将血液当作牛顿流体来处理,考虑到当动脉存在局部狭窄等几何突变情况时,动脉局部流场中可能产生流动剪切率非常低的区域,因此有必要考虑血液的非牛顿特性。建立了轴流式血泵模型,通过C FD仿真分析得到血泵转速和流量的变化对血泵出入口流场的影响,以及血泵导叶对泵体内流场的影响规律,并通过对设计的血泵进行泵水实验,测量了轴流式血泵输出流量和压力参数。结果表明所设计的血泵在驱动性能上和仿真是相符的。%In the development of the axial flow blood pump ,the blood was usually taken as a New-tonian fluid .When taking into account of the existence of local artery stenosis and other geomet-ric mutation occurs ,an area with very low flow shear rate meight be produced in the arterial par-tial flow field .So the non-New tonian characteristics of blood should be considered .A model of the axial flow blood pump was established ,and the impaction of the flow and the rotate speed on the inlet and outlet of the flow field in the blood pump was analyzed through CFD as well as the influence of the guide vane on the flow field .By the drive experiment of the designed blood pump ,the output flow and pressure were measured .The results showed that the designed blood pump was consistent on the drive performance of the simulation .

  14. A comparative study of the CFD modeling of a ventilated active façade including phase change materials

    International Nuclear Information System (INIS)

    Highlights: • A CFD model of a ventilated active façade with PCM was developed. • Results were validated against real-scale experimental data. • Convection effects within PCM can be neglected in for the façade under study. • DO radiation model and RNG k–ε showed accurate results for air turbulent flow regime. • k–ω models showed better accuracy than the RNG k–ε model for transitional air flows. - Abstract: This article describes the development of a CFD 2D model of a new type of ventilated active façade which includes a PCM (Phase Change Material) in its outer layer. The model was carried out using the software Fluent. The numerical results were compared against experimental data obtained by means of a real-scale PASLINK test facility. Two different approaches were tested to model the PCM. To model the radiation, S2S and DO sub-models were tested. RNG k–ε, Standard k–ω and SST k–ω turbulence models were compared to model the air flow inside the ventilated layer. The results showed that for the geometry under consideration it was suitable to consider the PCM to be a solid material with variable Cp. The DO model accurately reproduced the radiation phenomena. For an air flow rate that resulted in a turbulent regime inside the air chamber, the RNG k–ε model showed good agreement between the experimental data and the simulated results. The developed model can be considered suitable for the simulation and optimization of the fa ade under turbulent flow conditions. Further research should be conducted to improve the accuracy of the model for low-Reynolds-number turbulence conditions

  15. CFD Application and OpenFOAM on the 2-D Model for the Moderator System of Heavy-Water Reactors

    International Nuclear Information System (INIS)

    The flow in the complex pipeline system in a calandria tank of CANDU reactor is transported through the distribution of heat sources, which also exerts the pressure drop to the coolant flow. So the phenomena should be considered as multi-physics both in the viewpoints of heat transfer and fluid dynamics. In this study, we have modeled the calandria tank system as two-dimensional simplified one preliminarily that is yet far from the real objects, but to see the essential physics and to test the possibility of the present CFD(computational fluid dynamics) methods for the thermo-hydraulic problem in the moderator system of heavy-water reactors

  16. CFD modelling of flow mal-distribution in an industrial ammonia oxidation reactor: A case study

    International Nuclear Information System (INIS)

    Ammonia oxidation reactor is widely used in nitric acid plant to cause the catalytic reaction between air and ammonia to produce nitrous gases. In this work, the flow distribution inside the ammonia oxidation reactor at Shiraz Petrochemical Complex (SPC) has been simulated using Computational Fluid Dynamics (CFD) code. The CFD results showed that the flow is non-uniformly distributed inside the reactor due to improper header design of the reactor. Measuring of the temperature distribution around the skin of the reactor has been carried out using thermograph. The thermograph experiment showed a considerable temperature difference between the left and right side of the reactor. It was found that the mal-distribution of the gas flow inside the reactor can directly affect the performance of the reactor. - Highlights: •A failure has been observed in an industrial ammonia oxidation reactor. •CFD code helps to simulate the flow inside the reactor. •The flow becomes non-uniformly distributed due to the reactor header mal-design. •The flow mal-distribution results in some drawbacks

  17. Thermal-hydraulic analysis of heat transfer in subchannels of the European high performance supercritical Water-Cooled Reactor for different CFD turbulence models

    Energy Technology Data Exchange (ETDEWEB)

    Castro, Landy Y.; Rojas, Leorlen Y.; Gamez, Abel; Rosales, Jesus; Gonzalez, Daniel; Garcia, Carlos, E-mail: lcastro@instec.cu, E-mail: leored1984@gmail.com, E-mail: agamezgmf@gmail.com, E-mail: jrosales@instec.cu, E-mail: danielgonro@gmail.com, E-mail: cgh@instec.cu [Instituto Superior de Tecnologias y Ciencias Aplicadas (InSTEC), La Habana (Cuba); Oliveira, Carlos Brayner de, E-mail: cabol@ufpe.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil); Dominguez, Dany S., E-mail: dsdominguez@gmail.com [Universidade Estadual de Santa Cruz (UESC), Ilheus, BA (Brazil). Pos-Graduacao em Modelagem Computacional

    2015-07-01

    Chosen as one of six Generation‒IV nuclear-reactor concepts, Supercritical Water-cooled Reactors (SCWRs) are expected to have high thermal efficiencies within the range of 45 - 50% owing to the reactor's high pressures and outlet temperatures. In this reactor, the primary water enters the core under supercritical-pressure condition (25 MPa) at a temperature of 280 deg C and leaves it at a temperature of up to 510 deg C. Due to the significant changes in the physical properties of water at supercritical-pressure, the system is susceptible to local temperature, density and power oscillations. The behavior of supercritical water into the core of the SCWR, need to be sufficiently studied. Most of the methods available to predict the effects of the heat transfer phenomena within the pseudocritical region are based on empirical one-directional correlations, which do not capture the multidimensional effects and do not provide accurate results in regions such as the deteriorated heat transfer regime. In this paper, computational fluid dynamics (CFD) analysis was carried out to study the thermal-hydraulic behavior of supercritical water flows in sub-channels of a typical European High Performance Light Water Reactor (HPLWR) fuel assembly using commercial CFD code CFX-14. It was determined the steady-state equilibrium parameters and calculated the temperature and density distributions. A comparative study for different turbulence models were carried out and the obtained results are discussed. (author)

  18. 3D CFD modeling of subsonic and transonic flowing-gas DPALs with different pumping geometries

    Science.gov (United States)

    Yacoby, Eyal; Sadot, Oren; Barmashenko, Boris D.; Rosenwaks, Salman

    2015-10-01

    Three-dimensional computational fluid dynamics (3D CFD) modeling of subsonic (Mach number M ~ 0.2) and transonic (M ~ 0.9) diode pumped alkali lasers (DPALs), taking into account fluid dynamics and kinetic processes in the lasing medium is reported. The performance of these lasers is compared with that of supersonic (M ~ 2.7 for Cs and M ~ 2.4 for K) DPALs. The motivation for this study stems from the fact that subsonic and transonic DPALs require much simpler hardware than supersonic ones where supersonic nozzle, diffuser and high power mechanical pump (due to a drop in the gas total pressure in the nozzle) are required for continuous closed cycle operation. For Cs DPALs with 5 x 5 cm2 flow cross section pumped by large cross section (5 x 2 cm2) beam the maximum achievable power of supersonic devices is higher than that of the transonic and subsonic devices by only ~ 3% and ~ 10%, respectively. Thus in this case the supersonic operation mode has no substantial advantage over the transonic one. The main processes limiting the power of Cs supersonic DPALs are saturation of the D2 transition and large ~ 60% losses of alkali atoms due to ionization, whereas the influence of gas heating is negligible. For K transonic DPALs both the gas heating and ionization effects are shown to be unimportant. The maximum values of the power are higher than those in Cs transonic laser by ~ 11%. The power achieved in the supersonic and transonic K DPAL is higher than for the subsonic version, with the same resonator and K density at the inlet, by ~ 84% and ~ 27%, respectively, showing a considerable advantaged of the supersonic device over the transonic one. For pumping by rectangular beams of the same (5 x 2 cm2) cross section, comparison between end-pumping - where the laser beam and pump beam both propagate at along the same axis, and transverse-pumping - where they propagate perpendicularly to each other, shows that the output power and optical-to-optical efficiency are not

  19. Estimation of Radius Ratio in a Fin Using Inverse CFD Model

    Directory of Open Access Journals (Sweden)

    Ranjan Das

    2011-03-01

    Full Text Available

    This article deals with the retrieval of parameters such as the radius-ratio in a rectangular fin using an inverse CFD model involving a mixed boundary condition. At first, the temperature field is obtained from a forward problem using the finite difference method (FDM in which the inner and outer radii or the radius-ratio is assumed to be known. Next, by an inverse approach using the FDM in conjunction with the genetic algorithm (GA, the inner and outer radii or the radius-ratio is retrieved. To accomplish the task, an objective function represented by the sum of square of the error between the guessed and the exact/measured temperature fields is minimized. Apart from demonstrating the suitability of the FDM

  20. A comparison of turbulence models in airship steady-state CFD simulations

    OpenAIRE

    Voloshin, Vitaly; Chen, Yong K.; Calay, Rajnish K.

    2012-01-01

    The accuracy and resource consumption of the four different turbulence models based on the eddy viscosity assumption, namely, $k-\\varepsilon$, two $k-\\omega$ and Spallart-Allmaram models, in modeling airships are investigated. The test airship shape is a conventional shape. Three different angles of attack are considered. The results are checked against the wind tunnel experimental data. The resource consumption study is based on the benchmark of 1500 iterations. Based on all data obtained it...