WorldWideScience

Sample records for barton springs salamander

  1. Contaminant discharge in habitat springs of the Barton Springs Salamander during storm rainfall events

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Aquatic habitat of the endangered Barton Springs salamander, Eurycea sosorum, in Travis County, Texas can potentially be impacted by contaminants in surface runoff...

  2. Multimodal communication, mismatched messages and the effects of turbidity on the antipredator behavior of the Barton Springs salamander, Eurycea sosorum.

    Science.gov (United States)

    Zabierek, Kristina C; Gabor, Caitlin R

    2016-09-01

    Prey may use multiple sensory channels to detect predators, whose cues may differ in altered sensory environments, such as turbid conditions. Depending on the environment, prey may use cues in an additive/complementary manner or in a compensatory manner. First, to determine whether the purely aquatic Barton Springs salamander, Eurycea sosorum, show an antipredator response to visual cues, we examined their activity when exposed to either visual cues of a predatory fish (Lepomis cyanellus) or a non-predatory fish (Etheostoma lepidum). Salamanders decreased activity in response to predator visual cues only. Then, we examined the antipredator response of these salamanders to all matched and mismatched combinations of chemical and visual cues of the same predatory and non-predatory fish in clear and low turbidity conditions. Salamanders decreased activity in response to predator chemical cues matched with predator visual cues or mismatched with non-predator visual cues. Salamanders also increased latency to first move to predator chemical cues mismatched with non-predator visual cues. Salamanders decreased activity and increased latency to first move more in clear as opposed to turbid conditions in all treatment combinations. Our results indicate that salamanders under all conditions and treatments preferentially rely on chemical cues to determine antipredator behavior, although visual cues are potentially utilized in conjunction for latency to first move. Our results also have potential conservation implications, as decreased antipredator behavior was seen in turbid conditions. These results reveal complexity of antipredator behavior in response to multiple cues under different environmental conditions, which is especially important when considering endangered species.

  3. Integrated geophysical investigations of Main Barton Springs, Austin, Texas, USA

    Science.gov (United States)

    Saribudak, By Mustafa; Hauwert, Nico M.

    2017-03-01

    Barton Springs is a major discharge site for the Barton Springs Segment of the Edwards Aquifer and is located in Zilker Park, Austin, Texas. Barton Springs actually consists of at least four springs. The Main Barton Springs discharges into the Barton Springs pool from the Barton Springs fault and several outlets along a fault, from a cave, several fissures, and gravel-filled solution cavities on the floor of the pool west of the fault. Surface geophysical surveys [resistivity imaging, induced polarization (IP), self-potential (SP), seismic refraction, and ground penetrating radar (GPR)] were performed across the Barton Springs fault and at the vicinity of the Main Barton Springs in south Zilker Park. The purpose of the surveys was two-fold: 1) locate the precise location of submerged conduits (caves, voids) carrying flow to Main Barton Springs; and 2) characterize the geophysical signatures of the fault crossing Barton Springs pool. Geophysical results indicate significant anomalies to the south of the Barton Springs pool. A majority of these anomalies indicate a fault-like pattern, in front of the south entrance to the swimming pool. In addition, resistivity and SP results, in particular, suggest the presence of a large conduit in the southern part of Barton Springs pool. The groundwater flow-path to the Main Barton Springs could follow the locations of those resistivity and SP anomalies along the newly discovered fault, instead of along the Barton Springs fault, as previously thought.

  4. Dissolved oxygen fluctuations in karst spring flow and implications for endemic species: Barton Springs, Edwards aquifer, Texas, USA

    Science.gov (United States)

    Mahler, Barbara J.; Bourgeais, Renan

    2013-01-01

    Karst aquifers and springs provide the dissolved oxygen critical for survival of endemic stygophiles worldwide, but little is known about fluctuations of dissolved oxygen concentrations (DO) and factors that control those concentrations. We investigated temporal variation in DO at Barton Springs, Austin, Texas, USA. During 2006–2012, DO fluctuated by as much as a factor of 2, and at some periods decreased to concentrations that adversely affect the Barton Springs salamander (Eurycea sorosum) (≤4.4 mg/L), a federally listed endangered species endemic to Barton Springs. DO was lowest (≤4.4 mg/L) when discharge was low (≤1 m3/s) and spring water temperature was >21 °C, although not at a maximum; the minimum DO recorded was 4.0 mg/L. Relatively low DO (3/s) and maximum T (22.2 °C). A four-segment linear regression model with daily data for discharge and spring water temperature as explanatory variables provided an excellent fit for mean daily DO (Nash–Sutcliffe coefficient for the validation period of 0.90). DO also fluctuated at short-term timescales in response to storms, and DO measured at 15-min intervals could be simulated with a combination of discharge, spring temperature, and specific conductance as explanatory variables. On the basis of the daily-data regression model, we hypothesize that more frequent low DO corresponding to salamander mortality could result from (i) lower discharge from Barton Springs resulting from increased groundwater withdrawals or decreased recharge as a result of climate change, and (or) (ii) higher groundwater temperature as a result of climate change.

  5. Water and sediment quality in habitat springs of Edwards Aquifer salamanders

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Many springs associated with the Edwards Aquifer of Texas are inhabited by relict populations of neotenic salamanders in the genus Eurycea. This study was done to...

  6. Geophysical delineation of the freshwater/saline-water transition zone in the Barton Springs segment of the Edwards Aquifer, Travis and Hays Counties, Texas, September 2006

    Science.gov (United States)

    Payne, J.D.; Kress, W.H.; Shah, S.D.; Stefanov, J.E.; Smith, B.A.; Hunt, B.B.

    2007-01-01

    During September 2006, the U.S. Geological Survey, in cooperation with the Barton Springs/Edwards Aquifer Conservation District, conducted a geophysical pilot study to determine whether time-domain electromagnetic (TDEM) sounding could be used to delineate the freshwater/saline-water transition zone in the Barton Springs segment of the Edwards aquifer in Travis and Hays Counties, Texas. There was uncertainty regarding the application of TDEM sounding for this purpose because of the depth of the aquifer (200-500 feet to the top of the aquifer) and the relatively low-resistivity clayey units in the upper confining unit. Twenty-five TDEM soundings were made along four 2-3-mile-long profiles in a study area overlying the transition zone near the Travis-Hays County boundary. The soundings yield measurements of subsurface electrical resistivity, the variations in which were correlated with hydrogeologic and stratigraphic units, and then with dissolved solids concentrations in the aquifer. Geonics Protem 47 and 57 systems with 492-foot and 328-foot transmitter-loop sizes were used to collect the TDEM soundings. A smooth model (vertical delineation of calculated apparent resistivity that represents an estimate [non-unique] of the true resistivity) for each sounding site was created using an iterative software program for inverse modeling. The effectiveness of using TDEM soundings to delineate the transition zone was indicated by comparing the distribution of resistivity in the aquifer with the distribution of dissolved solids concentrations in the aquifer along the profiles. TDEM sounding data show that, in general, the Edwards aquifer in the study area is characterized by a sharp change in resistivity from west to east. The western part of the Edwards aquifer in the study area shows higher resistivity than the eastern part. The higher resistivity regions correspond to lower dissolved solids concentrations (freshwater), and the lower resistivity regions correspond to

  7. Recent (2008-10) concentrations and isotopic compositions of nitrate and concentrations of wastewater compounds in the Barton Springs zone, south-central Texas, and their potential relation to urban development in the contributing zone

    Science.gov (United States)

    Mahler, Barbara J.; Musgrove, MaryLynn; Herrington, Chris; Sample, Thomas L.

    2011-01-01

    During 2008–10, the U.S. Geological Survey, in cooperation with the City of Austin, the City of Dripping Springs, the Barton Springs/Edwards Aquifer Conservation District, the Lower Colorado River Authority, Hays County, and Travis County, collected and analyzed water samples from five streams (Barton, Williamson, Slaughter, Bear, and Onion Creeks), two groundwater wells (Marbridge well [YD–58–50–704] and Buda well [LR–58–58–403]), and the main orifice of Barton Springs in Austin, Texas, with the objective of characterizing concentrations and isotopic compositions of nitrate and concentrations of wastewater compounds in the Barton Springs zone. The Barton Springs zone is in south-central Texas, an area undergoing rapid growth in population and in land area affected by development, with associated increases in wastewater generation. Over a period of 17 months, during which the hydrologic conditions transitioned from dry to wet, samples were collected routinely from the streams, wells, and spring and, in response to storms, from the streams and spring; some or all samples were analyzed for nitrate, nitrogen and oxygen isotopes of nitrate, and waste­water compounds. The median nitrate concentrations in routine samples from all sites were higher in samples collected during the wet period than in samples collected during the dry period, with the greatest difference for stream samples (0.05 milligram per liter during the dry period to 0.96 milligram per liter for the wet period). Nitrate concentrations in recent (2008–10) samples were elevated relative to concentrations in historical (1990–2008) samples from streams and from Barton Springs under medium- and high-flow conditions. Recent nitrate concentrations were higher than historical concentrations at the Marbridge well but the reverse was true at the Buda well. The elevated concentrations likely are related to the cessation of dry conditions coupled with increased nitrogen loading in the

  8. Salamander Saver

    Science.gov (United States)

    Ilseman, Kelly; Hoffmann, Kristine

    2016-01-01

    On a spring morning in Maine, traps made of nets rise above vernal pools in a small wetland, ready to collect salamanders. The traps were designed by groups of rural and urban high school students from Maine and Massachusetts participating in the University of Maine Upward Bound Math Science Program (UBMS) at the university campus in Orono, Maine.…

  9. Effects of timber harvests and silvicultural edges on terrestrial salamanders.

    Directory of Open Access Journals (Sweden)

    Jami E MacNeil

    Full Text Available Balancing timber production and conservation in forest management requires an understanding of how timber harvests affect wildlife species. Terrestrial salamanders are useful indicators of mature forest ecosystem health due to their importance to ecosystem processes and sensitivity to environmental change. However, the effects of timber harvests on salamanders, though often researched, are still not well understood. To further this understanding, we used artificial cover objects to monitor the relative abundance of terrestrial salamanders for two seasons (fall and spring pre-harvest and five seasons post-harvest in six forest management treatments, and for three seasons post-harvest across the edge gradients of six recent clearcuts. In total, we recorded 19,048 encounters representing nine species of salamanders. We observed declines in mean encounters of eastern red-backed salamanders (Plethodon cinereus and northern slimy salamanders (P. glutinosus from pre- to post-harvest in group selection cuts and in clearcuts. However, we found no evidence of salamander declines at shelterwoods and forested sites adjacent to harvests. Edge effects induced by recent clearcuts influenced salamanders for approximately 20 m into the forest, but edge influence varied by slope orientation. Temperature, soil moisture, and canopy cover were all correlated with salamander counts. Our results suggest silvicultural techniques that remove the forest canopy negatively affect salamander relative abundance on the local scale during the years immediately following harvest, and that the depth of edge influence of clearcuts on terrestrial salamanders is relatively shallow (<20 m. Small harvests (<4 ha and techniques that leave the forest canopy intact may be compatible with maintaining terrestrial salamander populations across a forested landscape. Our results demonstrate the importance of examining species-specific responses and monitoring salamanders across multiple

  10. Effects of timber harvests and silvicultural edges on terrestrial salamanders.

    Science.gov (United States)

    MacNeil, Jami E; Williams, Rod N

    2014-01-01

    Balancing timber production and conservation in forest management requires an understanding of how timber harvests affect wildlife species. Terrestrial salamanders are useful indicators of mature forest ecosystem health due to their importance to ecosystem processes and sensitivity to environmental change. However, the effects of timber harvests on salamanders, though often researched, are still not well understood. To further this understanding, we used artificial cover objects to monitor the relative abundance of terrestrial salamanders for two seasons (fall and spring) pre-harvest and five seasons post-harvest in six forest management treatments, and for three seasons post-harvest across the edge gradients of six recent clearcuts. In total, we recorded 19,048 encounters representing nine species of salamanders. We observed declines in mean encounters of eastern red-backed salamanders (Plethodon cinereus) and northern slimy salamanders (P. glutinosus) from pre- to post-harvest in group selection cuts and in clearcuts. However, we found no evidence of salamander declines at shelterwoods and forested sites adjacent to harvests. Edge effects induced by recent clearcuts influenced salamanders for approximately 20 m into the forest, but edge influence varied by slope orientation. Temperature, soil moisture, and canopy cover were all correlated with salamander counts. Our results suggest silvicultural techniques that remove the forest canopy negatively affect salamander relative abundance on the local scale during the years immediately following harvest, and that the depth of edge influence of clearcuts on terrestrial salamanders is relatively shallow (salamander populations across a forested landscape. Our results demonstrate the importance of examining species-specific responses and monitoring salamanders across multiple seasons and years. Long-term monitoring will be necessary to understand the full impacts of forest management on terrestrial salamanders.

  11. Harbingers of Spring

    Science.gov (United States)

    Serrao, John

    1976-01-01

    Emphasizing the spring migration of frogs, toads, and salamanders to their watery breeding sites, this article presents information on numerous amphibians and suggests both indoor and outdoor educational activities appropriate for elementary and/or early secondary instruction. (JC)

  12. Investigating the Maya Polity at Lower Barton Creek Cayo, Belize

    Science.gov (United States)

    Kollias, George Van, III

    The objectives of this research are to determine the importance of Lower Barton Creek in both time and space, with relation to other settlements along the Belize River Valley. Material evidence recovered from field excavations and spatial information developed from Lidar data were employed in determining the socio-political nature and importance of this settlement, so as to orient its existence within the context of ancient socio-political dynamics in the Belize River Valley. Before the investigations detailed in this thesis no archaeological research had been conducted in the area, the site of Lower Barton Creek itself was only recently identified via the 2013 West-Central Belize LiDAR Survey (WCBLS 2013). Previously, the southern extent of the Barton Creek area represented a major break in our knowledge not only of the Barton Creek area, but the southern extent of the Belize River Valley. Conducting research at Lower Barton Creek has led to the determination of the polity's temporal existence and allowed for a greater and more complex understanding of the Belize River Valley's interaction with regions abutting the Belize River Valley proper.

  13. Springs

    Institute of Scientific and Technical Information of China (English)

    James J. Kilpatrick

    2006-01-01

    @@ Springs are not always the same. In some years, April bursts upon our Virginia hills in one prodigious leap-and all the stage is filled at once, whole choruses of tulips, arabesques of forsythia, cadenzas of flowering plum. The trees grow leaves overnight

  14. Ambystoma maculatum (spotted salamander). Reproduction

    Science.gov (United States)

    Glorioso, Brad M.; Waddle, Hardin; Hefner, Jeromi

    2012-01-01

    The Spotted Salamander is a wide-ranging salamander of the eastern United States that typically breeds in winter or early spring in ephemeral pools in lowland forests. Ambystoma maculatum is known to deposit 2-4 egg masses per year, each containing 1-250 eggs. As part of ongoing research into the ecology and reproductive biology of Spotted Salamanders in the Kisatchie District of Kisatchie National Forest in Natchitoches Parish, Louisiana, USA, we have been counting the number of embryos per egg mass. We captured seven female A. maculatum in a small pool, six of which were still gravid. We took standard measurements, including SVL, and then implanted a Passive Integrated Transponder (PIT tag) into each adult female as was the protocol. About an hour after processing these animals we marked new A. maculatum egg masses found in the same small pool using PVC pin flags pushed carefully through the outer jelly. We did not have enough time to process them that evening, and it was not until a few days later that we photographed those masses. We discovered that one of the masses contained a PIT tag in the outer jelly that corresponded to one of the six gravid females that were marked that same evening. To our knowledge, this is the first report of PIT tags being the means, albeit coincidentally, by which a particular egg mass of Ambystoma maculatum has been assigned to a particular female. For our purposes, losing the PIT tag from the adult female is counter to the goals of our study of this population, and we will no longer be implanting PIT tags into gravid females.

  15. Evolutionary cytogenetics in salamanders.

    Science.gov (United States)

    Sessions, Stanley K

    2008-01-01

    Salamanders (Amphibia: Caudata/Urodela) have been the subject of numerous cytogenetic studies, and data on karyotypes and genome sizes are available for most groups. Salamanders show a more-or-less distinct dichotomy between families with large chromosome numbers and interspecific variation in chromosome number, relative size, and shape (i.e. position of the centromere), and those that exhibit very little variation in these karyological features. This dichotomy is the basis of a major model of karyotype evolution in salamanders involving a kind of 'karyotypic orthoselection'. Salamanders are also characterized by extremely large genomes (in terms of absolute mass of nuclear DNA) and extensive variation in genome size (and overall size of the chromosomes), which transcends variation in chromosome number and shape. The biological significance and evolution of chromosome number and shape within the karyotype is not yet understood, but genome size variation has been found to have strong phenotypic, biogeographic, and phylogenetic correlates that reveal information about the biological significance of this cytogenetic variable. Urodeles also present the advantage of only 10 families and less than 600 species, which facilitates the analysis of patterns within the entire order. The purpose of this review is to present a summary of what is currently known about overall patterns of variation in karyology and genome size in salamanders. These patterns are discussed within an evolutionary context.

  16. A Study of Mrs.Gaskell’s Feminism in Mary Barton

    Institute of Scientific and Technical Information of China (English)

    甄艳华; 屈伟丽

    2015-01-01

    Mrs.Gaskel is one of the most outstanding feminist novelists in Victorian Age.Mary Barton is her first novel and the most important one deal with many subjects include the labor conflicts,ethical concerns as wel as the struggle for women rights.The paper tries to analyze Mary Barton from the feminist ’ s perspective and study Mrs.Gaskel ’s feminism through the analysis of the main characters in the novel.

  17. Landmark learning by juvenile salamanders (Ambystoma maculatum).

    Science.gov (United States)

    Heuring, Whitney L; Mathis, Alicia

    2014-10-01

    Learning to use a landmark as a beacon to locate resources is one of the simplest forms of spatial learning. We tested whether landmark learning occurs in a semifossorial salamander that migrates annually to breeding ponds as adults. Juvenile spotted salamanders (Ambystoma maculatum) were tested in square containers with a plastic feeding dish in each corner, and a piece of earthworm was placed in one randomly-chosen dish. For landmark-trained salamanders, a rock was placed beside the dish containing the prey. For control salamanders, the rock was placed beside a randomly selected feeding dish. Each salamander was trained once every 2 days for 30 days. Significantly more landmark-trained salamanders than control salamanders entered the landmark area first, and landmark-trained individuals had faster latencies to enter the landmark area and longer stay-times. These results suggest that spotted salamanders are able to locate resources by associating their positions with landmarks.

  18. Clara Barton: teacher, nurse, Civil War heroine, founder of the American Red Cross.

    Science.gov (United States)

    Evans, Gerald D

    2003-01-01

    Clara Barton was a nineteenth century woman driven to greatness. She was a teacher, a nurse, a Civil War heroine and founder of the American Red Cross. In order to cut a path into the future we must know where we have been. The story of Clara Barton is about someone who cut that path. It is about courage, overcoming obstacles, never giving up and doing the job that needs doing. What makes it fascinating is the human side, the weaknesses that coloured her life. We can learn from her journey as we develop our own path into the future.

  19. Clara Barton High School Bilingual Program. O.E.E. Evaluation Report, 1982-1983.

    Science.gov (United States)

    Collazo-Levy, Dora; Sica, Michael

    In 1982-83, the program evaluated here provided tutorial and supportive services to approximately 50 Spanish-speaking students of limited English proficiency (LEP) in grades 9-12 at Clara Barton High School, Brooklyn, New York. The program's main objective was to enable LEP students to function successfully in terms of language achievement and…

  20. Shifty salamanders: transient trophic polymorphism and cannibalism within natural populations of larval ambystomatid salamanders

    OpenAIRE

    Jefferson, Dale M; Ferrari, Maud CO; Mathis, Alicia; Hobson, Keith A.; Eric R Britzke; Crane, Adam L; Blaustein, Andrew R.; Chivers, Douglas P.

    2014-01-01

    Introduction Many species of ambystomatid salamanders are dependent upon highly variable temporary wetlands for larval development. High larval densities may prompt the expression of a distinct head morphology that may facilitate cannibalism. However, few studies have characterized structural cannibalism within natural populations of larval salamanders. In this study we used two species of larval salamanders, long-toed (Ambystoma macrodactylum) and ringed salamanders (A. annulatum). Head morp...

  1. Road deicing salt irreversibly disrupts osmoregulation of salamander egg clutches

    Energy Technology Data Exchange (ETDEWEB)

    Karraker, Nancy E., E-mail: karraker@hku.hk [Department of Environmental and Forest Biology, State University of New York, College of Environmental Science and Forestry, Syracuse, NY 13210 (United States); Gibbs, James P. [Department of Environmental and Forest Biology, State University of New York, College of Environmental Science and Forestry, Syracuse, NY 13210 (United States)

    2011-03-15

    It has been postulated that road deicing salts are sufficiently diluted by spring rains to ameliorate any physiological impacts to amphibians breeding in wetlands near roads. We tested this conjecture by exposing clutches of the spotted salamander (Ambystoma maculatum) to three chloride concentrations (1 mg/L, 145 mg/L, 945 mg/L) for nine days, then transferred clutches to control water for nine days, and measured change in mass at three-day intervals. We measured mass change because water uptake by clutches reduces risks to embryos associated with freezing, predation, and disease. Clutches in controls sequestered water asymptotically. Those in the moderate concentrations lost 18% mass initially and regained 14% after transfer to control water. Clutches in high concentration lost 33% mass and then lost an additional 8% after transfer. Our results suggest that spring rains do not ameliorate the effects of deicing salts in wetlands with extremely high chloride concentrations. - Road deicing salts irreversibly disrupts osmoregulation of salamander egg clutches.

  2. Adolescent Volar Barton Fracture with Open Physis treated with Volar Plating using Buttressing Principle

    Directory of Open Access Journals (Sweden)

    Shah H

    2015-07-01

    Full Text Available Objective: The objective of the study was to assess the outcome of Salter- Harris type III distal radius fracture fixed using the principle of buttressing and avoiding screw insertion through the physis. Materials and Method: Eight school going children in the age group of 11-16 years with volar Barton fractures were treated with a volar plate using the buttress principle without inserting screws in the distal fragment. Patients were evaluated over a period of 18 months. Clinical evaluation was done using the Green O’Brien criteria and radiological evaluation using the Sarmiento criteria. Results: The average union time was two months. All the patients had good to excellent functional outcome with full extension and flexion. Conclusion: Buttress plating of volar Barton fractures in the adolescent age group is an excellent technique to achieve satisfactory outcome without violation of the physis.

  3. Earliest known crown-group salamanders.

    Science.gov (United States)

    Gao, Ke-Qin; Shubin, Neil H

    2003-03-27

    Salamanders are a model system for studying the rates and patterns of the evolution of new anatomical structures. Recent discoveries of abundant Late Jurassic and Early Cretaceous salamanders are helping to address these issues. Here we report the discovery of well-preserved Middle Jurassic salamanders from China, which constitutes the earliest known record of crown-group urodeles (living salamanders and their closest relatives). The new specimens are from the volcanic deposits of the Jiulongshan Formation (Bathonian), Inner Mongolia, China, and represent basal members of the Cryptobranchidae, a family that includes the endangered Asian giant salamander (Andrias) and the North American hellbender (Cryptobranchus). These fossils document a Mesozoic record of the Cryptobranchidae, predating the previous record of the group by some 100 million years. This discovery provides evidence to support the hypothesis that the divergence of the Cryptobranchidae from the Hynobiidae had taken place in Asia before the Middle Jurassic period.

  4. Road deicing salt irreversibly disrupts osmoregulation of salamander egg clutches.

    Science.gov (United States)

    Karraker, Nancy E; Gibbs, James P

    2011-03-01

    It has been postulated that road deicing salts are sufficiently diluted by spring rains to ameliorate any physiological impacts to amphibians breeding in wetlands near roads. We tested this conjecture by exposing clutches of the spotted salamander (Ambystoma maculatum) to three chloride concentrations (1 mg/L, 145 mg/L, 945 mg/L) for nine days, then transferred clutches to control water for nine days, and measured change in mass at three-day intervals. We measured mass change because water uptake by clutches reduces risks to embryos associated with freezing, predation, and disease. Clutches in controls sequestered water asymptotically. Those in the moderate concentrations lost 18% mass initially and regained 14% after transfer to control water. Clutches in high concentration lost 33% mass and then lost an additional 8% after transfer. Our results suggest that spring rains do not ameliorate the effects of deicing salts in wetlands with extremely high chloride concentrations.

  5. Different season, different strategies: Feeding ecology of two syntopic forest-dwelling salamanders

    Science.gov (United States)

    Sebastiano, Salvidio; Antonio, Romano; Fabrizio, Oneto; Dario, Ottonello; Roberta, Michelon

    2012-08-01

    Trophic niche may be the most important ecological dimension for some vertebrate groups and in particular for terrestrial amphibians, that are important predators of soil invertebrates. In general, resource partitioning occurs between syntopic species with similar ecological niches, and coexistence patterns seem to be regulated by temporal resource variability. However most of the generalization on foraging strategies of terrestrial salamanders are extrapolated from studies on New World temperate species, thus we investigated the seasonal effect of resource variation in an European forest ecosystem, in which two ecologically similar but phylogenetically distinct salamander species are found. The diet of adult and juvenile cave salamanders (Speleomantes strinati), and of adult spectacled salamander (Salamandrina perspicillata) was obtained by stomach flushing, and results showed large seasonal changes both in prey availability and in salamander realised trophic niche. Values of trophic diversity were similar and niche overlaps were large among all salamander groups in spring, during high prey availability. Conversely in autumn, when a two-fold reduction in prey biomass was observed, there was a clear niche partitioning as the smaller S. perspicillata shifted from a generalist to a specialized trophic strategy. Juvenile Speleomantes strinatii, that largely overlapped in size with S. perspicillata, did not show any change in diet, suggesting that the feeding strategies were species-specific and not size-mediated. The observed patterns of variation in feeding ecology indicate that similar predators may react differently to changing prey availability to enhance niche partitioning. We also observed an increased energy intake during autumn for S perspicillata and S. strinatii juveniles, possibly related to differences in microhabitat use and activity patterns.

  6. Linking the evolution of habitat choice to ecosystem functioning: direct and indirect effects of pond-reproducing fire salamanders on aquatic-terrestrial subsidies.

    Science.gov (United States)

    Reinhardt, Timm; Steinfartz, Sebastian; Paetzold, Achim; Weitere, Markus

    2013-09-01

    Shifts in life history traits and in the behaviour of species can potentially alter ecosystem functioning. The reproduction of the central European fire salamander (Salamandra salamandra), which usually deposits its larvae in first-order streams, in small pool and pond-like habitats, is an example of a recent local adaptation in this species. Here we aimed to quantify the direct and indirect effects of the predatory larvae on the aquatic food webs in the ponds and on the flux of matter between the ponds and adjacent terrestrial habitats. Our estimates are based on biomass data of the present pond fauna as well as on the analysis of stomach content data, growth rates and population dynamics of the salamander larvae in pond habitats. By their deposition of larvae in early spring, female fire salamanders import between 0.07 and 2.86 g dry mass m(-2) larval biomass into the ponds. Due to high mortality rates in the larval phase and the relatively small size at metamorphosis of the pond-adapted salamanders compared to stream-adapted ones, the biomass export of the metamorphosed salamanders clearly falls below the initial biomass import. Catastrophic events such as high water temperatures and low oxygen levels may even occasionally result in mass mortalities of salamander larvae and thus in a net 100 % import of the salamander biomass into the pond food webs. Indirect effects further accelerate this net import of matter into the aquatic habitat, e.g. the feeding of salamanders on aquatic insect larvae with the emergence of terrestrial adults-thus preventing export-and on terrestrial organisms that fall on the water surface (supporting import). This study demonstrates that the adaptation of salamanders to pond reproduction can alter food web linkages across ecosystem boundaries by enhancing the flux of materials and energy from terrestrial (i.e. forest) to the aquatic (i.e. pond) habitat.

  7. Experimental exposure of adult San Marcos salamanders and larval leopard frogs to the cercariae of Centrocestus formosanus.

    Science.gov (United States)

    Huston, D C; Cantu, V; Huffman, D G

    2014-04-01

    The gill parasite Centrocestus formosanus (Trematoda: Heterophyidae) is an exotic parasite of concern in Texas because it has been shown to infect multiple threatened and endangered fish species. The purpose of this study was to determine if C. formosanus could present a threat to larval anurans, as well as threatened neotenic salamanders endemic to the spring-fed systems of Texas. We exposed adults of the San Marcos salamander Eurycea nana (Caudata: Plethodontidae) and tadpoles of the Rio Grande leopard frog Lithobates berlandieri (Anura: Ranidae) to the cercariae of C. formosanus . The San Marcos salamander showed no signs of metacercarial infection, suggesting that E. nana may be refractory to C. formosanus cercariae. Centrocestus formosanus readily infects the gills of leopard frog tadpoles, but the metacercariae apparently died prior to reaching maturity in our tadpoles.

  8. The Analysis of Mary Barton from the Perspective of Spiritual Ecology

    Institute of Scientific and Technical Information of China (English)

    QI Hong-yan

    2016-01-01

    Mary Barton is Elizabeth Gaskell’s first novel, published in 1848, depicted the fierce conflict between working class and capitalist. This novel reveals the fact that with the development of capitalism, capitalist hold the money worship of consum-er cultural perspective, social spiritual slump and self lost. People enter the wasteland of spiritual life, result the imbalanced of mental spiritual. According to describing the disasters of industrial capitalism to human spiritual ecology that draws attention to imbalanced psychology ecology. And advocate to rethinking life significance.

  9. Conservation assessment for the Siskiyou Mountains salamander and Scott Bar salamander in northern California.

    Energy Technology Data Exchange (ETDEWEB)

    Vinikour, W. S.; LaGory, K. E.; Adduci, J. J.; Environmental Science Division

    2006-10-20

    The purpose of this conservation assessment is to summarize existing knowledge regarding the biology and ecology of the Siskiyou Mountains salamander and Scott Bar salamander, identify threats to the two species, and identify conservation considerations to aid federal management for persistence of the species. The conservation assessment will serve as the basis for a conservation strategy for the species.

  10. Identification of Euryhelmis costaricensis metacercariae in the skin of Tohoku hynobiid salamanders (Hynobius lichenatus), northeastern Honshu, Japan.

    Science.gov (United States)

    Sato, Hiroshi; Ihara, Sadao; Inaba, Osamu; Une, Yumi

    2010-07-01

    Since 2000, cutaneous nodular lesions were observed in Tohoku hynobiid salamanders (Hynobius lichenatus) in the northern Abukuma Mountains, northeastern Honshu, Japan. The distribution of diseased salamanders has expanded, along with the increasing severity of the disease. Samples (foreleg, hindleg, and tail) from five diseased salamanders caught in the spring of 2009 contained 11 to 383 metacercarial cysts (0.43-0.48 mm in diameter) per individual. Experimental inoculations of the metacercariae into rats (Rattus norvegicus) resulted in the development of pentagonal adults with intrauterine eggs that were collected at 3 days, 2 wk, and 5 wk postinoculation. Although adults obtained from rats were smaller, the flukes were morphologically similar to Euryhelmis costaricensis, recorded from Japanese martens (Martes melampus) in northeastern Honshu. The ribosomal RNA gene sequences of the metacercariae collected from salamanders and the E. costaricensis collected from a Japanese marten were identical, confirming the morphology-based species identification. Environmental changes responsible for the increased frequency of diseased salamanders and the increased parasite load are unknown, although increases in feral populations of introduced raccoons (Procyon lotor) and American minks (Neovison vison) may be associated.

  11. ARE SALAMANDERS USEFUL INDICATORS OF HYDROLOGIC PERMANENCE IN HEADWATER STREAMS?

    Science.gov (United States)

    Regulatory agencies need appropriate indicators of stream permanence to aid in jurisdictional determinations for headwater streams. We evaluated salamanders as permanence indicators because they are often abundant in fishless headwaters. Salamander and habitat data were collect...

  12. Predator-prey relationships among larval dragonflies, salamanders, and frogs.

    Science.gov (United States)

    Caldwell, J P; Thorp, J H; Jervey, T O

    1980-09-01

    Tadpoles of the barking tree frog, Hyla gratiosa, are abundant in spring and summer in some ponds and Carolina bays on the Savannah River Plant near Aiken, South Carolina. To determine how these tadpoles survive in the presence of predaceous salamander larvae, Ambystoma talpoideum, and larvae of an aeshnid dragonfly, Anax junius, we determined fields densities and sizes of the predators and the prey and conducted predation experiments in the laboratory. Tadpoles rapidly grow to a size not captured by Ambystoma, although Anax larvae can capture slightly larger tadpoles. Differing habitat preferences among the tadpoles and the two predator species probably aid in reducing predation pressure. Preliminary work indicates that the tadpoles may have an immobility response to an attack by a predator. In addition, the smallest, most vulnerable tadpoles have a distinctive color pattern which may function to disrupt the body outline and make them indiscernable to predators.

  13. LTR retrotransposons contribute to genomic gigantism in plethodontid salamanders.

    Science.gov (United States)

    Sun, Cheng; Shepard, Donald B; Chong, Rebecca A; López Arriaza, José; Hall, Kathryn; Castoe, Todd A; Feschotte, Cédric; Pollock, David D; Mueller, Rachel Lockridge

    2012-01-01

    Among vertebrates, most of the largest genomes are found within the salamanders, a clade of amphibians that includes 613 species. Salamander genome sizes range from ~14 to ~120 Gb. Because genome size is correlated with nucleus and cell sizes, as well as other traits, morphological evolution in salamanders has been profoundly affected by genomic gigantism. However, the molecular mechanisms driving genomic expansion in this clade remain largely unknown. Here, we present the first comparative analysis of transposable element (TE) content in salamanders. Using high-throughput sequencing, we generated genomic shotgun data for six species from the Plethodontidae, the largest family of salamanders. We then developed a pipeline to mine TE sequences from shotgun data in taxa with limited genomic resources, such as salamanders. Our summaries of overall TE abundance and diversity for each species demonstrate that TEs make up a substantial portion of salamander genomes, and that all of the major known types of TEs are represented in salamanders. The most abundant TE superfamilies found in the genomes of our six focal species are similar, despite substantial variation in genome size. However, our results demonstrate a major difference between salamanders and other vertebrates: salamander genomes contain much larger amounts of long terminal repeat (LTR) retrotransposons, primarily Ty3/gypsy elements. Thus, the extreme increase in genome size that occurred in salamanders was likely accompanied by a shift in TE landscape. These results suggest that increased proliferation of LTR retrotransposons was a major molecular mechanism contributing to genomic expansion in salamanders.

  14. Invasive Asian Earthworms Negatively Impact Keystone Terrestrial Salamanders.

    Science.gov (United States)

    Ziemba, Julie L; Hickerson, Cari-Ann M; Anthony, Carl D

    2016-01-01

    Asian pheretimoid earthworms (e.g. Amynthas and Metaphire spp.) are invading North American forests and consuming the vital detrital layer that forest floor biota [including the keystone species Plethodon cinereus (Eastern Red-backed Salamander)], rely on for protection, food, and habitat. Plethodon cinereus population declines have been associated with leaf litter loss following the invasion of several exotic earthworm species, but there have been few studies on the specific interactions between pheretimoid earthworms and P. cinereus. Since some species of large and active pheretimoids spatially overlap with salamanders beneath natural cover objects and in detritus, they may distinctively compound the negative consequences of earthworm-mediated resource degradation by physically disturbing important salamander activities (foraging, mating, and egg brooding). We predicted that earthworms would exclude salamanders from high quality microhabitat, reduce foraging efficiency, and negatively affect salamander fitness. In laboratory trials, salamanders used lower quality microhabitat and consumed fewer flies in the presence of earthworms. In a natural field experiment, conducted on salamander populations from "non-invaded" and "pheretimoid invaded" sites in Ohio, salamanders and earthworms shared cover objects ~60% less than expected. Earthworm abundance was negatively associated with juvenile and male salamander abundance, but had no relationship with female salamander abundance. There was no effect of pheretimoid invasion on salamander body condition. Juvenile and non-resident male salamanders do not hold stable territories centered beneath cover objects such as rocks or logs, which results in reduced access to prey, greater risk of desiccation, and dispersal pressure. Habitat degradation and physical exclusion of salamanders from cover objects may hinder juvenile and male salamander performance, ultimately reducing recruitment and salamander abundance following Asian

  15. Invasive Asian Earthworms Negatively Impact Keystone Terrestrial Salamanders.

    Directory of Open Access Journals (Sweden)

    Julie L Ziemba

    Full Text Available Asian pheretimoid earthworms (e.g. Amynthas and Metaphire spp. are invading North American forests and consuming the vital detrital layer that forest floor biota [including the keystone species Plethodon cinereus (Eastern Red-backed Salamander], rely on for protection, food, and habitat. Plethodon cinereus population declines have been associated with leaf litter loss following the invasion of several exotic earthworm species, but there have been few studies on the specific interactions between pheretimoid earthworms and P. cinereus. Since some species of large and active pheretimoids spatially overlap with salamanders beneath natural cover objects and in detritus, they may distinctively compound the negative consequences of earthworm-mediated resource degradation by physically disturbing important salamander activities (foraging, mating, and egg brooding. We predicted that earthworms would exclude salamanders from high quality microhabitat, reduce foraging efficiency, and negatively affect salamander fitness. In laboratory trials, salamanders used lower quality microhabitat and consumed fewer flies in the presence of earthworms. In a natural field experiment, conducted on salamander populations from "non-invaded" and "pheretimoid invaded" sites in Ohio, salamanders and earthworms shared cover objects ~60% less than expected. Earthworm abundance was negatively associated with juvenile and male salamander abundance, but had no relationship with female salamander abundance. There was no effect of pheretimoid invasion on salamander body condition. Juvenile and non-resident male salamanders do not hold stable territories centered beneath cover objects such as rocks or logs, which results in reduced access to prey, greater risk of desiccation, and dispersal pressure. Habitat degradation and physical exclusion of salamanders from cover objects may hinder juvenile and male salamander performance, ultimately reducing recruitment and salamander abundance

  16. Salamander occupancy in headwater stream networks

    Science.gov (United States)

    Grant, E.H.C.; Green, L.E.; Lowe, W.H.

    2009-01-01

    1. Stream ecosystems exhibit a highly consistent dendritic geometry in which linear habitat units intersect to create a hierarchical network of connected branches. 2. Ecological and life history traits of species living in streams, such as the potential for overland movement, may interact with this architecture to shape patterns of occupancy and response to disturbance. Specifically, large-scale habitat alteration that fragments stream networks and reduces connectivity may reduce the probability a stream is occupied by sensitive species, such as stream salamanders. 3. We collected habitat occupancy data on four species of stream salamanders in first-order (i.e. headwater) streams in undeveloped and urbanised regions of the eastern U.S.A. We then used an information-theoretic approach to test alternative models of salamander occupancy based on a priori predictions of the effects of network configuration, region and salamander life history. 4. Across all four species, we found that streams connected to other first-order streams had higher occupancy than those flowing directly into larger streams and rivers. For three of the four species, occupancy was lower in the urbanised region than in the undeveloped region. 5. These results demonstrate that the spatial configuration of stream networks within protected areas affects the occurrences of stream salamander species. We strongly encourage preservation of network connections between first-order streams in conservation planning and management decisions that may affect stream species.

  17. Data congruence, paedomorphosis and salamanders

    Directory of Open Access Journals (Sweden)

    Struck Torsten H

    2007-10-01

    Full Text Available Abstract Background The retention of ancestral juvenile characters by adult stages of descendants is called paedomorphosis. However, this process can mislead phylogenetic analyses based on morphological data, even in combination with molecular data, because the assessment if a character is primary absent or secondary lost is difficult. Thus, the detection of incongruence between morphological and molecular data is necessary to investigate the reliability of simultaneous analyses. Different methods have been proposed to detect data congruence or incongruence. Five of them (PABA, PBS, NDI, LILD, DRI are used herein to assess incongruence between morphological and molecular data in a case study addressing salamander phylogeny, which comprises several supposedly paedomorphic taxa. Therefore, previously published data sets were compiled herein. Furthermore, two strategies ameliorating effects of paedomorphosis on phylogenetic studies were tested herein using a statistical rigor. Additionally, efficiency of the different methods to assess incongruence was analyzed using this empirical data set. Finally, a test statistic is presented for all these methods except DRI. Results The addition of morphological data to molecular data results in both different positions of three of the four paedomorphic taxa and strong incongruence, but treating the morphological data using different strategies ameliorating the negative impact of paedomorphosis revokes these changes and minimizes the conflict. Of these strategies the strategy to just exclude paedomorphic character traits seem to be most beneficial. Of the three molecular partitions analyzed herein the RAG1 partition seems to be the most suitable to resolve deep salamander phylogeny. The rRNA and mtDNA partition are either too conserved or too variable, respectively. Of the different methods to detect incongruence, the NDI and PABA approaches are more conservative in the indication of incongruence than LILD and

  18. The first salamander defensin antimicrobial peptide.

    Directory of Open Access Journals (Sweden)

    Ping Meng

    Full Text Available Antimicrobial peptides have been widely identified from amphibian skins except salamanders. A novel antimicrobial peptide (CFBD was isolated and characterized from skin secretions of the salamander, Cynops fudingensis. The cDNA encoding CFBD precursor was cloned from the skin cDNA library of C. fudingensis. The precursor was composed of three domains: signal peptide of 17 residues, mature peptide of 41 residues and intervening propeptide of 3 residues. There are six cysteines in the sequence of mature CFBD peptide, which possibly form three disulfide-bridges. CFBD showed antimicrobial activities against Staphylococcus aureus, Bacillus subtilis, Candida albicans and Escherichia coli. This peptide could be classified into family of β-defensin based on its sequence similarity with β-defensins from other vertebrates. Evolution analysis indicated that CFBD was close to fish β-defensin. As far as we know, CFBD is the first β-defensin antimicrobial peptide from salamanders.

  19. Evolution of gigantism in amphiumid salamanders.

    Science.gov (United States)

    Bonett, Ronald M; Chippindale, Paul T; Moler, Paul E; Van Devender, R Wayne; Wake, David B

    2009-05-20

    The Amphiumidae contains three species of elongate, permanently aquatic salamanders with four diminutive limbs that append one, two, or three toes. Two of the species, Amphiuma means and A. tridactylum, are among the largest salamanders in the world, reaching lengths of more than one meter, whereas the third species (A. pholeter), extinct amphiumids, and closely related salamander families are relatively small. Amphiuma means and A. tridactylum are widespread species and live in a wide range of lowland aquatic habitats on the Coastal Plain of the southeastern United States, whereas A. pholeter is restricted to very specialized organic muck habitats and is syntopic with A. means. Here we present analyses of sequences of mitochondrial and nuclear loci from across the distribution of the three taxa to assess lineage diversity, relationships, and relative timing of divergence in amphiumid salamanders. In addition we analyze the evolution of gigantism in the clade. Our analyses indicate three lineages that have diverged since the late Miocene, that correspond to the three currently recognized species, but the two gigantic species are not each other's closest relatives. Given that the most closely related salamander families and fossil amphiumids from the Upper Cretaceous and Paleocene are relatively small, our results suggest at least two extreme changes in body size within the Amphuimidae. Gigantic body size either evolved once as the ancestral condition of modern amphiumas, with a subsequent strong size reduction in A. pholeter, or gigantism independently evolved twice in the modern species, A. means and A. tridactylum. These patterns are concordant with differences in habitat breadth and range size among lineages, and have implications for reproductive isolation and diversification of amphiumid salamanders.

  20. Evolution of gigantism in amphiumid salamanders.

    Directory of Open Access Journals (Sweden)

    Ronald M Bonett

    Full Text Available The Amphiumidae contains three species of elongate, permanently aquatic salamanders with four diminutive limbs that append one, two, or three toes. Two of the species, Amphiuma means and A. tridactylum, are among the largest salamanders in the world, reaching lengths of more than one meter, whereas the third species (A. pholeter, extinct amphiumids, and closely related salamander families are relatively small. Amphiuma means and A. tridactylum are widespread species and live in a wide range of lowland aquatic habitats on the Coastal Plain of the southeastern United States, whereas A. pholeter is restricted to very specialized organic muck habitats and is syntopic with A. means. Here we present analyses of sequences of mitochondrial and nuclear loci from across the distribution of the three taxa to assess lineage diversity, relationships, and relative timing of divergence in amphiumid salamanders. In addition we analyze the evolution of gigantism in the clade. Our analyses indicate three lineages that have diverged since the late Miocene, that correspond to the three currently recognized species, but the two gigantic species are not each other's closest relatives. Given that the most closely related salamander families and fossil amphiumids from the Upper Cretaceous and Paleocene are relatively small, our results suggest at least two extreme changes in body size within the Amphuimidae. Gigantic body size either evolved once as the ancestral condition of modern amphiumas, with a subsequent strong size reduction in A. pholeter, or gigantism independently evolved twice in the modern species, A. means and A. tridactylum. These patterns are concordant with differences in habitat breadth and range size among lineages, and have implications for reproductive isolation and diversification of amphiumid salamanders.

  1. Experimental infection of native north Carolina salamanders with Batrachochytrium dendrobatidis.

    Science.gov (United States)

    Chinnadurai, Sathya K; Cooper, David; Dombrowski, Daniel S; Poore, Matthew F; Levy, Michael G

    2009-07-01

    Chytridiomycosis is an often fatal fungal disease of amphibians caused by Batrachochytrium dendrobatidis. This disease has been implicated in the worldwide decline of many anuran species, but studies of chytridiomycosis in wild salamanders are limited. Between August 2006 and December 2006, we tested wild amphibians in North Carolina, USA (n=212) by polymerase chain reaction (PCR). We identified three PCR-positive animals: one Rana clamitans and two Plethodontid salamanders. We experimentally infected two species of native North Carolina Plethodontid salamanders, the slimy salamander (Plethodon glutinosus) and the Blue Ridge Mountain dusky salamander (Desmognathus orestes) with 1,000,000 zoospores of B. dendrobatidis per animal. Susceptibility was species dependent; all slimy salamanders developed clinical signs of chytridiomycosis, and one died, whereas dusky salamanders remained unaffected. In a second experiment, we challenged naïve slimy salamanders with either 10,000 or 100,000 motile zoospores per animal. Clinical signs consistent with chytridiomycosis were not observed at either dose or in uninfected controls during the 45 days of this experiment. All animals inoculated with B. dendrobatidis in both experiments, regardless of dose, tested positive by PCR. Our study indicates that slimy salamanders are more susceptible to clinical chytridiomycosis than dusky salamanders, and in a laboratory setting, a dose greater than 100,000 zoospores per animal is required to induce clinical disease. This study also indicates that PCR is a very sensitive tool for detecting B. dendrobatidis infection, even in animals that are clinically unaffected, thus positive results should be interpreted with caution.

  2. Environmental factors determining growth of salamander larvae:A field study

    Institute of Scientific and Technical Information of China (English)

    Laura LIMONGI; Gentile Francesco FICETOLA; Giuseppe ROMEO; Raoul MANENTI

    2015-01-01

    Larval growth and survival of organisms are strongly influenced by abiotic and biotic factors, as demonstrated by ex-perimental studies performed under controlled laboratory or semi-natural conditions. Even if they have many advantages, ex-periments cannot cover the full complexity of natural conditions and field studies are needed for a better understanding of how environmental variation determines growth and development rate. Fire salamanderSalamandra salamandrafemales give birth to larvae in a variety of habitats, both epigean and subterranean. In caves, salamander larvae successfully grow and metamorphose, but their growth is more than three times longer than in epigean streams and factors determining these differences require inves-tigation. We performed a field study to understand the factors related to the growth of fire salamander larvae in different envi-ronmental conditions, evaluating the relationship between environmental features and larval growth and differences between caves and epigean spring habitats. Both caves and epigean larvae successfully grew. Capture-mark-recapture allowed to individu-ally track individuals along their whole development, and measure their performance. Growth rate was significantly affected by environmental variables: larvae grew faster in environments with abundant invertebrates and few conspecifics. Taking into ac-count the effect of environmental variables, larval growth was significantly lower in caves. Food availability plays a different ef-fect in the two environments. Larval growth was positively related to the availability of invertebrates in epigean sites only. The development rate of hypogeous populations of salamanders is slower because of multiple parameters, but biotic factors play a much stronger role than the abiotic ones [Current Zoology 61 (3): 421–427, 2015].

  3. Homing orientation in salamanders: A mechanism involving chemical cues

    Science.gov (United States)

    Madison, D. M.

    1972-01-01

    A detailed description is given of experiments made to determine the senses and chemical cues used by salamanders for homing orientation. Sensory impairment and cue manipulative techniques were used in the investigation. All experiments were carried out at night. Results show that sense impaired animals did not home as readily as those who were blind but retained their sensory mechanism. This fact suggests that the olfactory mechanism is necessary for homing in the salamander. It was determined that after the impaired salamander regenerated its sensory mechanism it too returned home. It was concluded that homing ability in salamanders is direction independent, distant dependent, and vision independent.

  4. Lethal effects of water quality on threatened California salamanders but not on co-occurring hybrid salamanders.

    Science.gov (United States)

    Ryan, Maureen E; Johnson, Jarrett R; Fitzpatrick, Benjamin M; Lowenstine, Linda J; Picco, Angela M; Shaffer, H Bradley

    2013-02-01

    Biological invasions and habitat alteration are often detrimental to native species, but their interactions are difficult to predict. Interbreeding between native and introduced species generates novel genotypes and phenotypes, and human land use alters habitat structure and chemistry. Both invasions and habitat alteration create new biological challenges and opportunities. In the intensively farmed Salinas Valley, California (U.S.A.), threatened California tiger salamanders (Ambystoma californiense) have been replaced by hybrids between California tiger salamander and introduced barred tiger salamanders (Ambystoma tigrinum mavortium). We conducted an enclosure experiment to examine the effects habitat modification and relative frequency of hybrid and native California tiger salamanders have on recruitment of salamanders and their prey, Pacific chorus frogs (Pseudacris regilla). We tested whether recruitment differed among genetic classes of tiger salamanders (hybrid or native) and pond hydroperiod (seasonal or perennial). Roughly 6 weeks into the experiment, 70% (of 378 total) of salamander larvae died in 4 out of 6 ponds. Native salamanders survived (n = 12) in these ponds only if they had metamorphosed prior to the die-offs. During die-offs, all larvae of native salamanders died, whereas 56% of hybrid larvae died. We necropsied native and hybrid salamanders, tested water quality, and queried the California Department of Pesticide Regulation database to investigate possible causes of the die-offs. Salamander die-offs, changes in the abundance of other community members (invertebrates, algae, and cyanobacteria), shifts in salamander sex ratio, and patterns of pesticide application in adjacent fields suggest that pesticide use may have contributed to die-offs. That all survivors were hybrids suggests that environmental stress may promote rapid displacement of native genotypes.

  5. Skeletal muscle dedifferentiation during salamander limb regeneration.

    Science.gov (United States)

    Wang, Heng; Simon, András

    2016-10-01

    Salamanders can regenerate entire limbs throughout their life. A critical step during limb regeneration is formation of a blastema, which gives rise to the new extremity. Salamander limb regeneration has historically been tightly linked to the term dedifferentiation, however, with refined research tools it is important to revisit the definition of dedifferentiation in the context. To what extent do differentiated cells revert their differentiated phenotypes? To what extent do progeny from differentiated cells cross lineage boundaries during regeneration? How do cell cycle plasticity and lineage plasticity relate to each other? What is the relationship between dedifferentiation of specialized cells and activation of tissue resident stem cells in terms of their contribution to the new limb? Here we highlight these problems through the case of skeletal muscle.

  6. Reproductive biology of Ambystoma salamanders in the southeastern United States

    Science.gov (United States)

    Glorioso, Brad M.; Waddle, J. Hardin; Hefner, Jeromi M.

    2015-01-01

    Reproductive aspects of Ambystoma salamanders were investigated at sites in Louisiana (2010–12) and Mississippi (2013). Three species occurred at the Louisiana site, Spotted Salamander (A. maculatum), Marbled Salamander (A. opacum), and Mole Salamander (A. talpoideum), whereas only Spotted Salamanders were studied at the Mississippi site. A total of 162 and 71 egg masses of Spotted Salamanders were examined at the Louisiana and Mississippi sites, respectively. Significantly more Spotted Salamander eggs per egg mass were observed at the Mississippi site (x̄ = 78.2) than the Louisiana site (x̄ = 53.8; P Salamanders at the Mississippi site (82.9 mm) was significantly larger than the Louisiana site (76.1 mm; P Salamander egg masses were not found at the Mississippi site, but accounted for 11% of examined egg masses at the Louisiana site. The mean number of eggs per egg mass at the Louisiana site did not differ between opaque (47.3) and clear (54.6) egg masses (P = 0.21). A total of 47 egg masses of the Mole Salamander were examined, with a mean number of 6.7 embryos per mass. Twenty-three individual nests of the Marbled Salamander were found either under or in decaying logs in the dry pond basins. There was no difference between the mean numbers of eggs per mass of attended nests (93.0) versus those that were discovered unattended (86.6; P = 0.67). Females tended to place their nests at intermediate heights within the pond basin.

  7. Bromeliad selection by two salamander species in a harsh environment.

    Directory of Open Access Journals (Sweden)

    Gustavo Ruano-Fajardo

    Full Text Available Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height, as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment.

  8. Spring Outing

    Institute of Scientific and Technical Information of China (English)

    孙芳

    2011-01-01

    It is springtime.The days are getting warmer and the flowers are in bloom.With the pleasantly warm sunshine,gentle breeze and fresh air,it is high time for spring outing and sightseeing.Are you still hesitating? Let’s see what benefits spring outing brings about and then pay attention to some matters while taking a trip out in spring. Benefits of spring outing Spring outing is especially popular with children and teenagers.But many adults also like to go on spring trips.The reason might be that spring outing can have several benefits.

  9. Spring in the Arab Spring

    NARCIS (Netherlands)

    Borg, G.J.A.

    2011-01-01

    Column Gert Borg | Spring in the Arab Spring door dr. Gert Borg, onderzoeker bij Islam en Arabisch aan de Radboud Universiteit Nijmegen en voormalig directeur van het Nederlands-Vlaams Instituut Caïro Spring If, in Google, you type "Arab Spring" and hit the button, you get more than 14 mill

  10. Northwestern salamanders Ambystoma gracile in mountain lakes: record oviposition depths among salamanders

    Science.gov (United States)

    Hoffman, R.; Pearl, C.A.; Larson, G.L.; Samora, B.

    2012-01-01

    Oviposition timing, behaviors, and microhabitats of ambystomatid salamanders vary considerably (Egan and Paton 2004; Figiel and Semlitsch 1995; Howard and Wallace 1985; Mac-Cracken 2007). Regardless of species, however, females typically oviposit using sites conducive to embryo development and survival. For example, the results of an experiment by Figiel and Semlitsch (1995) on Ambystoma opacum (Marbled Salamander) oviposition indicated that females actively selected sites that were under grass clumps in wet versus dry treatments, and surmised that environmental conditions such as humidity, moisture, and temperature contributed to their results. Other factors associated with ambystomatid oviposition and embryo survival include water temperature (Anderson 1972; Brown 1976), dissolved oxygen concentration (Petranka et al. 1982; Sacerdote and King 2009), oviposition depth (Dougherty et al. 2005; Egan and Paton 2004), and oviposition attachment structures such as woody vegetation (McCracken 2007; Nussbaum et al. 1983). Resetarits (1996), in creating a model of oviposition site selection for anuran amphibians, hypothesized that oviparous organisms were also capable of modifying oviposition behavior and site selection to accommodate varying habitat conditions and to minimize potential negative effects of environmental stressors. Kats and Sih (1992), investigating the oviposition of Ambystoma barbouri (Streamside Salamander) in pools of a Kentucky stream, found that females preferred pools without predatory Lepomis cyanellus (Green Sunfish), and that the number of egg masses present in a pool historically containing fish increased significantly the year after fish had been extirpated from the pool. Palen et al. (2005) determined that Ambystoma gracile (Northwestern Salamander) and Ambystoma macrodactylum (Longtoed Salamander) eggs were deposited either at increased depth or in full shaded habitats, respectively, as water transperancy to UV-B radiation increased.

  11. Ecological separation in a polymorphic terrestrial salamander.

    Science.gov (United States)

    Anthony, Carl D; Venesky, Matthew D; Hickerson, Cari-Ann M

    2008-07-01

    1. When studying speciation, researchers commonly examine reproductive isolation in recently diverged populations. Polymorphic species provide an opportunity to examine the role of reproductive isolation in populations that may be in the process of divergence. 2. We examined a polymorphic population of Plethodon cinereus (red-backed salamanders) for evidence of sympatric ecological separation by colour morphology. Recent studies have correlated temperature and climate with colour morphology in this species, but no studies have looked at differences in diet or mate choice between colour morphs. We used artificial cover objects to assess salamander diet, mating preference and surface activity over a 2-year period at a field site in north-eastern Ohio. 3. We detected differences in diet between two colour morphs, striped and unstriped. The diets of striped individuals were significantly more diverse and were made up of more profitable prey than the diets of unstriped salamanders. 4. Opposite sex pairs were made up of individuals of the same colour morph and striped males were found more often with larger females than were unstriped males. 5. We corroborate findings of earlier studies suggesting that the unstriped form is adapted to warmer conditions. Unstriped individuals were the first to withdraw from the forest floor as temperatures fell in the late fall. We found no evidence that the colour morphs responded differently to abiotic factors such as soil moisture and relative humidity, and responses to surface temperatures were also equivocal. 6. We conclude that the two colour morphs exhibit some degree of ecological separation and tend to mate assortatively, but are unlikely to be undergoing divergence given the observed frequency of intermorph pairings.

  12. Effects of red-backed salamanders on ecosystem functions.

    Science.gov (United States)

    Hocking, Daniel J; Babbitt, Kimberly J

    2014-01-01

    Ecosystems provide a vast array of services for human societies, but understanding how various organisms contribute to the functions that maintain these services remains an important ecological challenge. Predators can affect ecosystem functions through a combination of top-down trophic cascades and bottom-up effects on nutrient dynamics. As the most abundant vertebrate predator in many eastern US forests, woodland salamanders (Plethodon spp.) likely affect ecosystems functions. We examined the effects of red-backed salamanders (Plethodon cinereus) on a variety of forest ecosystem functions using a combined approach of large-scale salamander removals (314-m(2) plots) and small-scale enclosures (2 m(2)) where we explicitly manipulated salamander density (0, 0.5, 1, 2, 4 m(-2)). In these experiments, we measured the rates of litter and wood decomposition, potential nitrogen mineralization and nitrification rates, acorn germination, and foliar insect damage on red oak seedlings. Across both experimental venues, we found no significant effect of red-backed salamanders on any of the ecosystem functions. We also found no effect of salamanders on intraguild predator abundance (carabid beetles, centipedes, spiders). Our study adds to the already conflicting evidence on effects of red-backed salamander and other amphibians on terrestrial ecosystem functions. It appears likely that the impact of terrestrial amphibians on ecosystem functions is context dependent. Future research would benefit from explicitly examining terrestrial amphibian effects on ecosystem functions under a variety of environmental conditions and in different forest types.

  13. Effects of red-backed salamanders on ecosystem functions.

    Directory of Open Access Journals (Sweden)

    Daniel J Hocking

    Full Text Available Ecosystems provide a vast array of services for human societies, but understanding how various organisms contribute to the functions that maintain these services remains an important ecological challenge. Predators can affect ecosystem functions through a combination of top-down trophic cascades and bottom-up effects on nutrient dynamics. As the most abundant vertebrate predator in many eastern US forests, woodland salamanders (Plethodon spp. likely affect ecosystems functions. We examined the effects of red-backed salamanders (Plethodon cinereus on a variety of forest ecosystem functions using a combined approach of large-scale salamander removals (314-m(2 plots and small-scale enclosures (2 m(2 where we explicitly manipulated salamander density (0, 0.5, 1, 2, 4 m(-2. In these experiments, we measured the rates of litter and wood decomposition, potential nitrogen mineralization and nitrification rates, acorn germination, and foliar insect damage on red oak seedlings. Across both experimental venues, we found no significant effect of red-backed salamanders on any of the ecosystem functions. We also found no effect of salamanders on intraguild predator abundance (carabid beetles, centipedes, spiders. Our study adds to the already conflicting evidence on effects of red-backed salamander and other amphibians on terrestrial ecosystem functions. It appears likely that the impact of terrestrial amphibians on ecosystem functions is context dependent. Future research would benefit from explicitly examining terrestrial amphibian effects on ecosystem functions under a variety of environmental conditions and in different forest types.

  14. Effects of urbanization on occupancy of stream salamanders.

    Science.gov (United States)

    Price, Steven J; Cecala, Kristen K; Browne, Robert A; Dorcas, Michael E

    2011-06-01

    Urban development is the most common form of land conversion in the United States. Using a before-after control-impact study design, we investigated the effects of urbanization on larval and adult stages of southern two-lined salamanders (Eurycea cirrigera) and northern dusky salamanders (Desmognathus fuscus). Over 5 years, we estimated changes in occupancy and probabilities of colonization and survival in 13 stream catchments after urbanization and in 17 catchments that were not urbanized. We also examined effects of proportion of urbanized area in a catchment and distance of the salamander population to the nearest stream on probabilities of colonization and survival. Before urbanization, adult and larval stages of the two salamander species occupied nearly all surveyed streams, with occupancy estimates ranging from 1.0 to 0.78. Four years after urbanization mean occupancy of larval and adult two-lined salamanders had decreased from 0.87 and 0.78 to 0.57 and 0.39, respectively. Estimates of mean occupancy of larval northern dusky salamanders decreased from 1.0 to 0.57 in urban streams 4 years after urbanization; however, adult northern dusky salamander occupancy remained close to 1.0 in urban streams over 5 years. Occupancy estimates in control streams were similar for each species and stage over 5 years. Urbanization was associated with decreases in survival probabilities of adult and larval two-lined salamanders and decreases in colonization probabilities of larval dusky salamanders. Nevertheless, proportion of impervious surface and distance to nearest stream had little effect on probabilities of survival and colonization. Our results imply that in the evaluation of the effects of urbanization on species, such as amphibians, with complex life cycles, consideration of the effects of urbanization on both adult and larval stages is required.

  15. Better than fish on land? Hearing across metamorphosis in salamanders

    DEFF Research Database (Denmark)

    Christensen, Christian Bech; Lauridsen, Henrik; Christensen-Dalsgaard, Jakob

    2015-01-01

    hearing in early tetrapods. Here, we combine imaging techniques with neurophysiological measurements to resolve how the change from aquatic larvae to terrestrial adult affects the ear morphology and sensory capabilities of salamanders. We show that air-induced pressure detection enhances underwater...... hearing sensitivity of salamanders at frequencies above 120 Hz, and that both terrestrial adults and fully aquatic juvenile salamanders can detect airborne sound. Collectively, these findings suggest that early atympanic tetrapods may have been pre-equipped to aerial hearing and are able to hear airborne...

  16. Locomotion and visually guided behavior in salamander: a neuromechanical study

    Science.gov (United States)

    Ijspeert, Auke J.; Arbib, Michael A.

    2000-10-01

    This article investigates the neural mechanisms underlying locomotion and visually-guided behavior in a lower vertebrate: the salamander. We develop connectionist models of the salamander's locomotor circuitry and visual system, and analyze their functioning by embedding them into a biomechanical simulation of the salamander's body. This work is therefore an experiment in computational neuroethology which aims at investigating how behavior results from the coupling of a central nervous system (CNS) and a body, and from the interactions of the CNS-body pair with the environment. We believe that understanding these mechanisms is not only relevant for neurobiology but also for potential applications in robotics.

  17. Generation of aneurogenic larvae by parabiosis of salamander embryos.

    Science.gov (United States)

    Kumar, Anoop; Delgado, Jean Paul

    2015-01-01

    Limb regeneration of salamanders is nerve dependent, and the removal of the nerves in early stages of limb regeneration severely curtails the proliferation of the blastemal cells and growth of the regenerate. The removal of the neural tube from a developing salamander embryo results in an aneurogenic larva and the aneurogenic limb (ANL) develops independently without innervation. Paradoxically, the limb in an ANL is capable of regeneration in a nerve-independent manner. Here, we describe a detailed method for the generation of ANL in the spotted salamander, Ambystoma maculatum, for regeneration studies.

  18. Sexual dimorphism and age of Mediterranean salamanders.

    Science.gov (United States)

    Reinhard, Sandy; Renner, Sandra; Kupfer, Alexander

    2015-02-01

    We analysed sexual size dimorphism (SSD) for two Mediterranean species of the "true" salamander clade possessing distinct life histories (Salamandra algira and Mertensiella caucasica) and equilibrated the morphometric approach to individual age by using skeletochronology. For species that have a short breeding season and live at high altitudes, such as Mediterranean amphibians, the fecundity advantage hypothesis predicts female-biased SSD to maximise reproductive success. Our results showed no SSD in either species; however, morphometric data indicated a male-biased dimorphism in limb (arm and leg) dimensions in both species when compared to body size. Limb dimorphisms are likely related to the particular mating system, which involves an amplexus during spermatophore transfer. Arm length appeared sexually dimorphic during ontogeny both in viviparous S. algira and oviparous M. caucasica. A review on SSD indicated monomorphy of body size as a common lineage-specific pattern among the "true" salamander clade, but also the common presence of other traits such as sexually dimorphic limb proportions.

  19. Streamside Salamander Inventory and Monitoring Northeast Refuges Summer 2001

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objectives of this project are to (1) conduct transect and quadrat sampling for streamside salamanders, (2) determine detection rates and population estimates...

  20. Streamside Salamander Inventory and Monitoring Northeast Refuges Summer 2003

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objectives of this project are to (1) conduct transect and quadrat sampling for streamside salamanders, (2) determine detection rates and population estimates...

  1. Streamside Salamander Inventory and Monitoring Northeast Refuges Summer 2002

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objectives of this project are to (1) conduct transect and quadrat sampling for streamside salamanders, (2) determine detection rates and population estimates...

  2. Final Critical Habitat for Reticulated Flatwoods Salamander (Ambystoma bishopi)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These data identify, in general, the areas of final critical habitat for the endangered Ambystoma bishopi (reticulated flatwoods salamander).

  3. Streamside Salamander Inventory and Monitoring Northeast Refuges Summer 2004

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objectives of this project are to (1) conduct transect and quadrat sampling for streamside salamanders, (2) determine detection rates and population estimates...

  4. Final Critical Habitat for the San Marcos salamander (Eurycea nana)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — To provide the user with a general idea of areas where final critical habitat for San Marcos salamander (Eurycea nana) occur based on the description provided in the...

  5. Maintaining plethodontid salamanders in the laboratory for regeneration studies.

    Science.gov (United States)

    Arenas, Claudia Marcela; Gómez-Molina, Andrea; Delgado, Jean Paul

    2015-01-01

    Limb regeneration studies have been extensively carried out in species of Ambystomatidae and Salamandridae families. So far limited research has been conducted in species belonging to the Plethodontidae family, where some of the species differs from other salamander families due to their direct development, thus absence of a larval life. Here, we describe a protocol to maintain the plethodontid salamanders of genus Bolitoglossa species under laboratory conditions to perform regeneration studies.

  6. Terrestrial salamander abundance on reclaimed mountaintop removal mines

    Science.gov (United States)

    Wood, Petra Bohall; Williams, Jennifer M.

    2013-01-01

    Mountaintop removal mining, a large-scale disturbance affecting vegetation, soil structure, and topography, converts landscapes from mature forests to extensive grassland and shrubland habitats. We sampled salamanders using drift-fence arrays and coverboard transects on and near mountaintop removal mines in southern West Virginia, USA, during 2000–2002. We compared terrestrial salamander relative abundance and species richness of un-mined, intact forest with habitats on reclaimed mountaintop removal mines (reclaimed grassland, reclaimed shrubland, and fragmented forest). Salamanders within forests increased in relative abundance with increasing distance from reclaimed mine edge. Reclaimed grassland and shrubland habitats had lower relative abundance and species richness than forests. Characteristics of reclaimed habitats that likely contributed to lower salamander abundance included poor soils (dry, compacted, little organic matter, high rock content), reduced vertical structure of vegetation and little tree cover, and low litter and woody debris cover. Past research has shown that salamander populations reduced by clearcutting may rebound in 15–24 years. Time since disturbance was 7–28 years in reclaimed habitats on our study areas and salamander populations had not reached levels found in adjacent mature forests.

  7. Landmark learning by the Ozark zigzag salamander Plethodon angusticlavius

    Directory of Open Access Journals (Sweden)

    Adam L. CRANE, Alicia MATHIS

    2011-08-01

    Full Text Available Although salamanders have been shown to respond to classical conditioning, spatial learning has been largely unstudied. We tested whether salamanders could learn to locate foraging areas by using landmarks. We trained 10 salamanders Plethodon angusticlavius to use landmarks (small rocks to locate patches within the arena containing food (blackworms Lumbriculus variegatus. At the corners of each square testing arena were four plastic dishes, one containing blackworms and the other three empty. A rock was placed in front of the dish containing blackworms, and the location of the food-dish was randomly chosen for each training trial. A control group was also trained to feed on blackworms in the presence of a rock, but the rock was positioned randomly among the four dish locations so that the rock was not a reliable landmark for the worms. Although the length of the training period for individual salamanders varied (22–38 trainings per individual, the mean number of trainings for salamanders in the control and experimental groups was equal (30 training trials. During testing, no blackworms were present to eliminate any visual or chemical cues emanating directly from the prey. Individuals trained with the rock landmarks spent significantly more time in the area of the landmark than did control salamanders [Current Zoology 57 (4: 485–490, 2011].

  8. Spring Tire

    Science.gov (United States)

    Asnani, Vivake M.; Benzing, Jim; Kish, Jim C.

    2011-01-01

    The spring tire is made from helical springs, requires no air or rubber, and consumes nearly zero energy. The tire design provides greater traction in sandy and/or rocky soil, can operate in microgravity and under harsh conditions (vastly varying temperatures), and is non-pneumatic. Like any tire, the spring tire is approximately a toroidal-shaped object intended to be mounted on a transportation wheel. Its basic function is also similar to a traditional tire, in that the spring tire contours to the surface on which it is driven to facilitate traction, and to reduce the transmission of vibration to the vehicle. The essential difference between other tires and the spring tire is the use of helical springs to support and/or distribute load. They are coiled wires that deform elastically under load with little energy loss.

  9. Beginning Spring

    CERN Document Server

    Caliskan, Mert

    2015-01-01

    Get up to speed quickly with this comprehensive guide toSpring Beginning Spring is the complete beginner's guide toJava's most popular framework. Written with an eye towardreal-world enterprises, the book covers all aspects of applicationdevelopment within the Spring Framework. Extensive samples withineach chapter allow developers to get up to speed quickly byproviding concrete references for experimentation, building askillset that drives successful application development byexploiting the full capabilities of Java's latest advances. Spring provides the exact toolset required to build anent

  10. Just Spring

    CERN Document Server

    Konda, Madhusudhan

    2011-01-01

    Get a concise introduction to Spring, the increasingly popular open source framework for building lightweight enterprise applications on the Java platform. This example-driven book for Java developers delves into the framework's basic features, as well as advanced concepts such as containers. You'll learn how Spring makes Java Messaging Service easier to work with, and how its support for Hibernate helps you work with data persistence and retrieval. Throughout Just Spring, you'll get your hands deep into sample code, beginning with a problem that illustrates dependency injection, Spring's co

  11. Practice, theory and authority in a Middle English medical text: "Barton's Urines Which He Treated at Tilney".

    Science.gov (United States)

    Tavormina, M Teresa

    2009-01-01

    A medieval English text on the theory and practice of uroscopic analysis is found in British Library, Sloane MS 280, and Cambridge, St. John's College MS B.16. The treatise, the title of which is given in the fuller and earlier copy in Sloane 280 as "Barton's Urines Which He Treated at Tilney," offers an unusual mix of practical diagnostic methodology focused mainly on uroscopy, and a conceptual framework for that methodology which begins with humoral physiological theory but continues with digressions on astronomy, the calendar, Aristotelian psychology, reproductive anatomy and physiology, embryology and ensoulment. This paper discusses the possible authorship and dating of the original text, the author's intellectual interests and habits, his approach to his vernacular audience, and the relation of the treatise to the Latin authorities on which it draws, particularly but not exclusively Isaac Israeli and Giles of Corbeil.

  12. Spring Festival

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Spring Festival is the most important festival in China. It's to celebrate the lunar calendar's new year. In the evening before the Spring Festival, families get together and have a big meal. In many places people like to set off firecrackers. Dumplings are

  13. Hellbender genome sequences shed light on genomic expansion at the base of crown salamanders.

    Science.gov (United States)

    Sun, Cheng; Mueller, Rachel Lockridge

    2014-07-01

    Among animals, genome sizes range from 20 Mb to 130 Gb, with 380-fold variation across vertebrates. Most of the largest vertebrate genomes are found in salamanders, an amphibian clade of 660 species. Thus, salamanders are an important system for studying causes and consequences of genomic gigantism. Previously, we showed that plethodontid salamander genomes accumulate higher levels of long terminal repeat (LTR) retrotransposons than do other vertebrates, although the evolutionary origins of such sequences remained unexplored. We also showed that some salamanders in the family Plethodontidae have relatively slow rates of DNA loss through small insertions and deletions. Here, we present new data from Cryptobranchus alleganiensis, the hellbender. Cryptobranchus and Plethodontidae span the basal phylogenetic split within salamanders; thus, analyses incorporating these taxa can shed light on the genome of the ancestral crown salamander lineage, which underwent expansion. We show that high levels of LTR retrotransposons likely characterize all crown salamanders, suggesting that disproportionate expansion of this transposable element (TE) class contributed to genomic expansion. Phylogenetic and age distribution analyses of salamander LTR retrotransposons indicate that salamanders' high TE levels reflect persistence and diversification of ancestral TEs rather than horizontal transfer events. Finally, we show that relatively slow DNA loss rates through small indels likely characterize all crown salamanders, suggesting that a decreased DNA loss rate contributed to genomic expansion at the clade's base. Our identification of shared genomic features across phylogenetically distant salamanders is a first step toward identifying the evolutionary processes underlying accumulation and persistence of high levels of repetitive sequence in salamander genomes.

  14. 77 FR 36287 - Proposed Low-Effect Habitat Conservation Plan for the California Tiger Salamander, Calaveras...

    Science.gov (United States)

    2012-06-18

    ... Salamander, Calaveras County, CA AGENCY: Fish and Wildlife Service, Interior. ACTION: Notice of availability... salamander (tiger salamander). The applicant would implement a conservation program to minimize and mitigate... comment is in reference to the Low-Effect Habitat Conservation Plan for the California Tiger...

  15. Variation in salamanders: an essay on genomes, development, and evolution.

    Science.gov (United States)

    Brockes, Jeremy P

    2015-01-01

    Regeneration is studied in a few model species of salamanders, but the ten families of salamanders show considerable variation, and this has implications for our understanding of salamander biology. The most recent classification of the families identifies the cryptobranchoidea as the basal group which diverged in the early Jurassic. Variation in the sizes of genomes is particularly obvious, and reflects a major contribution from transposable elements which is already present in the basal group.Limb development has been a focus for evodevo studies, in part because of the variable property of pre-axial dominance which distinguishes salamanders from other tetrapods. This is thought to reflect the selective pressures that operate on a free-living aquatic larva, and might also be relevant for the evolution of limb regeneration. Recent fossil evidence suggests that both pre-axial dominance and limb regeneration were present 300 million years ago in larval temnospondyl amphibians that lived in mountain lakes. A satisfying account of regeneration in salamanders may need to address all these different aspects in the future.

  16. Embryonic development and organogenesis of Chinese giant salamander, Andrias davidianus

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The morphology and organogenesis of Chinese giant salamander, Andrias davidianus, in its different developmental periods and stages are described in detail, which provides an intact criterion for distinguishing different stages of its developmental process.Based on the external morphological and internal histological features, six periods including 20 stages of organogenesis of Chinese giant salamander are established, which are cleavage period, blastula period, gastrula period, neurula period, organogenesis stage and hatching stage. Generally, the embryonic development of Chinese giant salamander is consistent with those of Eastern newt, Cynops orientalis,and Black spots frog, R. nigromaculata. However, they have some differences in the early cleavage process and the development of digestive system. The cleavage of Chinese giant salamander, A. davidianus is not a discoidal division type, which is different from other species reported. And the first three cleavages being meridional and a retardant development of its digestive system without halter and sucker existing are the evident features of the embryonic development of Chinese giant salamander.

  17. A potential wound-healing-promoting peptide from salamander skin.

    Science.gov (United States)

    Mu, Lixian; Tang, Jing; Liu, Han; Shen, Chuanbin; Rong, Mingqiang; Zhang, Zhiye; Lai, Ren

    2014-09-01

    Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders.

  18. Hydrocarbon occurrences near Kyle Hot Springs, Buena Vista Valley, Pershing County, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    Ehni, W.J. [Ehni Enterprises Inc., Carson City, NV (United States); McCarthy, H. [Univ. of Nevada, Reno, NV (United States); Neumann, W.H. [Minnova Inc., Sparks, NV (United States)

    1995-06-01

    Buena Vista Valley is a small Tertiary Basin located in Northwestern Nevada. Oil was discovered in a mineral exploration hole drilled by Independence Mining Company Inc. (IMC) during October, 1993 near Kyle Hot Springs in Buena Vista Valley. The hole flowed unchecked for four and a half days, producing an estimated 500 barrels of oil with large volumes of hot water, before it was plugged and abandoned. In August of 1994 a continuous core hole was drilled by Barton/Evans to further evaluate the oil occurrences in the IMC hole. Two oil zones were found in the Barton/Evans hole, both of which have similar characteristics to the oil produced in the IMC hole. Pristane and phytane ratios (pr/ph) for oil samples from both holes are low (<0.1) which suggests that the source rock for this oil is from non marine lacustrine Tertiary sediments. There are no detectable hydrocarbons in the gas emanating from Kyle Hot Springs which indicates that the current day geothermal system is not in direct contact with any oil accumulations. Organic rich Triassic marine rocks which outcrop west of Buena Vista Valley, are over mature which supports the hypothesis that unexposed organic rich Tertiary rocks occurring in the deeper portions of the basin acted as the source for the oil occurrences in the IMC hole and in the Barton/Evans hole. In 1974, Standard Oil drilled an 11,000 foot well south of Buena Vista Valley in the Carson Sink and encountered organic rich Tertiary sediments at about 3500`. If this organic rich unit extends north into Buena Vista Valley, local geothermal anomalies might play an important role in the generation of oil. Earlier researches have reported that such anomalies do exist with temperature gradients approaching 100 C per kilometer west of Kyle Hot Springs in an area where gravity data suggest a relatively thick interval of Tertiary rocks have accumulated.

  19. Effects of mercury on behavior and performance of northern two-lined salamanders (Eurycea bislineata).

    Science.gov (United States)

    Burke, John N; Bergeron, Christine M; Todd, Brian D; Hopkins, William A

    2010-12-01

    Mercury (Hg) causes a range of deleterious effects in wildlife, but little is known about its effects on amphibians. Our objective was to determine whether Hg affects performance and behavior in two-lined salamanders (Eurycea bislineata). We collected salamanders from Hg-contaminated and reference sites and assessed speed, responsiveness, and prey capture ability. Mercury concentrations were >17× higher in salamanders from the contaminated sites and were among the highest documented in amphibians. In the first, but not in the second, locomotion trial, we found a significant effect of Hg on speed and responsiveness. In the prey capture experiment, reference salamanders ate approximately twice as many prey items as the contaminated salamanders. Together, our results suggest that sublethal Hg concentrations may negatively affect salamanders by reducing their ability to successfully execute tasks critical to survival. Future work is warranted to determine whether Hg has other sublethal effects on salamanders and whether other amphibians are similarly affected.

  20. Climate change and shrinking salamanders: alternative mechanisms for changes in plethodontid salamander body size.

    Science.gov (United States)

    Connette, Grant M; Crawford, John A; Peterman, William E

    2015-08-01

    An increasing number of studies have demonstrated relationships between climate trends and body size change of organisms. In many cases, climate might be expected to influence body size by altering thermoregulation, energetics or food availability. However, observed body size change can result from a variety of ecological processes (e.g. growth, selection, population dynamics) or imperfect observation of biological systems. We used two extensive datasets to evaluate alternative mechanisms for recently reported changes in the observed body size of plethodontid salamanders. We found that mean adult body size of salamanders can be highly sensitive to survey conditions, particularly rainfall. This systematic bias in the detection of larger or smaller individuals could result in a signature of body size change in relation to reported climate trends when it is simply observation error. We also identify considerable variability in body size distributions among years and find that individual growth rates can be strongly influenced by weather. Finally, our study demonstrates that measures of mean adult body size can be highly variable among surveys and that large sample sizes may be required to make reliable inferences. Identifying the effects of climate change is a critical area of research in ecology and conservation. Researchers should be aware that observed changes in certain organisms can result from multiple ecological processes or systematic bias due to nonrandom sampling of populations.

  1. Ecological implications of metabolic compensation at low temperatures in salamanders

    Directory of Open Access Journals (Sweden)

    Alessandro Catenazzi

    2016-05-01

    Full Text Available Global warming is influencing the biology of the world’s biota. Temperature increases are occurring at a faster pace than that experienced by organisms in their evolutionary histories, limiting the organisms’ response to new conditions. Mechanistic models that include physiological traits can help predict species’ responses to warming. Changes in metabolism at high temperatures are often examined; yet many species are behaviorally shielded from high temperatures. Salamanders generally favor cold temperatures and are one of few groups of metazoans to be most species-rich in temperate regions. I examined variation in body temperature, behavioral activity, and temperature dependence of resting heart rate, used as a proxy for standard metabolic rate, in fire salamanders (Salamandra salamandra. Over 26 years, I found that salamanders are behaviorally active at temperatures as low as 1 °C, and aestivate at temperatures above 16 °C. Infrared thermography indicates limited thermoregulation opportunities for these nocturnal amphibians. Temperature affects resting heart rate, causing metabolic depression above 11 °C, and metabolic compensation below 8 °C: heart rate at 3 °C is 224% the expected heart rate. Thus, salamanders operating at low temperatures during periods of peak behavioral activity are able to maintain a higher metabolic rate than the rate expected in absence of compensation. This compensatory mechanism has important ecological implications, because it increases estimated seasonal heart rates. Increased heart rate, and thus metabolism, will require higher caloric intake for field-active salamanders. Thus, it is important to consider a species performance breadth over the entire temperature range, and particularly low temperatures that are ecologically relevant for cold tolerant species such as salamanders.

  2. Chloride equilibrium potential in salamander cones

    Directory of Open Access Journals (Sweden)

    Bryson Eric J

    2004-12-01

    Full Text Available Abstract Background GABAergic inhibition and effects of intracellular chloride ions on calcium channel activity have been proposed to regulate neurotransmission from photoreceptors. To assess the impact of these and other chloride-dependent mechanisms on release from cones, the chloride equilibrium potential (ECl was determined in red-sensitive, large single cones from the tiger salamander retinal slice. Results Whole cell recordings were done using gramicidin perforated patch techniques to maintain endogenous Cl- levels. Membrane potentials were corrected for liquid junction potentials. Cone resting potentials were found to average -46 mV. To measure ECl, we applied long depolarizing steps to activate the calcium-activated chloride current (ICl(Ca and then determined the reversal potential for the current component that was inhibited by the Cl- channel blocker, niflumic acid. With this method, ECl was found to average -46 mV. In a complementary approach, we used a Cl-sensitive dye, MEQ, to measure the Cl- flux produced by depolarization with elevated concentrations of K+. The membrane potentials produced by the various high K+ solutions were measured in separate current clamp experiments. Consistent with electrophysiological experiments, MEQ fluorescence measurements indicated that ECl was below -36 mV. Conclusions The results of this study indicate that ECl is close to the dark resting potential. This will minimize the impact of chloride-dependent presynaptic mechanisms in cone terminals involving GABAa receptors, glutamate transporters and ICl(Ca.

  3. Modular functional organisation of the axial locomotor system in salamanders.

    Science.gov (United States)

    Cabelguen, Jean-Marie; Charrier, Vanessa; Mathou, Alexia

    2014-02-01

    Most investigations on tetrapod locomotion have been concerned with limb movements. However, there is compelling evidence that the axial musculoskeletal system contributes to important functions during locomotion. Adult salamanders offer a remarkable opportunity to examine these functions because these amphibians use axial undulations to propel themselves in both aquatic and terrestrial environments. In this article, we review the currently available biological data on axial functions during various locomotor modes in salamanders. We also present data showing the modular organisation of the neural networks that generate axial synergies during locomotion. The functional implication of this modular organisation is discussed.

  4. Life history differences influence the impacts of drought on two pond-breeding salamanders.

    Science.gov (United States)

    Anderson, Thomas L; Ousterhout, Brittany H; Peterman, William E; Drake, Dana L; Semlitsch, Raymond D

    2015-10-01

    Drought is a strong density-independent environmental filter that contributes to population regulation and other ecological processes. Not all species respond similarly to drought, and the overall impacts can vary depending on life histories. Such differences can necessitate management strategies that incorporate information on individual species to maximize conservation success. We report the effects of a short-term drought on occupancy and reproductive success of two pond-breeding salamanders that differ in breeding phenology (fall vs. spring breeder) across an active military base landscape in Missouri, USA: We surveyed ~200 ponds for the presence of eggs, larvae, and metamorphs from 2011 to 2013. This period coincided with before, during, and after a severe drought that occurred in 2012. The two species showed contrasting responses to drought, where high reproductive failure (34% of ponds) was observed for the spring breeder during a single drought year. Alternatively, the fall breeder only showed a cumulative 8% failure over two years. The number of breeding ponds available for use in the fall decreased during the drought due to pond drying and/or a lack of re-filling. Estimates of occupancy probability declined for the fall-breeding salamander between 2012 and 2013, whereas occupancy probability estimates of the spring breeder increased post-drought. The presence of fish, hydroperiod, the amount of forest cover surrounding ponds, and canopy cover were all found to affect estimates of occupancy probabilities of each species. Pond clustering (distance to nearest pond and the number of ponds within close proximity), hydroperiod, forest cover, and canopy cover influenced both estimates of colonization and extinction probabilities. Our results show life history variation can be important in determining the relative susceptibility of a species to drought conditions, and that sympatric species experiencing the same environmental conditions can respond differently

  5. Extremely high-power tongue projection in plethodontid salamanders

    NARCIS (Netherlands)

    Deban, S.M.; O'Reilly, J.C.; Dicke, U.; Leeuwen, van J.L.

    2007-01-01

    Many plethodontid salamanders project their tongues ballistically at high speed and for relatively great distances. Capturing evasive prey relies on the tongue reaching the target in minimum time, therefore it is expected that power production, or the rate of energy release, is maximized during tong

  6. Digit reduction, body size, and paedomorphosis in salamanders.

    Science.gov (United States)

    Wiens, John J; Hoverman, Jason T

    2008-01-01

    The loss of digits is a widespread evolutionary trend in tetrapods which occurs in nearly every major clade. Alberch and Gale showed that the order in which digits are evolutionarily lost in salamanders versus frogs corresponds to the order in which they develop in each group, providing a classic example of developmental constraint. However, what actually drives the loss of digits in salamanders has remained unclear. Alberch and Gale suggested that loss of digits might be associated with paedomorphosis or with reduced body size. We test these hypotheses by combining morphometric and phylogenetic information for 98 species of salamanders. We find that digit loss is associated with both paedomorphosis and reduction in body size. However, these trends are surprisingly contradictory, in that paedomorphosis is significantly associated with an increase in body size in salamanders. Thus, much of the extreme digit reduction is found in the smaller species within paedomorphic clades that have, on average, unusually large body size. Our results show that the consequences of changes in body size on morphology are highly context dependent. We also show (possibly for the first time) a significant association between paedomorphosis and increased body size, rather than the expected association with reduced body size.

  7. Slow DNA loss in the gigantic genomes of salamanders.

    Science.gov (United States)

    Sun, Cheng; López Arriaza, José R; Mueller, Rachel Lockridge

    2012-01-01

    Evolutionary changes in genome size result from the combined effects of mutation, natural selection, and genetic drift. Insertion and deletion mutations (indels) directly impact genome size by adding or removing sequences. Most species lose more DNA through small indels (i.e., ~1-30 bp) than they gain, which can result in genome reduction over time. Because this rate of DNA loss varies across species, small indel dynamics have been suggested to contribute to genome size evolution. Species with extremely large genomes provide interesting test cases for exploring the link between small indels and genome size; however, most large genomes remain relatively unexplored. Here, we examine rates of DNA loss in the tetrapods with the largest genomes-the salamanders. We used low-coverage genomic shotgun sequence data from four salamander species to examine patterns of insertion, deletion, and substitution in neutrally evolving non-long terminal repeat (LTR) retrotransposon sequences. For comparison, we estimated genome-wide DNA loss rates in non-LTR retrotransposon sequences from five other vertebrate genomes: Anolis carolinensis, Danio rerio, Gallus gallus, Homo sapiens, and Xenopus tropicalis. Our results show that salamanders have significantly lower rates of DNA loss than do other vertebrates. More specifically, salamanders experience lower numbers of deletions relative to insertions, and both deletions and insertions are skewed toward smaller sizes. On the basis of these patterns, we conclude that slow DNA loss contributes to genomic gigantism in salamanders. We also identify candidate molecular mechanisms underlying these differences and suggest that natural variation in indel dynamics provides a unique opportunity to study the basis of genome stability.

  8. Influence of drought on salamander occupancy of isolated wetlands on the southeastern Coastal Plain of the United States

    Science.gov (United States)

    Walls, Susan C.; Barichivich, William J.; Brown, Mary E.; Scott, David E.; Hossack, Blake R.

    2013-01-01

    In the southeastern U.S., changes in temperature and precipitation over the last three decades have been the most dramatic in winter and spring seasons. Continuation of these trends could negatively impact pond-breeding amphibians, especially those that rely on winter and spring rains to fill seasonal wetlands, trigger breeding, and ensure reproductive success. From 2009 to 2012, we monitored Spring and Fall presence of aquatic stages (larval and paedomorphic, gilled adult) of a winter-breeding amphibian (the mole salamander, Ambystoma talpoideum) and used multi-season models to estimate occupancy, local colonization and extinction. Seasonal estimates of occupancy, corrected for imperfect detection, declined from 22.3 % of ponds in Spring 2009 to 9.9 % in Fall 2012. Our best supported model suggested that changes in occupancy were driven by increased rates of extinction that corresponded with drought-related drying of ponds. Based on uncertainty in climate change projections for the Southeast, we present a conceptual model of predicted changes in wetland hydroperiods across a landscape with projected decreases and increases in future precipitation. Such precipitation changes could alter wetland hydroperiods, facilitate extinctions of species adapted to short, intermediate or long hydroperiod environments and, ultimately, modify the composition of amphibian communities within freshwater wetland ecosystems.

  9. Salamander Regeneration as a Model for Developing Novel Regenerative and Anticancer Therapies

    OpenAIRE

    Fior, Jonathan

    2014-01-01

    Among vertebrates, urodele amphibians are the only tetrapods with the ability to regenerate complex structures such as limbs, tail, and spinal cord throughout their lives. Furthermore, the salamander regeneration process has been shown to reverse tumorigenicity. Fibroblasts are essential for salamander regeneration, but the mechanisms underlying their role in the formation of a regeneration blastema remain unclear. Here, I review the role of fibroblasts in salamander limb regeneration and how...

  10. Impact of valley fills on streamside salamanders in southern West Virginia

    Science.gov (United States)

    Wood, Petra Bohall; Williams, Jennifer M.

    2013-01-01

    Valley fills associated with mountaintop-removal mining bury stream headwaters and affect water quality and ecological function of reaches below fills. We quantified relative abundance of streamside salamanders in southern West Virginia during 2002 in three streams below valley fills (VFS) and in three reference streams (RS). We surveyed 36 10- × 2-m stream transects, once in summer and fall, paired by order and structure. Of 2,343 salamanders captured, 66.7% were from RS. Total salamanders (adults plus larvae) were more abundant in RS than VFS for first-order and second-order reaches. Adult salamanders had greater abundance in first-order reaches of RS than VFS. Larval salamanders were more abundant in second-order reaches of RS than VFS. No stream width or mesohabitat variables differed between VFS and RS. Only two cover variables differed. Silt cover, greater in VFS than RS first-order reaches, is a likely contributor to reduced abundance of salamanders in VFS. Second-order RS had more boulder cover than second-order VFS, which may have contributed to the higher total and larval salamander abundance in RS. Water chemistry assessments of our VFS and RS reported elevated levels of metal and ion concentrations in VFS, which can depress macroinvertebrate populations and likely affect salamander abundance. Valley fills appear to have significant negative effects on stream salamander abundance due to alterations in habitat structure, water quality and chemistry, and macroinvertebrate communities in streams below fills.

  11. High occupancy of stream salamanders despite high ranavirus prevalence in a southern appalachians watershed.

    Science.gov (United States)

    Rothermel, Betsie B; Travis, Emilie R; Miller, Debra L; Hill, Robert L; McGuire, Jessica L; Yabsley, Michael J

    2013-06-01

    The interactive effects of environmental stressors and emerging infectious disease pose potential threats to stream salamander communities and their headwater stream ecosystems. To begin assessing these threats, we conducted occupancy surveys and pathogen screening of stream salamanders (Family Plethodontidae) in a protected southern Appalachians watershed in Georgia and North Carolina, USA. Of the 101 salamanders screened for both chytrid fungus (Batrachochytrium dendrobatidis) and Ranavirus, only two exhibited low-level chytrid infections. Prevalence of Ranavirus was much higher (30.4% among five species of Desmognathus). Despite the ubiquity of ranaviral infections, we found high probabilities of site occupancy (≥0.60) for all stream salamander species.

  12. EL COLAPSO DEL CLÁSICO TARDÍO ENTRE LOS MAYAS DE UAXACTÚN (GUATEMALA Y BARTON RAMIE (BELICE SEGÚN EL REGISTRO FUNERARIO (The Late Classic Collapse among the Maya of Uaxactun, Guatemala and Barton Ramie, Belize according to the Mortuary Record

    Directory of Open Access Journals (Sweden)

    Pascual Izquierdo-Egea

    2015-09-01

    Full Text Available La aplicación del método de valoración contextual al análisis del registro funerario de Uaxactún (Guatemala y Barton Ramie (Belice aporta evidencias irrefutables sobre la huella material del colapso clásico en las ofrendas de los entierros mayas. Esto confirma lo que ya se había anticipado al estudiar la cuenca del río Balsas en México (2014. ENGLISH: Application of the contextual valuation method to the mortuary analysis of Uaxactun, Guatemala and Barton Ramie, Belize provides irrefutable evidence on the Classic Maya collapse recorded in the grave goods of these burials. This confirms what was already anticipated by studying the Balsas River basin in Mexico.

  13. Ecological radiation with limited morphological diversification in salamanders.

    Science.gov (United States)

    Blankers, Thomas; Adams, D C; Wiens, J J

    2012-04-01

    A major goal of evolutionary biology is to explain morphological diversity among species. Many studies suggest that much morphological variation is explained by adaptation to different microhabitats. Here, we test whether morphology and microhabitat use are related in plethodontid salamanders, which contain the majority of salamander species, and have radiated into a striking diversity of microhabitats. We obtained microhabitat data for 189 species that also had both morphometric and phylogenetic data. We then tested for associations between morphology and microhabitat categories using phylogenetic comparative methods. Associations between morphology and ecology in plethodontids are largely confined to a single clade within one subfamily (Bolitoglossinae), whereas variation in morphology across other plethodontids is unrelated to microhabitat categories. These results demonstrate that ecological radiation and morphological evolution can be largely decoupled in a major clade. The results also offer a striking contrast to lizards, which typically show close relationships between morphology and microhabitat.

  14. Total syntheses of (±)-spiroindimicins B and C enabled by a late-stage Schöllkopf-Magnus-Barton-Zard (SMBZ) reaction.

    Science.gov (United States)

    Blair, Lachlan M; Sperry, Jonathan

    2016-01-14

    The spiroindimicins are a family of structurally unprecedented alkaloids isolated from the deep-sea-derived marine actinomycete Streptomyces sp. SCSIO 03032. The total syntheses of (±)-spiroindimicins B and C are disclosed, the first of any member of this family. Central to the successful strategy was installing the spirocentre using a mild intramolecular Heck reaction, the assembly of a pentacyclic spirobisindole by Fischer indolization and a late-stage Schöllkopf-Magnus-Barton-Zard (SMBZ) reaction to construct the trisubstituted pyrrole.

  15. 76 FR 44036 - Proposed Low-Effect Habitat Conservation Plan for the California Tiger Salamander, AT&T Portable...

    Science.gov (United States)

    2011-07-22

    ... Salamander, AT&T Portable Generator Storage Facility, Yolo County, CA AGENCY: Fish and Wildlife Service... potential for ``take'' of one Federally listed animal, the California tiger salamander. The applicant would... for the California tiger salamander into a new storage facility for portable generators within...

  16. 76 FR 55413 - Proposed Safe Harbor Agreement for California Red-legged Frog, California Tiger Salamander, Smith...

    Science.gov (United States)

    2011-09-07

    ... Tiger Salamander, Smith's Blue Butterfly, and Yadon's Piperia at Palo Corona Regional Park, Monterey... federally threatened California red-legged frog (Rana draytonii) and California tiger salamander (Ambystoma..., California tiger salamander, Smith's blue butterfly, and Yadon's piperia on the property subject to...

  17. Macrophages are required for adult salamander limb regeneration

    OpenAIRE

    Godwin, James W.; Pinto, Alexander R.; Nadia A. Rosenthal

    2013-01-01

    The failure to replace damaged body parts in adult mammals results from a muted growth response and fibrotic scarring. Although infiltrating immune cells play a major role in determining the variable outcome of mammalian wound repair, little is known about the modulation of immune cell signaling in efficiently regenerating species such as the salamander, which can regrow complete body structures as adults. Here we present a comprehensive analysis of immune signaling during limb regeneration i...

  18. Cannibalistic-morph Tiger Salamanders in unexpected ecological contexts

    Science.gov (United States)

    McLean, Kyle I.; Stockwell, Craig A.; Mushet, David M.

    2016-01-01

    Barred tiger salamanders [Ambystoma mavortium (Baird, 1850)] exhibit two trophic morphologies; a typical and a cannibalistic morph. Cannibalistic morphs, distinguished by enlarged vomerine teeth, wide heads, slender bodies, and cannibalistic tendencies, are often found where conspecifics occur at high density. During 2012 and 2013, 162 North Dakota wetlands and lakes were sampled for salamanders. Fifty-one contained A. mavortium populations; four of these contained cannibalistic morph individuals. Two populations with cannibalistic morphs occurred at sites with high abundances of conspecifics. However, the other two populations occurred at sites with unexpectedly low conspecific but high fathead minnow [Pimephales promelas (Rafinesque, 1820)] abundances. Further, no typical morphs were observed in either of these later two populations, contrasting with earlier research suggesting cannibalistic morphs only occur at low frequencies in salamander populations. Another anomaly of all four populations was the occurrence of cannibalistic morphs in permanent water sites, suggesting their presence was due to factors other than faster growth allowing them to occupy ephemeral habitats. Therefore, our findings suggest environmental factors inducing the cannibalistic morphism may be more complex than previously thought.

  19. Evolutionary history of a complex adaptation: tetrodotoxin resistance in salamanders.

    Science.gov (United States)

    Hanifin, Charles T; Gilly, William F

    2015-01-01

    Understanding the processes that generate novel adaptive phenotypes is central to evolutionary biology. We used comparative analyses to reveal the history of tetrodotoxin (TTX) resistance in TTX-bearing salamanders. Resistance to TTX is a critical component of the ability to use TTX defensively but the origin of the TTX-bearing phenotype is unclear. Skeletal muscle of TTX-bearing salamanders (modern newts, family: Salamandridae) is unaffected by TTX at doses far in excess of those that block action potentials in muscle and nerve of other vertebrates. Skeletal muscle of non-TTX-bearing salamandrids is also resistant to TTX but at lower levels. Skeletal muscle TTX resistance in the Salamandridae results from the expression of TTX-resistant variants of the voltage-gated sodium channel NaV 1.4 (SCN4a). We identified four substitutions in the coding region of salSCN4a that are likely responsible for the TTX resistance measured in TTX-bearing salamanders and variation at one of these sites likely explains variation in TTX resistance among other lineages. Our results suggest that exaptation has played a role in the evolution of the TTX-bearing phenotype and provide empirical evidence that complex physiological adaptations can arise through the accumulation of beneficial mutations in the coding region of conserved proteins.

  20. Mechanisms underlying vertebrate limb regeneration: lessons from the salamander.

    Science.gov (United States)

    Brockes, Jeremy P; Gates, Phillip B

    2014-06-01

    Limb regeneration in adult salamanders proceeds by formation of a mound of progenitor cells called the limb blastema. It provides several pointers for regenerative medicine. These include the role of differentiated cells in the origin of the blastema, the role of regenerating axons of peripheral nerves and the importance of cell specification in conferring morphogenetic autonomy on the blastema. One aspect of regeneration that has received less attention is the ability to undergo multiple episodes without detectable change in the outcome, and with minimal effect of aging. We suggest that, although such pointers are valuable, it is important to understand why salamanders are the only adult tetrapod vertebrates able to regenerate their limbs. Although this remains a controversial issue, the existence of salamander-specific genes that play a significant role in the mechanism of regeneration provides evidence for the importance of local evolution, rather than a purely ancestral mechanism. The three-finger protein called Prod1 is discussed in the present article as an exemplar of this approach.

  1. Detection of an enigmatic plethodontid Salamander using Environmental DNA

    Science.gov (United States)

    Pierson, Todd W.; Mckee, Anna; Spear, Stephen F.; Maerz, John C.; Camp, Carlos D.; Glenn, Travis C.

    2016-01-01

    The isolation and identification of environmental DNA (eDNA) offers a non-invasive and efficient method for the detection of rare and secretive aquatic wildlife, and it is being widely integrated into inventory and monitoring efforts. The Patch-Nosed Salamander (Urspelerpes brucei) is a tiny, recently discovered species of plethodontid salamander known only from headwater streams in a small region of Georgia and South Carolina. Here, we present results of a quantitative PCR-based eDNA assay capable of detecting Urspelerpes in more than 75% of 33 samples from five confirmed streams. We deployed the method at 31 additional streams and located three previously undocumented populations of Urspelerpes. We compare the results of our eDNA assay with our attempt to use aquatic leaf litterbags for the rapid detection of Urspelerpes and demonstrate the relative efficacy of the eDNA assay. We suggest that eDNA offers great potential for use in detecting other aquatic and semi-aquatic plethodontid salamanders.

  2. FLOOPLAIN, BARTON COUNTY, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...

  3. Environmental and Anthropogenic Factors Influencing Salamanders in Riparian Forests: A Review

    Directory of Open Access Journals (Sweden)

    Hannah L. Clipp

    2014-11-01

    Full Text Available Salamanders and riparian forests are intimately interconnected. Salamanders are integral to ecosystem functions, contributing to vertebrate biomass and complex food webs in riparian forests. In turn, these forests are critical ecosystems that perform many environmental services, facilitate high biodiversity and species richness, and provide habitat to salamander populations. Due to the global decline of amphibians, it is important to understand, as thoroughly and holistically as possible, the roles of environmental parameters and the impact of human activities on salamander abundance and diversity in riparian forests. To determine the population responses of salamanders to a variety of environmental factors and anthropogenic activities, we conducted a review of published literature that compared salamander abundance and diversity, and then summarized and synthesized the data into general patterns. We identify stream quality, leaf litter and woody debris, riparian buffer width, and soil characteristics as major environmental factors influencing salamander populations in riparian forests, describe and explain salamander responses to those factors, and discuss the effects of anthropogenic activities such as timber harvest, prescribed fires, urbanization, road construction, and habitat fragmentation. This review can assist land and natural resource managers in anticipating the consequences of human activities and preparing strategic conservation plans.

  4. Effects of mercury on behavior and performance of northern two-lined salamanders (Eurycea bislineata)

    Energy Technology Data Exchange (ETDEWEB)

    Burke, John N.; Bergeron, Christine M.; Todd, Brian D. [Wildlife Ecotoxicology and Physiological Ecology Program, Department of Fisheries and Wildlife Sciences, Virginia Polytechnic Institute and State University, 100 Cheatham Hall, Blacksburg, VA 24061 (United States); Hopkins, William A., E-mail: hopkinsw@vt.ed [Wildlife Ecotoxicology and Physiological Ecology Program, Department of Fisheries and Wildlife Sciences, Virginia Polytechnic Institute and State University, 100 Cheatham Hall, Blacksburg, VA 24061 (United States)

    2010-12-15

    Mercury (Hg) causes a range of deleterious effects in wildlife, but little is known about its effects on amphibians. Our objective was to determine whether Hg affects performance and behavior in two-lined salamanders (Eurycea bislineata). We collected salamanders from Hg-contaminated and reference sites and assessed speed, responsiveness, and prey capture ability. Mercury concentrations were >17x higher in salamanders from the contaminated sites and were among the highest documented in amphibians. In the first, but not in the second, locomotion trial, we found a significant effect of Hg on speed and responsiveness. In the prey capture experiment, reference salamanders ate approximately twice as many prey items as the contaminated salamanders. Together, our results suggest that sublethal Hg concentrations may negatively affect salamanders by reducing their ability to successfully execute tasks critical to survival. Future work is warranted to determine whether Hg has other sublethal effects on salamanders and whether other amphibians are similarly affected. - Mercury contamination may alter behavior and performance in the northern two-lined salamander (Eurycea bislineata).

  5. [Selective processes and adaptive evolution of the cytochrome b gene in salamanders of the genus Salamandrella].

    Science.gov (United States)

    Maliarchuk, B A

    2012-06-01

    Sequence analysis of the cytochrome b gene fragment in the salamanders of the genus Salamandrella, Siberian salamander and Schrenk salamander was performed with the purpose to elucidate the effect of natural selection on the evolution of mitochondrial DNA (mtDNA) in these species. It was demonstrated that despite of notable influence of negative selection (expressed as very low dN/dS values), speciation and intraspecific divergence in salamanders was accompanied by the appearance of radical amino acid substitutions, caused by the influence of positive (directional) selection. To examine the evolutionary pattern of synonymous mtDNA sites, distribution of conservative and non-conservative substitutions was analyzed. The rates of conservative and non-conservative substitutions were nearly equal, pointing to neutrality of mutation process at synonymous mtDNA sites of salamanders. Analysis of conservative and non-conservative synonymous substitution distributions in different parts of phylogenetic trees showed that the differences between the synonymous groups compared were statistically significant only in one phylogenetic group of Siberian salamander (haplogroup C) (P = 0.02). In the group of single substitutions, located at terminal phylogenetic branches of Siberian salamanders from group C, increased rate of conservative substitutions was observed. Based on these findings, it was suggested that selective processes could have an influence on the formation of the synonymous substitution profile in the Siberian salamander mtDNA fragment examined.

  6. Environmental influences on egg and clutch sizes in lentic- and lotic-breeding salamanders

    Directory of Open Access Journals (Sweden)

    Jon M. Davenport

    2010-12-01

    Full Text Available Recent research indicates that social and environmental factors influence egg and clutch sizes in amphibians. However, most of this work is based on the reproductively diverse order Anura (frogs and toads, whereas less research has been conducted on Caudata (salamanders and Gymnophiona (caecilians. Researchers have suggested that a relationship exists between social and environmental factors and egg and clutch sizes in salamanders, but studies controlling for phylogenetic context are lacking. We could not identify a sufficient number of comparisons for social influences on egg and clutch sizes; therefore, we focused on environmental influences for this study. Data on egg size, clutch size, environmental factors, and phylogenies for salamanders were assembled from the scientific literature. We used independent, pair-wise comparisons to investigate the association of larval salamander habitat and egg size and the association of larval salamander habitat with clutch sizes within a phylogenetic framework. There is a significant association between larval habitat and egg size; specifically, stream-breeding species produce larger eggs. There is no significant association between larval habitat and clutchsize. Our study confirms earlier reports that salamander egg size is associated with larval environments, but is the first to use phylogenetically independent contrasts to account for the lack of phylogenetic independence of the traits measured (egg size and clutch size associated with many of the diverse lineages. Our study shows that environmental selection pressure can be quite strong on one aspect of salamander reproduction—egg size.

  7. What Do Owls, Salamanders, Flycatchers and Cuckoos Have In Common?

    Energy Technology Data Exchange (ETDEWEB)

    Musgrave, Maria A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Wildlife Management

    2016-09-27

    This is an article from the Los Alamos Living magazine. Los Alamos National Laboratory sits on a beautiful and unique landscape that provides important protected habitat to many species, including a few that are federally-listed as threatened or endangered. These species are the Jemez Mountains Salamander, the Mexican Spotted Owl, the Southwestern Willow Flycatcher, the Yellow-billed Cuckoo, and the New Mexico Meadow Jumping Mouse. Part of the job of the Laboratory's wildlife biologists is to survey for these species each year and determine what actions need to be taken if they are found.

  8. Axial dynamics during locomotion in vertebrates lesson from the salamander.

    Science.gov (United States)

    Cabelguen, Jean-Marie; Ijspeert, Auke; Lamarque, Stéphanie; Ryczko, Dimitri

    2010-01-01

    Much of what we know about the flexibility of the locomotor networks in vertebrates is derived from studies examining the adaptation of limb movements during stepping in various conditions. However, the body movements play important roles during locomotion: they produce the thrust during undulatory locomotion and they help to increase the stride length during legged locomotion. In this chapter, we review our current knowledge about the flexibility in the neuronal circuits controlling the body musculature during locomotion. We focus especially on salamander because, as an amphibian, this animal is able to display a rich repertoire of aquatic and terrestrial locomotor modes.

  9. Molecular detection of vertebrates in stream water: A demonstration using rocky mountain tailed frogs and Idaho giant salamanders

    Science.gov (United States)

    Goldberg, C.S.; Pilliod, D.S.; Arkle, R.S.; Waits, L.P.

    2011-01-01

    Stream ecosystems harbor many secretive and imperiled species, and studies of vertebrates in these systems face the challenges of relatively low detection rates and high costs. Environmental DNA (eDNA) has recently been confirmed as a sensitive and efficient tool for documenting aquatic vertebrates in wetlands and in a large river and canal system. However, it was unclear whether this tool could be used to detect low-density vertebrates in fast-moving streams where shed cells may travel rapidly away from their source. To evaluate the potential utility of eDNA techniques in stream systems, we designed targeted primers to amplify a short, species-specific DNA fragment for two secretive stream amphibian species in the northwestern region of the United States (Rocky Mountain tailed frogs, Ascaphus montanus, and Idaho giant salamanders, Dicamptodon aterrimus). We tested three DNA extraction and five PCR protocols to determine whether we could detect eDNA of these species in filtered water samples from five streams with varying densities of these species in central Idaho, USA. We successfully amplified and sequenced the targeted DNA regions for both species from stream water filter samples. We detected Idaho giant salamanders in all samples and Rocky Mountain tailed frogs in four of five streams and found some indication that these species are more difficult to detect using eDNA in early spring than in early fall. While the sensitivity of this method across taxa remains to be determined, the use of eDNA could revolutionize surveys for rare and invasive stream species. With this study, the utility of eDNA techniques for detecting aquatic vertebrates has been demonstrated across the majority of freshwater systems, setting the stage for an innovative transformation in approaches for aquatic research.

  10. Molecular detection of vertebrates in stream water: a demonstration using Rocky Mountain tailed frogs and Idaho giant salamanders.

    Directory of Open Access Journals (Sweden)

    Caren S Goldberg

    Full Text Available Stream ecosystems harbor many secretive and imperiled species, and studies of vertebrates in these systems face the challenges of relatively low detection rates and high costs. Environmental DNA (eDNA has recently been confirmed as a sensitive and efficient tool for documenting aquatic vertebrates in wetlands and in a large river and canal system. However, it was unclear whether this tool could be used to detect low-density vertebrates in fast-moving streams where shed cells may travel rapidly away from their source. To evaluate the potential utility of eDNA techniques in stream systems, we designed targeted primers to amplify a short, species-specific DNA fragment for two secretive stream amphibian species in the northwestern region of the United States (Rocky Mountain tailed frogs, Ascaphus montanus, and Idaho giant salamanders, Dicamptodon aterrimus. We tested three DNA extraction and five PCR protocols to determine whether we could detect eDNA of these species in filtered water samples from five streams with varying densities of these species in central Idaho, USA. We successfully amplified and sequenced the targeted DNA regions for both species from stream water filter samples. We detected Idaho giant salamanders in all samples and Rocky Mountain tailed frogs in four of five streams and found some indication that these species are more difficult to detect using eDNA in early spring than in early fall. While the sensitivity of this method across taxa remains to be determined, the use of eDNA could revolutionize surveys for rare and invasive stream species. With this study, the utility of eDNA techniques for detecting aquatic vertebrates has been demonstrated across the majority of freshwater systems, setting the stage for an innovative transformation in approaches for aquatic research.

  11. Science Review for the Scott Bar Salamander (Plethodon asupak) and the Siskiyou Mountains Salamander (P. stormi): Biology, Taxonomy, Habitat, and Detection Probabilities/Occupancy

    Science.gov (United States)

    DeGross, Douglas J.; Bury, R. Bruce

    2007-01-01

    The Plethodon elongatus Complex in the Klamath-Siskiyou Ecoregion of southern Oregon and northern California includes three species: the Del Norte salamander, Plethodon elongatus; the Siskiyou Mountains salamander, P. stormi; and the Scott Bar salamander, P. asupak. This review aims to summarize the current literature and information available on select topics for P. stormi and P. asupak. These are both terrestrial salamanders belonging to the Family Plethodontidae, which contains more species and has a wider geographic distribution than any other family of salamanders (Wake 1966, 2006; Pough 1989). The genera of this family have greatly diversified ecologically across North America, Central America, northern South America, Sardinia, southeastern France and northwestern Italy, and have recently been discovered on the Korean peninsula (Min et al. 2005). The genus Plethodon is found exclusively in North America and is split into three distinct clades, based upon morphology and phylogenetics (Highton and Larson 1979): eastern small Plethodon, eastern large Plethodon, and the western Plethodon. The western Plethodon are the greatest representation of Plethodontidae in the Pacific Northwest, with 8 species. The two species with the most restricted ranges of these regional congeners are the Siskiyou Mountains and Scott Bar salamanders. These salamanders occupy the interior of the Klamath-Siskiyou Ecoregion which straddles the California and Oregon state lines, between Siskiyou County (CA) and Jackson and Josephine Counties (OR). The relatively recent discovery of P. asupak (Mead et al. 2005) and the limited range of both species have created an environment of uncertain conservation status for these species. This review will focus on four central topics of concern for land and resource managers: Biology; Taxonomy; Habitat; and Detection Probabilities/Occupancy.

  12. Slow Lives in the Fast Landscape: Conservation and Management of Plethodontid Salamanders in Production Forests of the United States

    Directory of Open Access Journals (Sweden)

    Jessica A. Homyack

    2014-11-01

    Full Text Available Intensively-managed forest (IMF ecosystems support environmental processes, retain biodiversity and reduce pressure to extract wood products from other forests, but may affect species, such as plethodontid salamanders, that are associated with closed canopies and possess limited vagility. We describe: (1 critical aspects of IMF ecosystems; (2 effectiveness of plethodontid salamanders as barometers of forest change; (3 two case studies of relationships between salamanders and coarse woody debris (CWD; and (4 research needs for effective management of salamanders in IMF ecosystems. Although plethodontid salamanders are sensitive to microclimate changes, their role as ecological indicators rarely have been evaluated quantitatively. Our case studies of CWD and salamanders in western and eastern forests demonstrated effects of species, region and spatial scale on the existence and strength of relationships between plethodontid species and a “critical” microhabitat variable. Oregon slender salamanders (Batrachoseps wrighti were more strongly associated with abundance of CWD in managed second growth forests than ensatina salamanders (Ensatina eschscholtzii. Similarly, CWD was not an important predictor of abundance of Appalachian salamanders in managed hardwood forest. Gaining knowledge of salamanders in IMF ecosystems is critical to reconciling ecological and economic objectives of intensive forest management, but faces challenges in design and implementation.

  13. 春天%Spring

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ Days get longer and warmer in the spring. There are new leaves on the trees. Flowers begin to grow. Spring rain makes the grass green and helps the plants grow. Nature wears new clothes in many colors red, yellow, blue, white and purple. Spring is the time of new life. I love spring.

  14. Evidence for Sex Chromosome Turnover in Proteid Salamanders.

    Science.gov (United States)

    Sessions, Stanley K; Bizjak Mali, Lilijana; Green, David M; Trifonov, Vladimir; Ferguson-Smith, Malcolm

    2016-01-01

    A major goal of genomic and reproductive biology is to understand the evolution of sex determination and sex chromosomes. Species of the 2 genera of the Salamander family Proteidae - Necturus of eastern North America, and Proteus of Southern Europe - have similar-looking karyotypes with the same chromosome number (2n = 38), which differentiates them from all other salamanders. However, Necturus possesses strongly heteromorphic X and Y sex chromosomes that Proteus lacks. Since the heteromorphic sex chromosomes of Necturus were detectable only with C-banding, we hypothesized that we could use C-banding to find sex chromosomes in Proteus. We examined mitotic material from colchicine-treated intestinal epithelium, and meiotic material from testes in specimens of Proteus, representing 3 genetically distinct populations in Slovenia. We compared these results with those from Necturus. We performed FISH to visualize telomeric sequences in meiotic bivalents. Our results provide evidence that Proteus represents an example of sex chromosome turnover in which a Necturus-like Y-chromosome has become permanently translocated to another chromosome converting heteromorphic sex chromosomes to homomorphic sex chromosomes. These results may be key to understanding some unusual aspects of demographics and reproductive biology of Proteus, and are discussed in the context of models of the evolution of sex chromosomes in amphibians.

  15. Variation in mating systems of salamanders: mate guarding or territoriality?

    Science.gov (United States)

    Deitloff, Jennifer; Alcorn, Michael A; Graham, Sean P

    2014-07-01

    Two of the most common mating tactics in vertebrates are mate guarding and territoriality, yet much of the research on these strategies has focused on mating systems in birds, despite novel insights gained from studying less traditional systems. North American stream salamanders that comprise the Eurycea bislineata complex represent an excellent nontraditional system for comparing mating strategies because these species exhibit a continuum of male morphologies, diverse habitat associations, and various potential mating strategies. We studied two species within this complex that exhibit the extremes of this continuum, Eurycea aquatica (robust morph) and Eurycea cirrigera (slender morph). The larger head in males of E. aquatica is due to larger musculature around the jaw and may be associated with aggressive behavior. Therefore, we hypothesized that the robust morphology exhibited by males of E. aquatica provides benefits during either territorial defense or mate defense and that males of E. cirrigera would not exhibit aggression in either scenario. We found that neither species exhibited aggressive behavior to defend a territory. However, in the presence of a female, males of E. aquatica were significantly more aggressive toward intruding males than were males of E. cirrigera. Therefore, mate-guarding behavior occurs in E. aquatica, and the enlarged head of males likely aids in deterring rivals. This is the first demonstration of mate-guarding behavior in a plethodontid, the most speciose family of salamanders.

  16. Macrophages are required for adult salamander limb regeneration.

    Science.gov (United States)

    Godwin, James W; Pinto, Alexander R; Rosenthal, Nadia A

    2013-06-04

    The failure to replace damaged body parts in adult mammals results from a muted growth response and fibrotic scarring. Although infiltrating immune cells play a major role in determining the variable outcome of mammalian wound repair, little is known about the modulation of immune cell signaling in efficiently regenerating species such as the salamander, which can regrow complete body structures as adults. Here we present a comprehensive analysis of immune signaling during limb regeneration in axolotl, an aquatic salamander, and reveal a temporally defined requirement for macrophage infiltration in the regenerative process. Although many features of mammalian cytokine/chemokine signaling are retained in the axolotl, they are more dynamically deployed, with simultaneous induction of inflammatory and anti-inflammatory markers within the first 24 h after limb amputation. Systemic macrophage depletion during this period resulted in wound closure but permanent failure of limb regeneration, associated with extensive fibrosis and disregulation of extracellular matrix component gene expression. Full limb regenerative capacity of failed stumps was restored by reamputation once endogenous macrophage populations had been replenished. Promotion of a regeneration-permissive environment by identification of macrophage-derived therapeutic molecules may therefore aid in the regeneration of damaged body parts in adult mammals.

  17. Primary study on the impact of water temperature on the growth of juvenile giant salamander (Andrias davidanus)%水温对幼鲵生长影响的初步研究

    Institute of Scientific and Technical Information of China (English)

    张红星; 沈建忠; 赵虎; 王启军; Andy Kouba; Scott T.Willard

    2012-01-01

    研究了不同时间段泉水和河水对幼鲵(Andrias davidanus)生长的影响.结果显示:幼鲵在不同时间和不同地点增重存在差异.第二阶段幼鲵平均日增重极显著高于第一阶段(P<0.01).1号点(泉水)幼鲵平均增重和日平均增重极显著高于2号点(河水)幼鲵(P<0.01);第一阶段1号点日平均水温极显著高于2号点(P<0.01),最低温度较河水高6.95℃,且1号点水温变化较小.结果表明,水温是影响幼鲵生长的重要因素之一.%Impact of spring and river at two time periods on the growth of juvenile giant salamander was studied. The weight gain of juvenile giant salamander had differences at the different time and different places. Average daily weight gain of juvenile giant salamander at the second stage were significantly higher than the first stage (P <0.01). Average weight gain and average daily weight gain of juvenile giant salamander at No. 1 place (spring) were extremely higher than No. 2 place (river) (P<0.01); At the first stage, day average water temperature at No. 1 place was significantly higher than No.2 place (P<0.01), minimum water temperature at No. 1 place was 6.95 t higher than No. 2 place, and water temperature variation at No. 1 place was smaller. In short, water temperature is an important factor affecting the growth of juvenile giant salamander.

  18. Egg predators of an endemic Italian salamander, Salamandrina perspicillata (Savi, 1821

    Directory of Open Access Journals (Sweden)

    Antonio Romano

    2008-05-01

    Full Text Available We report new aquatic predators feeding on Northern spectacled salamander eggs, Salamandrina perspicillata, an endemic Italian species. Eggs were preyed upon by the leech, Trocheta bykowskii, and the trichopteran larvae of Potamophylax cingulatus and Halesus appenninus.

  19. SPATIALLY AUTOCORRELATED DEMOGRAPHY AND INTERPOND MIGRATION IN THE CALIFORNIA TIGER SALAMANDER (AMBYSTOME CALIFORNIENSE)

    Science.gov (United States)

    We investigated the metapopulation structure of the California tiger salamander (Ambystoma californiense) using a combination of indirect and direct methods to evaluate two key requirements of modern metapopulation models: 1) that patches support somewhat independent populations ...

  20. Cheat Mountain Salamanders Search Report 2004 Canaan Valley National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This is a report that outlines the results of a one-day survey for the endangered Cheat Mountain Salamander at Canaan Valley National Wildlife Refuge in 2004. The...

  1. Larval salamanders and channel geomorphology are indicators of hydrologic permanence in forested headwater streams

    Science.gov (United States)

    Regulatory agencies need rapid indicators of hydrologic permanence for jurisdictional determinations of headwater streams. Our study objective was to assess the utility of larval salamander presence and assemblage structure and habitat variables for determining stream permanence ...

  2. Cheat Mountain Salamander coverboard data analysis Canaan Valley National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From 2000 to 2008 data was collected from three Cheat Mountain salamander coverboard sites at Canaan Valley National Wildlife Refuge: Cabin Knob A, Cabin Knob B, and...

  3. Stoichiometry of excreta and excretion rates of a stream-dwelling plethodontid salamander

    Data.gov (United States)

    U.S. Environmental Protection Agency — Stoichiometry of excreta and excretion rates of a stream-dwelling plethodontid salamander in Cincinnati, OH, USA. This dataset is associated with the following...

  4. Cheat Mountain Salamanders Search Reports 2008 Canaan Valley National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This documents six different surveys between July and September, 2008 that were done to monitor the endangered Cheat Mountain salamander at Canaan Valley National...

  5. Salamander võib õpetada jäsemete kasvatamist / Tiit Kändler

    Index Scriptorium Estoniae

    Kändler, Tiit, 1948-

    2008-01-01

    Salamander on selgroogsete seas ainulaadne olevus. Ta suudab endale kasvatada ka täiskasvanuna uued kehaosad. Kui arstiteadlased välja uurivad, kuidas ta seda teeb, võib see aidata ka inimest rasketest haavadest ravida

  6. Salamander regeneration as a model for developing novel regenerative and anticancer therapies.

    Science.gov (United States)

    Fior, Jonathan

    2014-01-01

    Among vertebrates, urodele amphibians are the only tetrapods with the ability to regenerate complex structures such as limbs, tail, and spinal cord throughout their lives. Furthermore, the salamander regeneration process has been shown to reverse tumorigenicity. Fibroblasts are essential for salamander regeneration, but the mechanisms underlying their role in the formation of a regeneration blastema remain unclear. Here, I review the role of fibroblasts in salamander limb regeneration and how their activity compares with that of human fibroblasts. In addition, the question of whether salamander blastema tissue could induce regeneration and tumor regression in animals with a limited regeneration ability is discussed. A deeper understanding of these processes may lead to the development of novel regenerative and anticancer therapies.

  7. Phylogenetic relationships of the endangered Shenandoah salamander (Plethodon shenandoah) and other salamanders of the Plethodon cinereus group (Caudata : Plethodontidae)

    Science.gov (United States)

    Sites, J.W.; Morando, M.; Highton, R.; Huber, F.; Jung, R.E.

    2004-01-01

    The Shenandoah salamander (Plethodon shenandoah), known from isolated talus slopes on three of the highest mountains in Shenandoah National Park, is listed as state-endangered in Virginia and federally endangered under the U.S. Endangered Species Act. A 1999 paper by G. R. Thurow described P. shenandoah-like salamanders from three localities further south in the Blue Ridge Physiographic Province, which, if confirmed, would represent a range extension for P. shenandoah of approximately 90 km from its nearest known locality. Samples collected from two of these three localities were included in a molecular phylogenetic study of the known populations of P. shenandoah, and all other recognized species in the Plethodon cinereus group, using a 792 bp region of the mitochondrial cytochrome-b gene. Phylogenetic estimates were based on Bayesian, maximum likelihood, and maximum parsimony methods and topologies examined for placement of the new P. shenandoah-like samples relative to all others. All topologies recovered all haplotypes of the P. shenandoah-like animals nested within P. cinereus, and a statistical comparison of the best likelihood tree topology with one with an enforced (Thurow + Shenandoah P. shenandoah) clade revealed that the unconstrained tree had a significantly lower -In L score (P Park.

  8. Thermal springs of Wyoming

    Energy Technology Data Exchange (ETDEWEB)

    Breckenridge, R.M.; Hinckley, B.S.

    1978-01-01

    This bulletin attempts, first, to provide a comprehensive inventory of the thermal springs of Wyoming; second, to explore the geologic and hydrologic factors producing these springs; and, third, to analyze the springs collectively as an indicator of the geothermal resources of the state. A general discussion of the state's geology and the mechanisms of thermal spring production, along with a brief comparison of Wyoming's springs with worldwide thermal features are included. A discussion of geothermal energy resources, a guide for visitors, and an analysis of the flora of Wyoming's springs follow the spring inventory. The listing and analysis of Wyoming's thermal springs are arranged alphabetically by county. Tabulated data are given on elevation, ownership, access, water temperature, and flow rate. Each spring system is described and its history, general characteristics and uses, geology, hydrology, and chemistry are discussed. (MHR)

  9. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander.

    Science.gov (United States)

    Zhang, Lu; Jiang, Wei; Wang, Qi-Jun; Zhao, Hu; Zhang, Hong-Xing; Marcec, Ruth M; Willard, Scott T; Kouba, Andrew J

    2016-01-01

    Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15) and the Donghe River (n = 16) in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702) was 1.7-fold higher than that at the Heihe River (0.405). Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8) increased in mass (0.50 ± 0.13 kg) and length (5.5 ± 1.5 cm) after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025). Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration.

  10. Transcriptomic analysis of the host response to an iridovirus infection in Chinese giant salamander, Andrias davidianus

    OpenAIRE

    Fan, Yuding; Chang, Ming Xian; Ma, Jie; LaPatra, Scott E.; Hu, Yi Wei; Huang, Lili; Nie, Pin; Zeng, Lingbing

    2015-01-01

    International audience; AbstractThe emergence of an infectious viral disease caused by the Chinese giant salamander iridovirus (GSIV) has led to substantial economic losses. However, no more molecular information is available for the understanding of the mechanisms associated with virus–host interaction. In this study, de novo sequencing was used to obtain abundant high-quality ESTs and investigate differentially-expressed genes in the spleen of Chinese giant salamanders that were either infe...

  11. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander

    Science.gov (United States)

    Zhang, Lu; Jiang, Wei; Wang, Qi-Jun; Zhao, Hu; Zhang, Hong-Xing; Marcec, Ruth M.; Willard, Scott T.; Kouba, Andrew J.

    2016-01-01

    Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15) and the Donghe River (n = 16) in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702) was 1.7-fold higher than that at the Heihe River (0.405). Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8) increased in mass (0.50 ± 0.13 kg) and length (5.5 ± 1.5 cm) after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025). Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration. PMID:27258650

  12. Tiger salamanders' (Ambystoma tigrinum) response learning and usage of visual cues.

    Science.gov (United States)

    Kundey, Shannon M A; Millar, Roberto; McPherson, Justin; Gonzalez, Maya; Fitz, Aleyna; Allen, Chadbourne

    2016-05-01

    We explored tiger salamanders' (Ambystoma tigrinum) learning to execute a response within a maze as proximal visual cue conditions varied. In Experiment 1, salamanders learned to turn consistently in a T-maze for reinforcement before the maze was rotated. All learned the initial task and executed the trained turn during test, suggesting that they learned to demonstrate the reinforced response during training and continued to perform it during test. In a second experiment utilizing a similar procedure, two visual cues were placed consistently at the maze junction. Salamanders were reinforced for turning towards one cue. Cue placement was reversed during test. All learned the initial task, but executed the trained turn rather than turning towards the visual cue during test, evidencing response learning. In Experiment 3, we investigated whether a compound visual cue could control salamanders' behaviour when it was the only cue predictive of reinforcement in a cross-maze by varying start position and cue placement. All learned to turn in the direction indicated by the compound visual cue, indicating that visual cues can come to control their behaviour. Following training, testing revealed that salamanders attended to stimuli foreground over background features. Overall, these results suggest that salamanders learn to execute responses over learning to use visual cues but can use visual cues if required. Our success with this paradigm offers the potential in future studies to explore salamanders' cognition further, as well as to shed light on how features of the tiger salamanders' life history (e.g. hibernation and metamorphosis) impact cognition.

  13. Reintroduction and Post-Release Survival of a Living Fossil: The Chinese Giant Salamander.

    Directory of Open Access Journals (Sweden)

    Lu Zhang

    Full Text Available Captive rearing and reintroduction / translocation are increasingly used as tools to supplement wild populations of threatened species. Reintroducing captive-reared Chinese giant salamanders may help to augment the declining wild populations and conserve this critically endangered amphibian. We released 31 captive-reared juvenile giant salamanders implanted with VHF radio transmitters at the Heihe River (n = 15 and the Donghe River (n = 16 in the Qinling Mountains of central China. Salamanders were monitored every day for survival from April 28th 2013 to September 3rd 2014. We attempted to recapture all living individuals by the end of the study, measured their body mass and total body length, and checked for abnormalities and presence of external parasites. Two salamanders at the Heihe River and 10 animals at the Donghe River survived through the project timeline. Nine salamanders were confirmed dead, while the status of the other 10 animals was undetermined. The annual survival rate of giant salamanders at the Donghe River (0.702 was 1.7-fold higher than that at the Heihe River (0.405. Survival increased as individuals were held longer following surgery, whereas body mass did not have a significant impact on survival rate. All salamanders recaptured from the Donghe River (n = 8 increased in mass (0.50 ± 0.13 kg and length (5.5 ± 1.5 cm after approximately 11 months in the wild, and they were only 7% lighter than wild animals of the same length (mean residual = -0.033 ± 0.025. Our results indicate that captive-reared Chinese giant salamanders can survive in the wild one year after release and adequate surgical recovery time is extremely important to post-release survival. Future projects may reintroduce older juveniles to achieve better survival and longer monitoring duration.

  14. Woodland salamander responses to a shelterwood harvest-prescribed burn silvicultural treatment within Appalachian mixed-oak forests

    Science.gov (United States)

    Ford, W. Mark; Mahoney, Kathleen R.; Russell, Kevin R.; Rodrigue, Jane L.; Riddle, Jason D.; Schuler, Thomas M.; Adams, Mary Beth

    2015-01-01

    Forest management practices that mimic natural canopy disturbances, including prescribed fire and timber harvests, may reduce competition and facilitate establishment of favorable vegetative species within various ecosystems. Fire suppression in the central Appalachian region for almost a century has contributed to a transition from oak-dominated to more mesophytic, fire-intolerant forest communities. Prescribed fire coupled with timber removal is currently implemented to aid in oak regeneration and establishment but responses of woodland salamanders to this complex silvicultural system is poorly documented. The purpose of our research was to determine how woodland salamanders respond to shelterwood harvests following successive burns in a central Appalachian mixed-oak forest. Woodland salamanders were surveyed using coverboard arrays in May, July, and August–September 2011 and 2012. Surveys were conducted within fenced shelterwood-burn (prescribed fires, shelterwood harvest, and fencing to prevent white-tailed deer [Odocoileus virginianus] herbivory), shelterwood-burn (prescribed fires and shelterwood harvest), and control plots. Relative abundance was modeled in relation to habitat variables measured within treatments for mountain dusky salamanders (Desmognathus ochrophaeus), slimy salamanders (Plethodon glutinosus), and eastern red-backed salamanders (Plethodon cinereus). Mountain dusky salamander relative abundance was positively associated with canopy cover and there were significantly more individuals within controls than either shelterwood-burn or fenced shelterwood-burn treatments. Conversely, habitat variables associated with slimy salamanders and eastern red-backed salamanders did not differ among treatments. Salamander age-class structure within controls did not differ from shelterwood-burn or fenced shelterwood-burn treatments for any species. Overall, the woodland salamander assemblage remained relatively intact throughout the shelterwoodburn

  15. Slow Lives in the Fast Landscape: Conservation and Management of Plethodontid Salamanders in Production Forests of the United States

    OpenAIRE

    Jessica A. Homyack; Andrew J. Kroll

    2014-01-01

    Intensively-managed forest (IMF) ecosystems support environmental processes, retain biodiversity and reduce pressure to extract wood products from other forests, but may affect species, such as plethodontid salamanders, that are associated with closed canopies and possess limited vagility. We describe: (1) critical aspects of IMF ecosystems; (2) effectiveness of plethodontid salamanders as barometers of forest change; (3) two case studies of relationships between salamanders and coarse wood...

  16. Abundance and phenology patterns of two pond-breeding salamanders determine species interactions in natural populations.

    Science.gov (United States)

    Anderson, Thomas L; Hocking, Daniel J; Conner, Christopher A; Earl, Julia E; Harper, Elizabeth B; Osbourn, Michael S; Peterman, William E; Rittenhouse, Tracy A G; Semlitsch, Raymond D

    2015-03-01

    Phenology often determines the outcome of interspecific interactions, where early-arriving species often dominate interactions over those arriving later. The effects of phenology on species interactions are especially pronounced in aquatic systems, but the evidence is largely derived from experimental studies. We examined whether differences in breeding phenology between two pond-breeding salamanders (Ambystoma annulatum and A. maculatum) affected metamorph recruitment and demographic traits within natural populations, with the expectation that the fall-breeding A. annulatum would negatively affect the spring-breeding A. maculatum. We monitored populations of each species at five ponds over 4 years using drift fences. Metamorph abundance and survival of A. annulatum were affected by intra- and interspecific processes, whereas metamorph size and date of emigration were primarily influenced by intraspecific effects. Metamorph abundance, snout-vent length, date of emigration and survival for A. maculatum were all predicted by combinations of intra- and interspecific effects, but often showed negative relationships with A. annulatum metamorph traits and abundance. Size and date of metamorphosis were strongly correlated within each species, but in opposite patterns (negative for A. annulatum and positive for A. maculatum), suggesting that the two species use alternative strategies to enhance terrestrial survival and that these factors may influence their interactions. Our results match predictions from experimental studies that suggest recruitment is influenced by intra- and interspecific processes which are determined by phenological differences between species. Incorporating spatiotemporal variability when modeling population dynamics is necessary to understand the importance of phenology in species interactions, especially as shifts in phenology occur under climate change.

  17. Organisation of the spinal central pattern generators for locomotion in the salamander: biology and modelling.

    Science.gov (United States)

    Chevallier, Stéphanie; Jan Ijspeert, Auke; Ryczko, Dimitri; Nagy, Frédéric; Cabelguen, Jean-Marie

    2008-01-01

    Among living tetrapods, salamanders are regarded as most closely resembling the first terrestrial vertebrates, and are therefore an interesting group in which the evolutionary changes in the locomotor behaviour from aquatic to terrestrial habitats can be inferred. Salamanders exhibit two locomotor modes: swimming and terrestrial stepping. The swimming is anguilliform and resembles closely that of the lamprey. On the ground, the salamander switches to a stepping gait with axial undulations that is also observed in many reptiles. The salamander is therefore ideally suited for examining the neural mechanisms for the generation of these two locomotor modes, as well as the neural mechanisms of gait transition. In the present paper, we describe the kinematics and patterns of activation of axial and limb muscles during stepping and swimming in adult salamanders. We then review the current neurobiological data about the organisation of the spinal networks underlying swimming and stepping, and the mechanisms of gait transition. Finally we report modelling studies aimed at understanding the organisation and operation of the salamander locomotor circuits. Altogether, the neurobiological and the modelling data support the hypothesis of a phylogenetic conservatism from agnathians to amphibians of the spinal locomotor networks generating axial motor patterns.

  18. Thermal equilibrium and temperature differences among body regions in European plethodontid salamanders.

    Science.gov (United States)

    Lunghi, Enrico; Manenti, Raoul; Canciani, Giancarlo; Scarì, Giorgio; Pennati, Roberta; Ficetola, Gentile Francesco

    2016-08-01

    Information on species thermal physiology is extremely important to understand species responses to environmental heterogeneity and changes. Thermography is an emerging technology that allows high resolution and accurate measurement of body temperature, but until now it has not been used to study thermal physiology of amphibians in the wild. Hydromantes terrestrial salamanders are strongly depending on ambient temperature for their activity and gas exchanges, but information on their body temperature is extremely limited. In this study we tested if Hydromantes salamanders are thermoconform, we assessed whether there are temperature differences among body regions, and evaluated the time required to reach the thermal equilibrium. During summers of 2014 and 2015 we analysed 56 salamanders (Hydromantes ambrosii and Hydromantes italicus) using infrared thermocamera. We photographed salamanders at the moment in which we found them and 1, 2, 3, 4, 5 and 15min after having kept them in the hands. Body temperature was equal to air temperature; salamanders attained the equilibrium with air temperature in about 8min, the time required to reach equilibrium was longer in individuals with large body size. We detected small temperature differences between body parts, the head being slightly warmer than the body and the tail (mean difference: 0.05°C). These salamanders quickly reach the equilibrium with the environment, thus microhabitat measurement allows obtaining accurate information on their tolerance limits.

  19. Instant Spring Tool Suite

    CERN Document Server

    Chiang, Geoff

    2013-01-01

    Filled with practical, step-by-step instructions and clear explanations for the most important and useful tasks. A tutorial guide that walks you through how to use the features of Spring Tool Suite using well defined sections for the different parts of Spring.Instant Spring Tool Suite is for novice to intermediate Java developers looking to get a head-start in enterprise application development using Spring Tool Suite and the Spring framework. If you are looking for a guide for effective application development using Spring Tool Suite, then this book is for you.

  20. Plethodon cinerius (eastern red-backed salamander) movement

    Science.gov (United States)

    Sterrett, Sean; Brand, Adrianne; Fields, William R.; Katz, Rachel A.; Grant, Evan H. Campbell

    2015-01-01

    Lungless salamanders (family Plethodontidae) are relatively sedentary and are presumed to have limited dispersal ability (Marsh et al. 2004. Ecology 85:3396–3405). Site fidelity in Plethodontidae is high, and individuals displaced 90 m return to home territories (Kleeberger and Werner 1982. Copeia 1982:409–415). Individuals defend territories (Jaeger et al. 1982. Anim. Behav. 30:490–496) and female home ranges have been estimated to be 24.34 m2 (Kleeberger and Werner 1982, op. cit.). Females may seek out suitable subsurface habitat to oviposit eggs, yet little is known about their maximum movement distances (Petranka 1998. Salamanders of the United States and Canada. Smithsonian Institution Press, Washington. 587 pp.).On 18 September 2014, a female P. cinereus (lead back morphotype; SVL = 44.68 mm; 0.89 g) was found under a coverboard during a standard sampling event and uniquely marked using visual implant elastomer at the S.O. Conte Anadromous Fish Research Center, Massachusetts, USA (42.59280°N, 72.58070°W, datum WGS84; elev. 74 m). This individual was subsequently recaptured at ~1500 h on 8 October 2014 under a coverboard within 3 m of the original capture location and then again ~1430 h on 16 October 2014 under a log, within the same forest patch, though in a 50 x 150 m area adjacent to the original study area. Because we found the marked salamander while collecting multiple individuals for a laboratory study, the exact recapture location of the marked individual is not known. However, the distance between the 8 October capture location and the nearest edge of the 16 October search area (i.e. 50 x 150 m) was 143 m, indicating a minimum movement distance. As far as we are aware, this is the longest recorded movement for P. cinereus by more than 53 m (Kleeberger and Werner 1982, op. cit.). This finding followed a rain event of 1.63 cm within 24 h and the second largest sustained rain event during October. The movement we observed may have been due to

  1. Predicted Changes in Climatic Niche and Climate Refugia of Conservation Priority Salamander Species in the Northeastern United States

    Directory of Open Access Journals (Sweden)

    William B. Sutton

    2014-12-01

    Full Text Available Global climate change represents one of the most extensive and pervasive threats to wildlife populations. Amphibians, specifically salamanders, are particularly susceptible to the effects of changing climates due to their restrictive physiological requirements and low vagility; however, little is known about which landscapes and species are vulnerable to climate change. Our study objectives included, (1 evaluating species-specific predictions (based on 2050 climate projections and vulnerabilities to climate change and (2 using collective species responses to identify areas of climate refugia for conservation priority salamanders in the northeastern United States. All evaluated salamander species were projected to lose a portion of their climatic niche. Averaged projected losses ranged from 3%–100% for individual species, with the Cow Knob Salamander (Plethodon punctatus, Cheat Mountain Salamander (Plethodon nettingi, Shenandoah Mountain Salamander (Plethodon virginia, Mabee’s Salamander (Ambystoma mabeei, and Streamside Salamander (Ambystoma barbouri predicted to lose at least 97% of their landscape-scale climatic niche. The Western Allegheny Plateau was predicted to lose the greatest salamander climate refugia richness (i.e., number of species with a climatically-suitable niche in a landscape patch, whereas the Central Appalachians provided refugia for the greatest number of species during current and projected climate scenarios. Our results can be used to identify species and landscapes that are likely to be further affected by climate change and potentially resilient habitats that will provide consistent climatic conditions in the face of environmental change.

  2. Positional identity of adult stem cells in salamander limb regeneration.

    Science.gov (United States)

    Kumar, Anoop; Gates, Phillip B; Brockes, Jeremy P

    2007-01-01

    Limb regeneration in larval and adult salamanders proceeds from a mound of mesenchymal stem cells called the limb blastema. The blastema gives rise just to those structures distal to its level of origin, and this property of positional identity is reset to more proximal values by treatment with retinoic acid. We have identified a cell surface protein, called Prod1/CD59, which appears to be a determinant of proximodistal identity. Prod1 is expressed in an exponential gradient in an adult limb as determined by detection of both mRNA and immunoreactive protein. Prod1 protein is up-regulated after treatment of distal blastemas with RA and this is particularly marked in cells of the dermis. These cells have previously been implicated in pattern formation during limb regeneration.

  3. Water Treatment Technology - Springs.

    Science.gov (United States)

    Ross-Harrington, Melinda; Kincaid, G. David

    One of twelve water treatment technology units, this student manual on springs provides instructional materials for two competencies. (The twelve units are designed for a continuing education training course for public water supply operators.) The competencies focus on spring basin construction and spring protection. For each competency, student…

  4. Pro Spring Batch

    CERN Document Server

    Minella, Michael T

    2011-01-01

    Since its release, Spring Framework has transformed virtually every aspect of Java development including web applications, security, aspect-oriented programming, persistence, and messaging. Spring Batch, one of its newer additions, now brings the same familiar Spring idioms to batch processing. Spring Batch addresses the needs of any batch process, from the complex calculations performed in the biggest financial institutions to simple data migrations that occur with many software development projects. Pro Spring Batch is intended to answer three questions: *What? What is batch processing? What

  5. IMPACT OF GUTHION ON SURVIVAL AND GROWTH OF THE FROG PSEUDACRIS REGILLA AND THE SALAMANDERS AMBYSTOMA GRACILE AND AMBYSTOMA MACULATUM

    Science.gov (United States)

    The effects of the insecticides Guthion (technical grade) and Guthion 2S(commercial formulation) on survival and growth of tadpoles of the Pacific treefrog Pseudacris regilla, and larvae of the Northwestern salamander Ambystoma gracile and the spotted salamander Ambystoma macula...

  6. Morphological variation in two genetically distinct groups of the golden-striped salamander, Chioglossa lusitanica (Amphibia: Urodela)

    NARCIS (Netherlands)

    Alexandrino, J.; Ferrand, N.; Arntzen, J.W.

    2005-01-01

    Morphometric and colour pattern variation in the endemic Iberian salamander Chioglossa lusitanica is concordant with the genetic differentiation of two groups of populations separated by the Mondego river in Portugal. Salamanders from the south have shorter digits than those from the north. Clinal v

  7. Numerical variations and spontaneous malformations in the early embryos of the Korean salamander, Hynobius leechii, in the farmlands of Korea.

    Science.gov (United States)

    Park, Yong-Uk; Yoon, Chun-Sik; Kim, Jong-Hyang; Park, Joo-Hung; Cheong, Seon-Woo

    2010-12-01

    Embryo sacs of the Korean salamander, Hynobius leechii, were collected from nine farmlands in Gyeongsangnam-Do, Korea, in early spring of 2002 and 2004. The variations in the number of embryos within each embryo sac and the mortality and abnormality rates among the embryos were investigated. We also analyzed the patterns of spontaneous embryonic malformations and the residual chemicals in the soil of the habitats using multiple-residue GC/MS. A total of 79,195 embryos were obtained from 1933 embryo sacs. There were regional variations in the length of individual embryo sacs and the number of embryos in each. The longest embryo sac averaged by region measured 20.67 cm ± 3.51 and was obtained from 2-Banseong in 2002. Of the embryos collected, 13.71% either died or stopped developing, and 3.54% of the hatched embryos developed abnormally; the latter were classified according to the patterns of malformation. External gill dysplasia was the most frequent malformation, and caudal dysplasia, abdominal blisters, and dysplasia of the fin were also observed frequently. Histopathological analysis showed neural tube abnormalities, acrania, curved notochords, thyroid teratoma, and various other kinds of endodermal developmental abnormalities. In the analysis of the residual pesticides in the soil, carbofuran, endosulfan-sulfate, and endosulfan-β were detected in the regions with high mortality and malformation rates. These results indicate that various agricultural chemicals and other unknown factors may cause the aforementioned forms of spontaneous malformations in the embryos of Hynobius leechii.

  8. Estimating superpopulation size and annual probability of breeding for pond-breeding salamanders

    Science.gov (United States)

    Kinkead, K.E.; Otis, D.L.

    2007-01-01

    It has long been accepted that amphibians can skip breeding in any given year, and environmental conditions act as a cue for breeding. In this paper, we quantify temporary emigration or nonbreeding probability for mole and spotted salamanders (Ambystoma talpoideum and A. maculatum). We estimated that 70% of mole salamanders may skip breeding during an average rainfall year and 90% may skip during a drought year. Spotted salamanders may be more likely to breed, with only 17% avoiding the breeding pond during an average rainfall year. We illustrate how superpopulations can be estimated using temporary emigration probability estimates. The superpopulation is the total number of salamanders associated with a given breeding pond. Although most salamanders stay within a certain distance of a breeding pond for the majority of their life spans, it is difficult to determine true overall population sizes for a given site if animals are only captured during a brief time frame each year with some animals unavailable for capture at any time during a given year. ?? 2007 by The Herpetologists' League, Inc.

  9. Anatomy, function, and evolution of jaw and hyobranchial muscles in cryptobranchoid salamander larvae.

    Science.gov (United States)

    Kleinteich, Thomas; Herzen, Julia; Beckmann, Felix; Matsui, Masafumi; Haas, Alexander

    2014-02-01

    Larval salamanders (Lissamphibia: Caudata) are known to be effective suction feeders in their aquatic environments, although they will eventually transform into terrestrial tongue feeding adults during metamorphosis. Early tetrapods may have had a similar biphasic life cycle and this makes larval salamanders a particularly interesting model to study the anatomy, function, development, and evolution of the feeding apparatus in terrestrial vertebrates. Here, we provide a description of the muscles that are involved in the feeding strike in salamander larvae of the Hynobiidae and compare them to larvae of the paedomorphic Cryptobranchidae. We provide a functional and evolutionary interpretation for the observed muscle characters. The cranial muscles in larvae from species of the Hynobiidae and Cryptobranchidae are generally very similar. Most notable are the differences in the presence of the m. hyomandibularis, a muscle that connects the hyobranchial apparatus with the lower jaw. We found this muscle only in Onychodactylus japonicus (Hynobiidae) but not in other hynobiid or cryptobranchid salamanders. Interestingly, the m. hyomandibularis in O. japonicus originates from the ceratobranchial I and not the ceratohyal, and thus exhibits what was previously assumed to be the derived condition. Finally, we applied a biomechanical model to simulate suction feeding in larval salamanders. We provide evidence that a flattened shape of the hyobranchial apparatus in its resting position is beneficial for a fast and successful suction feeding strike.

  10. Interactions between introduced trout and larval salamanders (Ambystoma macrodactylum) in high-elevation lakes

    Science.gov (United States)

    Tyler, T.; Liss, W.J.; Ganio, L.; Larson, Gary L.; Hoffman, Robert L.; Deimling, E.; Lomnicky, G.A.

    1998-01-01

    The larval stage of the long-toed salamander (Ambystoma macrodactylum) is the top vertebrate predator in high-elevation fishless lakes in the North Cascades National Park Service Complex, Washington (U.S.A.). Although most of these high-elevation lakes were naturally fishless, trout have been stocked in many of them. We sought to determine the effects of physicochemical factors and introduced trout on abundance and behavior of A. macrodactylum larvae. Larval salamander densities were estimated by snorkeling. Snorkelers carefully searched through substrate materials within 2 m of the shoreline and recorded the number of larvae observed and if larvae were hidden in benthic substrates. Physicochemical factors were measured in each lake on the same day that snorkel surveys were conducted. In fishless lakes, larval salamander densities were positively related to total Kjeldahl-N concentration and negatively related to lake elevation. Crustacean zooplankton, especially cladocerans, were important food resources for larval A. macrodactylum. Crustacean zooplankton and cladoceran densities were positively related to total Kjeldahl-N, suggesting that increased food resources contributed to increased densities of larval A. macrodactylum. Differences in larval salamander densities between fish and fishless lakes were related to total Kjeldahl-N concentrations and the reproductive status of trout. Mean larval salamander densities for fishless lakes with total Kjeldahl-N amphibians requires an understanding of natural abiotic and biotic factors and processes influencing amphibian distribution and abundance.

  11. A case for using Plethodontid salamanders for monitoring biodiversity and ecosystem integrity of North American forests

    Science.gov (United States)

    Welsh, H.H.; Droege, S.

    2001-01-01

    Terrestrial salamanders of the family P!ethodontidae have unique attributes that make them excellent indicators of biodiversity and ecosystem integrity in forested habitats. Their longevity, small territory size, site fidelity, sensitivity to natural and anthropogenic perturbations, tendency to occur in high densities, and low sampling costs mean that counts of plethodontid salamanders provide numerous advantages over counts of other North American forest organisms for indicating environmental change. Furthermore, they are tightly linked physiologically to microclimatic and successional processes that influence the distribution and abundance of numerous other hydrophilic but difficult-to-study forest-dwelling plants and animals. Ecosystem processes such as moisture cycling, food-web dynamics, and succession, with their related structural and microclimatic variability, all affect forest biodiversity and have been shown to affect salamander populations as well. We determined the variability associated with sampling for plethodontid salamanders by estimating the coefficient of variation (CV) from available time-series data. The median coefficient of variation indicated that variation in counts of individuals among studies was much lower in plethodonticis (27%) than in lepidoptera (93%), passerine birds (57%), small mammals (69%), or other amphibians (37-46%), which means plethodontid salamanders provide an important statistical advantage over other species for monitoring long-term forest health.

  12. Stream water temperature limits occupancy of salamanders in mid-Atlantic protected areas

    Science.gov (United States)

    Grant, Evan H. Campbell; Wiewel, Amber N. M.; Rice, Karen C.

    2014-01-01

    Stream ecosystems are particularly sensitive to urbanization, and tolerance of water-quality parameters is likely important to population persistence of stream salamanders. Forecasted climate and landscape changes may lead to significant changes in stream flow, chemical composition, and temperatures in coming decades. Protected areas where landscape alterations are minimized will therefore become increasingly important for salamander populations. We surveyed 29 streams at three national parks in the highly urbanized greater metropolitan area of Washington, DC. We investigated relationships among water-quality variables and occupancy of three species of stream salamanders (Desmognathus fuscus, Eurycea bislineata, and Pseudotriton ruber). With the use of a set of site-occupancy models, and accounting for imperfect detection, we found that stream-water temperature limits salamander occupancy. There was substantial uncertainty about the effects of the other water-quality variables, although both specific conductance (SC) and pH were included in competitive models. Our estimates of occupancy suggest that temperature, SC, and pH have some importance in structuring stream salamander distribution.

  13. Larval long-toed salamanders incur nonconsumptive effects in the presence of nonnative trout

    Science.gov (United States)

    Kenison, Erin K.; Litt, Andrea R.; Pilliod, David; McMahon, Thomas E.

    2016-01-01

    Predators can influence prey directly through consumption or indirectly through nonconsumptive effects (NCEs) by altering prey behavior, morphology, and life history. We investigated whether predator-avoidance behaviors by larval long-toed salamanders (Ambystoma macrodactylum) in lakes with nonnative trout result in NCEs on morphology and development. Field studies in lakes with and without trout were corroborated by experimental enclosures, where prey were exposed only to visual and chemical cues of predators. We found that salamanders in lakes with trout were consistently smaller than in lakes without trout: 38% lower weight, 24% shorter body length, and 29% shorter tail length. Similarly, salamanders in protective enclosures grew 2.9 times slower when exposed to visual and olfactory trout cues than when no trout cues were present. Salamanders in trout-free lakes and enclosures were 22.7 times and 1.48 times, respectively, more likely to metamorphose during the summer season than those exposed to trout in lakes and/or their cues. Observed changes in larval growth rate and development likely resulted from a facultative response to predator-avoidance behavior and demonstrate NCEs occurred even when predation risk was only perceived. Reduced body size and growth, as well as delayed metamorphosis, could have ecological consequences for salamander populations existing with fish if those effects carry-over into lower recruitment, survival, and fecundity.

  14. Low levels of LTR retrotransposon deletion by ectopic recombination in the gigantic genomes of salamanders.

    Science.gov (United States)

    Frahry, Matthew Blake; Sun, Cheng; Chong, Rebecca A; Mueller, Rachel Lockridge

    2015-02-01

    Across the tree of life, species vary dramatically in nuclear genome size. Mutations that add or remove sequences from genomes-insertions or deletions, or indels-are the ultimate source of this variation. Differences in the tempo and mode of insertion and deletion across taxa have been proposed to contribute to evolutionary diversity in genome size. Among vertebrates, most of the largest genomes are found within the salamanders, an amphibian clade with genome sizes ranging from ~14 to ~120 Gb. Salamander genomes have been shown to experience slower rates of DNA loss through small (i.e., salamander genomes resulting from larger deletions. Here, we focus on one type of large deletion-ectopic-recombination-mediated removal of LTR retrotransposon sequences. In ectopic recombination, double-strand breaks are repaired using a "wrong" (i.e., ectopic, or non-allelic) template sequence-typically another locus of similar sequence. When breaks occur within the LTR portions of LTR retrotransposons, ectopic-recombination-mediated repair can produce deletions that remove the internal transposon sequence and the equivalent of one of the two LTR sequences. These deletions leave a signature in the genome-a solo LTR sequence. We compared levels of solo LTRs in the genomes of four salamander species with levels present in five vertebrates with smaller genomes. Our results demonstrate that salamanders have low levels of solo LTRs, suggesting that ectopic-recombination-mediated deletion of LTR retrotransposons occurs more slowly than in other vertebrates with smaller genomes.

  15. Salamanders increase their feeding activity when infected with the pathogenic chytrid fungus Batrachochytrium dendrobatidis.

    Science.gov (United States)

    Hess, Alexandra; McAllister, Caroline; DeMarchi, Joseph; Zidek, Makenzie; Murone, Julie; Venesky, Matthew D

    2015-10-27

    Immune function is a costly line of defense against parasitism. When infected with a parasite, hosts frequently lose mass due to these costs. However, some infected hosts (e.g. highly resistant individuals) can clear infections with seemingly little fitness losses, but few studies have tested how resistant hosts mitigate these costly immune defenses. We explored this topic using eastern red-backed salamanders Plethodon cinereus and the fungal pathogen Batrachochytrium dendrobatidis (Bd). Bd is generally lethal for amphibians, and stereotypical symptoms of infection include loss in mass and deficits in feeding. However, individuals of P. cinereus can clear their Bd infections with seemingly few fitness costs. We conducted an experiment in which we repeatedly observed the feeding activity of Bd-infected and non-infected salamanders. We found that Bd-infected salamanders generally increased their feeding activity compared to non-infected salamanders. The fact that we did not observe any differences in mass change between the treatments suggests that increased feeding might help Bd-infected salamanders minimize the costs of an effective immune response.

  16. Hybrid vigor between native and introduced salamanders raises new challenges for conservation.

    Science.gov (United States)

    Fitzpatrick, Benjamin M; Shaffer, H Bradley

    2007-10-02

    Hybridization between differentiated lineages can have many different consequences depending on fitness variation among hybrid offspring. When introduced organisms hybridize with natives, the ensuing evolutionary dynamics may substantially complicate conservation decisions. Understanding the fitness consequences of hybridization is an important first step in predicting its evolutionary outcome and conservation impact. Here, we measured natural selection caused by differential viability of hybrid larvae in wild populations where native California Tiger Salamanders (Ambystoma californiense) and introduced Barred Tiger Salamanders (Ambystoma tigrinum mavortium) have been hybridizing for 50-60 years. We found strong evidence of hybrid vigor; mixed-ancestry genotypes had higher survival rates than genotypes containing mostly native or mostly introduced alleles. Hybrid vigor may be caused by heterozygote advantage (overdominance) or recombinant hybrid vigor (due to epistasis or complementation). These genetic mechanisms are not mutually exclusive, and we find statistical support for both overdominant and recombinant contributions to hybrid vigor in larval tiger salamanders. Because recombinant homozygous genotypes can breed true, a single highly fit genotype with a mosaic of native and introduced alleles may eventually replace the historically pure California Tiger Salamander (listed as Threatened under the U.S. Endangered Species Act). The management implications of this outcome are complex: Genetically pure populations may not persist into the future, but average fitness and population viability of admixed California Tiger Salamanders may be enhanced. The ecological consequences for other native species are unknown.

  17. Spring integration essentials

    CERN Document Server

    Pandey, Chandan

    2015-01-01

    This book is intended for developers who are either already involved with enterprise integration or planning to venture into the domain. Basic knowledge of Java and Spring is expected. For newer users, this book can be used to understand an integration scenario, what the challenges are, and how Spring Integration can be used to solve it. Prior experience of Spring Integration is not expected as this book will walk you through all the code examples.

  18. Pro Spring Integration

    CERN Document Server

    Lui, M; Chan, Andy; Long, Josh

    2011-01-01

    Pro Spring Integration is an authoritative book from the experts that guides you through the vast world of enterprise application integration (EAI) and application of the Spring Integration framework towards solving integration problems. The book is:. * An introduction to the concepts of enterprise application integration * A reference on building event-driven applications using Spring Integration * A guide to solving common integration problems using Spring Integration What makes this book unique is its coverage of contemporary technologies and real-world information, with a focus on common p

  19. Low metabolic rates in salamanders are correlated with weak selective constraints on mitochondrial genes.

    Science.gov (United States)

    Chong, Rebecca A; Mueller, Rachel Lockridge

    2013-03-01

    Mitochondria are the site for the citric acid cycle and oxidative phosphorylation (OXPHOS), the final steps of ATP synthesis via cellular respiration. Each mitochondrion contains its own genome; in vertebrates, this is a small, circular DNA molecule that encodes 13 subunits of the multiprotein OXPHOS electron transport complexes. Vertebrate lineages vary dramatically in metabolic rates; thus, functional constraints on mitochondrial-encoded proteins likely differ, potentially impacting mitochondrial genome evolution. Here, we examine mitochondrial genome evolution in salamanders, which have the lowest metabolic requirements among tetrapods. We show that salamanders experience weaker purifying selection on protein-coding sequences than do frogs, a comparable amphibian clade with higher metabolic rates. In contrast, we find no evidence for weaker selection against mitochondrial genome expansion in salamanders. Together, these results suggest that different aspects of mitochondrial genome evolution (i.e., nucleotide substitution, accumulation of noncoding sequences) are differently affected by metabolic variation across tetrapod lineages.

  20. Heterogeneous vesicles in mucous epithelial cells of posterior esophagus of Chinese giant salamander (Andrias davidianus

    Directory of Open Access Journals (Sweden)

    H. Zhang

    2015-08-01

    Full Text Available The Chinese giant salamander belongs to an old lineage of salamanders and endangered species. Many studies of breeding and disease regarding this amphibian had been implemented. However, the studies on the ultrastructure of this amphibian are rare. In this work, we provide a histological and ultrastructural investigation on posterior esophagus of Chinese giant salamander. The sections of amphibian esophagus were stained by hematoxylin & eosin (H&E. Moreover, the esophageal epithelium was observed by transmission electron microscopy (TEM. The results showed that esophageal epithelium was a single layer epithelium, which consisted of mucous cells and columnar cells. The esophageal glands were present in submucosa. The columnar cells were ciliated. According to the diverging ultrastructure of mucous vesicles, three types of mucous cells could be identified in the esophageal mucosa: i electron-lucent vesicles mucous cell (ELV-MC; ii electron-dense vesicles mucous cell (EDV-MC; and iii mixed vesicles mucous cell (MV-MC.

  1. Resource partitioning in two stream salamanders, Dicamptodon tenebrosus and Rhyacotriton cascadae, from the Oregon Cascade Mountains

    Science.gov (United States)

    Cudmore, Wynn W.; Bury, R. Bruce

    2014-01-01

    We investigated the potential for resource partitioning between the Coastal giant salamander (Dicamptodon tenebrosus) and the Cascade torrent salamander (Rhyacotriton cascadae) by examining their diet and microhabitats in forest streams. Larval D. tenebrosus and R. cascadae fed primarily upon aquatic insect larvae. We found similar foods in larval and adult R. cascadae and combined these results. Dicamptodon larvae consumed ephemeropteran, plecopteran, and trichopteran larvae in about equal amounts whereas R. cascadae ate more trichopteran and less ephemeropteran larvae than D. tenebrosus. Diet of all R. cascadae overlapped more with smaller than larger sized D. tenebrosus larvae. Comparisons of diets with available foods indicated R. cascadae is more selective or more gape-limited in its feeding habits than D. tenebrosus larvae. The two salamanders differed in use of microhabitats in creeks, which may contribute to their diet differences.

  2. Wildlife disease. Recent introduction of a chytrid fungus endangers Western Palearctic salamanders.

    Science.gov (United States)

    Martel, A; Blooi, M; Adriaensen, C; Van Rooij, P; Beukema, W; Fisher, M C; Farrer, R A; Schmidt, B R; Tobler, U; Goka, K; Lips, K R; Muletz, C; Zamudio, K R; Bosch, J; Lötters, S; Wombwell, E; Garner, T W J; Cunningham, A A; Spitzen-van der Sluijs, A; Salvidio, S; Ducatelle, R; Nishikawa, K; Nguyen, T T; Kolby, J E; Van Bocxlaer, I; Bossuyt, F; Pasmans, F

    2014-10-31

    Emerging infectious diseases are reducing biodiversity on a global scale. Recently, the emergence of the chytrid fungus Batrachochytrium salamandrivorans resulted in rapid declines in populations of European fire salamanders. Here, we screened more than 5000 amphibians from across four continents and combined experimental assessment of pathogenicity with phylogenetic methods to estimate the threat that this infection poses to amphibian diversity. Results show that B. salamandrivorans is restricted to, but highly pathogenic for, salamanders and newts (Urodela). The pathogen likely originated and remained in coexistence with a clade of salamander hosts for millions of years in Asia. As a result of globalization and lack of biosecurity, it has recently been introduced into naïve European amphibian populations, where it is currently causing biodiversity loss.

  3. Two new species of Salamanders, Genus Bolitoglossa (Amphibia: Plethodontidae), from the Eastern Colombian Andes.

    Science.gov (United States)

    Acevedo, Aldemar A; Wake, David B; Márquez, Roberto; Silva, Karen; Franco, Rosmery; Amézquita, Adolfo

    2013-01-25

    The salamander fauna of Colombia is very poorly known, probably because most research efforts have been devoted to anurans during the last two decades. Here, we describe two new species of the genus Bolitoglossa (Eladinea) from the eastern flank of the Eastern Colombian Andes (Cordillera Oriental), near the border with Venezuela. Bolitoglossa tamaense sp. nov. is distributed between 2000 to 2700 m.a.s.l. and Bolitoglossa leandrae sp. nov. is distributed in the low-lands at about 600 m. The new species are diagnosed by a combination of molecular (16S rRNA sequences), coloration, body size, and morphometric (number of maxillary and vomerine teeth and differences in foot webbing) characters. Both species face threats such as chytridiomycosis infections and habitat fragmentation that have already affected other sala-manders in the country. Thus, intensive field and museum work is needed to better document and perhaps protect the local salamander diversity.

  4. An orphan gene is necessary for preaxial digit formation during salamander limb development.

    Science.gov (United States)

    Kumar, Anoop; Gates, Phillip B; Czarkwiani, Anna; Brockes, Jeremy P

    2015-10-26

    Limb development in salamanders differs from other tetrapods in that the first digits to form are the two most anterior (preaxial dominance). This has been proposed as a salamander novelty and its mechanistic basis is unknown. Salamanders are the only adult tetrapods able to regenerate the limb, and the contribution of preaxial dominance to limb regeneration is unclear. Here we show that during early outgrowth of the limb bud, a small cohort of cells express the orphan gene Prod1 together with Bmp2, a critical player in digit condensation in amniotes. Disruption of Prod1 with a gene-editing nuclease abrogates these cells, and blocks formation of the radius and ulna, and outgrowth of the anterior digits. Preaxial dominance is a notable feature of limb regeneration in the larval newt, but this changes abruptly after metamorphosis so that the formation of anterior and posterior digits occurs together within the autopodium resembling an amniote-like pattern.

  5. Salamander limb regeneration involves the activation of a multipotent skeletal muscle satellite cell population.

    Science.gov (United States)

    Morrison, Jamie I; Lööf, Sara; He, Pingping; Simon, András

    2006-01-30

    In contrast to mammals, salamanders can regenerate complex structures after injury, including entire limbs. A central question is whether the generation of progenitor cells during limb regeneration and mammalian tissue repair occur via separate or overlapping mechanisms. Limb regeneration depends on the formation of a blastema, from which the new appendage develops. Dedifferentiation of stump tissues, such as skeletal muscle, precedes blastema formation, but it was not known whether dedifferentiation involves stem cell activation. We describe a multipotent Pax7+ satellite cell population located within the skeletal muscle of the salamander limb. We demonstrate that skeletal muscle dedifferentiation involves satellite cell activation and that these cells can contribute to new limb tissues. Activation of salamander satellite cells occurs in an analogous manner to how the mammalian myofiber mobilizes stem cells during skeletal muscle tissue repair. Thus, limb regeneration and mammalian tissue repair share common cellular and molecular programs. Our findings also identify satellite cells as potential targets in promoting mammalian blastema formation.

  6. Fundamental differences in dedifferentiation and stem cell recruitment during skeletal muscle regeneration in two salamander species.

    Science.gov (United States)

    Sandoval-Guzmán, Tatiana; Wang, Heng; Khattak, Shahryar; Schuez, Maritta; Roensch, Kathleen; Nacu, Eugeniu; Tazaki, Akira; Joven, Alberto; Tanaka, Elly M; Simon, András

    2014-02-06

    Salamanders regenerate appendages via a progenitor pool called the blastema. The cellular mechanisms underlying regeneration of muscle have been much debated but have remained unclear. Here we applied Cre-loxP genetic fate mapping to skeletal muscle during limb regeneration in two salamander species, Notophthalmus viridescens (newt) and Ambystoma mexicanum (axolotl). Remarkably, we found that myofiber dedifferentiation is an integral part of limb regeneration in the newt, but not in axolotl. In the newt, myofiber fragmentation results in proliferating, PAX7(-) mononuclear cells in the blastema that give rise to the skeletal muscle in the new limb. In contrast, myofibers in axolotl do not generate proliferating cells, and do not contribute to newly regenerated muscle; instead, resident PAX7(+) cells provide the regeneration activity. Our results therefore show significant diversity in limb muscle regeneration mechanisms among salamanders and suggest that multiple strategies may be feasible for inducing regeneration in other species, including mammals.

  7. Fictive rhythmic motor patterns produced by the tail spinal cord in salamanders.

    Science.gov (United States)

    Charrier, V; Cabelguen, J-M

    2013-01-01

    Most investigations into the role of the body axis in vertebrate locomotion have focused on the trunk, although in most tetrapods, the tail also plays an active role. In salamanders, the tail contributes to propulsion during swimming and to dynamic balance and maneuverability during terrestrial locomotion. The aim of the present study was to obtain information concerning the neural mechanisms that produce tail muscle contractions during locomotion in the salamander Pleurodeles waltlii. We recorded the ventral root activities in in vitro spinal cord preparations in which locomotor-like activity was induced via bath application of N-methyl-d-aspartate (20μM) and d-serine (10μM). Recordings showed that the tail spinal cord is capable of producing propagated waves of motor activity that alternate between the left and right sides. Lesion experiments further revealed that the tail rhythmogenic network is composed of a double chain of identical hemisegmental oscillators. Finally, using spinal cord preparations bathed in a chamber partitioned into two pools, we revealed efficient short-distance coupling between the trunk and tail networks. Together, our results demonstrate the existence of a pattern generator for rhythmic tail movements in the salamander and show that the global architecture of the tail network is similar to that previously proposed for the mid-trunk locomotor network in the salamander. Our findings further support the view that salamanders can control their trunk and tail independently during stepping movements. The relevance of our results in relation to the generation of tail muscle contractions in freely moving salamanders is discussed.

  8. Rangewide landscape genetics of an endemic Pacific northwestern salamander.

    Science.gov (United States)

    Trumbo, Daryl R; Spear, Stephen F; Baumsteiger, Jason; Storfer, Andrew

    2013-03-01

    A species' genetic structure often varies in response to ecological and landscape processes that differ throughout the species' geographic range, yet landscape genetics studies are rarely spatially replicated. The Cope's giant salamander (Dicamptodon copei) is a neotenic, dispersal-limited amphibian with a restricted geographic range in the Pacific northwestern USA. We investigated which landscape factors affect D. copei gene flow in three regions spanning the species' range, which vary in climate, landcover and degree of anthropogenic disturbance. Least cost paths and Circuitscape resistance analyses revealed that gene flow patterns vary across the species' range, with unique combinations of landscape variables affecting gene flow in different regions. Populations in the northern coastal portions of the range had relatively high gene flow, largely facilitated by stream and river networks. Near the southeastern edge of the species' range, gene flow was more restricted overall, with relatively less facilitation by streams and more limitation by heat load index and fragmented forest cover. These results suggested that the landscape is more difficult for individuals to disperse through at the southeastern edge of the species' range, with terrestrial habitat desiccation factors becoming more limiting to gene flow. We suggest that caution be used when attempting to extrapolate landscape genetic models and conservation measures from one portion of a species' range to another.

  9. Batrachochytrium salamandrivorans is the predominant chytrid fungus in Vietnamese salamanders

    Science.gov (United States)

    Laking, Alexandra E.; Ngo, Hai Ngoc; Pasmans, Frank; Martel, An; Nguyen, Tao Thien

    2017-01-01

    The amphibian chytrid fungi, Batrachochytrium dendrobatidis (Bd) and B. salamandrivorans (Bsal), pose a major threat to amphibian biodiversity. Recent evidence suggests Southeast Asia as a potential cradle for both fungi, which likely resulted in widespread host-pathogen co-existence. We sampled 583 salamanders from 8 species across Vietnam in 55 locations for Bsal and Bd, determined scaled mass index as a proxy for fitness and collected environmental data. Bsal was found within 14 of the 55 habitats (2 of which it was detected in 2013), in 5 salamandrid species, with a prevalence of 2.92%. The globalized pandemic lineage of Bd was found within one pond on one species with a prevalence of 0.69%. Combined with a complete lack of correlation between infection and individual body condition and absence of indication of associated disease, this suggests low level pathogen endemism and Bsal and Bd co-existence with Vietnamese salamandrid populations. Bsal was more widespread than Bd, and occurs at temperatures higher than tolerated by the type strain, suggesting a wider thermal niche than currently known. Therefore, this study provides support for the hypothesis that these chytrid fungi may be endemic to Asia and that species within this region may act as a disease reservoir. PMID:28287614

  10. The effect of waist twisting on walking speed of an amphibious salamander like robot

    Science.gov (United States)

    Yin, Xin-Yan; Jia, Li-Chao; Wang, Chen; Xie, Guang-Ming

    2016-06-01

    Amphibious salamanders often swing their waist to coordinate quadruped walking in order to improve their crawling speed. A robot with a swing waist joint, like an amphibious salamander, is used to mimic this locomotion. A control method is designed to allow the robot to maintain the rotational speed of its legs continuous and avoid impact between its legs and the ground. An analytical expression is established between the amplitude of the waist joint and the step length. Further, an optimization amplitude is obtained corresponding to the maximum stride. The simulation results based on automatic dynamic analysis of mechanical systems (ADAMS) and physical experiments verify the rationality and validity of this expression.

  11. The effect of waist twisting on walking speed of an amphibious salamander like robot

    Institute of Scientific and Technical Information of China (English)

    Xin-Yan Yin; Li-Chao Jia; Chen Wang; Guang-Ming Xie

    2016-01-01

    Amphibious salamanders often swing their waist to coordinate quadruped walking in order to improve their crawling speed. A robot with a swing waist joint, like an amphibious salamander, is used to mimic this locomotion. A control method is designed to allow the robot to maintain the rotational speed of its legs continuous and avoid impact between its legs and the ground. An analytical expression is established between the amplitude of the waist joint and the step length. Further, an optimization amplitude is obtained corresponding to the maximum stride. The simulation results based on automatic dynamic analysis of mechanical systems (ADAMS) and physical experiments verify the rationality and validity of this expression.

  12. Mockito for Spring

    CERN Document Server

    Acharya, Sujoy

    2015-01-01

    If you are an application developer with some experience in software testing and want to learn more about testing frameworks, then this technology and book is for you. Mockito for Spring will be perfect as your next step towards becoming a competent software tester with Spring and Mockito.

  13. Spring A Developer's Notebook

    CERN Document Server

    Tate, Bruce A

    2009-01-01

    This no-nonsense book quickly gets you up to speed on the new Spring open source framework. Favoring examples and practical application over theory, Spring: A Developer's Notebook features 10 code-intensive labs that'll reveal the many assets of this revolutionary, lightweight architecture. In the end, you'll understand how to produce simple, clean, and effective applications.

  14. Masters of the springs

    DEFF Research Database (Denmark)

    Laursen, Steffen

    2010-01-01

    led to a number of insights into the social organization of the mound cemeteries that will be presented in the paper. It is obvious that there existed a close spatial relation between freshwater springs and the compact mounds cemeteries that emerged c.2050 BC. The mound cemeteries appear to have been...... flanked by villages that relied on these water recourses for agricultural production. The springs emerged in the zone separating the cemeteries from the settlements. The freshwater springs were actively incorporated into the religious landscape of the dead, by consistently erecting mounds of a particular...... high status type right above the head of each spring. These tombs of the masters of the springs are distinguished by their larger size and vertical shaft entrance. It is argued that this particular strategy of power was employed after population growth had intensified conflicts over the rights...

  15. Long bone histology of the stem salamander Kokartus honorarius (Amphibia: Caudata) from the Middle Jurassic of Kyrgyzstan.

    Science.gov (United States)

    Skutschas, Pavel; Stein, Koen

    2015-04-01

    Kokartus honorarius from the Middle Jurassic (Bathonian) of Kyrgyzstan is one of the oldest salamanders in the fossil record, characterized by a mixture of plesiomorphic morphological features and characters shared with crown-group salamanders. Here we present a detailed histological analysis of its long bones. The analysis of a growth series demonstrates a significant histological maturation during ontogeny, expressed by the progressive appearance of longitudinally oriented primary vascular canals, primary osteons, growth marks, remodelling features in primary bone tissues, as well as progressive resorption of the calcified cartilage, formation of endochondral bone and development of cartilaginous to bony trabeculae in the epiphyses. Apart from the presence of secondary osteons, the long bone histology of Kokartus is very similar to that of miniaturized temnospondyls, other Jurassic stem salamanders, miniaturized seymouriamorphs and modern crown-group salamanders. We propose that the presence of secondary osteons in Kokartus honorarius is a plesiomorphic feature, and the loss of secondary osteons in the long bones of crown-group salamanders as well as in those of miniaturized temnospondyls is the result of miniaturization processes. Hitherto, all stem salamander long bong histology (Kokartus, Marmorerpeton and 'salamander A') has been generally described as having paedomorphic features (i.e. the presence of Katschenko's Line and a layer of calcified cartilage), these taxa were thus most likely neotenic forms. The absence of clear lines of arrested growth and annuli in long bones of Kokartus honorarius suggests that the animals lived in an environment with stable local conditions.

  16. Effect of arsenic on p53 mutation and occurrence of teratogenic salamanders: their potential as ecological indicators for arsenic contamination.

    Science.gov (United States)

    Chang, Jin-Soo; Gu, Man Bock; Kim, Kyoung-Woong

    2009-05-01

    The p53 mutation in salamanders can be used as an indicator of arsenic contamination. The influence of arsenic exposure was studied on mutation of tumor suppressor gene in salamanders collected from several As-contaminated mine areas in Korea. Salamander eggs and larvae were exposed to arsenic in a toxicity test, and teratogenic salamanders found in heavy metal- and As-contaminated water from As-Bi mines were evaluated using PCR-SSCP to determine if they would be useful as an ecological indicator species. Changes in amino acids were shown to have occurred as a result of an arsenic-accumulating event that occurred after the DNA damage. In addition, both of the Hynobius leechii exposed groups were primarily affected by forms of skin damage, changes in the lateral tail/dorsal flexure and/or abnormality teratogenesis. Single-base sense mutation in codons 346 (AAG: Lys to ATG: Met), 224 (TTT: Phe to TTA: Leu), 211 (ATG: Met to AAG: Lys), 244 (TTT: Phe to TTTG: insertion), 245 (Glu GAG to Gln CAG) and 249 (TGT Cys to TGA stop) of the p53 gene were simultaneously found in mutated salamanders. Based on the results of our data illustrating the effect of arsenic exposure on the p53 mutation of salamanders in arsenic-contaminated mine areas, these mutated salamanders can be used as potential ecological indicators in the arsenic-contaminated ecosystems.

  17. Responses of Eastern red-backed salamanders (Plethodon cinereus) to chemical cues of prey presented in soluble and volatile forms.

    Science.gov (United States)

    Telfer, A C; Laberge, F

    2013-04-10

    Terrestrial salamanders are able to detect prey items using chemical cues, but the nature of the cues involved is uncertain. This study aimed to tease apart the roles of the soluble and volatile components of prey cues detected by Eastern red-backed salamanders (Plethodon cinereus), assuming the likelihood that these different components are respectively detected by the vomeronasal (accessory) and main olfactory organs. Wild-caught salamanders were exposed to control or soluble and volatile cricket cues in two different behavioural assays conducted in the laboratory. The first series of assays focused on localized presentation of soluble cues on the substrate, and the second on point sources of volatile cues delivered through plastic tubes. Room temperature was varied across experiments. Salamanders increased chemoinvestigation of the substrate via nosetapping when soluble prey cues were distributed non-uniformly on the substrate. In the warmer of two temperatures tested, salamanders additionally showed a spatial preference for location of soluble cue deposition. Attraction to a point source of volatile cues was not evident when examining the responses of salamanders grouped together; however, investigation of the volatile point source was significantly correlated with side preference only when both soluble cues and a volatile point source were present. The latter suggests that a subset of salamanders were attracted to the point source of volatile cues in the presence of soluble cues on the substrate. This study indicates that soluble prey cues alone are sufficient to trigger salamander foraging behaviour, and that temperature influences this foraging response. It supports the notion that the vomeronasal system plays an important role in prey detection, but suggests that volatile cues are also investigated by some salamanders when soluble prey cues have been detected.

  18. telemetric data reveals ecolgoically adaptive behavior of captive raised chinese giant salamanders when reintroduced into their native habitat

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    little is known about the ecology of the chinese giant salamander (andrias davidianus),a critically endangered species.such information is needed to make informed decisions concerning the conservation and management of this species.four a.davidianus raised in a pool were released into their native habitat on 04 may 2005 and were subsequently radio-tracked for approximately 155-168 days.following their release,the giant salamanders traveled upstream in search of suitable micro-habitats,and settled after 10 days.later,a devastating summer flash flood destroyed the salamanders' dens,triggering another bout of habitat searching by the animals.eventually,the salamanders settled in different sections of the stream where they remained until the end of the study.on average,each habitat searching endeavor took 7.5 days,during which a giant salamander explored a 310 m stretch of stream with a surface area of about 1157 m2 and occupied 3.5 temporary dwellings.each giant salamander spent an average of 144.5 days in semi-permanent micro-habitats,and occupied territories that had a mean size of 34.75 m2.our results indicate that the chinese giant salamander responds to habitat disturbance by seeking new habitats upstream,both water temperature and water level affect the salamander's habitat searching activity,and the size of the salamander's semi-permanent territory is influenced by the size of the pool containing the animal's den.

  19. Molecular mechanisms of extensive mitochondrial gene rearrangementin plethodontid salamanders

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Rachel Lockridge; Boore, Jeffrey L.

    2005-06-01

    Extensive gene rearrangement is reported in the mitochondrial genomes of lungless salamanders (Plethodontidae). In each genome with a novel gene order, there is evidence that the rearrangement was mediated by duplication of part of the mitochondrial genome, including the presence of both pseudogenes and additional, presumably functional, copies of duplicated genes. All rearrangement-mediating duplications include either the origin of light strand replication and the nearby tRNA genes or the regions flanking the origin of heavy strand replication. The latter regions comprise nad6, trnE, cob, trnT, an intergenic spacer between trnT and trnP and, in some genomes, trnP, the control region, trnF, rrnS, trnV, rrnL, trnL1, and nad1. In some cases, two copies of duplicated genes, presumptive regulatory regions, and/or sequences with no assignable function have been retained in the genome following the initial duplication; in other genomes, only one of the duplicated copies has been retained. Both tandem and non-tandem duplications are present in these genomes, suggesting different duplication mechanisms. In some of these mtDNAs, up to 25 percent of the total length is composed of tandem duplications of non-coding sequence that includes putative regulatory regions and/or pseudogenes of tRNAs and protein-coding genes along with otherwise unassignable sequences. These data indicate that imprecise initiation and termination of replication, slipped-strand mispairing, and intra-molecular recombination may all have played a role in generating repeats during the evolutionary history of plethodontid mitochondrial genomes.

  20. The Spring Festival

    Institute of Scientific and Technical Information of China (English)

    萧平

    2005-01-01

    Everybody likes to have the Spring Festival, so do I.Because during the Spring Festival there are many good things to eat, to drink and to play with. During the last Spring Festival I had a very good time. On the eve of the festival, our family had a big dinner. My uncle, aunt and cousin came back from Canada to celebrate(庆祝) my grandma's eightieth birthday. They also brought many beautiful gifts to me. My cousin and I watched TV and played games the whole night, while the grown-ups had a long talk. I didn't know when I fell asleep.

  1. Effects of Buffering Key Habitat for Terrestrial Salamanders: Implications for the Management of the Federally Threatened Red Hills Salamander (Phaeognathus hubrichti and Other Imperiled Plethodontids

    Directory of Open Access Journals (Sweden)

    Joseph J. Apodaca

    2015-03-01

    Full Text Available Forestry practices are placing ever increasing emphasis on sustainability and the maintenance of ecological processes, biodiversity, and endangered species or populations. Balancing timber harvest and the management of imperiled species presents a particularly difficult challenge during this shift, as we often know very little about these species’ natural history and how and why silviculture practices affect their populations. Accordingly, investigation of and improvement on current management practices for threatened species is imperative. We investigated the effectiveness of habitat buffers as a management technique for the imperiled Red Hills salamander (Phaeognathus hubrichti by combining genetic, transect, and body-condition data. We found that populations where habitat buffers have been employed have higher genetic diversity and higher population densities, and individuals have better overall body condition. These results indicate that buffering the habitat of imperiled species can be an effective management tool for terrestrial salamanders. Additionally, they provide further evidence that leaving the habitat of imperiled salamanders unbuffered can have both immediate and long-term negative impacts on populations.

  2. Data from proteomic analysis of the skin of Chinese giant salamander (Andrias davidianus

    Directory of Open Access Journals (Sweden)

    Xiaofang Geng

    2015-06-01

    Full Text Available The Chinese giant salamander (Andrias davidianus, renowned as a living fossil, is the largest and longest-lived amphibian species in the world. Its skin is rich in collagens, and has developed mucous gland which could secrete a large amount of mucus under the scraping and electric stimulation. The molting is the degraded skin stratum corneum. To establish the functional skin proteome of Chinese giant salamander, two-dimensional gel electrophoresis (2DE and mass spectrometry (MS were applied to detect the composition and relative abundance of the proteins in the skin, mucus and molting. The determination of the general proteome in the skin can potentially serve as a foundation for future studies characterizing the skin proteomes from diseased salamander to provide molecular and mechanistic insights into various disease states and potential therapeutic interventions. Data presented here are also related to the research article “Proteomic analysis of the skin of Chinese giant salamander (Andrias davidianus” in the Journal of Proteomics [1].

  3. Behavioral and Physiological Responses of Ozark Zigzag Salamanders to Stimuli from an Invasive Predator: The Armadillo

    Directory of Open Access Journals (Sweden)

    Adam L. Crane

    2012-01-01

    Full Text Available When new predators invade a habitat, either through range extensions or introductions, prey may be at a high risk because they do not recognize the predators as dangerous. The nine-banded armadillo (Dasypus novemcinctus has recently expanded its range in North America. Armadillos forage by searching soil and leaf litter, consuming invertebrates and small vertebrates, including salamanders. We tested whether Ozark zigzag salamanders (Plethodon angusticlavius from a population coexisting with armadillos for about 30 years exhibit antipredator behavior in the presence of armadillo chemical cues and whether they can discriminate between stimuli from armadillos and a nonpredatory sympatric mammal (white-tailed deer, Odocoileus virginianus. Salamanders appeared to recognize substrate cues from armadillos as a threat because they increased escape behaviors and oxygen consumption. When exposed to airborne cues from armadillos, salamanders also exhibited an antipredator response by spending more time in an inconspicuous posture. Additionally, individually consistent behaviors across treatments for some response variables suggest the potential for a behavioral syndrome in this species.

  4. Sal-Site: Integrating new and existing ambystomatid salamander research and informational resources

    Directory of Open Access Journals (Sweden)

    Weisrock David W

    2005-12-01

    Full Text Available Abstract Salamanders of the genus Ambystoma are a unique model organism system because they enable natural history and biomedical research in the laboratory or field. We developed Sal-Site to integrate new and existing ambystomatid salamander research resources in support of this model system. Sal-Site hosts six important resources: 1 Salamander Genome Project: an information-based web-site describing progress in genome resource development, 2 Ambystoma EST Database: a database of manually edited and analyzed contigs assembled from ESTs that were collected from A. tigrinum tigrinum and A. mexicanum, 3 Ambystoma Gene Collection: a database containing full-length protein-coding sequences, 4 Ambystoma Map and Marker Collection: an image and database resource that shows the location of mapped markers on linkage groups, provides information about markers, and provides integrating links to Ambystoma EST Database and Ambystoma Gene Collection databases, 5 Ambystoma Genetic Stock Center: a website and collection of databases that describe an NSF funded salamander rearing facility that generates and distributes biological materials to researchers and educators throughout the world, and 6 Ambystoma Research Coordination Network: a web-site detailing current research projects and activities involving an international group of researchers. Sal-Site is accessible at http://www.ambystoma.org.

  5. Prevalence of Batrachochytrium dendrobatidis in a Nicaraguan, micro-endemic Neotropical salamander, Bolitoglossa mombachoensis

    NARCIS (Netherlands)

    Stark, Tariq; Laurijssens, Carlijn; Weterings, Martijn; Martel, An; Köhler, Gunther; Pasmans, Frank

    2017-01-01

    Amphibians are the most threatened terrestrial vertebrates on the planet and are iconic in the global biodiversity crisis. Their global decline caused by the fungal agent Batrachochytrium dendrobatidis (Bd) is well known. Declines of Mesoamerican salamanders of the family Plethodontidae, mainly affe

  6. Context-dependent movement behavior of woodland salamanders (Plethodon) in two habitat types.

    Science.gov (United States)

    Connette, Grant M; Semlitsch, Raymond D

    2013-12-01

    Animal movement is critical to the maintenance of functional connectivity at the landscape scale and can play a key role in population persistence and metapopulation dynamics. The permeability of habitat to animal movement may vary as a result of either differential mortality, physical resistance, or simply the behavioral responses of organisms to perceived habitat quality. Understanding how and when animal movement behavior varies among habitat types is critical for identifying barriers to dispersal and predicting species distributions in relation to landscape features. We conducted an experimental translocation study and compared the movement success and behavioral strategies of plethodontid salamanders in both forest and open-canopy habitat. We found that individuals in closed-canopy forest oriented more strongly towards their home ranges and moved significantly farther on their release night. In spite of the clear differences in movement paths, the ultimate movement success of homing salamanders did not appear to vary with habitat type. Our study contributes to a growing body of literature suggesting the importance of recognizing the context dependence of animal movement behavior. Because the movement rates of displaced salamanders were significantly reduced in open-canopy, dispersal rates of plethodontid salamanders in open-canopy habitat are likely lower than in control forest. Further mechanistic studies focusing on habitat-specific movement behavior and survival costs will be valuable for effectively identifying and mitigating barriers to animal movement.

  7. A new species of salamander (Bolitoglossa: Plethodontidae from the Cordillera Oriental of the Colombian Andes

    Directory of Open Access Journals (Sweden)

    Andrés R. Acosta-Galvis

    2012-01-01

    Full Text Available Eight species of salamanders are recognized to Cordillera Oriental of Colombia. Here we describe a new species of the genus Bolitoglossa, named Bolitoglossa guaneae sp. nov. The highest number of species of this genus is found in the cloud forests located in the western flank of the Cordillera Oriental.

  8. Coexistence in streams: do source-sink dynamics allow salamanders to persist with fish predators?

    Science.gov (United States)

    Sepulveda, Adam J; Lowe, Winsor H

    2011-08-01

    Theory suggests that source-sink dynamics can allow coexistence of intraguild predators and prey, but empirical evidence for this coexistence mechanism is limited. We used capture-mark-recapture, genetic methods, and stable isotopes to test whether source-sink dynamics promote coexistence between stream fishes, the intraguild predator, and stream salamanders (Dicamptodon aterrimus), the intraguild prey. Salamander populations from upstream reaches without fish were predicted to maintain or supplement sink populations in downstream reaches with fish. We found instead that downstream reaches with fish were not sinks even though fish consumed salamander larvae-apparent survival, recruitment, and population growth rate did not differ between upstream and downstream reaches. There was also no difference between upstream and downstream reaches in net emigration. We did find that D. aterrimus moved frequently along streams, but believe that this is a response to seasonal habitat changes rather than intraguild predation. Our study provides empirical evidence that local-scale mechanisms are more important than dispersal dynamics to coexistence of streams salamanders and fish. More broadly, it shows the value of empirical data on dispersal and gene flow for distinguishing between local and spatial mechanisms of coexistence.

  9. The amphibian chytrid fungus, Batrachochytrium dendrobatidis, in fully aquatic salamanders from Southeastern North America.

    Science.gov (United States)

    Chatfield, Matthew W H; Moler, Paul; Richards-Zawacki, Corinne L

    2012-01-01

    Little is known about the impact that the pathogenic amphibian chytrid fungus, Batrachochytrium dendrobatidis (Bd), has on fully aquatic salamander species of the eastern United States. As a first step in determining the impacts of Bd on these species, we aimed to determine the prevalence of Bd in wild populations of fully aquatic salamanders in the genera Amphiuma, Necturus, Pseudobranchus, and Siren. We sampled a total of 98 salamanders, representing nine species from sites in Florida, Mississippi, and Louisiana. Overall, infection prevalence was found to be 0.34, with significant differences among genera but no clear geographic pattern. We also found evidence for seasonal variation, but additional sampling throughout the year is needed to clarify this pattern. The high rate of infection discovered in this study is consistent with studies of other amphibians from the southeastern United States. Coupled with previously published data on life histories and population densities, the results presented here suggest that fully aquatic salamanders may be serving as important vectors of Bd and the interaction between these species and Bd warrants additional research.

  10. Cutaneous bacteria of the redback salamander prevent morbidity associated with a lethal disease.

    Directory of Open Access Journals (Sweden)

    Matthew H Becker

    Full Text Available Chytridiomycosis, caused by the fungal pathogen Batrachochytrium dendrobatidis (Bd, is an infectious disease that causes population declines of many amphibians. Cutaneous bacteria isolated from redback salamanders, Plethodon cinereus, and mountain yellow-legged frogs, Rana muscosa, inhibit the growth of Bd in vitro. In this study, the bacterial community present on the skin of P. cinereus individuals was investigated to determine if it provides protection to salamanders from the lethal and sub-lethal effects of chytridiomycosis. When the cutaneous bacterial community was reduced prior to Bd exposure, salamanders experienced a significantly greater decrease in body mass, which is a symptom of the disease, when compared to infected individuals with a normal bacterial community. In addition, a greater proportion of infected individuals with a reduced bacterial community experienced limb-lifting, a behavior seen only in infected individuals. Overall, these results demonstrate that the cutaneous bacterial community of P. cinereus provides protection to the salamander from Bd and that alteration of this community can change disease resistance. Therefore, symbiotic microbes associated with this species appear to be an important component of its innate skin defenses.

  11. Cheat Mountain Salamanders Search Report 2006 Canaan Valley National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objective of the survey was to document Cheat Mountain salamander use on either side of Powderline ski trail or Three-Mile ski trail in an effort to continue to...

  12. Near infrared reflectance spectroscopy studies of Chinese giant salamanders in aquaculture production

    Science.gov (United States)

    NIR spectra were collected at three surface locations for Chinese giant salamanders to ascertain whether spectral signatures could be separated by anatomical, presumably physiologically-based, locations. The first location was the smooth area immediately above the cloaca on the animal’s abdomen, whi...

  13. A single nucleotide polymorphism assay for the identification of unisexual Ambystoma salamanders.

    Science.gov (United States)

    Greenwald, Katherine R; Lisle Gibbs, H

    2012-03-01

    Unisexual (all female) salamanders in the genus Ambystoma are animals of variable ploidy (2N-5N) that reproduce via a unique system of 'leaky' gynogenesis. As a result, these salamanders have a diverse array of nuclear genome combinations from up to five sexual species: the blue-spotted (A. laterale), Jefferson (A. jeffersonianum), smallmouth (A. texanum), tiger (A. tigrinum) and streamside (A. barbouri) salamanders. Identifying the genome complement, or biotype, is a critical first step in addressing a broad range of ecological and evolutionary questions about these salamanders. Previous work relied upon genome-related differences in allele size distributions for specific microsatellite loci, but overlap in these distributions among different genomes makes definitive identification and ploidy determination in unisexuals difficult or impossible. Here, we develop the first single nucleotide polymorphism assay for the identification of unisexual biotypes, based on species-specific nucleotide polymorphisms in noncoding DNA loci. Tests with simulated and natural unisexual DNA samples show that this method can accurately identify genome complement and estimate ploidy, making this a valuable tool for assessing the genome composition of unisexual samples.

  14. Using the Eastern Hellbender Salamander in a High School Genetics & Ecological Conservation Activity

    Science.gov (United States)

    Chudyk, Sarah; McMillan, Amy; Lange, Catherine

    2014-01-01

    This article contains an original 5E lesson plan developed from conservation genetics research on the giant North American hellbender salamander, Cryptobranchus alleganiensis alleganiensis. The lesson plan provides background information on the hellbender, reviews basic genetics, and exposes students to the scientific process that is used during…

  15. A survey for Batrachochytrium dendrobatidis in endangered and highly susceptible Vietnamese salamanders (Tylototriton spp.).

    Science.gov (United States)

    Thien, Tao Nguyen; Martel, An; Brutyn, Melanie; Bogaerts, Sergé; Sparreboom, Max; Haesebrouck, Freddy; Fisher, Matthew C; Beukema, Wouter; Van, Tang Duong; Chiers, Koen; Pasmans, Frank

    2013-09-01

    Until now, Asian amphibians appear to have largely escaped declines driven by chytridiomycosis. Vietnamese salamanders that belong to the genus Tylototriton are rare and have a patchy distribution in mountainous areas, falling within the proposed environmental envelope of chytrid infections, surrounded by Batrachochytrium dendrobatidis infected regions. If these salamanders are susceptible to chytridiomycosis, then their populations could be highly vulnerable after the introduction of B. dendrobatidis. Examination for the presence of the chytrid fungus in skin swabs from 19 Tylototriton asperrimus and 104 Tylototriton vietnamensis by using quantitative polymerase chain reaction was performed. Susceptibility of T. asperrimus to experimental infection by using the global panzootic lineage (BdGPL) strain of B. dendrobatidis was examined. The fungus was absent in all samples from all wild salamanders examined. Inoculation with the BdGPL strain resulted in mortality of all five inoculated salamanders within 3 weeks after inoculation with infected animals that manifested severe orthokeratotic hyperkeratosis, epidermal hyperplasia, and spongiosis. Although infection by B. dendrobatidis currently appears absent in Vietnamese Tylototriton populations, the rarity of these animals, their pronounced susceptibility to chytridiomycosis, an apparently suitable environmental context and increasing likelihood of the pathogen being introduced, together suggest the need of urgent measures to avoid future scenarios of extinction as witnessed in Central America and Australia.

  16. A reference transcriptome and inferred proteome for the salamander Notophthalmus viridescens.

    Science.gov (United States)

    Abdullayev, Ilgar; Kirkham, Matthew; Björklund, Åsa K; Simon, András; Sandberg, Rickard

    2013-05-01

    Salamanders have a remarkable capacity to regenerate complex tissues, such as limbs and brain, and are therefore an important comparative model system for regenerative medicine. Despite these unique properties among adult vertebrates, the genomic information for amphibians in general, and salamanders in particular, is scarce. Here, we used massive parallel sequencing to reconstruct a de novo reference transcriptome of the red spotted newt (Notophthalmus viridescens) containing 118,893 transcripts with a N50 length of 2016 nts. Comparisons to other vertebrates revealed a newt transcriptome that is comparable in size and characteristics to well-annotated vertebrate transcriptomes. Identification of putative open reading frames (ORFs) enabled us to infer a comprehensive proteome, including the annotation of 19,903 newt proteins. We used the identified domain architectures (DAs) to assign ORFs phylogenetic positions, which also revealed putative salamander specific proteins. The reference transcriptome and inferred proteome of the red spotted newt will facilitate the use of systematic genomic technologies for regeneration studies in salamanders and enable evolutionary analyses of vertebrate regeneration at the molecular level.

  17. Cytogenetics of the Brazilian Bolitoglossa paraensis (Unterstein, 1930 salamanders (Caudata, Plethodontidae

    Directory of Open Access Journals (Sweden)

    Jéssica Barata da Silva

    2014-09-01

    Full Text Available Plethodontid salamanders of genus Bolitoglossa constitute the largest and most diverse group of salamanders, including around 20% of living caudate species. Recent studies have indicated the occurrence of five recognized species in the Brazilian Amazon Rainforest. We present here the first cytogenetic data of a Brazilian salamander, which may prove to be a useful by contribution to the cytotaxonomy of the genus. Specimens were collected near the "type" locality (Utinga, Belém, PA, Brazil. Chromosomal preparations from duodenal epithelial cells and testes were subjected to Giemsa staining, C-banding and DAPI/CMA3 fluorochrome staining. All specimens showed a karyotype with 13 bi-armed chromosome pairs (2n = 26. Nucleolar Organizer Regions, evidenced by CMA3, were located distally on the long arm of pair 7 (7q. DAPI+ heterochromatin was predominantly centromeric, with some small pericentromeric bands. Although the C-banding patterns of other Bolitoglossa species are so far unknown, cytogenetic studies conducted in other Plethodontid salamanders have demonstrated that pericentromeric heterochromatin is a useful cytological marker for identifying interspecific homeologies. Species diversification is usually accompanied by chromosomal changes. Therefore, the cytogenetic characterization of Bolitoglossa populations from the middle and western Brazilian Amazon Basin could identify differences which may lead to the identification of new species.

  18. Microarray analysis of a salamander hopeful monster reveals transcriptional signatures of paedomorphic brain development

    Directory of Open Access Journals (Sweden)

    Putta Srikrishna

    2010-06-01

    Full Text Available Abstract Background The Mexican axolotl (Ambystoma mexicanum is considered a hopeful monster because it exhibits an adaptive and derived mode of development - paedomorphosis - that has evolved rapidly and independently among tiger salamanders. Unlike related tiger salamanders that undergo metamorphosis, axolotls retain larval morphological traits into adulthood and thus present an adult body plan that differs dramatically from the ancestral (metamorphic form. The basis of paedomorphic development was investigated by comparing temporal patterns of gene transcription between axolotl and tiger salamander larvae (Ambystoma tigrinum tigrinum that typically undergo a metamorphosis. Results Transcript abundances from whole brain and pituitary were estimated via microarray analysis on four different days post hatching (42, 56, 70, 84 dph and regression modeling was used to independently identify genes that were differentially expressed as a function of time in both species. Collectively, more differentially expressed genes (DEGs were identified as unique to the axolotl (n = 76 and tiger salamander (n = 292 than were identified as shared (n = 108. All but two of the shared DEGs exhibited the same temporal pattern of expression and the unique genes tended to show greater changes later in the larval period when tiger salamander larvae were undergoing anatomical metamorphosis. A second, complementary analysis that directly compared the expression of 1320 genes between the species identified 409 genes that differed as a function of species or the interaction between time and species. Of these 409 DEGs, 84% exhibited higher abundances in tiger salamander larvae at all sampling times. Conclusions Many of the unique tiger salamander transcriptional responses are probably associated with metamorphic biological processes. However, the axolotl also showed unique patterns of transcription early in development. In particular, the axolotl showed a genome

  19. At random meetings to the creation of new species of Salamander

    Science.gov (United States)

    Brillant, Marie-Pierre

    2013-04-01

    The pupils in final year of high school (15-18 years old) study the notion "species" and the creation of new species in various ways. Having studied genetic admixtures, this activity allows the pupils to build a scenario explaining the creation of a new species of Salamander in southern California from an ancestral population existing in northern Oregon. They can observe, on Google Earth, various populations of Salamander of the genus Ensatina. Salamanders of the genus Ensatina live in California around the Joaquin and Sacramento dry valleys. In this software, the pupils get information about the salamanders' environment and photographs of individuals and environments. During a migratory movement toward new territories to be colonized, these salamanders meet an inhospitable environment that they can not occupy. This population then splits up into two migratory branches, east and west, each overcoming the obstacles in different ways. The two groups gradually colonized southern territories but they avoided the too dry and hot San Joaquin plains. The two main branches of the original population gradually move away from each other, and genetic exchanges between them decrease over time. Eventually, we can find various populations of Salamander on both sides of the valleys, since the salamanders occupied new territories and diversified along the way. Among mutations that randomly occur, only those mutations that are best adapted in the origin were conserved in the genetic heritage of every population. When the individuals stemming from different western populations met, they were interfertile and give fertile hybrids, which was verified in the laboratory. Likewise, when individuals of the different eastern subspecies met accidentally, fertile hybrids also could arise from these crossings. The pupils can observe what happens in the overlap of various populations : interfertility or not. They also have geological, geographical and climatic information about the San Joaquin

  20. The Springs at Pipe Spring National Monument, Arizona (pisp_springs)

    Data.gov (United States)

    National Park Service, Department of the Interior — This is an Arc/Info coverage consisting of 5 points representing the springs, natural and man-made, at Pipe Spring National Monument, Arizona. The springs were...

  1. Learning Spring application development

    CERN Document Server

    Soni, Ravi Kant

    2015-01-01

    This book is intended for those who are interested in learning the core features of the Spring Framework. Prior knowledge of Java programming and web development concepts with basic XML knowledge is expected.

  2. Spring Bottom Trawl Survey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The standardized NEFSC Spring Bottom Trawl Survey was initiated in 1968 and covered an area from Cape Hatteras, NC, to Nova Scotia, Canada, at depths >27m....

  3. Fish Springs pond snail

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Communication scenario between the branch of Listing and Recovery, Fish and Wildlife Enhancement, and Fish Springs National Wildlife Refuge (NWR), in regards to the...

  4. The hyal and ventral branchial muscles in caecilian and salamander larvae: homologies and evolution.

    Science.gov (United States)

    Kleinteich, Thomas; Haas, Alexander

    2011-05-01

    Amphibians (Lissamphibia) are characterized by a bi-phasic life-cycle that comprises an aquatic larval stage and metamorphosis to the adult. The ancestral aquatic feeding behavior of amphibian larvae is suction feeding. The negative pressure that is needed for ingestion of prey is created by depression of the hyobranchial apparatus as a result of hyobranchial muscle action. Understanding the homologies of hyobranchial muscles in amphibian larvae is a crucial step in understanding the evolution of this important character complex. However, the literature mostly focuses on the adult musculature and terms used for hyal and ventral branchial muscles in different amphibians often do not reflect homologies across lissamphibian orders. Here we describe the hyal and ventral branchial musculature in larvae of caecilians (Gymnophiona) and salamanders (Caudata), including juveniles of two permanently aquatic salamander species. Based on previous alternative terminology schemes, we propose a terminology for the hyal and ventral branchial muscles that reflects the homologies of muscles and that is suited for studies on hyobranchial muscle evolution in amphibians. We present a discussion of the hyal and ventral branchial muscles in larvae of the most recent common ancestor of amphibians (i.e. the ground plan of Lissamphibia). Based on our terminology, the hyal and ventral branchial musculature of caecilians and salamanders comprises the following muscles: m. depressor mandibulae, m. depressor mandibulae posterior, m. hyomandibularis, m. branchiohyoideus externus, m. interhyoideus, m. interhyoideus posterior, m. subarcualis rectus I, m. subarcualis obliquus II, m. subarcualis obliquus III, m. subarcualis rectus II-IV, and m. transversus ventralis IV. Except for the m. branchiohyoideus externus, all muscles considered herein can be assigned to the ground plan of the Lissamphibia with certainty. The m. branchiohyoideus externus is either apomorphic for the Batrachia (frogs

  5. Evaluating Multi-Level Models to Test Occupancy State Responses of Plethodontid Salamanders.

    Directory of Open Access Journals (Sweden)

    Andrew J Kroll

    Full Text Available Plethodontid salamanders are diverse and widely distributed taxa and play critical roles in ecosystem processes. Due to salamander use of structurally complex habitats, and because only a portion of a population is available for sampling, evaluation of sampling designs and estimators is critical to provide strong inference about Plethodontid ecology and responses to conservation and management activities. We conducted a simulation study to evaluate the effectiveness of multi-scale and hierarchical single-scale occupancy models in the context of a Before-After Control-Impact (BACI experimental design with multiple levels of sampling. Also, we fit the hierarchical single-scale model to empirical data collected for Oregon slender and Ensatina salamanders across two years on 66 forest stands in the Cascade Range, Oregon, USA. All models were fit within a Bayesian framework. Estimator precision in both models improved with increasing numbers of primary and secondary sampling units, underscoring the potential gains accrued when adding secondary sampling units. Both models showed evidence of estimator bias at low detection probabilities and low sample sizes; this problem was particularly acute for the multi-scale model. Our results suggested that sufficient sample sizes at both the primary and secondary sampling levels could ameliorate this issue. Empirical data indicated Oregon slender salamander occupancy was associated strongly with the amount of coarse woody debris (posterior mean = 0.74; SD = 0.24; Ensatina occupancy was not associated with amount of coarse woody debris (posterior mean = -0.01; SD = 0.29. Our simulation results indicate that either model is suitable for use in an experimental study of Plethodontid salamanders provided that sample sizes are sufficiently large. However, hierarchical single-scale and multi-scale models describe different processes and estimate different parameters. As a result, we recommend careful consideration of

  6. Mercury Speciation and Trophic Magnification Slopes in Giant Salamander Larvae from the Pacific Northwest, USA

    Science.gov (United States)

    Bank, M. S.; Crocker, J.; Wachtl, J.; Kleeman, P.; Fellers, G.; Currens, C.; Hothem, R.; Madej, M. A.

    2014-12-01

    Mercury (Hg) contamination of stream salamanders in the Pacific Northwest region of the United States has received little attention. Here we report total Hg (HgT) and methyl mercury (MeHg) concentrations in larval giant salamanders (Dicamptodon spp.) and surface water from forested and chaparral lotic ecosystems distributed along a latitudinal gradient throughout Northern California and Washington. To test hypotheses related to potential effects from mining land-use activities, salamander larvae were also sampled from a reference site at Whiskeytown National Recreation Area, California, and at a nearby, upstream site (Shasta county) on Bureau of Land Management land where Hg contamination from gold mining activities has been documented. HgT concentrations in whole body larvae ranged from 4.6 to 74.5 ng/g wet wt. and percent MeHg ranged from 67% to 86%. Both HgT and MeHg larval tissue concentrations were significantly higher at the mining site in comparison to measured background levels (P salamander larvae in remote stream ecosystems, where Hg sources were dominated by atmospheric deposition, were generally low in HgT and MeHg and, in comparison, watersheds with a legacy of land-use practices (i.e., mining operations) had approximately 4.5 - 5.5 times the level of HgT bioaccumulation. Moreover, trophic magnification slopes were highest in the Shasta county region where mining was present. These findings suggest that mining activities increase HgT and MeHg exposure to salamander larvae in the region and may present a threat to other higher trophically positioned organisms, and their associated food webs.

  7. Evaluating Multi-Level Models to Test Occupancy State Responses of Plethodontid Salamanders.

    Science.gov (United States)

    Kroll, Andrew J; Garcia, Tiffany S; Jones, Jay E; Dugger, Katie; Murden, Blake; Johnson, Josh; Peterman, Summer; Peerman, Summer; Brintz, Ben; Rochelle, Michael

    2015-01-01

    Plethodontid salamanders are diverse and widely distributed taxa and play critical roles in ecosystem processes. Due to salamander use of structurally complex habitats, and because only a portion of a population is available for sampling, evaluation of sampling designs and estimators is critical to provide strong inference about Plethodontid ecology and responses to conservation and management activities. We conducted a simulation study to evaluate the effectiveness of multi-scale and hierarchical single-scale occupancy models in the context of a Before-After Control-Impact (BACI) experimental design with multiple levels of sampling. Also, we fit the hierarchical single-scale model to empirical data collected for Oregon slender and Ensatina salamanders across two years on 66 forest stands in the Cascade Range, Oregon, USA. All models were fit within a Bayesian framework. Estimator precision in both models improved with increasing numbers of primary and secondary sampling units, underscoring the potential gains accrued when adding secondary sampling units. Both models showed evidence of estimator bias at low detection probabilities and low sample sizes; this problem was particularly acute for the multi-scale model. Our results suggested that sufficient sample sizes at both the primary and secondary sampling levels could ameliorate this issue. Empirical data indicated Oregon slender salamander occupancy was associated strongly with the amount of coarse woody debris (posterior mean = 0.74; SD = 0.24); Ensatina occupancy was not associated with amount of coarse woody debris (posterior mean = -0.01; SD = 0.29). Our simulation results indicate that either model is suitable for use in an experimental study of Plethodontid salamanders provided that sample sizes are sufficiently large. However, hierarchical single-scale and multi-scale models describe different processes and estimate different parameters. As a result, we recommend careful consideration of study questions

  8. Pygoscelis antarcticus feathers as bioindicator of trace element risk in marine environments from Barton Peninsula, 25 de Mayo (King George) Island, Antarctica.

    Science.gov (United States)

    Catán, Soledad Perez; Bubach, Debora; Di Fonzo, Carla; Dopchiz, Laura; Arribére, Maria; Ansaldo, Martin

    2017-04-01

    We report the contents of elements in feathers of Chinstrap penguin (Pygoscelis antarcticus), which had not been informed up to now, such as silver and bromine and others listed as hazardous by the United States Environmental Protection Agency as arsenic, cobalt, chromium, and mercury. Analyses of the element concentrations in feathers, adult and chicken, from Barton Peninsulas at 25 de Mayo (King George) Island, South Shetlands, were made by Instrumental Neutron Activation Analysis. Samarium, lanthanum a, thorium, and uranium concentrations in Chinstrap penguin feathers were below 0.1 mg/kg. This suggests that the elements in feather do not come from atmospheric particles surface deposition. Arsenic (0.120 ± 0.050 mg/kg) and cobalt (0.030 ± 0.020 mg/kg) concentrations were lower than the reports for other colony of Chinstrap penguins, and essential elements as iron (26 ± 12 mg/kg), zinc (78.0 ± 5.3 mg/kg), and chromium (0.51 ± 0.27 mg/kg) were in the same range while Se (2.90 ± 0.65 mg/kg) content were the lowest reported. Mercury (0.43 ± 0.21 mg/kg), chromium (0.210 ± 0.060 mg/kg), and silver (0.083 ± 0.003 mg/kg) in chicks tended to be lower than in adults. Iron, cobalt, and arsenic concentrations in feathers found in this study were the lowest compared to measurements were in several penguin species in Antarctica. These results confirm to feathers like effective indicators for the trace elements incorporated in the penguins and it provide a data set which can adds to the baseline for bioindication studies using feathers.

  9. Report on the Status of the Cheat Mountain Salamander in the Cabin Mountain Area of West Virginia 1991

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This outlines the results of field surveys that were conducted for the Cheat Mountain salamander on the Kelley property on three mountains in the Cabin Mountain area...

  10. The phenology of a rare salamander (Salamandra infraimmaculata in a population breeding under unpredictable ambient conditions: a 25 year study

    Directory of Open Access Journals (Sweden)

    Michael R. Warburg

    2007-11-01

    Full Text Available This is a long-term study (1974-1999 on the phenology of the rare, xeric- inhabiting salamander Salamandra infraimmaculata in a small isolated population during the breeding season near the breeding ponds on Mt. Carmel. This is a fringe area of the genus’ south-easternmost Palaearctic distribution. Salamanders were captured during the 25 year long study. The first years up to the 1980s the total number of salamanders increased but during the last years there seems to have been a decline. Although this could be a phase in normal population cyclic oscillations nevertheless when compared with long-term data on a European Salamandra it does not seem so. The interpretation of the species’ status is dependent on numbers of salamanders captured as well as on the duration of the study. These subjects are reviewed and discussed in this paper.

  11. Life history as a predictor of salamander recovery rate from timber harvest in southern appalachian forests, USA.

    Science.gov (United States)

    Connette, Grant M; Semlitsch, Raymond D

    2013-12-01

    Forest management often represents a balance between social, economic, and ecological objectives. In the eastern United States, numerous studies have established that terrestrial salamander populations initially decline in abundance following timber harvest, yet the large-scale and long-term consequences are relatively unknown. We used count data from terrestrial survey points to examine the relation between salamander abundance and historic timber harvest while accounting for imperfect detection of individuals. Overall, stream- and terrestrial-breeding salamanders appeared to differ by magnitude of population decline, rate of population recovery, and extent of recolonization from surrounding forest. Specifically, estimated abundance of both species groups was positively associated with stand age and recovery rates were predicted to increase over time for red-legged salamanders (Plethodon shermani) and decrease in stream-breeding species. Abundance of stream-breeding salamanders was predicted to reach a peak by 100 years after timber harvest, and the population growth rate of red-legged salamanders was predicted to undergo a significant increase 100 years after harvest. Estimated abundance of stream-breeding salamanders in young forest stands was also negatively associated with the distance to adjacent forest, a result that suggests immigration has a role in the recovery of these species. Our results indicate that salamander abundance in young forest stands may be only modestly lower than in more mature forest but that full recovery from timber harvest may take a substantial amount of time and that species life history may affect patterns of recovery. Historia de Vida como un Vaticinador de la Tasa de Recuperación de una Salamandra a la Colecta de Madera en los Bosques del Sur de los Apalaches, E.U.A.

  12. JINAN: the City of Springs

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ Attractions Jinan is not a hot tourist destination in China, but it has Something special to offer, such as the 72 springs scattered throughout the city. Jinan has an alias of the Spring City (Quan Cheng)because of ouver 700 natural springs run through the city. Among them,the Baotu Spring is the most famous.

  13. First report of a ranavirus associated with morbidity and mortality in farmed Chinese giant salamanders (Andrias davidianus).

    Science.gov (United States)

    Geng, Y; Wang, K Y; Zhou, Z Y; Li, C W; Wang, J; He, M; Yin, Z Q; Lai, W M

    2011-07-01

    From February to May 2010, an outbreak of disease occurred amongst farmed Chinese giant salamanders (Andrias davidianus) in Hanzhong County, Shanxi Province, China. Clinical signs included anorexia, lethargy, ecchymoses and swollen areas on the head and limbs, and skin ulceration. The aim of this study was to determine the cause of this disease. Necropsy examination revealed subcutaneous and intramuscular oedema, swollen and pale livers with multifocal haemorrhage, swollen kidneys with multifocal haemorrhage and distended fluid-filled intestines with areas of haemorrhage. Light microscopy revealed intracytoplasmic inclusions suggestive of a viral infection in a variety of organs, as well as degeneration and necrosis of these organs. Electron microscopy of ultrathin sections of the same tissues revealed iridovirus-like particles within the inclusions. Of the six specimens tested, all were positive for ranavirus major capsid protein (MCP) gene. Sequence alignments of the ranavirus MCP gene from these specimens showed 95-98% similarity with published ranavirus data. The virus, provisionally designated as Chinese giant salamander virus (CGSV), was isolated from tissue homogenates of diseased salamanders following inoculation of epithelioma papilloma cyprini cells. Sequence analysis of the MCP genes showed that the isolated virus was a ranavirus with marked sequence identity to other members of the genus Ranavirus. Koch's postulates were fulfilled by infecting healthy Chinese giant salamanders with the CGSV. These salamanders all died within 6-8 days. This is the first report of ranavirus infection associated with mass mortality in Chinese giant salamanders.

  14. Pro Spring security

    CERN Document Server

    Scarioni, Carlo

    2013-01-01

    Security is a key element in the development of any non-trivial application. The Spring Security Framework provides a comprehensive set of functionalities to implement industry-standard authentication and authorization mechanisms for Java applications. Pro Spring Security will be a reference and advanced tutorial that will do the following: Guides you through the implementation of the security features for a Java web application by presenting consistent examples built from the ground-up. Demonstrates the different authentication and authorization methods to secure enterprise-level applications

  15. Instant Spring security starter

    CERN Document Server

    Jagielski, Piotr

    2013-01-01

    Get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks. A concise guide written in an easy-to-follow format following the Starter guide approach.This book is for people who have not used Spring Security before and want to learn how to use it effectively in a short amount of time. It is assumed that readers know both Java and HTTP protocol at the level of basic web programming. The reader should also be familiar with Inversion-of-Control/Dependency Injection, preferably with the Spring framework itsel

  16. Spring of women?

    Directory of Open Access Journals (Sweden)

    Mónica Castillo

    2012-12-01

    Full Text Available Terms such as “Islamic feminism” and “women’s movement” refer to those social movements of women that seek to assert their rights in Islamic societies. This brief study focuses on theses social movements of women and will presentan overview of the role and participation of women in the Arab Spring by examining news, events, press articles and opinions in order to contextualize the participation of women and feminists in the Arab Spring from a perspective of the social networking phenomenon as apparent drivers of the revolution.

  17. What's Behind Spring Festival?

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ Similar to what the Christmas Day means for the westerners,the Spring Festival is the most important celebration for Chinese people.This big event according to Chinese traditional lunar calendar relaxes and pleases the whole country as the happiest gathering time of the year.National-wide crusade for going back home,too-difficult-to-get train tickets,generous family-going-out shopping,Miaohui laundering,New Year Eve reunion dinner,visiting friends and relatives,watching annual TV gala……each piece of clue reminds us of the smell of Chinese Spring Festival.

  18. Energy Matters - Spring 2002

    Energy Technology Data Exchange (ETDEWEB)

    None

    2002-03-01

    Quarterly newsletter from DOE's Industrial Technologies Program to promote the use of energy-efficient industrial systems. The focus of the Spring 2002 Issue of Energy Matters focuses on premium energy efficiency systems, with articles on new gas technologies, steam efficiency, the Augusta Newsprint Showcase, and more.

  19. Spring batch essentials

    CERN Document Server

    Rao, P Raja Malleswara

    2015-01-01

    If you are a Java developer with basic knowledge of Spring and some experience in the development of enterprise applications, and want to learn about batch application development in detail, then this book is ideal for you. This book will be perfect as your next step towards building simple yet powerful batch applications on a Java-based platform.

  20. Tissue lesions of tiger salamanders (Ambystoma tigrinum): relationship to sewage effluents

    Energy Technology Data Exchange (ETDEWEB)

    Rose, F.L.

    1977-01-01

    A population of facultative neotenous tiger salamanders (A. tigrinum) inhabiting a sewage lagoon at Reese AFB, Hurlwood, Texas, was found to have an exceptionally high rate of spontaneous tissue lesions. The population is composed of an estimated 28,000 large, reproductively mature larvae that are restricted to the lagoon. Only about 17 percent of the population metamorphoses normally. In contrast, tiger salamanders from uncontaminated lagoons in the same general vicinity metamorphose normally; however, no neoplasms were discovered in larvae sampled from the nonsewage lagoons. N-nitrosamine analyses of water and tissue samples of larvae were negative. Polycyclic aromatic hydrocargon analyses revealed traces of benzo(a)pyrene in the sludge; however, perylene, a constituent of jet fuel, was found in high concentration (300 ppB). These results indicate that perylene, which was previously found not be tumorigenic to mice and rats, should be retested as a possible agent for nonmammalian species.

  1. Distribution of the Sonora Tiger Salamander (Ambystoma mavortium stebbinsi) in Mexico

    Science.gov (United States)

    Hossack, Blake R.; Muths, Erin L.; Rorabaugh, James C.; Lemos Espinal, Julio A.; Sigafus, Brent H.; Chambert, Thierry A; Carreon Arroyo, Gerardo; Hurtado Felix, David; Toyos Martinez, Daniel; Jones, Thomas R

    2016-01-01

    The Sonoran Tiger Salamander (Ambystoma mavortium stebbinsi Lowe, 1954) was listed as federally endangered in the USA in 1997 (USFWS 1997). In the USA, the distribution of A. mavortium stebbinsi is limited to the San Rafael Valley (approximately 567 km2), between the Sierra San Antonio (called the Patagonia Mountains in Arizona) and Huachuca Mountains, and south of the Canelo Hills, Arizona (Fig. 1). The USA listing was triggered by loss of natural wetland habitats, threats from invasive predators, frequent die-offs from disease, introgression with the introduced Barred Tiger Salamander (A. mavortium mavortium), and small range and number of breeding sites that increases susceptibility to stochastic events (USFWS 1997). Small population sizes and limited gene flow have caused inbreeding, which may further reduce population viability and the potential for recovery (Jones et al. 1988; Storfer et al. 2014). 

  2. Climate-mediated competition in a high-elevation salamander community

    Science.gov (United States)

    Dallalio, Eric A.; Brand, Adrianne; Grant, Evan H. Campbell

    2017-01-01

    The distribution of the federally endangered Shenandoah Salamander (Plethodon shenandoah) is presumed to be limited by competition with the Red-backed Salamander (Plethodon cinereus). In particular, the current distribution of P. shenandoah is understood to be restricted to warmer and drier habitats because of interspecific interactions. These habitats may be particularly sensitive to climate change, though the influence of competition may also be affected by temperature and relative humidity. We investigated the response of P. shenandoah to competition with P. cinereus under four climate scenarios in 3-dimensional mesocosms. The results suggest that, although climate change may alleviate competitive pressure from P. cinereus, warmer temperatures may also significantly influence the persistence of the species across its known range.

  3. Morganella morganii as a Causative Agent of Disease in the Chinese Giant Salamander (Andrias davidianus)

    Institute of Scientific and Technical Information of China (English)

    Li WANG; Yong WEI; Yanqing HUANG

    2013-01-01

    Morganella morganii strain 602-1 was isolated from a sick Chinese giant salamander (Andrias davidianus). The strain 602-1 was identiifed through its physiological and biochemical properties and 16S rDNA gene ampliifcation and analyses. Pathogenicity was proven by experimental animal infection, and histopathological examination. The results showed that the ampliifed 16S rDNA sequence of strain 602-1 was 1455 bp, and showed 99%identity with M. morganii. In the host infection experiment, the mortality of Chinese giant salamanders was about 70%. Pathological changes occurred in the spleen, heart, liver, kidney and intestine. This study will help the prevention, understanding and cure for M. morganii infections in amphibians.

  4. Gender-dependent dimorphic teeth in four species of Mesoamerican plethodontid salamanders (Urodela, Amphibia).

    Science.gov (United States)

    Ehmcke, Jens; Wistuba, Joachim; Clemen, Günter

    2004-06-01

    The tooth shapes of premaxillary and maxillary teeth of adults of four Mesoamerican salamander species (Urodela, Plethodontidae) were examined. Using scanning electron microscopy we determined whether the monocuspid teeth that are present only on the premaxillary of sexually mature males belong to the conical, unbladed, monocuspid tooth type found in urodele larvae or whether they represent morphological variations of the typical, bladed, bicuspid teeth of metamorphosed individuals. The teeth of some studied species are, in fact, unbladed and in some cases show one very reduced tip. But none of the studied teeth is per definitionem monocuspid and no tooth shows an enameloid layer between dentine shaft and enamel cap, which is always present in the teeth of early urodele larvae. The "monocuspid" teeth of adult males of Mesoamerican plethodontid salamanders have to be considered a morphological variation of the metamorphosed, bicuspid tooth type typical for metamorphosed urodeles.

  5. The spinal cord supports of vertebrae in the crown-group salamanders (Caudata, Urodela).

    Science.gov (United States)

    Skutschas, Pavel P; Baleeva, Nataly V

    2012-09-01

    The development of spinal cord supports (bony thickenings which extend into the vertebral canal of vertebrae) in primitive (Salamandrella keyserlingii) and derived (Lissotriton vulgaris) salamanders were described. The spinal cord supports develop as the protuberances of periostal bone of the neural arches in the anteroproximal part of the septal collagenous fibers which connect a transverse myoseptum with the notochord and spinal cord, in the septal bundle inside the vertebral canal. Spinal cord supports were also found in some teleostean (Salmo salar, Oncorhynchus mykiss) and dipnoan (Protopterus sp.) fishes. The absence of the spinal cord supports in vertebrates with cartilaginous vertebrae (lampreys, chondrichthyan, and chondrostean fishes) corresponds to the fact that the spinal cord supports are bone structures. The absence of the spinal cord supports in frogs correlates with the lack of the well developed septal bundles inside the vertebral canal. The spinal cord supports are, presumably, a synapomorphic character for salamanders which originated independently of those observed in teleostean and dipnoan fishes.

  6. Comparing population patterns to processes: abundance and survival of a forest salamander following habitat degradation.

    Directory of Open Access Journals (Sweden)

    Clint R V Otto

    Full Text Available Habitat degradation resulting from anthropogenic activities poses immediate and prolonged threats to biodiversity, particularly among declining amphibians. Many studies infer amphibian response to habitat degradation by correlating patterns in species occupancy or abundance with environmental effects, often without regard to the demographic processes underlying these patterns. We evaluated how retention of vertical green trees (CANOPY and coarse woody debris (CWD influenced terrestrial salamander abundance and apparent survival in recently clearcut forests. Estimated abundance of unmarked salamanders was positively related to CANOPY (β Canopy  = 0.21 (0.02-1.19; 95% CI, but not CWD (β CWD  = 0.11 (-0.13-0.35 within 3,600 m2 sites, whereas estimated abundance of unmarked salamanders was not related to CANOPY (β Canopy  = -0.01 (-0.21-0.18 or CWD (β CWD  = -0.02 (-0.23-0.19 for 9 m2 enclosures. In contrast, apparent survival of marked salamanders within our enclosures over 1 month was positively influenced by both CANOPY and CWD retention (β Canopy  = 0.73 (0.27-1.19; 95% CI and β CWD  = 1.01 (0.53-1.50. Our results indicate that environmental correlates to abundance are scale dependent reflecting habitat selection processes and organism movements after a habitat disturbance event. Our study also provides a cautionary example of how scientific inference is conditional on the response variable(s, and scale(s of measure chosen by the investigator, which can have important implications for species conservation and management. Our research highlights the need for joint evaluation of population state variables, such as abundance, and population-level process, such as survival, when assessing anthropogenic impacts on forest biodiversity.

  7. First record of salamander predation by a Liophis (Wagler, 1830 snake in the Venezuelan Andes

    Directory of Open Access Journals (Sweden)

    Luis Felipe Esqueda

    2009-12-01

    Full Text Available Information available so far is exceedingly meagre about the diet of the snakes included in the genus Liophis, one of the most diverse groups that inhabit terrestrial ecosystems of South America. For the first time is documented the predation of a salamander by Liophis from Venezuela, including a brief overview on the alteration of montane and submontane Andean ecosystem and their effect on the natural dynamic.

  8. SURGICAL IMPLANTATION OF COELOMIC RADIOTRANSMITTERS AND POSTOPERATIVE SURVIVAL OF CHINESE GIANT SALAMANDERS (ANDRIAS DAVIDIANUS) FOLLOWING REINTRODUCTION.

    Science.gov (United States)

    Marcec, Ruth; Kouba, Andrew; Zhang, Lu; Zhang, Hongxing; Wang, Qijun; Zhao, Hu; Jiang, Wei; Willard, Scott

    2016-03-01

    Worldwide, there are only a handful of reintroduction programs for threatened salamander species, and very few have conducted postrelease studies to examine survival, habitat selection, and dispersal. Limitations in postrelease monitoring are primarily due to size constraints of amphibians and to dimensions of the radiotransmitters available for implantation. However, due to the large size of the critically endangered Chinese giant salamander (Andrias davidianus), these animals make optimal candidates for surgical implantation of radiotransmitters prior to reintroduction or translocation. The objective of this study was to develop an anesthetic protocol using tricane methanesulfonate (MS-222) and test a surgical procedure for coelomic implantation of radiotransmitters for this species. A total of 32 Chinese giant salamanders from two age groups (Group A: 4.7 yr old, n = 16; Group B: 2.7 yr old, n = 16) were implanted with 4-g radiotransmitters designed for underwater monitoring of fish. Group A was held 16 wk before release while Group B was held 6 wk before release, and the salamanders' survival and postoperative complications recorded for the first month postrelease. Group A animals took longer to reach a surgical plane of anesthesia than did Group B animals, and this was directly correlated to mass of the animals. Postsurgery, one animal from Group B died of dehiscence before release while 83.9% animals survived after the first month in the wild. All of the animals that died postrelease were from Group B; three animals experienced dehiscence of the suture site and died while another two animals expired from trauma and fungal infection, respectively. Improvements for future studies include use of alternative suture material for closure after implantation and additional healing time of the incision.

  9. A little bit is better than nothing: the incomplete parthenogenesis of salamanders, frogs and fish

    Directory of Open Access Journals (Sweden)

    Schartl Manfred

    2010-08-01

    Full Text Available Abstract A re-examination of the mitochondrial genomes of unisexual salamander lineages, published in BMC Evolutionary Biology, shows them to be the oldest unisexual vertebrates known, having been around for 5 million years. This presents a challenge to the prediction that lack of genetic recombination is a fast track to extinction. See research article http://www.biomedcentral.com/1471-2148/10/238

  10. Microbial community dynamics and effect of environmental microbial reservoirs on red-backed salamanders (Plethodon cinereus).

    Science.gov (United States)

    Loudon, Andrew H; Woodhams, Douglas C; Parfrey, Laura Wegener; Archer, Holly; Knight, Rob; McKenzie, Valerie; Harris, Reid N

    2014-04-01

    Beneficial cutaneous bacteria on amphibians can protect against the lethal disease chytridiomycosis, which has devastated many amphibian species and is caused by the fungus Batrachochytrium dendrobatidis. We describe the diversity of bacteria on red-backed salamanders (Plethodon cinereus) in the wild and the stability of these communities through time in captivity using culture-independent Illumina 16S rRNA gene sequencing. After field sampling, salamanders were housed with soil from the field or sterile media. The captive conditions led to different trajectories of bacterial communities. Eight OTUs present on >90% of salamanders in the field, through time, and in both treatments were defined as the core community, suggesting that some bacteria are closely associated with the host and are independent of an environmental reservoir. One of these taxa, a Pseudomonas sp., was previously cultured from amphibians and found to be antifungal. As all host-associated bacteria were found in the soil reservoir, environmental microbes strongly influence host-microbial diversity and likely regulate the core community. Using PICRUSt, an exploratory bioinformatics tool to predict gene functions, we found that core skin bacteria provided similar gene functions to the entire community. We suggest that future experiments focus on testing whether core bacteria on salamander skin contribute to the observed resistance to chytridiomycosis in this species even under hygenic captive conditions. For disease-susceptible hosts, providing an environmental reservoir with defensive bacteria in captive-rearing programs may improve outcomes by increasing bacterial diversity on threatened amphibians or increasing the likelihood that defensive bacteria are available for colonization.

  11. Fish Springs molluscan studies: House and Percy Springs

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes the findings of a limited survey of House and Percy Springs molluscan fauna within Fish Springs National Wildlife Refuge. Various...

  12. Toxicological responses of red-backed salamanders (Plethodon cinereus) to subchronic soil exposures of 2,4,6-trinitrotoluene.

    Science.gov (United States)

    Bazar, Mathew A; Quinn, Michael J; Mozzachio, Kristie; Johnson, Mark S

    2008-06-01

    Since World War I, trinitrotoluene (TNT) has been the most commonly used explosive. Environmental contamination associated with synthesis, manufacture of weapons, and use during training exercises has been extensive, with soil concentrations reaching 145,000 mg/kg. Some of these areas include habitats for amphibian species. Earlier studies have shown that salamanders dermally absorb TNT from soil. To ascertain what soil concentrations of TNT are toxic to amphibians, red-backed salamanders (Plethodon cinereus) were exposed to one of five concentrations of TNT in soil for 28 d and evaluated for indicators of toxicity. A total of 100 salamanders were randomly sorted by weight and assigned to target TNT concentrations in soil of either 3,000, 1,500, 750, 325, or 0 mg/kg dry weight. Food consisted of uncontaminated flightless Drosophila melanogaster. Survival was reduced in salamanders exposed to 1,500 and 3,000 mg/kg by 10 and 55%, respectively. Most mortality/morbidity occurred within the first week of exposure. Salamanders had a reduction in hemoglobin at 750 mg/kg or greater and a reduction in red blood cell concentration at 1,500 mg/kg or greater. Food consumption was affected in salamanders at 750 mg/kg or greater; a reduction in body mass and liver glycogen content also occurred at and above this concentration. Splenic congestion also was observed in salamanders from these groups. These data suggest that soil TNT concentrations of 373 +/- 41.0 mg/kg or greater result in reduced body mass, reduced feed intake, and hematological effects.

  13. Vertebrate hosts as islands: dynamics of selection, immigration, loss, persistence and potential function of bacteria on salamander skin

    Directory of Open Access Journals (Sweden)

    Andrew Howard Loudon

    2016-03-01

    Full Text Available Skin bacterial communities can protect amphibians from a fungal pathogen; however, little is known about how these communities are maintained. We used a neutral model of community ecology to identify bacteria that are maintained on salamanders by selection or by dispersal from a bacterial reservoir (soil and ecological drift. We found that 75% (9/12 of bacteria that were consistent with positive selection, < 1% of bacteria that were consistent with random dispersal and none of the bacteria that were consistent under negative selection had a 97% or greater match to antifungal isolates. Additionally we performed an experiment where salamanders were either provided or denied a bacterial reservoir and estimated immigration and loss (emigration and local extinction rates of bacteria on salamanders in both treatments. Loss was strongly related to bacterial richness, suggesting competition is important for structuring the community. Bacteria closely related to antifungal isolates were more likely to persist on salamanders with or without a bacterial reservoir, suggesting they had a competitive advantage. Furthermore, over-represented and under-represented OTUs had similar persistence on salamanders when a bacterial reservoir was present. However, under-represented OTUs were less likely to persist in the absence of a bacterial reservoir, suggesting that the over-represented and under-represented bacteria are selected for or against on salamanders through time. Our findings from the neutral model, migration and persistence analyses show that bacteria that exhibit a high similarity to antifungal isolates persist on salamanders, which likely protect hosts against pathogens and improve fitness. This research is one of the first to apply ecological theory to investigate assembly of host associated-bacterial communities, which can provide insights for probiotic bioaugmentation as a conservation strategy against disease.

  14. Unexpected Rarity of the Pathogen Batrachochytrium dendrobatidis in Appalachian Plethodon Salamanders: 1957–2011

    Science.gov (United States)

    Muletz, Carly; Caruso, Nicholas M.; Fleischer, Robert C.; McDiarmid, Roy W.; Lips, Karen R.

    2014-01-01

    Widespread population declines in terrestrial Plethodon salamanders occurred by the 1980s throughout the Appalachian Mountains, the center of global salamander diversity, with no evident recovery. We tested the hypothesis that the historic introduction and spread of the pathogenic fungus Batrachochytrium dendrobatidis (Bd) into the eastern US was followed by Plethodon population declines. We expected to detect elevated prevalence of Bd prior to population declines as observed for Central American plethodontids. We tested 1,498 Plethodon salamanders of 12 species (892 museum specimens, 606 wild individuals) for the presence of Bd, and tested 94 of those for Batrachochytrium salamandrivorans (Bs) and for ranavirus. Field samples were collected in 2011 from 48 field sites across a 767 km transect. Historic samples from museum specimens were collected at five sites with the greatest number and longest duration of collection (1957–987), four of which were sampled in the field in 2011. None of the museum specimens were positive for Bd, but four P. cinereus from field surveys were positive. The overall Bd prevalence from 1957–2011 for 12 Plethodon species sampled across a 757 km transect was 0.2% (95% CI 0.1–0.7%). All 94 samples were negative for Bs and ranavirus. We conclude that known amphibian pathogens are unlikely causes for declines in these Plethodon populations. Furthermore, these exceptionally low levels of Bd, in a region known to harbor Bd, may indicate that Plethodon specific traits limit Bd infection. PMID:25084159

  15. Co-option and evolution of non-olfactory proteinaceous pheromones in a terrestrial lungless salamander.

    Science.gov (United States)

    Doty, Kari A; Wilburn, Damien B; Bowen, Kathleen E; Feldhoff, Pamela W; Feldhoff, Richard C

    2016-03-01

    Gene co-option is a major force in the evolution of novel biological functions. In plethodontid salamanders, males deliver proteinaceous courtship pheromones to the female olfactory system or transdermally to the bloodstream. Molecular studies identified three families of highly duplicated, rapidly evolving pheromones (PRF, PMF, and SPF). Analyses for Plethodon salamanders revealed pheromone mixtures of primarily PRF and PMF. The current study demonstrates that in Desmognathus ocoee--a plesiomorphic species with transdermal delivery--SPF is the major pheromone component representing >30% of total protein. Chromatographic profiles of D. ocoee pheromones were consistent from May through October. LC/MS-MS analysis suggested uniform SPF isoform expression between individual male D. ocoee. A gene ancestry for SPF with the Three-Finger Protein superfamily was supported by intron-exon boundaries, but not by the disulfide bonding pattern. Further analysis of the pheromone mixture revealed paralogs to peptide hormones that contained mutations in receptor binding regions, such that these novel molecules may alter female physiology by acting as hormone agonists/antagonists. Cumulatively, gene co-option, duplication, and neofunctionalization have permitted recruitment of additional gene families for pheromone activity. Such independent co-option events may be playing a key role in salamander speciation by altering male traits that influence reproductive success.

  16. Genic regions of a large salamander genome contain long introns and novel genes

    Directory of Open Access Journals (Sweden)

    Bryant Susan V

    2009-01-01

    Full Text Available Abstract Background The basis of genome size variation remains an outstanding question because DNA sequence data are lacking for organisms with large genomes. Sixteen BAC clones from the Mexican axolotl (Ambystoma mexicanum: c-value = 32 × 109 bp were isolated and sequenced to characterize the structure of genic regions. Results Annotation of genes within BACs showed that axolotl introns are on average 10× longer than orthologous vertebrate introns and they are predicted to contain more functional elements, including miRNAs and snoRNAs. Loci were discovered within BACs for two novel EST transcripts that are differentially expressed during spinal cord regeneration and skin metamorphosis. Unexpectedly, a third novel gene was also discovered while manually annotating BACs. Analysis of human-axolotl protein-coding sequences suggests there are 2% more lineage specific genes in the axolotl genome than the human genome, but the great majority (86% of genes between axolotl and human are predicted to be 1:1 orthologs. Considering that axolotl genes are on average 5× larger than human genes, the genic component of the salamander genome is estimated to be incredibly large, approximately 2.8 gigabases! Conclusion This study shows that a large salamander genome has a correspondingly large genic component, primarily because genes have incredibly long introns. These intronic sequences may harbor novel coding and non-coding sequences that regulate biological processes that are unique to salamanders.

  17. Safe caves and dangerous forests? Predation risk may contribute to salamander colonization of subterranean habitats

    Science.gov (United States)

    Salvidio, Sebastiano; Palumbi, Giulia; Romano, Antonio; Costa, Andrea

    2017-04-01

    Recent studies suggest that many organisms actively colonize the subterranean environment to avoid climatic stress, exploit new ecological opportunities and reduce competition and predation. Terrestrial salamanders are known to colonize the more stable subterranean habitats mainly to escape external climatic extremes, while the role of predation avoidance remains untested. To better understand the importance of predation, we used clay models of the cave salamander Speleomantes strinatii to compare the predation occurring in woodland and subterranean habitats. Models were positioned in three forests and in three caves in NW Italy. One-hundred eighty-four models were retrieved from the field and 59 (32%) were attacked by predators. Models were attacked on their head more often than expected by chance and, therefore, were perceived by predators as real prey items. In the woodlands, clay models showed a four-time higher probability of being attacked in comparison to caves, suggesting a different level of potential predation risk in these surface habitats. These findings are one of the first experimental evidences that, in terrestrial ecosystems, predation avoidance may contribute to the salamander underground colonization process.

  18. Trends in Ranavirus Prevalence Among Plethodontid Salamanders in the Great Smoky Mountains National Park.

    Science.gov (United States)

    Sutton, William B; Gray, Matthew J; Hoverman, Jason T; Secrist, Richard G; Super, Paul E; Hardman, Rebecca H; Tucker, Jennifer L; Miller, Debra L

    2015-06-01

    Emerging pathogens are a potential contributor to global amphibian declines. Ranaviruses, which infect ectothermic vertebrates and are common in aquatic environments, have been implicated in die-offs of at least 72 amphibian species worldwide. Most studies on the subject have focused on pool-breeding amphibians, and infection trends in other amphibian species assemblages have been understudied. Our primary study objective was to evaluate hypotheses explaining ranavirus prevalence within a lungless salamander assemblage (Family Plethodontidae) in the Great Smoky Mountains National Park, USA. We sampled 566 total plethodontid salamanders representing 14 species at five sites over a 6-year period (2007-2012). We identified ranavirus-positive individuals in 11 of the 14 (78.6%) sampled species, with salamanders in the genus Desmognathus having greatest infection prevalence. Overall, we found the greatest support for site elevation and sampling year determining infection prevalence. We detected the greatest number of infections in 2007 with 82.5% of sampled individuals testing positive for ranavirus, which we attribute to record drought during this year. Infection prevalence remained relatively high in low-elevation sites in 2008 and 2009. Neither body condition nor aquatic dependence was a significant predictor of ranavirus prevalence. Overall, our results indicate that life history differences among species play a minor role determining ranavirus prevalence compared to the larger effects of site elevation and yearly fluctuations (likely due to environmental stressors) during sampling years.

  19. The dynamic evolutionary history of genome size in North American woodland salamanders.

    Science.gov (United States)

    Newman, Catherine E; Gregory, T Ryan; Austin, Christopher C

    2017-04-01

    The genus Plethodon is the most species-rich salamander genus in North America, and nearly half of its species face an uncertain future. It is also one of the most diverse families in terms of genome sizes, which range from 1C = 18.2 to 69.3 pg, or 5-20 times larger than the human genome. Large genome size in salamanders results in part from accumulation of transposable elements and is associated with various developmental and physiological traits. However, genome sizes have been reported for only 25% of the species of Plethodon (14 of 55). We collected genome size data for Plethodon serratus to supplement an ongoing phylogeographic study, reconstructed the evolutionary history of genome size in Plethodontidae, and inferred probable genome sizes for the 41 species missing empirical data. Results revealed multiple genome size changes in Plethodon: genomes of western Plethodon increased, whereas genomes of eastern Plethodon decreased, followed by additional decreases or subsequent increases. The estimated genome size of P. serratus was 21 pg. New understanding of variation in genome size evolution, along with genome size inferences for previously unstudied taxa, provide a foundation for future studies on the biology of plethodontid salamanders.

  20. Seasonal variation in microhabitat of salamanders: environmental variation or shift of habitat selection?

    Directory of Open Access Journals (Sweden)

    Enrico Lunghi

    2015-08-01

    Full Text Available Relationships between species and their habitats are not always constant. Different processes may determine changes in species-habitat association: individuals may prefer different habitat typologies in different periods, or they may be forced to occupy a different habitat in order to follow the changing environment. The aim of our study was to assess whether cave salamanders change their habitat association pattern through the year, and to test whether such changes are determined by environmental changes or by changes in preferences. We monitored multiple caves in Central Italy through one year, and monthly measured biotic and abiotic features of microhabitat and recorded Italian cave salamanders distribution. We used mixed models and niche similarity tests to assess whether species-habitat relationships remain constant through the year. Microhabitat showed strong seasonal variation, with the highest variability in the superficial sectors. Salamanders were associated to relatively cold and humid sectors in summer, but not during winter. Such apparent shift in habitat preferences mostly occurred because the environmental gradient changed through the year, while individuals generally selected similar conditions. Nevertheless, juveniles were more tolerant to dry sectors during late winter, when food demand was highest. This suggests that tolerance for suboptimal abiotic conditions may change through time, depending on the required resources. Differences in habitat use are jointly determined by environmental variation through time, and by changes in the preferred habitat. The trade-offs between tolerance and resources requirement are major determinant of such variation.

  1. Unexpected rarity of the pathogen Batrachochytrium dendrobatidis in Appalachian Plethodon Salamanders: 1957-2011.

    Directory of Open Access Journals (Sweden)

    Carly Muletz

    Full Text Available Widespread population declines in terrestrial Plethodon salamanders occurred by the 1980s throughout the Appalachian Mountains, the center of global salamander diversity, with no evident recovery. We tested the hypothesis that the historic introduction and spread of the pathogenic fungus Batrachochytrium dendrobatidis (Bd into the eastern US was followed by Plethodon population declines. We expected to detect elevated prevalence of Bd prior to population declines as observed for Central American plethodontids. We tested 1,498 Plethodon salamanders of 12 species (892 museum specimens, 606 wild individuals for the presence of Bd, and tested 94 of those for Batrachochytrium salamandrivorans (Bs and for ranavirus. Field samples were collected in 2011 from 48 field sites across a 767 km transect. Historic samples from museum specimens were collected at five sites with the greatest number and longest duration of collection (1957-987, four of which were sampled in the field in 2011. None of the museum specimens were positive for Bd, but four P. cinereus from field surveys were positive. The overall Bd prevalence from 1957-2011 for 12 Plethodon species sampled across a 757 km transect was 0.2% (95% CI 0.1-0.7%. All 94 samples were negative for Bs and ranavirus. We conclude that known amphibian pathogens are unlikely causes for declines in these Plethodon populations. Furthermore, these exceptionally low levels of Bd, in a region known to harbor Bd, may indicate that Plethodon specific traits limit Bd infection.

  2. Phylogeography of Sardinian cave salamanders (genus Hydromantes) is mainly determined by geomorphology.

    Science.gov (United States)

    Chiari, Ylenia; van der Meijden, Arie; Mucedda, Mauro; Lourenço, João M; Hochkirch, Axel; Veith, Michael

    2012-01-01

    Detecting the factors that determine the interruption of gene flow between populations is key to understanding how speciation occurs. In this context, caves are an excellent system for studying processes of colonization, differentiation and speciation, since they represent discrete geographical units often with known geological histories. Here, we asked whether discontinuous calcareous areas and cave systems represent major barriers to gene flow within and among the five species of Sardinian cave salamanders (genus Hydromantes) and whether intraspecific genetic structure parallels geographic distance within and among caves. We generated mitochondrial cytochrome b gene sequences from 184 individuals representing 48 populations, and used a Bayesian phylogeographic approach to infer possible areas of cladogenesis for these species and reconstruct historical and current dispersal routes among distinct populations. Our results show deep genetic divergence within and among all Sardinian cave salamander species, which can mostly be attributed to the effects of mountains and discontinuities in major calcareous areas and cave systems acting as barriers to gene flow. While these salamander species can also occur outside caves, our results indicate that there is a very poor dispersal of these species between separate cave systems.

  3. Variable infection of stream salamanders in the southern Appalachians by the trematode Metagonimoides oregonensis (family: Heterophyidae).

    Science.gov (United States)

    Wyderko, Jennie A; Benfield, Ernest F; Maerz, John C; Cecala, Kristen C; Belden, Lisa K

    2015-08-01

    Many factors contribute to parasites varying in host specificity and distribution among potential hosts. Metagonimoides oregonensis is a digenetic trematode that uses stream-dwelling plethodontid salamanders as second intermediate hosts in the Eastern US. We completed a field survey to identify which stream salamander species, at a regional level, are most likely to be important for transmission to raccoon definitive hosts. We surveyed six plethodontid species (N = 289 salamanders) from 23 Appalachian headwater sites in North Carolina: Desmognathus quadramaculatus (n = 69), Eurycea wilderae (n = 160), Desmognathus ocoee (n = 31), Desmognathus monticola (n = 3), Eurycea guttolineata (n = 7), and Gyrinophilus porphyriticus (n = 19). We found infection in all species except D. monticola. Further analysis focused on comparing infection in the two most abundant species, D. quadramaculatus and E. wilderae. We found that D. quadramaculatus had significantly higher infection prevalence and intensity, probably due to a longer aquatic larval period and larger body sizes and thus greater cumulative exposure to the parasite.

  4. Potential reduction in terrestrial salamander ranges associated with Marcellus shale development

    Science.gov (United States)

    Brand, Adrianne; Wiewel, Amber N. M.; Grant, Evan H. Campbell

    2014-01-01

    Natural gas production from the Marcellus shale is rapidly increasing in the northeastern United States. Most of the endemic terrestrial salamander species in the region are classified as ‘globally secure’ by the IUCN, primarily because much of their ranges include state- and federally protected lands, which have been presumed to be free from habitat loss. However, the proposed and ongoing development of the Marcellus gas resources may result in significant range restrictions for these and other terrestrial forest salamanders. To begin to address the gaps in our knowledge of the direct impacts of shale gas development, we developed occurrence models for five species of terrestrial plethodontid salamanders found largely within the Marcellus shale play. We predicted future Marcellus shale development under several scenarios. Under scenarios of 10,000, 20,000, and 50,000 new gas wells, we predict 4%, 8%, and 20% forest loss, respectively, within the play. Predictions of habitat loss vary among species, but in general, Plethodon electromorphus and Plethodonwehrlei are predicted to lose the greatest proportion of forested habitat within their ranges if future Marcellus development is based on characteristics of the shale play. If development is based on current well locations,Plethodonrichmondi is predicted to lose the greatest proportion of habitat. Models showed high uncertainty in species’ ranges and emphasize the need for distribution data collected by widespread and repeated, randomized surveys.

  5. Unexpected rarity of the pathogen Batrachochytrium dendrobatidis in Appalachian Plethodon Salamanders: 1957-2011.

    Science.gov (United States)

    Muletz, Carly; Caruso, Nicholas M; Fleischer, Robert C; McDiarmid, Roy W; Lips, Karen R

    2014-01-01

    Widespread population declines in terrestrial Plethodon salamanders occurred by the 1980s throughout the Appalachian Mountains, the center of global salamander diversity, with no evident recovery. We tested the hypothesis that the historic introduction and spread of the pathogenic fungus Batrachochytrium dendrobatidis (Bd) into the eastern US was followed by Plethodon population declines. We expected to detect elevated prevalence of Bd prior to population declines as observed for Central American plethodontids. We tested 1,498 Plethodon salamanders of 12 species (892 museum specimens, 606 wild individuals) for the presence of Bd, and tested 94 of those for Batrachochytrium salamandrivorans (Bs) and for ranavirus. Field samples were collected in 2011 from 48 field sites across a 767 km transect. Historic samples from museum specimens were collected at five sites with the greatest number and longest duration of collection (1957-987), four of which were sampled in the field in 2011. None of the museum specimens were positive for Bd, but four P. cinereus from field surveys were positive. The overall Bd prevalence from 1957-2011 for 12 Plethodon species sampled across a 757 km transect was 0.2% (95% CI 0.1-0.7%). All 94 samples were negative for Bs and ranavirus. We conclude that known amphibian pathogens are unlikely causes for declines in these Plethodon populations. Furthermore, these exceptionally low levels of Bd, in a region known to harbor Bd, may indicate that Plethodon specific traits limit Bd infection.

  6. Phylogeography of Sardinian cave salamanders (genus Hydromantes is mainly determined by geomorphology.

    Directory of Open Access Journals (Sweden)

    Ylenia Chiari

    Full Text Available Detecting the factors that determine the interruption of gene flow between populations is key to understanding how speciation occurs. In this context, caves are an excellent system for studying processes of colonization, differentiation and speciation, since they represent discrete geographical units often with known geological histories. Here, we asked whether discontinuous calcareous areas and cave systems represent major barriers to gene flow within and among the five species of Sardinian cave salamanders (genus Hydromantes and whether intraspecific genetic structure parallels geographic distance within and among caves. We generated mitochondrial cytochrome b gene sequences from 184 individuals representing 48 populations, and used a Bayesian phylogeographic approach to infer possible areas of cladogenesis for these species and reconstruct historical and current dispersal routes among distinct populations. Our results show deep genetic divergence within and among all Sardinian cave salamander species, which can mostly be attributed to the effects of mountains and discontinuities in major calcareous areas and cave systems acting as barriers to gene flow. While these salamander species can also occur outside caves, our results indicate that there is a very poor dispersal of these species between separate cave systems.

  7. Frequency-dependent selection by wild birds promotes polymorphism in model salamanders

    Directory of Open Access Journals (Sweden)

    Shook Kim

    2009-05-01

    Full Text Available Abstract Background Co-occurrence of distinct colour forms is a classic paradox in evolutionary ecology because both selection and drift tend to remove variation from populations. Apostatic selection, the primary hypothesis for maintenance of colour polymorphism in cryptic animals, proposes that visual predators focus on common forms of prey, resulting in higher survival of rare forms. Empirical tests of this frequency-dependent foraging hypothesis are rare, and the link between predator behaviour and maintenance of variation in prey has been difficult to confirm. Here, we show that predatory birds can act as agents of frequency-dependent selection on terrestrial salamanders. Polymorphism for presence/absence of a dorsal stripe is widespread in many salamander species and its maintenance is a long-standing mystery. Results We used realistic food-bearing model salamanders to test whether selection by wild birds maintains a stripe/no-stripe polymorphism. In experimental manipulations, whichever form was most common was most likely to be attacked by ground-foraging birds, resulting in a survival advantage for the rare form. Conclusion This experiment demonstrates that frequency-dependent foraging by wild birds can maintain colour polymorphism in cryptic prey.

  8. Sex in unisexual salamanders: discovery of a new sperm donor with ancient affinities.

    Science.gov (United States)

    Bogart, J P; Bartoszek, J; Noble, D W A; Bi, K

    2009-12-01

    Although bisexual reproduction has considerable evolutionary benefits, several all-female vertebrates exist. Unisexual salamanders in the genus Ambystoma are common around the Great Lakes region in eastern North America. They originated from a hybridization event that involved a female that shared a common ancestor with Ambystoma barbouri 2.4 to 3.9 million years ago but, unexpectedly, A. barbouri nuclear genomes were unknown in unisexuals. Unisexual salamanders steal sperm from donors of normally bisexual species, so their reproductive mode is described as kleptogenesis. Most known unisexuals are polyploid and they all possess at least one A. laterale genome. One or more other genomes are taken from sperm donors that may include A. jeffersonianum, A. laterale, A. texanum and A. tigrinum. We examined unisexual adults and larvae in a southern Ohio pond where unisexual individuals coexist with male A. barbouri. This population provided an opportunity to test hypotheses pertaining to the role of A. barbouri in the evolution of the disparate cytoplasmic and nuclear genomes in unisexual salamanders. Microsatellite DNA loci, mitochondrial DNA sequences and genomic in situ hybridization were used to identify the genomic constitution of individuals. A. barbouri was found to be an acceptable sperm donor for unisexuals but only contributed genomes in ploidy-elevated individuals. In the absence of A. jeffersonianum, this Ohio population is likely experiencing a recent switch in sperm donors from A. jeffersonianum to A. barbouri and demonstrates the evolutionary flexibility and dynamics of kleptogenesis.

  9. Midbrain dopaminergic neurogenesis and behavioural recovery in a salamander lesion-induced regeneration model.

    Science.gov (United States)

    Parish, Clare L; Beljajeva, Anna; Arenas, Ernest; Simon, András

    2007-08-01

    Death and lack of functional regeneration of midbrain dopaminergic (DA) neurons, decreased DA input in the target striatum and movement anomalies characterise Parkinson's disease (PD). There is currently no cure for PD. One way to promote recovery would be to induce or enhance DA neurogenesis. Whether DA neurogenesis occurs in the adult midbrain is a matter of debate. Here, we describe the creation of a salamander 6-hydroxydopamine model of PD to examine midbrain DA regeneration. We demonstrate a robust and complete regeneration of the mesencephalic and diencephalic DA system after elimination of DA neurons. Regeneration is contributed by DA neurogenesis, leads to histological restoration, and to full recovery of motor behaviour. Molecular analyses of the temporal expression pattern of DA determinants indicate that the regenerating DA neurons mature along a similar developmental program as their mammalian counterparts during embryogenesis. We also find that the adult salamander midbrain can reactivate radial glia-like ependymoglia cells that proliferate. The salamander model provides insights into the mechanisms of DA regeneration/neurogenesis and may contribute to the development of novel regenerative strategies for the mammalian brain.

  10. Evidence for the local evolution of mechanisms underlying limb regeneration in salamanders.

    Science.gov (United States)

    Garza-Garcia, A Acely; Driscoll, Paul C; Brockes, Jeremy P

    2010-10-01

    The most extensive regenerative ability in adult vertebrates is found in the salamanders. Although it is often suggested that regeneration is an ancestral property for vertebrates, our studies on the cell-surface three-finger-protein Prod 1 provide clear evidence for the importance of local evolution of limb regeneration in salamanders. Prod 1 is implicated in both patterning and growth in the regeneration of limbs. It interacts with well-conserved proteins such as the epidermal growth-factor receptor and the anterior gradient protein that are widely expressed in phylogeny. A detailed analysis of the structure and sequence of Prod 1 in relation to other vertebrate three-finger proteins in mammals and zebra fish supports the view that it is a salamander-specific protein. This is the first example of a taxon-specific protein that is clearly implicated in the mechanisms of regeneration. We propose the hypothesis that regeneration depends on the activity of taxon-specific components in orchestrating a cellular machinery that is extensively conserved between regenerating and non-regenerating taxa. This hypothesis has significant implications for our outlook on regeneration in vertebrates, as well as for the strategies employed in extending regenerative ability in mammals.

  11. Studying Springs in Series Using a Single Spring

    Science.gov (United States)

    Serna, Juan D.; Joshi, Amitabh

    2011-01-01

    Springs are used for a wide range of applications in physics and engineering. Possibly, one of their most common uses is to study the nature of restoring forces in oscillatory systems. While experiments that verify Hooke's law using springs are abundant in the physics literature, those that explore the combination of several springs together are…

  12. Warm Springs pupfish recovery plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document gives a history of pupfish and focuses on the warm springs pupfish. The warm springs pupfish is endangered, and this is a plan to help recover the...

  13. Salamander chytrid fungus (Batrachochytrium salamandrivorans) in the United States—Developing research, monitoring, and management strategies

    Science.gov (United States)

    Grant, Evan H. Campbell; Muths, Erin L.; Katz, Rachel A.; Canessa, Stefano; Adams, Michael J.; Ballard, Jennifer R.; Berger, Lee; Briggs, Cheryl J.; Coleman, Jeremy; Gray, Matthew J.; Harris, M. Camille; Harris, Reid N.; Hossack, Blake R.; Huyvaert, Kathryn P.; Kolby, Jonathan E.; Lips, Karen R.; Lovich, Robert E.; McCallum, Hamish I.; Mendelson, Joseph R.; Nanjappa, Priya; Olson, Deanna H.; Powers, Jenny G.; Richgels, Katherine L.D.; Russell, Robin E.; Schmidt, Benedikt R.; Spitzen-van der Sluijs, Annemarieka; Watry, Mary Kay; Woodhams, Douglas C.; White, C. LeAnn

    2016-01-20

    The recently (2013) identified pathogenic chytrid fungus, Batrachochytrium salamandrivorans (Bsal), poses a severe threat to the distribution and abundance of salamanders within the United States and Europe. Development of a response strategy for the potential, and likely, invasion of Bsal into the United States is crucial to protect global salamander biodiversity. A formal working group, led by Amphibian Research and Monitoring Initiative (ARMI) scientists from the U.S. Geological Survey (USGS) Patuxent Wildlife Research Center, Fort Collins Science Center, and Forest and Rangeland Ecosystem Science Center, was held at the USGS Powell Center for Analysis and Synthesis in Fort Collins, Colorado, United States from June 23 to June 25, 2015, to identify crucial Bsal research and monitoring needs that could inform conservation and management strategies for salamanders in the United States. Key findings of the workshop included the following: (1) the introduction of Bsal into the United States is highly probable, if not inevitable, thus requiring development of immediate short-term and long-term intervention strategies to prevent Bsal establishment and biodiversity decline; (2) management actions targeted towards pathogen containment may be ineffective in reducing the long-term spread of Bsal throughout the United States; and (3) early detection of Bsal through surveillance at key amphibian import locations, among high-risk wild populations, and through analysis of archived samples is necessary for developing management responses. Top research priorities during the preinvasion stage included the following: (1) deployment of qualified diagnostic methods for Bsal and establishment of standardized laboratory practices, (2) assessment of susceptibility for amphibian hosts (including anurans), and (3) development and evaluation of short- and long-term pathogen intervention and management strategies. Several outcomes were achieved during the workshop, including development

  14. Hot Spring Metagenomics

    Directory of Open Access Journals (Sweden)

    Olalla López-López

    2013-04-01

    Full Text Available Hot springs have been investigated since the XIX century, but isolation and examination of their thermophilic microbial inhabitants did not start until the 1950s. Many thermophilic microorganisms and their viruses have since been discovered, although the real complexity of thermal communities was envisaged when research based on PCR amplification of the 16S rRNA genes arose. Thereafter, the possibility of cloning and sequencing the total environmental DNA, defined as metagenome, and the study of the genes rescued in the metagenomic libraries and assemblies made it possible to gain a more comprehensive understanding of microbial communities—their diversity, structure, the interactions existing between their components, and the factors shaping the nature of these communities. In the last decade, hot springs have been a source of thermophilic enzymes of industrial interest, encouraging further study of the poorly understood diversity of microbial life in these habitats.

  15. Magnetic Spring Device

    OpenAIRE

    Hassam, A. B.; Rodgers, J. C.

    2009-01-01

    A cylindrical system is proposed that will store magnetic energy in a localized azimuthal field that can then be quickly released on Alfvenic timescales, accompanied by the formation of a flowing Z-pinch plasma. The magnetized plasma is MHD in character and will have unilateral axial momentum with Alfvenic speeds. Conventional plasma gun injectors (Marshall type) have a limited parameter space of operation. The "magnetic spring" momentum injector differs from Marshall guns in that it has an a...

  16. Intraerythrocytic rickettsial inclusions in Ocoee salamanders (Desmognathus ocoee): prevalence, morphology, and comparisons with inclusions of Plethodon cinereus.

    Science.gov (United States)

    Davis, Andrew K; Cecala, Kristen

    2010-07-01

    Reports of an unusual intraerythrocytic pathogen in amphibian blood have been made for decades; these pathogens appear as membrane-bound vacuoles within erythrocytes. It is now understood that the pathogen is a Rickettsia bacteria, which are obligate intracellular parasites, and most are transmitted by arthropod vectors. In an effort to further understand the host range and characteristics of this pathogen, we examined 20 Ocoee salamanders (Desmognathus ocoee) from a site in southwest North Carolina for the presence of rickettsial inclusions and report the general characteristics of infections. Seven individuals (35%) were infected, and this level of prevalence was consistent with all other members of this genus examined to date. In contrast, infections within the genus Plethodon tend to occur in less than 10% of individuals, based on review of the literature. The difference could be related to the semi-aquatic nature of Desmognathus salamanders versus the completely terrestrial Plethodon. It is also possible that both groups are hosts to different types of rickettsial bacteria, since the inclusions found here only vaguely resembled those found recently in red-backed salamanders (Plethodon cinereus). Inclusions in Ocoee salamanders measured 4 microm in diameter on average, and most cells (88%) only had one inclusion. Of all infected individuals, inclusions occurred in approximately 3% of erythrocytes. Similar to that found in red-backed salamanders, infected hosts were significantly larger than non-infected. Future investigations into the nature of this unusual parasite of amphibians would help to further our understanding of its life cycle and transmission.

  17. Similarity and differentiation between bacteria associated with skin of salamanders (Plethodon jordani) and free-living assemblages.

    Science.gov (United States)

    Fitzpatrick, Benjamin M; Allison, Amanda L

    2014-06-01

    All animals and plants have intimate associations with microbes. Opinion has shifted from viewing microbes primarily as pathogens to the idea that healthy animals and plants carry specialized communities of coevolving microorganisms. However, the generality of this proposition is unknown because surveys rarely compare host-associated microbes with samples from relevant microhabitats. Symbiotic communities might be assembled from local environments with little evolutionary specialization. We evaluated the specificity of bacteria associated with salamander skin in comparison with surfaces in their immediate environments using 16S rRNA sequences. Host-associated and free-living samples were significantly different. However, relative abundances were strongly correlated; the most abundant taxa on salamander skin were also most abundant on moist debris on the forest floor. Thus, although bacterial assemblages on salamander skin are statistically differentiated from those on inanimate surfaces, they are not entirely 'distinct'. Candidate salamander specialists were few in number and occurred at low relative abundances. Within some OTUs, differences in allele frequency suggested genetic specialization at finer levels. Although host-associated and free-living assemblages were similar, a range of more or less specialized symbiotes was evident and bacteria on salamander skin were often specific genotypes of OTUs commonly found on other moist surfaces in the environment.

  18. Cloning of a cDNA encoding cathepsin D from salamander, Hynobius leechii, and its expression in the limb regenerates.

    Science.gov (United States)

    Ju, B G; Kim, W S

    2000-01-01

    Cathepsin D is a major lysosomal aspartic proteinase participating in the degradation or modification of intra- and extracellular matrix molecules, and its activity is known to increase in the process of tissue reorganization during the early phase of salamander limb regeneration. Here, we report the cloning of a salamander cathepsin D cDNA from Hynobius leechii and its expression profile in normal and retinoic acid (RA) treated limb regenerates. The gene expression of cathepsin D increased notably during the dedifferentiation stage and decreased gradually thereafter. Furthermore, RA that enhances dedifferentiation of regenerating salamander limb caused the elevation of cathepsin D expression both in terms of level and duration. These results suggest that cathepsin D plays important role(s) in the dedifferentiation process, and enhancement of cathepsin D expression might be closely related to RA-evoked pattern duplication.

  19. In search of critically endangered species: the current situation of two tiny salamander species in the Neotropical mountains of Mexico.

    Directory of Open Access Journals (Sweden)

    Adriana Sandoval-Comte

    Full Text Available Worldwide, one in every three species of amphibian is endangered, 39 species have gone extinct in the last 500 years and another 130 species are suspected to have gone extinct in recent decades. Of the amphibians, salamanders have the highest portion of their species in one of the risk categories, even higher than the frogs. To date there have been few studies that have used recent field data to examine the status of populations of endangered salamanders. In this study we evaluate the current situation of two tiny salamanders, Parvimolge townsendi and Thorius pennatulus, both of which are distributed at intermediate elevations in the mountains of the northern Neotropics and are considered to be critically endangered; the first has been proposed as possibly extinct. By carrying out exhaustive surveys in both historical and potentially suitable sites for these two species, we evaluated their abundance and the characteristics of their habitats, and we estimated their potential geographic distribution. We visited 22 sites, investing 672 person-hours of sampling effort in the surveys, and found 201 P. townsendi salamanders in 11 sites and only 13 T. pennatulus salamanders in 5 sites. Both species were preferentially found in cloud forest fragments that were well conserved or only moderately transformed, and some of the salamanders were found in shade coffee plantations. The potential distribution area of both species is markedly fragmented and we estimate that it has decreased by more than 48%. The results of this study highlight the importance of carrying out exhaustive, systematic field surveys to obtain accurate information about the current situation of critically endangered species, and help us better understand the crisis that amphibians are facing worldwide.

  20. Magnetic Spring Device

    CERN Document Server

    Hassam, A B

    2009-01-01

    A cylindrical system is proposed that will store magnetic energy in a localized azimuthal field that can then be quickly released on Alfvenic timescales, accompanied by the formation of a flowing Z-pinch plasma. The magnetized plasma is MHD in character and will have unilateral axial momentum with Alfvenic speeds. Conventional plasma gun injectors (Marshall type) have a limited parameter space of operation. The "magnetic spring" momentum injector differs from Marshall guns in that it has an already stored strong magnetic field before release. The resulting parameter space is much broader. There are possible applications to momentum injectors for fusion and to plasma and rail guns.

  1. Behavioral and physiological antipredator responses of the San Marcos salamander, Eurycea nana.

    Science.gov (United States)

    Davis, Drew R; Gabor, Caitlin R

    2015-02-01

    Exposure to predatory stimuli typically results in the elevation of circulating glucocorticoid levels and a behavioral response of freezing or escape behavior in many prey species. Corticosterone (CORT) is the main glucocorticoid in amphibians and is known to be important in modulating many behaviors and developmental functions. The federally threatened San Marcos salamander, Eurycea nana, decreases activity in response to both native and introduced predatory fish, however, experience may further influence these interactions. To better understand the indirect effects of fish predators on this salamander, we examined both the antipredator behavior and water-borne CORT release rates in response to chemical cues (kairomones) from two fish species that varied in temporal risk of predation: (1) a low encounter frequency predator (largemouth bass, Micropterus salmoides), (2) a high encounter frequency predator (redbreast sunfish, Lepomis auritus), and (3) a blank water control. Salamanders reduced activity (antipredator response) after exposure to both predator treatments, but not to the blank water control, and the response to M. salmoides was significantly stronger than that to L. auritus. The CORT response (post-stimulus/pre-stimulus release rates) did not differ between the blank water control and L. auritus treatments, and both were significantly less than the CORT response to M. salmoides. Overall, E. nana showed a decreased antipredator response and no CORT response towards the high encounter frequency L. auritus as compared to the low encounter frequency M. salmoides. Eurycea nana may mute antipredator and CORT responses to high temporal frequency predators. There was, however, no correlation between CORT release rates and antipredator behavior, which suggests that the presence of predators may be affecting CORT response and behavior independently.

  2. Life history plasticity does not confer resilience to environmental change in the mole salamander (Ambystoma talpoideum)

    Science.gov (United States)

    Courtney L. Davis,; David A.W. Miller,; Walls, Susan; Barichivich, William J.; Riley, Jeffrey W.; Brown, Mary E.

    2017-01-01

    Plasticity in life history strategies can be advantageous for species that occupy spatially or temporally variable environments. We examined how phenotypic plasticity influences responses of the mole salamander, Ambystoma talpoideum, to disturbance events at the St. Marks National Wildlife Refuge (SMNWR), FL, USA from 2009 to 2014. We observed periods of extensive drought early in the study, in contrast to high rainfall and expansive flooding events in later years. Flooding facilitated colonization of predatory fishes to isolated wetlands across the refuge. We employed multistate occupancy models to determine how this natural experiment influenced the occurrence of aquatic larvae and paedomorphic adults and what implications this may have for the population. We found that, in terms of occurrence, responses to environmental variation differed between larvae and paedomorphs, but plasticity (i.e. the ability to metamorphose rather than remain in aquatic environment) was not sufficient to buffer populations from declining as a result of environmental perturbations. Drought and fish presence negatively influenced occurrence dynamics of larval and paedomorphic mole salamanders and, consequently, contributed to observed short-term declines of this species. Overall occurrence of larval salamanders decreased from 0.611 in 2009 to 0.075 in 2014 and paedomorph occurrence decreased from 0.311 in 2009 to 0.121 in 2014. Although variation in selection pressures has likely maintained this polyphenism previously, our results suggest that continued changes in environmental variability and the persistence of fish in isolated wetlands could lead to a loss of paedomorphosis in the SMNWR population and, ultimately, impact regional persistence in the future.

  3. The role of climate in the dynamics of a hybrid zone in Appalachian salamanders

    Science.gov (United States)

    Walls, Susan

    2009-01-01

    I examined the potential influence of climate change on the dynamics of a previously studied hybrid zone between a pair of terrestrial salamanders at the Coweeta Hydrologic Laboratory, U.S. Forest Service, in the Nantahala Mountains of North Carolina, USA. A 16-year study led by Nelson G. Hairston, Sr. revealed that Plethodon teyahalee and Plethodon shermani hybridized at intermediate elevations, forming a cline between 'pure' parental P. teyahalee at lower elevations and 'pure' parental P. shermani at higher elevations. From 1974 to 1990 the proportion of salamanders at the higher elevation scored as 'pure' P. shermani declined significantly, indicating that the hybrid zone was spreading upward. To date there have been no rigorous tests of hypotheses for the movement of this hybrid zone. Using temperature and precipitation data from Coweeta, I re-analyzed Hairston's data to examine whether the observed elevational shift was correlated with variation in either air temperature or precipitation from the same time period. For temperature, my analysis tracked the results of the original study: the proportion of 'pure' P. shermani at the higher elevation declined significantly with increasing mean annual temperature, whereas the proportion of 'pure' P. teyahalee at lower elevations did not. There was no discernable relationship between proportions of 'pure' individuals of either species with variation in precipitation. From 1974 to 1990, low-elevation air temperatures at the Coweeta Laboratory ranged from annual means of 11.8 to 14.2 °C, compared with a 55-year average (1936-1990) of 12.6 °C. My re-analyses indicate that the upward spread of the hybrid zone is correlated with increasing air temperatures, but not precipitation, and provide an empirical test of a hypothesis for one factor that may have influenced this movement. My results aid in understanding the potential impact that climate change may have on the ecology and evolution of terrestrial salamanders in

  4. Role of habitat complexity in predator-prey dynamics between an introduced fish and larval Long-toed Salamanders (Ambystoma macrodactylum)

    Science.gov (United States)

    Kenison, Erin K; Litt, Andrea R.; Pilliod, David; McMahon, Tom E

    2016-01-01

    Predation by nonnative fishes has reduced abundance and increased extinction risk for amphibian populations worldwide. Although rare, fish and palatable amphibians have been observed to coexist where aquatic vegetation and structural complexity provide suitable refugia. We examined whether larval long-toed salamanders (Ambystoma macrodactylum Baird, 1849) increased use of vegetation cover in lakes with trout and whether adding vegetation structure could reduce predation risk and nonconsumptive effects (NCEs), such as reductions in body size and delayed metamorphosis. We compared use of vegetation cover by larval salamanders in lakes with and without trout and conducted a field experiment to investigate the influence of added vegetation structure on salamander body morphology and life history. The probability of catching salamanders in traps in lakes with trout was positively correlated with the proportion of submerged vegetation and surface cover. Growth rates of salamanders in enclosures with trout cues decreased as much as 85% and the probability of metamorphosis decreased by 56%. We did not find evidence that adding vegetation reduced NCEs in experimental enclosures, but salamanders in lakes with trout utilized more highly-vegetated areas which suggests that adding vegetation structure at the scale of the whole lake may facilitate coexistence between salamanders and introduced trout.

  5. Several Moments of the Spring

    Institute of Scientific and Technical Information of China (English)

    毛竹晨

    2003-01-01

    Spring has finally fallen on Cambridge. After a long, wet and dark winter, sky finally brightens up. The first messenger of spring is the daffodil (水仙花). English daffodils are slightly different from the Chinese ones that we are all familiar with. First of all, they bloom in spring, not in winter as the Chinese daffodils do. Second, they do not grow in water, but on the ground, though they

  6. Detection of spring viraemia of carp virus in imported amphibians reveals an unanticipated foreign animal disease threat.

    Science.gov (United States)

    Ip, Hon S; Lorch, Jeffrey M; Blehert, David S

    2016-09-07

    Global translocation of plants and animals is a well-recognized mechanism for introduction of pathogens into new regions. To mitigate this risk, various tools such as preshipment health certificates, quarantines, screening for specific disease agents and outright bans have been implemented. However, such measures only target known infectious agents and their hosts and may fail to prevent translocation of even well-recognized pathogens if they are carried by novel host species. In a recent example, we screened an imported shipment of Chinese firebelly newts (Cynops orientalis) for Batrachochytrium salamandrivorans, an emergent fungal pathogen of salamanders. All animals tested negative for the fungus. However, a virus was cultured from internal organs from 7 of the 11 individual dead salamanders and from two pools of tissues from four additional dead animals. Sequencing of a portion of the glycoprotein gene from all viral isolates indicated 100% identity and that they were most closely related to spring viraemia of carp virus (SVCV). Subsequently, SVCV-specific PCR testing indicated the presence of virus in internal organs from each of the four animals previously pooled, and whole-genome sequencing of one of the viral isolates confirmed genomic arrangement characteristic of SVCV. SVCV is a rhabdovirus pathogen of cyprinid fish that is listed as notifiable to the Office International des Epizooties. This discovery reveals a novel route for potential spillover of this economically important pathogen as rhabdovirus has not previously been documented in amphibians.

  7. Detection of spring viraemia of carp virus in imported amphibians reveals an unanticipated foreign animal disease threat

    Science.gov (United States)

    Ip, Hon S.; Lorch, Jeffrey M.; Blehert, David

    2016-01-01

    Global translocation of plants and animals is a well-recognized mechanism for introduction of pathogens into new regions. To mitigate this risk, various tools such as preshipment health certificates, quarantines, screening for specific disease agents and outright bans have been implemented. However, such measures only target known infectious agents and their hosts and may fail to prevent translocation of even well-recognized pathogens if they are carried by novel host species. In a recent example, we screened an imported shipment of Chinese firebelly newts (Cynops orientalis) for Batrachochytrium salamandrivorans, an emergent fungal pathogen of salamanders. All animals tested negative for the fungus. However, a virus was cultured from internal organs from 7 of the 11 individual dead salamanders and from two pools of tissues from four additional dead animals. Sequencing of a portion of the glycoprotein gene from all viral isolates indicated 100% identity and that they were most closely related to spring viraemia of carp virus (SVCV). Subsequently, SVCV-specific PCR testing indicated the presence of virus in internal organs from each of the four animals previously pooled, and whole-genome sequencing of one of the viral isolates confirmed genomic arrangement characteristic of SVCV. SVCV is a rhabdovirus pathogen of cyprinid fish that is listed as notifiable to the Office International des Epizooties. This discovery reveals a novel route for potential spillover of this economically important pathogen as rhabdovirus has not previously been documented in amphibians.

  8. Spring viremia of carp

    Science.gov (United States)

    Ahne, W.; Bjorklund, H.V.; Essbauer, S.; Fijan, N.; Kurath, G.; Winton, J.R.

    2002-01-01

    pring viremia of carp (SVC) is an important disease affecting cyprinids, mainly common carp Cyprinus carpio. The disease is widespread in European carp culture, where it causes significant morbidity and mortality. Designated a notifiable disease by the Office International des Epizooties, SVC is caused by a rhabdovirus, spring viremia of carp virus (SVCV). Affected fish show destruction of tissues in the kidney, spleen and liver, leading to hemorrhage, loss of water-salt balance and impairment of immune response. High mortality occurs at water temperatures of 10 to 17°C, typically in spring. At higher temperatures, infected carp develop humoral antibodies that can neutralize the spread of virus and such carp are protected against re-infection by solid immunity. The virus is shed mostly with the feces and urine of clinically infected fish and by carriers. Waterborne transmission is believed to be the primary route of infection, but bloodsucking parasites like leeches and the carp louse may serve as mechanical vectors of SVCV. The genome of SVCV is composed of a single molecule of linear, negative-sense, single-stranded RNA containing 5 genes in the order 3¹-NPMGL-5¹ coding for the viral nucleoprotein, phosphoprotein, matrix protein, glycoprotein, and polymerase, respectively. Polyacrylamide gel electrophoresis of the viral proteins, and sequence homologies between the genes and gene junctions of SVCV and vesicular stomatitis viruses, have led to the placement of the virus as a tentative member of the genus Vesiculovirus in the family Rhabdoviridae. These methods also revealed that SVCV is not related to fish rhabdoviruses of the genus Novirhabdovirus. In vitro replication of SVCV takes place in the cytoplasm of cultured cells of fish, bird and mammalian origin at temperatures of 4 to 31°C, with an optimum of about 20°C. Spring viremia of carp can be diagnosed by clinical signs, isolation of virus in cell culture and molecular methods. Antibodies directed

  9. Spring security 3.x cookbook

    CERN Document Server

    Mankale, Anjana

    2013-01-01

    This book follows a cookbook style exploring various security solutions provided by Spring Security for various vulnerabilities and threat scenarios that web applications may be exposed to at the authentication and session level layers.This book is for all Spring-based application developers as well as Java web developers who wish to implement robust security mechanisms into web application development using Spring Security.Readers are assumed to have a working knowledge of Java web application development, a basic understanding of the Spring framework, and some knowledge of the fundamentals o

  10. Persistence and extirpation in invaded landscapes: patch characteristics and connectivity determine effects of non-native predatory fish on native salamanders

    Science.gov (United States)

    Pilliod, David S.; Arkle, Robert S.; Maxell, Bryce A.

    2012-01-01

    Studies have demonstrated negative effects of non-native, predatory fishes on native amphibians, yet it is still unclear why some amphibian populations persist, while others are extirpated, following fish invasion. We examined this question by developing habitat-based occupancy models for the long-toed salamander (Ambystoma macrodactylum) and nonnative fish using survey data from 1,749 water bodies across 470 catchments in the Northern Rocky Mountains, USA. We first modeled the habitat associations of salamanders at 468 fishless water bodies in 154 catchments where non-native fish were historically, and are currently, absent from the entire catchment. Wethen applied this habitat model to the complete data set to predict the probability of salamander occupancy in each water body, removing any effect of fish presence. Finally, we compared field-observed occurrences of salamanders and fish to modeled probability of salamander occupancy. Suitability models indicated that fish and salamanders had similar habitat preferences, possibly resulting in extirpations of salamander populations from entire catchments where suitable habitats were limiting. Salamanders coexisted with non-native fish in some catchments by using marginal quality, isolated (no inlet or outlet) habitats that remained fishless. They rarely coexisted with fish within individual water bodies and only where habitat quality was highest. Connectivity of water bodies via streams resulted in increased probability of fish invasion and consequently reduced probability of salamander occupancy.These results could be used to identify and prioritize catchments and water bodies where control measures would be most effective at restoring amphibian populations. Our approach could be useful as a framework for improved investigations into questions of persistence and extirpation of native species when non-native species have already become established.

  11. Large springs of east Tennessee

    Science.gov (United States)

    Sun, Pao-chang P.; Criner, J.H.; Poole, J.L.

    1963-01-01

    Springs constitute an important source of water in east Tennessee, and many individual springs are capable of supplying the large quantities needed for municipal and industrial supplies. Most of the springs in east Tennessee issue from solution openings and fractured and faulted zones in limestone and dolomite of the Knox Group, Chickamauga Limestone, and Conasauga Group. The ability of these rocks to yield a sustained flow of water to springs is dependent on a system of interconnected openings through which water can infiltrate from the land surface and move to points of natural discharge. Ninety springs were selected for detailed study, and 84 of these are analyzed in terms of magnitude and variability of discharge. Of the 84 springs analyzed, 4 flow at an average rate of 10 to 100 cfs (cubic feet per second), 62 at an average rate of 1 to 10 cfs, and 18 at an average rate of 1 cfs or less. Of the 90 springs, 75 are variable in their discharge; that is, the ratio of their fluctuations to their average discharges exceeds 100 percent. Mathematical analysis of the flow recession curve of Mill Spring near Jefferson City shows that the hydrologic system contributing to the flow of the spring has an effective capacity of about 70 million cubic feet of water. The rate of depletion of this volume of water, in the absence of significant precipitation, averages 0.0056 cfs per day between the time when the hydrologic system is full and the time when the spring ceases to flow. From such a curve it is possible to determine at any time the residual volume of water remaining in the system and the expected rate of decrease in discharge from that time to cessation of flow. Correlation of discharge measurements of 22 springs with those of Mill Spring shows that rough approximations of discharge can be projected for springs for which few measurements are available. Seventeen of the springs analyzed in this manner show good correlation with Mill Spring: that is, their coefficients

  12. Vertebral number is highly evolvable in salamanders and newts (family Salamandridae) and variably associated with climatic parameters

    NARCIS (Netherlands)

    Arntzen, J.W.; Beukema, W.; Galis, F.; Ivanović, A.

    2015-01-01

    In vertebrates, the relative proportion of the number of trunk and caudal vertebrae is an important determinant of body shape. While among amphibians frogs and toads show low variation in vertebrae numbers, in salamanders the numbers of trunk and caudal vertebrae vary widely, giving rise to phenotyp

  13. Conservation genetics of extremely isolated urban populations of the northern dusky salamander (Desmognathus fuscus in New York City

    Directory of Open Access Journals (Sweden)

    Jason Munshi-South

    2013-04-01

    Full Text Available Urbanization is a major cause of amphibian decline. Stream-dwelling plethodontid salamanders are particularly susceptible to urbanization due to declining water quality and hydrological changes, but few studies have examined these taxa in cities. The northern dusky salamander (Desmognathus fuscus was once common in the New York City metropolitan area, but has substantially declined throughout the region in recent decades. We used five tetranucleotide microsatellite loci to examine population differentiation, genetic variation, and bottlenecks among five remnant urban populations of dusky salamanders in NYC. These genetic measures provide information on isolation, prevalence of inbreeding, long-term prospects for population persistence, and potential for evolutionary responses to future environmental change. All populations were genetically differentiated from each other, and the most isolated populations in Manhattan have maintained very little genetic variation (i.e. <20% heterozygosity. A majority of the populations also exhibited evidence of genetic bottlenecks. These findings contrast with published estimates of high genetic variation within and lack of structure between populations of other desmognathine salamanders sampled over similar or larger spatial scales. Declines in genetic variation likely resulted from population extirpations and the degradation of stream and terrestrial paths for dispersal in NYC. Loss of genetic variability in populations isolated by human development may be an underappreciated cause and/or consequence of the decline of this species in urbanized areas of the northeast USA.

  14. Experimenting with Inexpensive Plastic Springs

    Science.gov (United States)

    Perez, Leander; Marques, Adriana; Sánchez, Iván

    2014-01-01

    Acommon undergraduate laboratory experience is the determination of the elastic constant of a spring, whether studying the elongation under a static load or studying the damped harmonic motion of the spring with a suspended mass. An alternative approach to this laboratory experience has been suggested by Menezes et al., aimed at studying the…

  15. Purification and characterization of cholecystokinin from the skin of salamander Tylototriton verrucosus.

    Science.gov (United States)

    Jiang, Wen-Bin; Hakim, Ma; Luo, Lei; Li, Bo-Wen; Yang, Shi-Long; Song, Yu-Zhu; Lai, Ren; Lu, Qiu-Min

    2015-05-18

    As a group of intestinal hormones and neurotransmitters, cholecystokinins (CCKs) regulate and affect pancreatic enzyme secretion, gastrointestinal motility, pain hypersensitivity, digestion and satiety, and generally contain a DYMGWMDFG sequence at the C-terminus. Many CCKs have been reported in mammals. However, only a few have been reported in amphibians, such as Hyla nigrovittata, Xenopus laevis, and Rana catesbeiana, with none reported in urodele amphibians like newts and salamanders. Here, a CCK called CCK-TV was identified and characterized from the skin of the salamander Tylototriton verrucosus. This CCK contained an amino acid sequence of DYMGWMDF-NH2 as seen in other CCKs. A cDNA encoding the CCK precursor containing 129 amino acid residues was cloned from the cDNA library of T. verrucosus skin. The CCK-TV had the potential to induce the contraction of smooth muscle strips isolated from porcine gallbladder, eliciting contraction at a concentration of 5.0 x 10⁻¹¹ mol/L and inducing maximal contraction at a concentration of 2.0 x 10⁻⁶ mol/L. The EC50 was 13.6 nmol/L. To the best of our knowledge, this is the first report to identify the presence of a CCK in an urodele amphibian.

  16. Transcriptome analysis of predator- and prey-induced phenotypic plasticity in the Hokkaido salamander (Hynobius retardatus).

    Science.gov (United States)

    Matsunami, Masatoshi; Kitano, Jun; Kishida, Osamu; Michimae, Hirofumi; Miura, Toru; Nishimura, Kinya

    2015-06-01

    Predator- and prey-induced phenotypic plasticity is widely observed among amphibian species. Although ecological factors inducing diverse phenotypic responses have been extensively characterized, we know little about the molecular bases of variation in phenotypic plasticity. Larvae of the Hokkaido salamander, Hynobius retardatus, exhibit two distinct morphs: the presence of their prey, Rana pirica tadpoles, induces a broad-headed attack morph, and the presence of predatory dragonfly nymphs (Aeshna nigroflava) induces a defence morph with enlarged external gills and a high tail. To compare the genes involved in predator- and prey-induced phenotypic plasticity, we carried out a de novo transcriptome analysis of Hokkaido salamander larvae exposed to either prey or predator individuals. First, we found that the number of genes involved in the expression of the defence morph was approximately five times the number involved in the expression of the attack morph. This result is consistent with the fact that the predator-induced plasticity involves more drastic morphological changes than the prey-induced plasticity. Second, we found that particular sets of genes were upregulated during the induction of both the attack and defence morphs, but others were specific to the expression of one or the other morph. Because both shared and unique molecular mechanisms were used in the expression of each morph, the evolution of a new plastic phenotype might involve both the co-option of pre-existing molecular mechanisms and the acquisition of novel regulatory mechanisms.

  17. Cutaneous mastocytomas in the neotenic caudate amphibians Ambystoma mexicanum (axolotl) and Ambystoma tigrinun (tiger salamander)

    Science.gov (United States)

    Harshbarger, J.C.; Chang, S.C.; DeLanney, L.E.; Rose, F.L.; Green, D.E.

    1999-01-01

    Spontaneous mastocytomas studied in 18 axolotls (Ambystoma mexicanum) and six tiger salamanders (Ambystoma tigrinum) were gray-white, uni- to multilobular cutaneous protrusions from 2mm to 2cm in diameter. Tumors were moderately cellular unencapsulated masses that usually infiltrated the dermis and hypodermis with the destruction of intervening tissues. Some tumors were invading superficial bundles of the underlying skeletal muscle. Tumors consisted of mitotically active cells derived from a single lineage but showing a range of differentiation. Immature cells had nearly smooth to lightly cleft or folded basophilic nuclei bordered by a band of cytoplasm with few cytoplasmic processes and containing a few small uniform eccentric granules. Mature cells had basophilic nuclei with deep clefts or folds and abundant eosinophilic cytoplasm with multiple long intertwining cytoplasmic extensions packed with metachromatic granules. The axolotls were old individuals from an inbred laboratory colony. The tiger salamanders were wild animals from a single polluted pond. They could have been old and inbred. Both groups were neotenic. These are the first mastocytomas discovered in cold-blooded animals.

  18. Cutaneous mastocytomas in the neotenic caudate amphibians Ambystoma mexicanum (axolotl) and Ambystoma tigrinum (tiger salamander).

    Science.gov (United States)

    Harshbarger, J C; Chang, S C; DeLanney, L E; Rose, F L; Green, D E

    1999-01-01

    Spontaneous mastocytomas studied in 18 axolotls (Ambystoma mexicanum) and six tiger salamanders (Ambystoma tigrinum) were gray-white, uni- to multilobular cutaneous protrusions from 2 mm to 2 cm in diameter. Tumors were moderately cellular unencapsulated masses that usually infiltrated the dermis and hypodermis with the destruction of intervening tissues. Some tumors were invading superficial bundles of the underlying skeletal muscle. Tumors consisted of mitotically active cells derived from a single lineage but showing a range of differentiation. Immature cells had nearly smooth to lightly cleft or folded basophilic nuclei bordered by a band of cytoplasm with few cytoplasmic processes and containing a few small uniform eccentric granules. Mature cells had basophilic nuclei with deep clefts or folds and abundant eosinophilic cytoplasm with multiple long intertwining cytoplasmic extensions packed with metachromatic granules. The axolotls were old individuals from an inbred laboratory colony. The tiger salamanders were wild animals from a single polluted pond. They could have been old and inbred. Both groups were neotenic. These are the first mastocytomas discovered in cold-blooded animals.

  19. Identification of Mutant Genes and Introgressed Tiger Salamander DNA in the Laboratory Axolotl, Ambystoma mexicanum.

    Science.gov (United States)

    Woodcock, M Ryan; Vaughn-Wolfe, Jennifer; Elias, Alexandra; Kump, D Kevin; Kendall, Katharina Denise; Timoshevskaya, Nataliya; Timoshevskiy, Vladimir; Perry, Dustin W; Smith, Jeramiah J; Spiewak, Jessica E; Parichy, David M; Voss, S Randal

    2017-12-01

    The molecular genetic toolkit of the Mexican axolotl, a classic model organism, has matured to the point where it is now possible to identify genes for mutant phenotypes. We used a positional cloning-candidate gene approach to identify molecular bases for two historic axolotl pigment phenotypes: white and albino. White (d/d) mutants have defects in pigment cell morphogenesis and differentiation, whereas albino (a/a) mutants lack melanin. We identified in white mutants a transcriptional defect in endothelin 3 (edn3), encoding a peptide factor that promotes pigment cell migration and differentiation in other vertebrates. Transgenic restoration of Edn3 expression rescued the homozygous white mutant phenotype. We mapped the albino locus to tyrosinase (tyr) and identified polymorphisms shared between the albino allele (tyr (a) ) and tyr alleles in a Minnesota population of tiger salamanders from which the albino trait was introgressed. tyr (a) has a 142 bp deletion and similar engineered alleles recapitulated the albino phenotype. Finally, we show that historical introgression of tyr (a) significantly altered genomic composition of the laboratory axolotl, yielding a distinct, hybrid strain of ambystomatid salamander. Our results demonstrate the feasibility of identifying genes for traits in the laboratory Mexican axolotl.

  20. Origin and control of the dominant time constant of salamander cone photoreceptors.

    Science.gov (United States)

    Zang, Jingjing; Matthews, Hugh R

    2012-08-01

    Recovery of the light response in vertebrate photoreceptors requires the shutoff of both active intermediates in the phototransduction cascade: the visual pigment and the transducin-phosphodiesterase complex. Whichever intermediate quenches more slowly will dominate photoresponse recovery. In suction pipette recordings from isolated salamander ultraviolet- and blue-sensitive cones, response recovery was delayed, and the dominant time constant slowed when internal [Ca(2+)] was prevented from changing after a bright flash by exposure to 0Ca(2+)/0Na(+) solution. Taken together with a similar prior observation in salamander red-sensitive cones, these observations indicate that the dominance of response recovery by a Ca(2+)-sensitive process is a general feature of amphibian cone phototransduction. Moreover, changes in the external pH also influenced the dominant time constant of red-sensitive cones even when changes in internal [Ca(2+)] were prevented. Because the cone photopigment is, uniquely, exposed to the external solution, this may represent a direct effect of protons on the equilibrium between its inactive Meta I and active Meta II forms, consistent with the notion that the process dominating recovery of the bright flash response represents quenching of the active Meta II form of the cone photopigment.

  1. Memory of conspecifics in male salamanders Plethodon cinereus: Implications for territorial defense

    Institute of Scientific and Technical Information of China (English)

    Nancy R.KOHN; Jennifer M.DEITLOFF; Schuyler F.DARTEZ; Michelle M.WILCOX; Robert G.JAEGER

    2013-01-01

    We investigated how exposure duration (time that two individuals initially interact) and separation interval (time between the initial interaction and a subsequent interaction) affect recognition memory of conspecifics in male red-backed salamanders Plethodon cinereus.Previous studies have demonstrated that this species aggressively defends territories.We recorded aggressive behavior to assess recognition memory,because aggression is more intense toward previously unencountered individuals compared to previously encountered individuals in this species.We found that with 15-min exposures and 5-day separation intervals,focal males did not spend significantly more time threatening ‘unfamiliar' intruders than ‘familiar' intruders.After either 8-hour exposures and 5-day separation intervals and 5-day exposures and 5-day separation intervals,focal males spent significantly more time threatening unfamiliar intruders than familiar intruders.These results suggest that male red-backed salamanders can remember familiar conspecifics (e.g.,territorial neighbors) after at least an 8-hour exposure duration and that memory persists at least as long as 5 days.After 5-day exposure and 15-day separation intervals,we found no significant difference in aggressive behavior toward familiar and unfamiliar intruders.Long separation intervals (15 days) may lead either to loss of memory of previously familiar individuals or,alternatively,aggressive reassessment of individuals as only a change in behavior indicates positively that memory has occurred.Thus,variance in territorial defense within an individual may depend on its ability to recognize conspecific males.

  2. Genetic Diversity of Black Salamanders (Aneides flavipunctatus across Watersheds in the Klamath Mountains

    Directory of Open Access Journals (Sweden)

    David B. Wake

    2013-08-01

    Full Text Available Here we characterize the genetic structure of Black Salamanders (Aneides flavipunctatus in the Klamath Mountains of northwestern California and southwestern Oregon using mitochondrial and nuclear DNA sequences. We hypothesized that the Sacramento, Smith, Klamath, and Rogue River watersheds would represent distinct genetic populations based on prior ecological results, which suggest that Black Salamanders avoid high elevations such as the ridges that separate watersheds. Our mitochondrial results revealed two major lineages, one in the Sacramento River watershed, and another containing the Klamath, Smith, and Rogue River watersheds. Clustering analyses of our thirteen nuclear loci show the Sacramento watershed population to be genetically distinctive. Populations in the Klamath, Smith, and Rogue watersheds are also distinctive but not as differentiated and their boundaries do not correspond to watersheds. Our historical demographic analyses suggest that the Sacramento population has been isolated from the Klamath populations since the mid-Pleistocene, with negligible subsequent gene flow (2 Nm ≤ 0.1. The Smith and Rogue River watershed populations show genetic signals of recent population expansion. These results suggest that the Sacramento River and Klamath River watersheds served as Pleistocene refugia, and that the Rogue and Smith River watersheds were colonized more recently by northward range expansion from the Klamath.

  3. Successful treatment of Batrachochytrium salamandrivorans infections in salamanders requires synergy between voriconazole, polymyxin E and temperature.

    Science.gov (United States)

    Blooi, M; Pasmans, F; Rouffaer, L; Haesebrouck, F; Vercammen, F; Martel, A

    2015-06-30

    Chytridiomycosis caused by the chytrid fungus Batrachochytrium salamandrivorans (Bsal) poses a serious threat to urodelan diversity worldwide. Antimycotic treatment of this disease using protocols developed for the related fungus Batrachochytrium dendrobatidis (Bd), results in therapeutic failure. Here, we reveal that this therapeutic failure is partly due to different minimum inhibitory concentrations (MICs) of antimycotics against Bsal and Bd. In vitro growth inhibition of Bsal occurs after exposure to voriconazole, polymyxin E, itraconazole and terbinafine but not to florfenicol. Synergistic effects between polymyxin E and voriconazole or itraconazole significantly decreased the combined MICs necessary to inhibit Bsal growth. Topical treatment of infected fire salamanders (Salamandra salamandra), with voriconazole or itraconazole alone (12.5 μg/ml and 0.6 μg/ml respectively) or in combination with polymyxin E (2000 IU/ml) at an ambient temperature of 15 °C during 10 days decreased fungal loads but did not clear Bsal infections. However, topical treatment of Bsal infected animals with a combination of polymyxin E (2000 IU/ml) and voriconazole (12.5 μg/ml) at an ambient temperature of 20 °C resulted in clearance of Bsal infections. This treatment protocol was validated in 12 fire salamanders infected with Bsal during a field outbreak and resulted in clearance of infection in all animals.

  4. Estimating occurrence and detection probabilities for stream-breeding salamanders in the Gulf Coastal Plain

    Science.gov (United States)

    Lamb, Jennifer Y.; Waddle, J. Hardin; Qualls, Carl P.

    2017-01-01

    Large gaps exist in our knowledge of the ecology of stream-breeding plethodontid salamanders in the Gulf Coastal Plain. Data describing where these salamanders are likely to occur along environmental gradients, as well as their likelihood of detection, are important for the prevention and management of amphibian declines. We used presence/absence data from leaf litter bag surveys and a hierarchical Bayesian multispecies single-season occupancy model to estimate the occurrence of five species of plethodontids across reaches in headwater streams in the Gulf Coastal Plain. Average detection probabilities were high (range = 0.432–0.942) and unaffected by sampling covariates specific to the use of litter bags (i.e., bag submergence, sampling season, in-stream cover). Estimates of occurrence probabilities differed substantially between species (range = 0.092–0.703) and were influenced by the size of the upstream drainage area and by the maximum proportion of the reach that dried. The effects of these two factors were not equivalent across species. Our results demonstrate that hierarchical multispecies models successfully estimate occurrence parameters for both rare and common stream-breeding plethodontids. The resulting models clarify how species are distributed within stream networks, and they provide baseline values that will be useful in evaluating the conservation statuses of plethodontid species within lotic systems in the Gulf Coastal Plain.

  5. Non-additive response of larval ringed salamanders to intraspecific density.

    Science.gov (United States)

    Ousterhout, Brittany H; Semlitsch, Raymond D

    2016-04-01

    Conditions experienced in early developmental stages can have long-term consequences for individual fitness. High intraspecific density during the natal period can affect juvenile and eventually adult growth rates, metabolism, immune function, survival, and fecundity. Despite the important ecological and evolutionary effects of early developmental density, the form of the relationship between natal density and resulting juvenile phenotype is poorly understood. To test competing hypotheses explaining responses to intraspecific density, we experimentally manipulated the initial larval density of ringed salamanders (Ambystoma annulatum), a pond-breeding amphibian, over 11 densities. We modeled the functional form of the relationship between natal density and juvenile traits, and compared the relative support for the various hypotheses based on their goodness of fit. These functional form models were then used to parameterize a simple simulation model of population growth. Our data support non-additive density dependence and presents an alternate hypothesis to additive density dependence, self-thinning and Allee effects in larval amphibians. We posit that ringed salamander larvae may be under selective pressure for tolerance to high density and increased efficiency in resource utilization. Additionally, we demonstrate that models of population dynamics are sensitive to assumptions of the functional form of density dependence.

  6. Evolution of paedomorphosis in plethodontid salamanders: ecological correlates and re-evolution of metamorphosis.

    Science.gov (United States)

    Bonett, Ronald M; Steffen, Michael A; Lambert, Shea M; Wiens, John J; Chippindale, Paul T

    2014-02-01

    Life-history modes can profoundly impact the biology of a species, and a classic example is the dichotomy between metamorphic (biphasic) and paedomorphic (permanently aquatic) life-history strategies in salamanders. However, despite centuries of research on this system, several basic questions about the evolution of paedomorphosis in salamanders have not been addressed. Here, we use a nearly comprehensive, time-calibrated phylogeny of spelerpine plethodontids to reconstruct the evolution of paedomorphosis and to test if paedomorphosis is (1) reversible; (2) associated with living in caves; (3) associated with relatively dry climatic conditions on the surface; and (4) correlated with limited range size and geographic dispersal. We find that paedomorphosis arose multiple times in spelerpines. We also find evidence for re-evolution of metamorphosis after several million years of paedomorphosis in a lineage of Eurycea from the Edwards Plateau region of Texas. We also show for the first time using phylogenetic comparative methods that paedomorphosis is highly correlated with cave-dwelling, arid surface environments, and small geographic range sizes, providing insights into both the causes and consequences of this major life history transition.

  7. Computer-assisted photo identification outperforms visible implant elastomers in an endangered salamander, Eurycea tonkawae.

    Directory of Open Access Journals (Sweden)

    Nathan F Bendik

    Full Text Available Despite recognition that nearly one-third of the 6300 amphibian species are threatened with extinction, our understanding of the general ecology and population status of many amphibians is relatively poor. A widely-used method for monitoring amphibians involves injecting captured individuals with unique combinations of colored visible implant elastomer (VIE. We compared VIE identification to a less-invasive method - computer-assisted photographic identification (photoID - in endangered Jollyville Plateau salamanders (Eurycea tonkawae, a species with a known range limited to eight stream drainages in central Texas. We based photoID on the unique pigmentation patterns on the dorsal head region of 1215 individual salamanders using identification software Wild-ID. We compared the performance of photoID methods to VIEs using both 'high-quality' and 'low-quality' images, which were taken using two different camera types and technologies. For high-quality images, the photoID method had a false rejection rate of 0.76% compared to 1.90% for VIEs. Using a comparable dataset of lower-quality images, the false rejection rate was much higher (15.9%. Photo matching scores were negatively correlated with time between captures, suggesting that evolving natural marks could increase misidentification rates in longer term capture-recapture studies. Our study demonstrates the utility of large-scale capture-recapture using photo identification methods for Eurycea and other species with stable natural marks that can be reliably photographed.

  8. Environmental correlates of species and genetic richness in lungless salamanders (family plethodontidae)

    Science.gov (United States)

    Marshall, Jeremy L.; Camp, Carlos D.

    2006-01-01

    Biological diversity is distributed across the planet in non-random, organised ways. At the species level, numerous environmental variables have been proposed to explain this non-random distribution with available energy and habitat heterogeneity receiving the most empirical support. With regard to genetic organisation, environmental stress and habitat heterogeneity have been widely supported. However, few studies have addressed if these two scales of biological organisation are structured via similar processes. Here, we tested whether or not the distributional organisation of genetic and species richness were driven by similar environmental variables for salamanders of the family Plethodontidae across North America. In general, we found that those environmental variables related to energy, particularly energy made accessible to salamanders via the actions of available moisture, were the primary determinants of both genetic and species richness. This finding is consistent with both the "more individuals hypothesis" of species richness and neutral-theory expectations for genetic richness. Additionally, greater habitat heterogeneity, as measured by increased topographic variance, was of secondary importance in positively influencing species richness, although its effects on genetic richness were far more variable. In total, our results suggest that both of these scales of biological organisation are influenced by similar environmental variables, even though increased genetic richness at the population-level does not always translate into greater species richness.

  9. Structured decision making as a conservation tool for recovery planning of two endangered salamanders

    Science.gov (United States)

    O'Donnell, Katherine; Messerman, Arianne F; Barichivich, William J.; Semlitsch, Raymond D.; Gorman, Thomas A.; Mitchell, Harold G; Allan, Nathan; Fenolio, Dante B.; Green, Adam; Johnson, Fred A.; Keever, Allison; Mandica, Mark; Martin, Julien; Mott, Jana; Peacock, Terry; Reinman, Joseph; Romanach, Stephanie; Titus, Greg; McGowan, Conor; Walls, Susan

    2017-01-01

    At least one-third of all amphibian species face the threat of extinction, and current amphibian extinction rates are four orders of magnitude greater than background rates. Preventing extirpation often requires both ex situ (i.e., conservation breeding programs) and in situ strategies (i.e., protecting natural habitats). Flatwoods salamanders (Ambystoma bishopi and A. cingulatum) are protected under the U.S. Endangered Species Act. The two species have decreased from 476 historical locations to 63 recently extant locations (86.8% loss). We suggest that recovery efforts are needed to increase populations and prevent extinction, but uncertainty regarding optimal actions in both ex situ and in situ realms hinders recovery planning. We used structured decision making (SDM) to address key uncertainties regarding both captive breeding and habitat restoration, and we developed short-, medium-, and long-term goals to achieve recovery objectives. By promoting a transparent, logical approach, SDM has proven vital to recovery plan development for flatwoods salamanders. The SDM approach has clear advantages over other previous approaches to recovery efforts, and we suggest that it should be considered for other complex decisions regarding endangered species.

  10. Coalescence patterns of endemic Tibetan species of stream salamanders (Hynobiidae: Batrachuperus).

    Science.gov (United States)

    Lu, Bin; Zheng, Yuchi; Murphy, Robert W; Zeng, Xiaomao

    2012-07-01

    Orogenesis of topographically diverse montane regions often drives complex evolutionary histories of species. The extensive biodiversity of the eastern edge of the Tibetan Plateau, which gradually decreases eastwardly, facilitates a comparison of historical patterns. We use coalescence methods to compare species of stream salamanders (Batrachuperus) that occur at high and low elevations. Coalescent simulations reveal that closely related species are likely to have been influenced by different drivers of diversification. Species living in the western high-elevation region with its northsouth extending mountains appear to have experienced colonization via dispersal followed by isolation and divergence. In contrast, species on the eastern low-elevation region, which has many discontinuous mountain ranges, appear to have experienced fragmentation, sometimes staged, of wide-ranging ancestral populations. The two groups of species appear to have been affected differently by glaciation. High-elevation species, which are more resistant to cooler temperatures, appear to have experienced population declines as recently as the last glaciation (0.016-0.032Ma). In contrast, salamanders dwelling in the warmer and wetter habitats at low-elevation environs appear to have been affected less by the relatively recent, milder glaciation, and more so by harsher, extensive glaciations (0.5-0.175 Ma). Thus, elevation, topography and cold tolerance appear to drive evolutionary patterns of diversification and demography even among closely related taxa. The comparison of multiple species in genealogical analyses can lead to an understanding of the evolutionary drivers.

  11. Retrotransposon long interspersed nucleotide element-1 (LINE-1) is activated during salamander limb regeneration.

    Science.gov (United States)

    Zhu, Wei; Kuo, Dwight; Nathanson, Jason; Satoh, Akira; Pao, Gerald M; Yeo, Gene W; Bryant, Susan V; Voss, S Randal; Gardiner, David M; Hunter, Tony

    2012-09-01

    Salamanders possess an extraordinary capacity for tissue and organ regeneration when compared to mammals. In our effort to characterize the unique transcriptional fingerprint emerging during the early phase of salamander limb regeneration, we identified transcriptional activation of some germline-specific genes within the Mexican axolotl (Ambystoma mexicanum) that is indicative of cellular reprogramming of differentiated cells into a germline-like state. In this work, we focus on one of these genes, the long interspersed nucleotide element-1 (LINE-1) retrotransposon, which is usually active in germ cells and silent in most of the somatic tissues in other organisms. LINE-1 was found to be dramatically upregulated during regeneration. In addition, higher genomic LINE-1 content was also detected in the limb regenerate when compared to that before amputation indicating that LINE-1 retrotransposition is indeed active during regeneration. Active LINE-1 retrotransposition has been suggested to have a potentially deleterious impact on genomic integrity. Silencing of activated LINE-1 by small RNAs has been reported to be part of the machinery aiming to maintain genomic integrity. Indeed, we were able to identify putative LINE-1-related piRNAs in the limb blastema. Transposable element-related piRNAs have been identified frequently in the germline in other organisms. Thus, we present here a scenario in which a unique germline-like state is established during axolotl limb regeneration, and the re-activation of LINE-1 may serve as a marker for cellular dedifferentiation in the early-stage of limb regeneration.

  12. Early gene expression during natural spinal cord regeneration in the salamander Ambystoma mexicanum.

    Science.gov (United States)

    Monaghan, James R; Walker, John A; Page, Robert B; Putta, Srikrishna; Beachy, Christopher K; Voss, S Randal

    2007-04-01

    In contrast to mammals, salamanders have a remarkable ability to regenerate their spinal cord and recover full movement and function after tail amputation. To identify genes that may be associated with this greater regenerative ability, we designed an oligonucleotide microarray and profiled early gene expression during natural spinal cord regeneration in Ambystoma mexicanum. We sampled tissue at five early time points after tail amputation and identified genes that registered significant changes in mRNA abundance during the first 7 days of regeneration. A list of 1036 statistically significant genes was identified. Additional statistical and fold change criteria were applied to identify a smaller list of 360 genes that were used to describe predominant expression patterns and gene functions. Our results show that a diverse injury response is activated in concert with extracellular matrix remodeling mechanisms during the early acute phase of natural spinal cord regeneration. We also report gene expression similarities and differences between our study and studies that have profiled gene expression after spinal cord injury in rat. Our study illustrates the utility of a salamander model for identifying genes and gene functions that may enhance regenerative ability in mammals.

  13. Lessons from the swamp: developing small molecules that confer salamander muscle cellularization in mammals.

    Science.gov (United States)

    Um, JungIn; Jung, Da-Woon; Williams, Darren Reece

    2017-12-01

    The ability of salamanders, such as newts, to regenerate damaged tissues has been studied for centuries. A prominent example of this regenerative power is the ability to re-grow entire amputated limbs. One important step in this regeneration process is skeletal muscle cellularization, in which the muscle fibers break down into dedifferentiated, mononuclear cells that proliferate and form new muscle in the replacement limb. In contrast, mammalian skeletal muscle does not undergo cellularization after injury. A significant proportion of research about tissue regeneration in salamanders aims to characterize regulatory genes that may have mammalian homologs. A less mainstream approach is to develop small molecule compounds that induce regeneration-related mechanisms in mammals. In this commentary, we discuss progress in discovering small molecules that induce cellularization in mammalian muscle. New research findings using these compounds has also shed light on cellular processes that regulate cellularization, such as apoptotic signaling. Although formidable technical hurdles remain, this progress increases our understanding of tissue regeneration and provide opportunities for developing small molecules that may enhance tissue repair in humans.

  14. Mallow Springs, County Cork, Ireland

    Science.gov (United States)

    Aldwell, C. R.

    1996-03-01

    Because of its copious and reliable rainfall, Ireland has an abundance of springs. Many of the larger ones issue from the Carboniferous limestone that occurs in over 40% of the country. The spring water is mainly a calcium bicarbonate type with a temperature of about 10°C. In the 18th century, warm and cold springs were developed as spas in various parts of Ireland. The popularity of these springs was short and most were in major decline by 1850. Today only one cold spa at Lisdoonvarna, Co. Clare is still operating. Springs in Ireland were places of religious significance for the pre-Christian Druidic religion. In the Christian period they became holy wells, under the patronage of various saints. Cures for many different ailments were attributed to water from these wells.

  15. Enlarged Multilocus Data set Provides Surprisingly Younger Time of Origin for the Plethodontidae, the Largest Family of Salamanders.

    Science.gov (United States)

    Shen, Xing-Xing; Liang, Dan; Chen, Meng-Yun; Mao, Rong-Li; Wake, David B; Zhang, Peng

    2016-01-01

    Deep phylogenetic relationships of the largest salamander family Plethodontidae have been difficult to resolve, probably reflecting a rapid diversification early in their evolutionary history. Here, data from 50 independent nuclear markers (total 48,582 bp) are used to reconstruct the phylogeny and divergence times for plethodontid salamanders, using both concatenation and coalescence-based species tree analyses. Our results robustly resolve the position of the enigmatic eastern North American four-toed salamander (Hemidactylium) as the sister taxon of Batrachoseps + Tribe Bolitoglossini, thus settling a long-standing question. Furthermore, we statistically reject sister taxon status of Karsenia and Hydromantes, the only plethodontids to occur outside the Americas, leading us to new biogeographic hypotheses. Contrary to previous long-standing arguments that plethodontid salamanders are an old lineage originating in the Cretaceous (more than 90 Ma), our analyses lead to the hypothesis that these salamanders are much younger, arising close to the K-T boundary (~66 Ma). These time estimates are highly stable using alternative calibration schemes and dating methods. Our data simulation highlights the potential risk of making strong arguments about phylogenetic timing based on inferences from a handful of nuclear genes, a common practice. Based on the newly obtained timetree and ancestral area reconstruction results, we argue that (i) the classic "Out of Appalachia" hypothesis of plethodontid origins is problematic; (ii) the common ancestor of extant plethodontids may have originated in northwestern North America in the early Paleocene; (iii) origins of Eurasian plethodontids likely result from two separate dispersal events from western North America via Beringia in the late Eocene (~42 Ma) and the early Miocene (~23 Ma), respectively.

  16. A bountiful spring harvest

    CERN Multimedia

    2013-01-01

    Although we recently put the clocks forward and spring has officially begun, the view from my window looks more autumnal – befitting of the season of mists and mellow fruitfulness, rather than that of sowing seeds for the future. Which, in a way is appropriate. With the LHC paused, we are reaping a kind of harvest in the form of recognition for our efforts.   Two weeks ago, I was in Edinburgh, on behalf of everyone at CERN, to collect the Edinburgh medal, which we shared with Peter Higgs. I particularly like the citation for this honour: “The Edinburgh Medal is awarded each year to men and women of science and technology whose professional achievements are judged to have made a significant contribution to the understanding and well-being of humanity.” I like this, because it underlines a fact that needs to be shouted louder – that fundamental science does more than build the sum of human knowledge, it is also the foundation of human well-being. A few d...

  17. Spring comes for ATLAS

    CERN Multimedia

    Butin, F.

    2004-01-01

    (First published in the CERN weekly bulletin 24/2004, 7 June 2004.) A short while ago the ATLAS cavern underwent a spring clean, marking the end of the installation of the detector's support structures and the cavern's general infrastructure. The list of infrastructure to be installed in the ATLAS cavern from September 2003 was long: a thousand tonnes of mechanical structures spread over 13 storeys, two lifts, two 65-tonne overhead travelling cranes 25 metres above cavern floor, with a telescopic boom and cradle to access the remaining 10 metres of the cavern, a ventilation system for the 55 000 cubic metre cavern, a drainage system, a standard sprinkler system and an innovative foam fire-extinguishing system, as well as the external cryogenic system for the superconducting magnets and the liquid argon calorimeters (comprising, amongst other things, two helium refrigeration units, a nitrogen refrigeration unit and 5 km of piping for gaseous or liquid helium and nitrogen), not to mention the handling eq...

  18. Terrestrial salamander captures in 100 m2 sub-plots two years after the 2003 Clark fire (Willamette National Forest, OR)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Data exist in a Microsoft Access 2003 database, and are the result of fixed-area, time-constrained searches for terrestrial salamanders within and nearby a...

  19. SPRING FESTIVAL ON THE LOESS PLATEAU

    Institute of Scientific and Technical Information of China (English)

    亦西; 杨延康

    2005-01-01

    How Spring Festival is celebrated Although the date of the Spring Festival was switched from the beginning of spring to the first day of the first lunar month, the main ways of celebrating it, from bygone days, remain popular.

  20. Can the eastern red-backed salamander (Plethodon cinereus) persist in an acidified landscape?

    Science.gov (United States)

    Bondi, Cheryl A; Beier, Colin M.; Ducey, Peter K; Lawrence, Gregory B.; Bailey, Scott W.

    2016-01-01

    Hardwood forests of eastern North America have experienced decades of acidic deposition, leading to soil acidification where base cation supply was insufficient to neutralize acid inputs. Negative impacts of soil acidity on amphibians include disrupted embryonic development, lower growth rates, and habitat loss. However, some amphibians exhibit intraspecific variation in acid tolerance, suggesting the potential for local adaptation in areas where soils are naturally acidic. The eastern red-backed salamander (Plethodon cinereus) is a highly abundant top predator of the northern hardwood forest floor. Early research found that P. cinereus was sensitive to acidic soils, avoiding substrates with pH < 3.8 and experiencing decreased growth rates in acidic habitats. However, recent studies have documented P. cinereus populations in lower pH conditions than previously observed, suggesting some populations may persist in acidic conditions. Here, we evaluated relationships between organic horizon soil pH and P. cinereus abundance, adult health (body size and condition), and microhabitat selection, based on surveys of 34 hardwood forests in northeastern United States that encompass a regional soil pH gradient. We found no associations between soil pH and P. cinereus abundance or health, and observed that this salamander used substrates with pH similar to that available, suggesting that pH does not mediate their fine-scale distributions. The strongest negative predictor of P. cinereus abundance was the presence of dusky salamanders (Desmognathus spp.), which were most abundant in the western Adirondacks. Our results indicate that P. cinereus occupies a wider range of soil pH than has been previously thought, which has implications for their functional role in forest food webs and nutrient cycles in acid-impaired ecosystems. Tolerance of P. cinereus for more acidic habitats, including anthropogenically acidified forests, may be due to local adaptation in

  1. Report on Fish Springs - 1958

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document discusses field survey results from several trips to Fish Springs National Wildlife Refuge during the summer of 1958. The following information is...

  2. The Importance of Maintaining Upland Forest Habitat Surrounding Salamander Breeding Ponds: Case Study of the Eastern Tiger Salamander in New York, USA

    Directory of Open Access Journals (Sweden)

    Valorie Titus

    2014-12-01

    Full Text Available Most amphibians use both wetland and upland habitats, but the extent of their movement in forested habitats is poorly known. We used radiotelemetry to observe the movements of adult and juvenile eastern tiger salamanders over a 4-year period. Females tended to move farther from the breeding ponds into upland forested habitat than males, while the distance a juvenile moved appeared to be related to body size, with the largest individuals moving as far as the adult females. Individuals chose refugia in native pitch pine—oak forested habitat and avoided open fields, roads, and developed areas. We also observed a difference in potential predation pressures in relation to the distance an individual moved from the edge of the pond. Our results support delineating forested wetland buffer zones on a case-by-case basis to reduce the impacts of concentrated predation, to increase and protect the availability of pitch pine—oak forests near the breeding pond, and to focus primarily on the habitat needs of the adult females and larger juveniles, which in turn will encompass habitat needs of adult males and smaller juveniles.

  3. Plethodontid salamander mitochondrial genomics: A parsimonyevaluation of character conflict and implications for historicalbiogeography

    Energy Technology Data Exchange (ETDEWEB)

    Macey, J. Robert

    2005-01-19

    A new parsimony analysis of 27 complete mitochondrial genomic sequences is conducted to investigate the phylogenetic relationships of plethodontid salamanders. This analysis focuses on the amount of character conflict between phylogenetic trees recovered from newly conducted parsimony searches and the Bayesian and maximum likelihood topology reported by Mueller et al. (2004, PNAS, 101, 13820-13825). Strong support for Hemidactylium as the sister taxon to all other plethodontids is recovered from parsimony analyses. Plotting area relationships on the most parsimonious phylogenetic tree suggests that eastern North America is the origin of the family Plethodontidae supporting the ''Out of Appalachia'' hypothesis. A new taxonomy that recognizes clades recovered from phylogenetic analyses is proposed.

  4. Treatment with corticosterone delays cutaneous wound healing in male and female salamanders.

    Science.gov (United States)

    Thomas, Jessica R; Woodley, Sarah K

    2015-05-15

    In vertebrates, exposure to stressors and stress hormones has a number of physiological effects including modulation of immune function. These effects on immune function have been well studied in mammals, but less is known in other groups, in particular amphibians. To analyze the effects of exposure to stressors and the stress hormone corticosterone, we monitored cutaneous wound healing as a measure of integrated immunity in male and female semi-terrestrial salamanders (Desmognathus ochrophaeus) that were chased to induce endogenous release of corticosterone or were treated with physiologically relevant doses of corticosterone. As predicted, subjects treated daily with corticosterone healed more slowly than did controls. In contrast, subjects that had been chased daily healed at the same rate as controls. Surprisingly, repeated chasing did not elevate plasma corticosterone despite causing drops in body mass and survival. Additionally, females healed more slowly than males, possibly due to energetic constraints.

  5. Development and Characterization of Fifteen Polymorphic Microsatellites for Extremely Endangered Salamander, Echinotriton chinhaiensis

    Institute of Scientific and Technical Information of China (English)

    Weizhao YANG; Jie WANG; Jianping JIANG; Cheng LI; Feng XIE

    2014-01-01

    Echinotriton chinhaiensis is a critically endangered salamander and its distribution is restricted to Ningbo, Zhejiang Province of China. In this study, we developed and characterized iffteen polymorphic microsatellite loci forE. chinhaiensis from dinucleotide- and tetranucleotide- enriched library. The number of alleles ranges from 4 to 12 with an average of 7.27 alleles per locus. The observed and expected heterozygosities values were from 0.250 to 0.844 and 0.511 to 0.872 with an average value of 0.596 and 0.722; respectively. The polymorphic microsatellite loci described in this paper are useful in the further study on genetic diversity and gene lfow, which would be helpful to formulate effective conservation strategies for theE. chinhaiensis.

  6. The skull structure of six species of Mesoamerican plethodontid salamanders (Amphibia, Urodela).

    Science.gov (United States)

    Ehmcke, Jens; Clemen, Günter

    2003-06-01

    The skulls of six species of plethodontid salamanders of the genus Bolitoglossa from Costa Rica and Panama, Bolitoglossa colonnea, B. dofleini, B. lignicolor, B. marmorea, B. schizodactyla and B. striatula are comparatively analysed. All species are terrestrial or slightly arboreal and show no life-mode-dependent skull characteristics. Heads cleared by transparent preparation and stained in toto were used for examination of the skull structure and paraffin sections of the gonads were prepared to confirm sexual maturity of each individual. Focussing on the size of the premaxillary pars dentalis, the degree of fusion of the processus dorsales praemaxillares and the presence or absence of the paired prefrontals we state that B. dofleini and B. striatula possess more ancestral characteristics, B. marmorea is situated in an intermediate position and B. colonnea, B. lignicolor and B. schizodactyla show more advanced characteristics.

  7. Spinal cord regeneration: where fish, frogs and salamanders lead the way, can we follow?

    Science.gov (United States)

    Diaz Quiroz, Juan Felipe; Echeverri, Karen

    2013-05-01

    Major trauma to the mammalian spinal cord often results in irreversible loss of function, i.e. paralysis, and current therapies ranging from drugs, implantations of stem cells and/or biomaterials, and electrically stimulated nerve regrowth, have so far offered very limited success in improving quality-of-life. However, in marked contrast with this basic shortcoming of ours, certain vertebrate species, including fish and salamanders, display the amazing ability to faithfully regenerate various complex body structures after injury or ablation, restoring full functionality, even in the case of the spinal cord. Despite the inherently strong and obvious translational potential for improving treatment strategies for human patients, our in-depth molecular-level understanding of these decidedly more advanced repair systems remains in its infancy. In the present review, we will discuss the current state of this field, focusing on recent progress in such molecular analyses using various regenerative species, and how these so far relate to the mammalian situation.

  8. Dopamine controls neurogenesis in the adult salamander midbrain in homeostasis and during regeneration of dopamine neurons.

    Science.gov (United States)

    Berg, Daniel A; Kirkham, Matthew; Wang, Heng; Frisén, Jonas; Simon, András

    2011-04-08

    Appropriate termination of regenerative processes is critical for producing the correct number of cells in tissues. Here we provide evidence for an end-product inhibition of dopamine neuron regeneration that is mediated by dopamine. Ablation of midbrain dopamine neurons leads to complete regeneration in salamanders. Regeneration involves extensive neurogenesis and requires activation of quiescent ependymoglia cells, which express dopamine receptors. Pharmacological compensation for dopamine loss by L-dopa inhibits ependymoglia proliferation and regeneration in a dopamine receptor-signaling-dependent manner, specifically after ablation of dopamine neurons. Systemic administration of the dopamine receptor antagonist haloperidol alone causes ependymoglia proliferation and the appearance of excessive number of neurons. Our data show that stem cell quiescence is under dopamine control and provide a model for termination once normal homeostasis is restored. The findings establish a role for dopamine in the reversible suppression of neurogenesis in the midbrain and have implications for regenerative strategies in Parkinson's disease.

  9. Rapid evolution of plethodontid modulating factor, a hypervariable salamander courtship pheromone, is driven by positive selection.

    Science.gov (United States)

    Palmer, Catherine A; Watts, Richard A; Hastings, Amy P; Houck, Lynne D; Arnold, Stevan J

    2010-05-01

    Sexual communication in plethodontid salamanders is mediated by a proteinaceous pheromone that a male delivers to a female during courtship, boosting her receptivity. The pheromone consists of three proteins from three unrelated protein families. These proteins are among a small group of pheromones known to affect female receptivity in vertebrates. Previously, we showed that the genes of two of these proteins (PRF and SPF) are prone to incessant evolution driven by positive selection, presumably as a consequence of coevolution with female receptors. In this report, we focus on the evolution of the third pheromone protein gene family, plethodontid modulating factor (PMF), to determine whether it shows the same pattern of diversification. We used RT-PCR in mental gland cDNA to survey PMF sequences from three genera of plethodontid salamanders (27 spp.) to measure rates of evolution, level of gene diversification, modes of selection, and types of amino acid substitution. Like PRF and SPF, PMF is produced by a multigene family characterized by gene duplication and high levels of polymorphism. PMF evolution is rapid, incessant, and driven by positive selection. PMF is more extreme in these dimensions than both PRF and SPF. Nestled within this extraordinary variation, however, is a signature of purifying selection, acting to preserve important structural and biochemical features of the PMF protein (i.e., secretion signal, cysteine residues, and pI). Although a pattern of persistent diversification exists at the molecular level, the morphological and behavioral aspects of the pheromone delivery system show evolutionary stasis over millions of years.

  10. Using multilevel spatial models to understand salamander site occupancy patterns after wildfire

    Science.gov (United States)

    Chelgren, N.D.; Adams, M.J.; Bailey, L.L.; Bury, R.B.

    2011-01-01

    Studies of the distribution of elusive forest wildlife have suffered from the confounding of true presence with the uncertainty of detection. Occupancy modeling, which incorporates probabilities of species detection conditional on presence, is an emerging approach for reducing observation bias. However, the current likelihood modeling framework is restrictive for handling unexplained sources of variation in the response that may occur when there are dependence structures such as smaller sampling units that are nested within larger sampling units. We used multilevel Bayesian occupancy modeling to handle dependence structures and to partition sources of variation in occupancy of sites by terrestrial salamanders (family Plethodontidae) within and surrounding an earlier wildfire in western Oregon, USA. Comparison of model fit favored a spatial N-mixture model that accounted for variation in salamander abundance over models that were based on binary detection/non-detection data. Though catch per unit effort was higher in burned areas than unburned, there was strong support that this pattern was due to a higher probability of capture for individuals in burned plots. Within the burn, the odds of capturing an individual given it was present were 2.06 times the odds outside the burn, reflecting reduced complexity of ground cover in the burn. There was weak support that true occupancy was lower within the burned area. While the odds of occupancy in the burn were 0.49 times the odds outside the burn among the five species, the magnitude of variation attributed to the burn was small in comparison to variation attributed to other landscape variables and to unexplained, spatially autocorrelated random variation. While ordinary occupancy models may separate the biological pattern of interest from variation in detection probability when all sources of variation are known, the addition of random effects structures for unexplained sources of variation in occupancy and detection

  11. Effects of modified chromophores on the spectral sensitivity of salamander, squirrel and macaque cones.

    Science.gov (United States)

    Makino, C L; Kraft, T W; Mathies, R A; Lugtenburg, J; Miley, M E; van der Steen, R; Baylor, D A

    1990-05-01

    1. Chemically modified retinal chromophores were used to investigate the mechanisms that produce the characteristic spectral absorptions of cone pigments. Spectral sensitivities of single cones from the salamander, squirrel and macaque retina were determined by electrical recording. The chromophore was then replaced by bleaching the pigment and regenerating it with a retinal analogue. 2. Exposing a bleached cone to 9-cis-retinal for a brief period (less than 20 min) caused its flash sensitivity to recover to about 0.2 of the pre-bleach value. Similar exposure to a locked 6-s-cis, 9-cis analogue gave a recovery to about 0.03 of the pre-bleach value. 3. Unlike the flash sensitivity, the saturating photocurrent amplitude often recovered completely after bleaching and regenerating the pigment. 4. When the 3-dehydroretinal chromophore in the salamander long-wavelength-sensitive (red) cone was replaced with 11-cis-retinal, shortening the conjugated chain in the chromophore, the spectral sensitivity underwent a blue shift of 67 nm. 5. Pigments containing the planar-locked 6-s-cis.9-cis-retinal analogue absorbed at substantially longer wavelength than those containing unmodified 9-cis-retinal. The opsin shift, a measure of the protein's ability to modify the chromophore's absorption was larger for the locked analogue than for 9-cis-retinal. This suggests that the native chromophore assumes a twisted 6-s-cis conformation in these pigments. 6. The spectral sensitivities of red and green macaque cones containing 9-cis-retinal or planar-locked 6-s-cis.9-cis-retinal retained the 30 nm separation characteristic of the native pigments. This suggests that the different absorptions of of the 6-7 carbon bond in the retinal chromophore.

  12. Morphological variation in salamanders and their potential response to climate change.

    Science.gov (United States)

    Ficetola, Gentile Francesco; Colleoni, Emiliano; Renaud, Julien; Scali, Stefano; Padoa-Schioppa, Emilio; Thuiller, Wilfried

    2016-06-01

    Despite the recognition that some species might quickly adapt to new conditions under climate change, demonstrating and predicting such a fundamental response is challenging. Morphological variations in response to climate may be caused by evolutionary changes or phenotypic plasticity, or both, but teasing apart these processes is difficult. Here, we built on the number of thoracic vertebrae (NTV) in ectothermic vertebrates, a known genetically based feature, to establish a link with body size and evaluate how climate change might affect the future morphological response of this group of species. First, we show that in old-world salamanders, NTV variation is strongly related to changes in body size. Secondly, using 22 salamander species as a case study, we found support for relationships between the spatial variation in selected bioclimatic variables and NTV for most of species. For 44% of species, precipitation and aridity were the predominant drivers of geographical variation of the NTV. Temperature features were dominant for 31% of species, while for 19% temperature and precipitation played a comparable role. This two-step analysis demonstrates that ectothermic vertebrates may evolve in response to climate change by modifying the number of thoracic vertebrae. These findings allow to develop scenarios for potential morphological evolution under future climate change and to identify areas and species in which the most marked evolutionary responses are expected. Resistance to climate change estimated from species distribution models was positively related to present-day species morphological response, suggesting that the ability of morphological evolution may play a role for species' persistence under climate change. The possibility that present-day capacity for local adaptation might help the resistance response to climate change can be integrated into analyses of the impact of global changes and should also be considered when planning management actions favouring

  13. Metabolism, gas exchange, and acid-base balance of giant salamanders.

    Science.gov (United States)

    Ultsch, Gordon R

    2012-08-01

    The giant salamanders are aquatic and paedomorphic urodeles including the genera Andrias and Cryptobranchus (Cryptobranchidae), Amphiuma (Amphiumidae), Siren (Sirenidae), and Necturus (Proteidae, of which only N. maculosus is considered 'a giant'). Species in the genera Cryptobranchus and Necturus are considered aquatic salamanders well adapted for breathing water, poorly adapted for breathing air, and with limited abilities to compensate acid-base disturbances. As such, they are water-breathing animals with a somewhat fish-like respiratory and acid-base physiology, whose habitat selection is limited to waters that do not typically become hypoxic or hypercarbic (although this assertion has been questioned for N. maculosus). Siren and Amphiuma species, by contrast, are dependent upon air-breathing, have excellent lungs, inefficient (Siren) or no (Amphiuma) gills, and are obligate air-breathers with an acid-base status more similar to that of terrestrial tetrapods. As such, they can be considered to be air-breathing animals that live in water. Their response to the aquatic hypercarbia that they often encounter is to maintain intracellular pH (pH(i) ) and abandon extracellular pH regulation, a process that has been referred to as preferential pH(i) regulation. The acid-base status of some present-day tropical air-breathing fishes, and of Siren and Amphiuma, suggests that the acid-base transition from a low PCO(2) -low [] system typical of water-breathing fishes to the high PCO(2) -high [] systems of terrestrial tetrapods may have been completed before emergence onto land, and likely occurred in habitats that were typically both hypoxic and hypercarbic.

  14. Defining evolutionary boundaries across parapatric ecomorphs of Black Salamanders (Aneides flavipunctatus) with conservation implications.

    Science.gov (United States)

    Reilly, Sean B; Marks, Sharyn B; Jennings, W Bryan

    2012-12-01

    The accurate delimitation of evolutionary population units represents an important component in phylogeographic and conservation genetic studies. Here, we used a combined population assignment and historical demographic approach to study a complex of ecomorphologically distinctive populations of Black Salamanders (Aneides flavipunctatus) that are parapatrically distributed and meet at a three-way contact zone in north-western California. We used mitochondrial tree-based and multilocus clustering methods to evaluate a priori two- (Northern and Southern) and three (Northern, Coast and Inland) population hypotheses derived from previous studies. Mitochondrial results were consistent with the two- and three-population hypotheses, while the nDNA clustering results supported only the two-population hypothesis. Historical demographic analyses and mtDNA gene divergence estimates revealed that the Northern and Southern populations split during the Pliocene (2-5 Ma). Subdivision of the Southern population into Coast and Inland populations was estimated to be late Pleistocene (0.24 Ma), although our mtDNA results suggested a Pliocene divergence. Effective gene flow estimates (2N(e)m) suggest that either the two- or three-population hypotheses remain valid. However, our results unexpectedly revealed that the Northern population might instead represent two parapatric populations that separated nearly 4 Ma. These results are surprising because the Pliocene divergence between these ecomorphologically conservative forms is similar or older than for the ecomorphologically divergent Coast and Inland sister populations. We conclude that Black Salamanders in north-western California belong to at least three or four populations or species, and these all meet criteria for being Evolutionary Significant Units or 'ESUs' and therefore warrant conservation consideration.

  15. Terrestrial distribution of pond-breeding salamanders around an isolated wetland.

    Science.gov (United States)

    Scott, David E; Komoroski, Mark J; Croshaw, Dean A; Dixon, Philip M

    2013-11-01

    Terrestrial habitats surrounding isolated wetlands are a critical resource for many pond-breeding amphibian species, yet few studies have examined the terrestrial distribution of post-metamorphic juveniles and adults. We used an encircling drift fence at a breeding pond in conjunction with partial fences at 90, 172, and 332 m from the wetland to estimate the terrestrial distribution of adult marbled salamanders (Ambystoma opacum; four breeding seasons) and mole salamanders (A. talpoideum; two seasons), as well as the dispersion of newly metamorphosed A. opacum (one summer). For newly metamorphosed A. opacum, 79% emigrated < 90 m from the wetland, and 8% moved beyond 172 m; movement distance was unrelated to body size. Distribution of adult A. opacum varied among years, with an average of 28% (range 23-31%) occurring beyond 172 m in all years. Averaged across two years, 51% of adult A. talpoideum occurred beyond 172 m. Lognormal models provided a good fit to both the juvenile and adult ambystomatid distributions, and parameters differed between age classes, sexes, species, and years within species. For adult A. opacum a buffer radius of 300 m or 340 m, depending on the year, is estimated to include 95% of adults; for A. talpoideum the estimate is 464 m or 501 m. A reanalysis of distribution data for seven ambystomatid species shows that a previous estimate of a 164-m radius to protect 95% of a population underestimates the needed buffer radius by 185 m. Because our study wetland requires a nearly 500 m wide radius to protect 95% of its ambystomatid adults, preservation of similar communities may require much more surrounding terrestrial habitat than previously thought.

  16. Habitat adaptation rather than genetic distance correlates with female preference in fire salamanders (Salamandra salamandra

    Directory of Open Access Journals (Sweden)

    Weitere Markus

    2009-06-01

    Full Text Available Abstract Background Although some mechanisms of habitat adaptation of conspecific populations have been recently elucidated, the evolution of female preference has rarely been addressed as a force driving habitat adaptation in natural settings. Habitat adaptation of fire salamanders (Salamandra salamandra, as found in Middle Europe (Germany, can be framed in an explicit phylogeographic framework that allows for the evolution of habitat adaptation between distinct populations to be traced. Typically, females of S. salamandra only deposit their larvae in small permanent streams. However, some populations of the western post-glacial recolonization lineage use small temporary ponds as larval habitats. Pond larvae display several habitat-specific adaptations that are absent in stream-adapted larvae. We conducted mate preference tests with females from three distinct German populations in order to determine the influence of habitat adaptation versus neutral genetic distance on female mate choice. Two populations that we tested belong to the western post-glacial recolonization group, but are adapted to either stream or pond habitats. The third population is adapted to streams but represents the eastern recolonization lineage. Results Despite large genetic distances with FST values around 0.5, the stream-adapted females preferred males from the same habitat type regardless of genetic distance. Conversely, pond-adapted females did not prefer males from their own population when compared to stream-adapted individuals of either lineage. Conclusion A comparative analysis of our data showed that habitat adaptation rather than neutral genetic distance correlates with female preference in these salamanders, and that habitat-dependent female preference of a specific pond-reproducing population may have been lost during adaptation to the novel environmental conditions of ponds.

  17. From biomedicine to natural history research: EST resources for ambystomatid salamanders

    Directory of Open Access Journals (Sweden)

    Bryant Susan V

    2004-08-01

    Full Text Available Abstract Background Establishing genomic resources for closely related species will provide comparative insights that are crucial for understanding diversity and variability at multiple levels of biological organization. We developed ESTs for Mexican axolotl (Ambystoma mexicanum and Eastern tiger salamander (A. tigrinum tigrinum, species with deep and diverse research histories. Results Approximately 40,000 quality cDNA sequences were isolated for these species from various tissues, including regenerating limb and tail. These sequences and an existing set of 16,030 cDNA sequences for A. mexicanum were processed to yield 35,413 and 20,599 high quality ESTs for A. mexicanum and A. t. tigrinum, respectively. Because the A. t. tigrinum ESTs were obtained primarily from a normalized library, an approximately equal number of contigs were obtained for each species, with 21,091 unique contigs identified overall. The 10,592 contigs that showed significant similarity to sequences from the human RefSeq database reflected a diverse array of molecular functions and biological processes, with many corresponding to genes expressed during spinal cord injury in rat and fin regeneration in zebrafish. To demonstrate the utility of these EST resources, we searched databases to identify probes for regeneration research, characterized intra- and interspecific nucleotide polymorphism, saturated a human – Ambystoma synteny group with marker loci, and extended PCR primer sets designed for A. mexicanum / A. t. tigrinum orthologues to a related tiger salamander species. Conclusions Our study highlights the value of developing resources in traditional model systems where the likelihood of information transfer to multiple, closely related taxa is high, thus simultaneously enabling both laboratory and natural history research.

  18. Evolution along the mutation gradient in the dynamic mitochondrial genome of salamanders.

    Science.gov (United States)

    Chong, Rebecca A; Mueller, Rachel Lockridge

    2013-01-01

    Mitochondria are intracellular organelles where oxidative phosphorylation is carried out to complete ATP synthesis. Mitochondria have their own genome; in metazoans, this is a small, circular molecule encoding 13 electron transport proteins, 22 tRNAs, and 2 rRNAs. In invertebrates, mitochondrial gene rearrangement is common, and it is correlated with increased substitution rates. In vertebrates, mitochondrial gene rearrangement is rare, and its relationship to substitution rate remains unexplored. Mitochondrial genes can also show spatial variation in substitution rates around the genome due to the mechanism of mtDNA replication, which produces a mutation gradient. To date, however, the strength of the mutation gradient and whether movement along the gradient in rearranged (or otherwise modified) genomes impacts genic substitution rates remain unexplored in the majority of vertebrates. Salamanders include both normal mitochondrial genomes and independently derived rearrangements and expansions, providing a rare opportunity to test the effects of large-scale changes to genome architecture on vertebrate mitochondrial gene sequence evolution. We show that: 1) rearranged/expanded genomes have higher substitution rates; 2) most genes in rearranged/expanded genomes maintain their position along the mutation gradient, substitution rates of the genes that do move are unaffected by their new position, and the gradient in salamanders is weak; and 3) genomic rearrangements/expansions occur independent of levels of selective constraint on genes. Together, our results demonstrate that large-scale changes to genome architecture impact mitochondrial gene evolution in predictable ways; however, despite these impacts, the same functional constraints act on mitochondrial protein-coding genes in both modified and normal genomes.

  19. Variation in salamander tail regeneration is associated with genetic factors that determine tail morphology.

    Directory of Open Access Journals (Sweden)

    Gareth J Voss

    Full Text Available Very little is known about the factors that cause variation in regenerative potential within and between species. Here, we used a genetic approach to identify heritable genetic factors that explain variation in tail regenerative outgrowth. A hybrid ambystomatid salamander (Ambystoma mexicanum x A. andersoni was crossed to an A. mexicanum and 217 offspring were induced to undergo metamorphosis and attain terrestrial adult morphology using thyroid hormone. Following metamorphosis, each salamander's tail tip was amputated and allowed to regenerate, and then amputated a second time and allowed to regenerate. Also, DNA was isolated from all individuals and genotypes were determined for 187 molecular markers distributed throughout the genome. The area of tissue that regenerated after the first and second amputations was highly positively correlated across males and females. Males presented wider tails and regenerated more tail tissue during both episodes of regeneration. Approximately 66-68% of the variation in regenerative outgrowth was explained by tail width, while tail length and genetic sex did not explain a significant amount of variation. A small effect QTL was identified as having a sex-independent effect on tail regeneration, but this QTL was only identified for the first episode of regeneration. Several molecular markers significantly affected regenerative outgrowth during both episodes of regeneration, but the effect sizes were small (<4% and correlated with tail width. The results show that ambysex and minor effect QTL explain variation in adult tail morphology and importantly, tail width. In turn, tail width at the amputation plane largely determines the rate of regenerative outgrowth. Because amputations in this study were made at approximately the same position of the tail, our results resolve an outstanding question in regenerative biology: regenerative outgrowth positively co-varies as a function of tail width at the amputation site.

  20. Variation in salamander tail regeneration is associated with genetic factors that determine tail morphology.

    Science.gov (United States)

    Voss, Gareth J; Kump, D Kevin; Walker, John A; Voss, S Randal

    2013-01-01

    Very little is known about the factors that cause variation in regenerative potential within and between species. Here, we used a genetic approach to identify heritable genetic factors that explain variation in tail regenerative outgrowth. A hybrid ambystomatid salamander (Ambystoma mexicanum x A. andersoni) was crossed to an A. mexicanum and 217 offspring were induced to undergo metamorphosis and attain terrestrial adult morphology using thyroid hormone. Following metamorphosis, each salamander's tail tip was amputated and allowed to regenerate, and then amputated a second time and allowed to regenerate. Also, DNA was isolated from all individuals and genotypes were determined for 187 molecular markers distributed throughout the genome. The area of tissue that regenerated after the first and second amputations was highly positively correlated across males and females. Males presented wider tails and regenerated more tail tissue during both episodes of regeneration. Approximately 66-68% of the variation in regenerative outgrowth was explained by tail width, while tail length and genetic sex did not explain a significant amount of variation. A small effect QTL was identified as having a sex-independent effect on tail regeneration, but this QTL was only identified for the first episode of regeneration. Several molecular markers significantly affected regenerative outgrowth during both episodes of regeneration, but the effect sizes were small (<4%) and correlated with tail width. The results show that ambysex and minor effect QTL explain variation in adult tail morphology and importantly, tail width. In turn, tail width at the amputation plane largely determines the rate of regenerative outgrowth. Because amputations in this study were made at approximately the same position of the tail, our results resolve an outstanding question in regenerative biology: regenerative outgrowth positively co-varies as a function of tail width at the amputation site.

  1. Posterior tail development in the salamander Eurycea cirrigera: exploring cellular dynamics across life stages.

    Science.gov (United States)

    Vaglia, Janet L; Fornari, Chet; Evans, Paula K

    2017-03-01

    During embryogenesis, the body axis elongates and specializes. In vertebrate groups such as salamanders and lizards, elongation of the posterior body axis (tail) continues throughout life. This phenomenon of post-embryonic tail elongation via addition of vertebrae has remained largely unexplored, and little is known about the underlying developmental mechanisms that promote vertebral addition. Our research investigated tail elongation across life stages in a non-model salamander species, Eurycea cirrigera (Plethodontidae). Post-embryonic addition of segments suggests that the tail tip retains some aspects of embryonic cell/tissue organization and gene expression throughout the life cycle. We describe cell and tissue differentiation and segmentation of the posterior tail using serial histology and expression of the axial tissue markers, MF-20 and Pax6. Embryonic expression patterns of HoxA13 and C13 are shown with in situ hybridization. Tissue sections reveal that the posterior spinal cord forms via cavitation and precedes development of the underlying cartilaginous rod after embryogenesis. Post-embryonic tail elongation occurs in the absence of somites and mesenchymal cells lateral to the midline express MF-20. Pax6 expression was observed only in the spinal cord and some mesenchymal cells of adult Eurycea tails. Distinct temporal and spatial patterns of posterior Hox13 gene expression were observed throughout embryogenesis. Overall, important insights to cell organization, differentiation, and posterior Hox gene expression may be gained from this work. We suggest that further work on gene expression in the elongating adult tail could shed light on mechanisms that link continual axial elongation with regeneration.

  2. Morphological variation in salamanders and their potential response to climate change

    Science.gov (United States)

    Ficetola, Gentile Francesco; Colleoni, Emiliano; Renaud, Julien; Scali, Stefano; Padoa-Schioppa, Emilio; Thuiller, Wilfried

    2016-01-01

    Despite the recognition that some species might quickly adapt to new conditions under climate change, demonstrating and predicting such a fundamental response is challenging. Morphological variations in response to climate may be caused by evolutionary changes or phenotypic plasticity, or both, but teasing apart these processes is difficult. Here we built on the number of thoracic vertebrae (NTV) in ectothermic vertebrates, a known genetically-based feature, to establish a link with body size and evaluate how climate change might affect the future morphological response of this group of species. First we show that in old-world salamanders, NTV variation is strongly related to changes in body size. Secondly, using 22 salamander species as a case study, we found support for relationships between the spatial variation in selected bioclimatic variables and NTV for most of species. For 44% of species, precipitation and aridity were the predominant drivers of geographical variation of the NTV. Temperature features were dominant for 31% of species, while for 19% temperature and precipitation played a comparable role. This two-step analysis demonstrates that ectothermic vertebrates may evolve in response to climate change by modifying the number of thoracic vertebrae. These findings allow to develop scenarios for potential morphological evolution under future climate change, and to identify areas and species in which the most marked evolutionary responses are expected. Resistance to climate change estimated from species distribution models was positively related to present-day species morphological response, suggesting that the ability of morphological evolution may play a role for species’ persistence under climate change. The possibility that present-day capacity for local adaptation might help the resistance response to climate change can be integrated into analyses of the impact of global changes, and should also be considered when planning management actions

  3. 75 FR 39241 - Hooper Springs Project

    Science.gov (United States)

    2010-07-08

    ... Bonneville Power Administration Hooper Springs Project AGENCY: Bonneville Power Administration (BPA... Hooper Springs Project). The new BPA substation would be called Hooper Springs Substation and would be... Soda Springs in Caribou County, Idaho. The new 115-kV single-circuit BPA transmission line would...

  4. Sexual Dimorphism of the Jilin Clawed Salamander, Onychodactylus zhangyapingi, (Urodela:Hynobiidae:Onychodactylinae) from Jilin Province, China

    Institute of Scientific and Technical Information of China (English)

    Jianli XIONG; Xiuying LIU; Xiaomei ZHANG; Mengyun LI; Yao MIN

    2016-01-01

    Sexual dimorphism in size and shape is common in many organisms, and is a key evolutionary feature. In this study, we analyzed morphometric data of the Jilin clawed salamanderOnychodactylus zhangyapingi, an endemic Chinese salamander, to examine sexual size and shape dimorphism. The morphometric data included 14 characteristics of 13 females and 11 males and was analyzed using univariate and multivariate methods. Our results showed that sexual dimorphism occurs not only in body size, but also in body shape. Males have a longer snout-vent length than females, a rarely reported pattern of male-biased sexual size dimorphism. Females have a larger space between the axilla and groin than males, while males have longer and larger tails compared to females. The sexual dimorphism in body size and shape can be explained by existing theories, but there is little data for the mating system, behavior, reproduction, or ecology ofO. zhangyapingi, so further studies are required.

  5. Process of Luggage Leather by Giant Salamander Skin%大鲵皮箱包革工艺技术

    Institute of Scientific and Technical Information of China (English)

    徐达宇; 雷明智; 周赟; 彭海蓉

    2012-01-01

    The manufacturing technology of luggage leather with giant salamander skin was introduced. The finished leather is soft and flexible with natural grains and primitive styles. It shows that after manufacture, the giant salamander skin could be made into high value added luggage leather.%利用大鲵皮试制出的箱包革等样品,既保存了大鲵皮的天然粒面和原始风格,又具有一定的柔软度和丰满性。试验表明大鲵皮经过科学加工,能够制造出具有较高经济价值的高档箱包皮革。

  6. Clinical Study on Treating Barton Fracture by Manipulative Reduction and Fixation with Electronic Intelligent Splint%桡骨远端骨折手法复位电子智能夹板固定的临床研究

    Institute of Scientific and Technical Information of China (English)

    赵道洲; 邓强; 王胡伟

    2014-01-01

    Objective:To explore the conditions of preventing the complications, the healing of bone fracture and the recovery of wrist joints function by comparing the effects of manipulative reduction combined with electron-ic intelligent splint and traditional splint for Barton fracture. Methods:Sixty patients were randomized into electronic intelligent splint group and traditional splint group, 30 cases each group. The patients were treated by manipulative reduction, fixed by electronic intelligent splint or traditional splint, they were observed and followed up for six months. Therapeutic effects of both groups were compared and assessed by taking Gartland and Werlley wrist joint scaling as the standard, imagine evaluation was performed from ulnar inclination, volar inclination and radial height before treating, in six weeks after treating, the swelling and pain judged in two weeks after the surgery. Results:All the patients were followed up for six months, according to the standard of Gartland and Werlley wrist joint scaling, swelling scales (in one day, three days, seven days and 14 days after the reduction) and pain scales (in three days, seven days and 14 days after the reduction), clinical effects of electronic intelligent splint group were superior to these of traditional splint group significantly (P0.05). Conclusion:Electronic intelligent splint in treating Barton fracture could effectively relieve swelling, pain and prevent the ischemia of extremities, and promote the recovery of wrist joint function maximally.%目的:观察桡骨远端骨折经正骨手法复位电子智能夹板和传统夹板固定后,并发症的预防、骨折愈合、腕关节功能恢复情况。方法:将符合诊断标准、纳入标准及排除标准的桡骨远端骨折患者60例,按照就诊时间的先后顺序随机分为电子智能夹板组、传统夹板组各30例。经正骨手法复位电子智能夹板固定和传统夹板固定治疗后观察和随访6个月

  7. Interactive effects of temperature and glyphosate on the behavior of blue ridge two-lined salamanders (Eurycea wilderae).

    Science.gov (United States)

    Gandhi, Jaina S; Cecala, Kristen K

    2016-09-01

    The objective of the present study was to evaluate the potential interactive effects of stream temperatures and environmentally relevant glyphosate-based herbicide concentrations on movement and antipredator behaviors of larval Eurycea wilderae (Blue Ridge two-lined salamander). Larval salamanders were exposed to 1 of 4 environmentally relevant glyphosate concentrations (0.00 µg acid equivalent [a.e.]/L, 0.73 µg a.e./L, 1.46 µg a.e./L, and 2.92 µg a.e./L) at either ambient (12 °C) or elevated (23 °C) water temperature. Behaviors observed included the exploration of a novel habitat, use of refuge, habitat selection relative to a potential predator, and burst movement distance. In the absence of glyphosate, temperature consistently affected movement and refuge-use behavior, with individuals moving longer distances more frequently and using refuge less at warm temperatures; however, when glyphosate was added, the authors observed inconsistent effects of temperature that may have resulted from differential toxicity at various temperatures. Larval salamanders made shorter, more frequent movements and demonstrated reduced burst distance at higher glyphosate concentrations. The authors also found that lower glyphosate concentrations sometimes had stronger effects than higher concentrations (i.e., nonmonotonic dose responses), suggesting that standard safety tests conducted only at higher glyphosate concentrations might overlook important sublethal effects on salamander behavior. These data demonstrate that sublethal effects of glyphosate-based herbicides on natural behaviors of amphibians can occur with short-term exposure to environmentally relevant concentrations. Environ Toxicol Chem 2016;35:2297-2303. © 2016 SETAC.

  8. Disease prevention and treatment of the giant salamander Andrias davidanus%大鲵的疾病防治

    Institute of Scientific and Technical Information of China (English)

    邓捷; 王中乾; 张红星; 姜维; 王启军; 赵虎

    2014-01-01

    中国大鲵是国家二级保护动物,具有很高的药用价值和特殊的进化地位,人工繁育和养殖大鲵具有科学研究和经济学双重意义。但多种高传染、高致死性疾病成为大鲵养殖业发展的瓶颈,这些疾病的病原体包括细菌、真菌、寄生虫和病毒等。本文就目前大鲵多种病害的发病原因、临床特征及相应的治疗方法进行简单综述,为中国大鲵疾病的深入研究提供必备的科学依据。%Chinese giant salamander is one of the State Second-class Protection species ,with high me‐dicinal value and evolutionary significance .Artificial breeding giant salamander has double meaning in both science research and economics .However ,a variety of highly infectious ,lethal diseases have be‐come the bottleneck in breeding industry development of giant salamander .Pathogens of these diseases are included bacteria ,fungi ,parasites and viruses .T his article briefly review s the current various dis‐eases etiology ,clinical features and appropriate treatments ,in order to provide the necessary scientific basis for in-depth study of Chinese giant salamander disease .

  9. Effectiveness of releasing artificially-bred Chinese giant salamander (Andrias davidianus) into the wild in Zhangjiajie, Hunan

    OpenAIRE

    Qinghua Luo; Ying Liu; Liyun Zhang

    2009-01-01

    Chinese giant salamander (Andrias davidianus) is a native amphibian to China. It was listed as a Class II protected wildlife species under the state conservation law largely due to its sharply declined population size in the past two decades. Habitat destruction, habitat degradation and human over-exploitation have been considered as the primary causes of the declination. Designed to boost the wild population, a captive breeding program has been successfully established and artificially bred ...

  10. Sustained ERK Activation Underlies Reprogramming in Regeneration-Competent Salamander Cells and Distinguishes Them from Their Mammalian Counterparts

    OpenAIRE

    Maximina H. Yun; Phillip B. Gates; Jeremy P. Brockes

    2014-01-01

    Summary In regeneration-competent vertebrates, such as salamanders, regeneration depends on the ability of various differentiated adult cell types to undergo natural reprogramming. This ability is rarely observed in regeneration-incompetent species such as mammals, providing an explanation for their poor regenerative potential. To date, little is known about the molecular mechanisms mediating natural reprogramming during regeneration. Here, we have identified the extent of extracellular signa...

  11. Microarray analysis identifies keratin loci as sensitive biomarkers for thyroid hormone disruption in the salamander Ambystoma mexicanum.

    Science.gov (United States)

    Page, Robert B; Monaghan, James R; Samuels, Amy K; Smith, Jeramiah J; Beachy, Christopher K; Voss, S Randal

    2007-02-01

    Ambystomatid salamanders offer several advantages for endocrine disruption research, including genomic and bioinformatics resources, an accessible laboratory model (Ambystoma mexicanum), and natural lineages that are broadly distributed among North American habitats. We used microarray analysis to measure the relative abundance of transcripts isolated from A. mexicanum epidermis (skin) after exogenous application of thyroid hormone (TH). Only one gene had a >2-fold change in transcript abundance after 2 days of TH treatment. However, hundreds of genes showed significantly different transcript levels at days 12 and 28 in comparison to day 0. A list of 123 TH-responsive genes was identified using statistical, BLAST, and fold level criteria. Cluster analysis identified two groups of genes with similar transcription patterns: up-regulated versus down-regulated. Most notably, several keratins exhibited dramatic (1000 fold) increases or decreases in transcript abundance. Keratin gene expression changes coincided with morphological remodeling of epithelial tissues. This suggests that keratin loci can be developed as sensitive biomarkers to assay temporal disruptions of larval-to-adult gene expression programs. Our study has identified the first collection of loci that are regulated during TH-induced metamorphosis in a salamander, thus setting the stage for future investigations of TH disruption in the Mexican axolotl and other salamanders of the genus Ambystoma.

  12. Sensory feedback plays a significant role in generating walking gait and in gait transition in salamanders: A simulation study

    Directory of Open Access Journals (Sweden)

    Nalin eHarischandra

    2011-11-01

    Full Text Available Here, we use a three-dimensional, neuro-musculo-mechanical model of a salamander with realistic physical parameters in order to investigate the role of sensory feedback in gait generation and transition. Activation of limb and axial muscles were driven by neural output patterns obtained from a central pattern generator (CPG which is composed of simulated spiking neurons with adaptation. The CPG consists of a body CPG and four limb CPGs that are interconnected via synapses both ipsilateraly and contralaterally. We use the model both with and without sensory modulation and for different combinations of ipsilateral and contralateral coupling between the limb CPGs. We found that the proprioceptive sensory inputs are essential in obtaining a coordinated walking gait. The sensory feedback includes the signals coming from the stretch receptor like intraspinal neurons located in the girdle regions and the limb stretch receptors residing in the hip and scapula regions of the salamander. On the other hand, coordinated motor output patterns for the trotting gait were obtainable without the sensory inputs. We found that the gait transition from walking to trotting can be induced by increased activity of the descending drive coming from the mesencephalic locomotor region (MLR and is helped by the sensory inputs at the hip and scapula regions detecting the late stance phase. More neurophysiological experiments are required to identify the precise type of mechanoreceptors in the salamander and the neural mechanisms mediating the sensory modulation.

  13. Sustained ERK Activation Underlies Reprogramming in Regeneration-Competent Salamander Cells and Distinguishes Them from Their Mammalian Counterparts

    Directory of Open Access Journals (Sweden)

    Maximina H. Yun

    2014-07-01

    Full Text Available In regeneration-competent vertebrates, such as salamanders, regeneration depends on the ability of various differentiated adult cell types to undergo natural reprogramming. This ability is rarely observed in regeneration-incompetent species such as mammals, providing an explanation for their poor regenerative potential. To date, little is known about the molecular mechanisms mediating natural reprogramming during regeneration. Here, we have identified the extent of extracellular signal-regulated kinase (ERK activation as a key component of such mechanisms. We show that sustained ERK activation following serum induction is required for re-entry into the cell cycle of postmitotic salamander muscle cells, partially by promoting the downregulation of p53 activity. Moreover, ERK activation induces epigenetic modifications and downregulation of muscle-specific genes such as Sox6. Remarkably, while long-term ERK activation is found in salamander myotubes, only transient activation is seen in their mammalian counterparts, suggesting that the extent of ERK activation could underlie differences in regenerative competence between species.

  14. Sustained ERK activation underlies reprogramming in regeneration-competent salamander cells and distinguishes them from their mammalian counterparts.

    Science.gov (United States)

    Yun, Maximina H; Gates, Phillip B; Brockes, Jeremy P

    2014-07-08

    In regeneration-competent vertebrates, such as salamanders, regeneration depends on the ability of various differentiated adult cell types to undergo natural reprogramming. This ability is rarely observed in regeneration-incompetent species such as mammals, providing an explanation for their poor regenerative potential. To date, little is known about the molecular mechanisms mediating natural reprogramming during regeneration. Here, we have identified the extent of extracellular signal-regulated kinase (ERK) activation as a key component of such mechanisms. We show that sustained ERK activation following serum induction is required for re-entry into the cell cycle of postmitotic salamander muscle cells, partially by promoting the downregulation of p53 activity. Moreover, ERK activation induces epigenetic modifications and downregulation of muscle-specific genes such as Sox6. Remarkably, while long-term ERK activation is found in salamander myotubes, only transient activation is seen in their mammalian counterparts, suggesting that the extent of ERK activation could underlie differences in regenerative competence between species.

  15. Motor gasoline assessment, Spring 1997

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-07-01

    The springs of 1996 and 1997 provide an excellent example of contrasting gasoline market dynamics. In spring 1996, tightening crude oil markets pushed up gasoline prices sharply, adding to the normal seasonal gasoline price increases; however, in spring 1997, crude oil markets loosened and crude oil prices fell, bringing gasoline prices down. This pattern was followed throughout the country except in California. As a result of its unique reformulated gasoline, California prices began to vary significantly from the rest of the country in 1996 and continued to exhibit distinct variations in 1997. In addition to the price contrasts between 1996 and 1997, changes occurred in the way in which gasoline markets were supplied. Low stocks, high refinery utilizations, and high imports persisted through 1996 into summer 1997, but these factors seem to have had little impact on gasoline price spreads relative to average spread.

  16. Spring harvest of corn stover

    Energy Technology Data Exchange (ETDEWEB)

    Lizotte, P.L. [Laval Univ., Quebec City, PQ (Canada). Dept. des sols et de genie agroalimentaire; Savoie, P. [Agriculture and Agri-Food Canada, Quebec City, PQ (Canada)

    2010-07-01

    Corn stover is typically left behind in the field after grain harvest. Although part of the stover should remain in the field for soil organic matter renewal and erosion protection, half of the stover could be removed sustainably. This represents about one million t dry matter (DM) of stover per year in the province of Quebec. Stover harvested in the fall is very wet. While there are applications for wet stover, the available markets currently require a dry product. Preliminary measurements have shown that stover left in the field throughout the winter becomes very dry, and a considerable amount would still be harvestable in the spring. In the spring of 2009, corn stover was harvested at 2 sites, each subdivided into 2 parcels. The first parcel was cut and raked in the fall of 2008 (fall parcel), while the second parcel was cut and raked in spring 2009. Fibre from both parcels was baled in the spring 2009. At the first site, a large square baler was used in late April to produce bales measuring 0.8 m x 0.9 m x 1.8 m. On the second site a round baler was used in late May to produce bales of 1.2 m in width by 1.45 m in diameter. On the second site, a small square baler was also used to produce bales of 0.35 m x 0.45 m x 0.60 m (spring cutting only). With the large square baler, an average of 3.9 t DM/ha was harvested equally on the fall parcel and the spring parcel, representing a 48 per cent recovery of biomass based on stover yields.

  17. Instant Spring for Android starter

    CERN Document Server

    Dahanne, Anthony

    2013-01-01

    Packt Instant Starter: get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks.This is a Starter which gives you an introduction to Spring for Android with plenty of well-explained practical code examples.If you are an Android developer who wants to learn about RESTful web services and OAuth authentication and authorization, and you also want to know how to speed up your development involving those architectures using Spring for Android abstractions, then this book is for you.But core Java developers

  18. Yarn Expo Spring Concluded the Spring Fair in Beijing Successfully

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ As the 2009 Yarn Expo Spring, organized by Messe Frankfurt (HK) Ltd, the Sub-Council of Textile Industry - CCPIT, China Cotton Textile Association, China Wool Textile Association, China Chemical Fibers Association, China Bast & Leaf Fiber Textiles Association, and China Textile Information Centre, came to an end on 1 April, the organizers had something to smile about.

  19. A new hynobiid-like salamander (Amphibia, Urodela from Inner Mongolia, China, provides a rare case study of developmental features in an Early Cretaceous fossil urodele

    Directory of Open Access Journals (Sweden)

    Jia Jia

    2016-10-01

    Full Text Available A new fossil salamander, Nuominerpeton aquilonaris (gen. et sp. nov., is named and described based on specimens from the Lower Cretaceous Guanghua Formation of Inner Mongolia, China. The new discovery documents a far northern occurrence of Early Cretaceous salamanders in China, extending the geographic distribution for the Mesozoic fossil record of the group from the Jehol area (40th–45th parallel north to near the 49th parallel north. The new salamander is characterized by having the orbitosphenoid semicircular in shape; coracoid plate of the scapulocoracoid greatly expanded with a convex ventral and posterior border; ossification of two centralia in carpus and tarsus; and first digit being about half the length of the second digit in both manus and pes. The new salamander appears to be closely related to hynobiids, although this inferred relationship awaits confirmation by research in progress by us on a morphological and molecular combined analysis of cryptobranchoid relationships. Comparison of adult with larval and postmetamorphic juvenile specimens provides insights into developmental patterns of cranial and postcranial skeletons in this fossil species, especially resorption of the palatine and anterior portions of the palatopterygoid in the palate and the coronoid in the mandible during metamorphosis, and postmetamorphic ossification of the mesopodium in both manus and pes. Thus, this study provides a rare case study of developmental features in a Mesozoic salamander.

  20. Finding Spring on Planet X

    Science.gov (United States)

    Simoson, Andrew J.

    2007-01-01

    For a given orbital period and eccentricity, we determine the maximum time lapse between the winter solstice and the spring equinox on a planet. In addition, given an axial precession path, we determine the effects on the seasons. This material can be used at various levels to illustrate ideas such as periodicity, eccentricity, polar coordinates,…

  1. NOVA Spring 2000 Teacher's Guide.

    Science.gov (United States)

    Colombo, Luann; Gregoire, Tanya; Ransick, Kristina; Sammons, Fran Lyons; Sammons, James

    This teacher's guide complements six programs that aired on the Public Broadcasting System (PBS) in the spring of 2000. Programs include: (1) "Lost on Everest"; (2) "Lost Tribes of Israel"; (3) "Crocodiles"; (4) "Lost at Sea: The Search for Longitude"; (5) "Global Warming"; and (6) "Secrets of…

  2. Spring for It: First Novels

    Science.gov (United States)

    Hoffert, Barbara

    2010-01-01

    How do publishers describe the first novels they will be releasing this spring and summer? "Amazing," "fabulous," and "unique" are words that pop up frequently, though hats off to one publicist forthright or cheeky enough to call a work "weird Western/horror." The proof of such praise is in the reading, but why not check out this preview of first…

  3. Deep divergences and extensive phylogeographic structure in a clade of lowland tropical salamanders

    Directory of Open Access Journals (Sweden)

    Rovito Sean M

    2012-12-01

    Full Text Available Abstract Background The complex geological history of Mesoamerica provides the opportunity to study the impact of multiple biogeographic barriers on population differentiation. We examine phylogeographic patterns in a clade of lowland salamanders (Bolitoglossa subgenus Nanotriton using two mitochondrial genes and one nuclear gene. We use several phylogeographic analyses to infer the history of this clade and test hypotheses regarding the geographic origin of species and location of genetic breaks within species. We compare our results to those for other taxa to determine if historical events impacted different species in a similar manner. Results Deep genetic divergence between species indicates that they are relatively old, and two of the three widespread species show strong phylogeographic structure. Comparison of mtDNA and nuclear gene trees shows no evidence of hybridization or introgression between species. Isolated populations of Bolitoglossa rufescens from Los Tuxtlas region constitute a separate lineage based on molecular data and morphology, and divergence between Los Tuxtlas and other areas appears to predate the arrival of B. rufescens in other areas west of the Isthmus of Tehuantepec. The Isthmus appears responsible for Pliocene vicariance within B. rufescens, as has been shown for other taxa. The Motagua-Polochic fault system does not appear to have caused population vicariance, unlike in other systems. Conclusions Species of Nanotriton have responded to some major geological events in the same manner as other taxa, particularly in the case of the Isthmus of Tehuantepec. The deep divergence of the Los Tuxtlas populations of B. rufescens from other populations highlights the contribution of this volcanic system to patterns of regional endemism, and morphological differences observed in the Los Tuxtlas populations suggests that they may represent an undescribed species of Bolitoglossa. The absence of phylogeographic structure in B

  4. Portrait of a Geothermal Spring, Hunter's Hot Springs, Oregon.

    Science.gov (United States)

    Castenholz, Richard W

    2015-01-27

    Although alkaline Hunter's Hot Springs in southeastern Oregon has been studied extensively for over 40 years, most of these studies and the subsequent publications were before the advent of molecular methods. However, there are many field observations and laboratory experiments that reveal the major aspects of the phototrophic species composition within various physical and chemical gradients of these springs. Relatively constant temperature boundaries demark the upper boundary of the unicellular cyanobacterium, Synechococcus at 73-74 °C (the world-wide upper limit for photosynthesis), and 68-70 °C the upper limit for Chloroflexus. The upper limit for the cover of the filamentous cyanobacterium, Geitlerinema (Oscillatoria) is at 54-55 °C, and the in situ lower limit at 47-48 °C for all three of these phototrophs due to the upper temperature limit for the grazing ostracod, Thermopsis. The in situ upper limit for the cyanobacteria Pleurocapsa and Calothrix is at ~47-48 °C, which are more grazer-resistant and grazer dependent. All of these demarcations are easily visible in the field. In addition, there is a biosulfide production in some sections of the springs that have a large impact on the microbiology. Most of the temperature and chemical limits have been explained by field and laboratory experiments.

  5. Fish Springs NWR Water Use Report : 2010

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Fish Springs National Wildlife Refuge (NWR) for 2010. A general background is presented on historical spring water...

  6. Large-conductance calcium-activated potassium channels facilitate transmitter release in salamander rod synapse.

    Science.gov (United States)

    Xu, Jian Wei; Slaughter, Malcolm M

    2005-08-17

    Large-conductance calcium-activated potassium (BK) channels are colocalized with calcium channels at sites of exocytosis at the presynaptic terminals throughout the nervous system. It is expected that their activation would provide negative feedback to transmitter release, but the opposite is sometimes observed. Attempts to resolve this apparent paradox based on alterations in action potential waveform have been ambiguous. In an alternative approach, we investigated the influence of this channel on neurotransmitter release in a nonspiking neuron, the salamander rod photoreceptors. Surprisingly, the BK channel facilitates calcium-mediated transmitter release from rods. The two presynaptic channels form a positive coupled loop. Calcium influx activates the BK channel current, leading to potassium efflux that increases the calcium current. The normal physiological voltage range of the rod is well matched to the dynamics of this positive loop. When the rod is further depolarized, then the hyperpolarizing BK channel current exceeds its facilitatory effect, causing truncation of transmitter release. Thus, the calcium channel-BK channel linkage performs two functions at the synapse: nonlinear potentiator and safety brake.

  7. Temporal response of the tiger salamander (Ambystoma tigrinum to 3,000 years of climatic variation

    Directory of Open Access Journals (Sweden)

    Long Webb

    2005-09-01

    Full Text Available Abstract Background Amphibians are sensitive indicators of environmental conditions and show measurable responses, such as changes in phenology, abundance and range limits to local changes in precipitation and temperature regimes. Amphibians offer unique opportunities to study the important ecological and evolutionary implications of responses in life history characteristics to climatic change. We analyzed a late-Holocene fossil record of the Tiger Salamander (Ambystoma tigrinum for evidence of population-level changes in body size and paedomorphosis to climatic change over the last 3000 years. Results We found a significant difference in body size index between paedomorphic and metamorphic individuals during the time interval dominated by the Medieval Warm Period. There is a consistent ratio of paedomorphic to metamorphic specimens through the entire 3000 years, demonstrating that not all life history characteristics of the population were significantly altered by changes in climate on this timescale. Conclusion The fossil record of Ambystoma tigrinum we used spans an ecologically relevant timescale appropriate for understanding population and community response to projected climatic change. The population-level responses we documented are concordant with expectations based on modern environmental studies, and yield insight into population-level patterns across hundreds of generations, especially the independence of different life history characteristics. These conclusions lead us to offer general predictions about the future response of this species based on likely scenarios of climatic warming in the Rocky Mountain region.

  8. Non-additive effects of intra- and interspecific competition between two larval salamanders.

    Science.gov (United States)

    Anderson, Thomas L; Whiteman, Howard H

    2015-05-01

    Assessment of the relative strengths of intra- and interspecific competition has increased in recent years and is critical to understanding the importance of competition. Yet, whether intra- and interspecific competition can have non-additive effects has rarely been tested. The resulting fitness consequences of such non-additive interactions are important to provide the context necessary to advance our understanding of competition theory. We compared the strength of additive and non-additive intra- and interspecific competition by manipulating densities of a pair of larval salamanders (Ambystoma talpoideum and A. maculatum) in experimental mesocosms within a response surface design. Intraspecific density had the strongest effect on the strength of competition for both species, and few observed comparisons indicated interspecific competition was an important factor in predicting body size, growth or larval period length of either species. Non-additive effects of intra- and interspecific competition influenced some response variables, including size and mass at metamorphosis in A. maculatum, but at a reduced strength compared to intraspecific effects alone. Intraspecific competition was thus the dominant biotic interaction, but non-additive effects also impact the outcome of competition in these species, validating the importance of testing for and incorporating non-additive density effects into competition models.

  9. Morphological homoplasy, life history evolution, and historical biogeography of plethodontid salamanders inferred from complete mitochondrial genomes

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Rachel Lockridge; Macey, J. Robert; Jaekel, Martin; Wake, David B.; Boore, Jeffrey L.

    2004-08-01

    The evolutionary history of the largest salamander family (Plethodontidae) is characterized by extreme morphological homoplasy. Analysis of the mechanisms generating such homoplasy requires an independent, molecular phylogeny. To this end, we sequenced 24 complete mitochondrial genomes (22 plethodontids and two outgroup taxa), added data for three species from GenBank, and performed partitioned and unpartitioned Bayesian, ML, and MP phylogenetic analyses. We explored four dataset partitioning strategies to account for evolutionary process heterogeneity among genes and codon positions, all of which yielded increased model likelihoods and decreased numbers of supported nodes in the topologies (PP > 0.95) relative to the unpartitioned analysis. Our phylogenetic analyses yielded congruent trees that contrast with the traditional morphology-based taxonomy; the monophyly of three out of four major groups is rejected. Reanalysis of current hypotheses in light of these new evolutionary relationships suggests that (1) a larval life history stage re-evolved from a direct-developing ancestor multiple times, (2) there is no phylogenetic support for the ''Out of Appalachia'' hypothesis of plethodontid origins, and (3) novel scenarios must be reconstructed for the convergent evolution of projectile tongues, reduction in toe number, and specialization for defensive tail loss. Some of these novel scenarios imply morphological transformation series that proceed in the opposite direction than was previously thought. In addition, they suggest surprising evolutionary lability in traits previously interpreted to be conservative.

  10. Mitochondrial cytochrome B phylogeny and historical biogeography of the Tohoku salamander, Hynobius lichenatus (Amphibia, Caudata).

    Science.gov (United States)

    Aoki, Gen; Matsui, Masafumi; Nishikawa, Kanto

    2013-03-01

    The Tohoku salamander, Hynobius lichenatus Boulenger, 1883, is a lentic breeding species widespread throughout montane regions of northeastern Japan. To explore intraspecific genetic variation and infer evolutionary history of H. lichenatus, we performed mitochondrial DNA analysis (complete 1141 bp sequences of the mitochondrial cytochrome b gene) using 215 adult and larval individuals collected from 75 localities, encompassing known distributional range of the species. Hynobius lichenatus proved to be monophyletic, including three well-supported and geographically structured clades (Clade I from northern Kanto, Clade II from southern Tohoku, and Clade III from northern Tohoku). These clades, respectively, comprise several subclades, and show genetic distances as large as those seen between different species of Hynobius. Results of population statistic analyses indicate that all clades and most subclades have maintained high genetic diversity and demographic stability over long periods. Molecular dating indicates divergence in H. lichenatus concords with topographic evolution of northeastern Japan from late Miocene to early Pleistocene, suggesting that paleogeographic events in this region, such as orogenesis, sea level change, and volcanic activity, have been crucial for shaping genetic patterns and diversity in this species. Hynobius lichenatus greatly differs from many other animal species from northeastern Japan in its much older periods and the pattern of genetic differentiation, and is suggested as an old faunal element in this region.

  11. Ancient DNA assessment of tiger salamander population in Yellowstone National Park.

    Science.gov (United States)

    McMenamin, Sarah K; Hadly, Elizabeth A

    2012-01-01

    Recent data indicates that blotched tiger salamanders (Ambystoma tigrinum melanostictum) in northern regions of Yellowstone National Park are declining due to climate-related habitat changes. In this study, we used ancient and modern mitochondrial haplotype diversity to model the effective size of this amphibian population through recent geological time and to assess past responses to climatic changes in the region. Using subfossils collected from a cave in northern Yellowstone, we analyzed >700 base pairs of mitochondrial sequence from 16 samples ranging in age from 100 to 3300 years old and found that all shared an identical haplotype. Although mitochondrial diversity was extremely low within the living population, we still were able to detect geographic subdivision within the local area. Using serial coalescent modelling with Bayesian priors from both modern and ancient genetic data we simulated a range of probable population sizes and mutation rates through time. Our simulations suggest that regional mitochondrial diversity has remained relatively constant even through climatic fluctuations of recent millennia.

  12. Ancient DNA assessment of tiger salamander population in Yellowstone National Park.

    Directory of Open Access Journals (Sweden)

    Sarah K McMenamin

    Full Text Available Recent data indicates that blotched tiger salamanders (Ambystoma tigrinum melanostictum in northern regions of Yellowstone National Park are declining due to climate-related habitat changes. In this study, we used ancient and modern mitochondrial haplotype diversity to model the effective size of this amphibian population through recent geological time and to assess past responses to climatic changes in the region. Using subfossils collected from a cave in northern Yellowstone, we analyzed >700 base pairs of mitochondrial sequence from 16 samples ranging in age from 100 to 3300 years old and found that all shared an identical haplotype. Although mitochondrial diversity was extremely low within the living population, we still were able to detect geographic subdivision within the local area. Using serial coalescent modelling with Bayesian priors from both modern and ancient genetic data we simulated a range of probable population sizes and mutation rates through time. Our simulations suggest that regional mitochondrial diversity has remained relatively constant even through climatic fluctuations of recent millennia.

  13. Landscape genetics of alpine Sierra Nevada salamanders reveal extreme population subdivision in space and time.

    Science.gov (United States)

    Savage, Wesley K; Fremier, Alexander K; Shaffer, H Bradley

    2010-08-01

    Quantifying the influence of the landscape on the genetic structure of natural populations remains an important empirical challenge, particularly for poorly studied, ecologically cryptic species. We conducted an extensive microsatellite analysis to examine the population genetics of the southern long-toed salamander (Ambystoma macrodactylum sigillatum) in a naturally complex landscape. Using spatially explicit modelling, we investigated the influence of the Sierra Nevada topography on potential dispersal corridors between sampled populations. Our results indicate very high-genetic divergence among populations, high within-deme relatedness, and little evidence of recent migration or population admixture. We also discovered unexpectedly high between-year genetic differentiation (F(ST)) for breeding sites, suggesting that breeding groups vary over localized space and time. While environmental factors associated with high-elevation montane habitats apparently play an important role in shaping population differentiation, additional, species-specific biological processes must also be operating to account for observed deviations from temporal, among-year panmixia. Our study emphasizes the population-level insights that can be gained from high-density sampling in space and time, and the highly substructured population biology that may characterize amphibians in extreme montane habitats.

  14. Two new Salamanders of the genus Onychodactylus from Eastern Honshu, Japan (Amphibia, Caudata, Hynobiidae).

    Science.gov (United States)

    Yoshikawa, Natsuhiko; Matsui, Masafumi

    2014-09-22

    We describe two new species of hynobiid salamanders in the genus Onychodactylus from eastern Honshu, Japan, based on the morphological and genetic evidence. Onychodactylus intermedius sp. nov. is distributed in southern part of Tohoku District and northern Ibaraki and Niigata Prefectures, and was previously reported as S-Tohoku group. Onychodactylus intermedius belongs to the O. japonicus species complex, and differs from the other congeners in having relatively long tail, narrow head, short snout, 18 presacral vertebrae, and distinctly curved vomerine tooth series without gap. Onychodactylus fuscus sp. nov. is known from only four localities in Fukushima and Niigata Prefectures of Tohoku and Hokuriku Districts. It also belongs to the O. japonicus complex, but lacks the dorsal stripe, which is a diagnostic character of the species complex. In other characteristics, O. fuscus differs from the other congeners in having comparatively long tail, wide head and internarial space, shallowly curved vomerine tooth series with gap, and relatively few vomerine teeth. Both species described here breed in winter. Phylogenetically, the two new species are closely related to each other, forming a well-supported clade with O. tsukubaensis as their sister species. Onychodactylus intermedius sp. nov. is known to be parapatric with O. japonicus and O. nipponoborealis without hybridization, whereas O. fuscus sp. nov. is sympatric with O. japonicus at least in a single known locality, and analysis of microsatellite loci indicates they are reproductively isolated.

  15. Resistance to chytridiomycosis in European plethodontid salamanders of the genus Speleomantes.

    Directory of Open Access Journals (Sweden)

    Frank Pasmans

    Full Text Available North America and the neotropics harbor nearly all species of plethodontid salamanders. In contrast, this family of caudate amphibians is represented in Europe and Asia by two genera, Speleomantes and Karsenia, which are confined to small geographic ranges. Compared to neotropical and North American plethodontids, mortality attributed to chytridiomycosis caused by Batrachochytrium dendrobatidis (Bd has not been reported for European plethodontids, despite the established presence of Bd in their geographic distribution. We determined the extent to which Bd is present in populations of all eight species of European Speleomantes and show that Bd was undetectable in 921 skin swabs. We then compared the susceptibility of one of these species, Speleomantes strinatii, to experimental infection with a highly virulent isolate of Bd (BdGPL, and compared this to the susceptible species Alytes muletensis. Whereas the inoculated A. muletensis developed increasing Bd-loads over a 4-week period, none of five exposed S. strinatii were colonized by Bd beyond 2 weeks post inoculation. Finally, we determined the extent to which skin secretions of Speleomantes species are capable of killing Bd. Skin secretions of seven Speleomantes species showed pronounced killing activity against Bd over 24 hours. In conclusion, the absence of Bd in Speleomantes combined with resistance to experimental chytridiomycosis and highly efficient skin defenses indicate that the genus Speleomantes is a taxon unlikely to decline due to Bd.

  16. Current and historical drivers of landscape genetic structure differ in core and peripheral salamander populations.

    Directory of Open Access Journals (Sweden)

    Rachael Y Dudaniec

    Full Text Available With predicted decreases in genetic diversity and greater genetic differentiation at range peripheries relative to their cores, it can be difficult to distinguish between the roles of current disturbance versus historic processes in shaping contemporary genetic patterns. To address this problem, we test for differences in historic demography and landscape genetic structure of coastal giant salamanders (Dicamptodon tenebrosus in two core regions (Washington State, United States versus the species' northern peripheral region (British Columbia, Canada where the species is listed as threatened. Coalescent-based demographic simulations were consistent with a pattern of post-glacial range expansion, with both ancestral and current estimates of effective population size being much larger within the core region relative to the periphery. However, contrary to predictions of recent human-induced population decline in the less genetically diverse peripheral region, there was no genetic signature of population size change. Effects of current demographic processes on genetic structure were evident using a resistance-based landscape genetics approach. Among core populations, genetic structure was best explained by length of the growing season and isolation by resistance (i.e. a 'flat' landscape, but at the periphery, topography (slope and elevation had the greatest influence on genetic structure. Although reduced genetic variation at the range periphery of D. tenebrosus appears to be largely the result of biogeographical history rather than recent impacts, our analyses suggest that inherent landscape features act to alter dispersal pathways uniquely in different parts of the species' geographic range, with implications for habitat management.

  17. Extensive unidirectional introgression between two salamander lineages of ancient divergence and its evolutionary implications

    Science.gov (United States)

    Canestrelli, Daniele; Bisconti, Roberta; Nascetti, Giuseppe

    2014-01-01

    Hybridization and introgression, contrary to previous beliefs, are now considered to be widespread processes even among animal species. Nonetheless, the range of their possible outcomes and roles in moulding biodiversity patterns are still far from being fully appraised. Here we investigated the pattern of hybridization and introgression between Salamandrina perspicillata and S. terdigitata, two salamanders endemic to the Italian peninsula. Using a set of diagnostic or differentiated genetic markers (9 nuclear and 1 mitochondrial), we documented extensive unidirectional introgression of S. terdigitata alleles into the S. perspicillata gene pool in central Italy, indicating that barriers against hybridization were permeable when they came into secondary contact, and despite their ancient divergence. Nonetheless, purebred S. terdigitata, as well as F1, F2, and backcrosses were not found within the hybrid zone. Moreover, Bayesian analyses of population structure identified admixed populations belonging to a differentiated gene pool with respect to both parental populations. Overall, the observed genetic structure, together with their geographic pattern of distribution, suggests that Salamandrina populations in central Italy could have entered a distinct evolutionary pathway. How far they have gone along this pathway will deserve future investigation. PMID:25269625

  18. Biology of tiny animals: three new species of minute salamanders (Plethodontidae: Thorius) from Oaxaca, Mexico

    Science.gov (United States)

    Rovito, Sean M.; García-París, Mario; Maisano, Jessica A.; Wake, David B.

    2016-01-01

    We describe three new species of minute salamanders, genus Thorius, from the Sierra Madre del Sur of Oaxaca, Mexico. Until now only a single species, T. minutissimus, has been reported from this region, although molecular data have long shown extensive genetic differentiation among geographically disjunct populations. Adult Thorius pinicola sp. nov., T. longicaudus sp. nov., and T. tlaxiacus sp. nov. are larger than T. minutissimus and possess elliptical rather than oval nostrils; T. pinicola and T. longicaudus also have longer tails. All three new species occur west of the range of T. minutissimus, which has the easternmost distribution of any member of the genus. The new species are distinguished from each other and from other named Thorius in Oaxaca by a combination of adult body size, external morphology and osteology, and by protein characters (allozymes) and differences in DNA sequences. In addition, we redescribe T. minutissimus and a related species, T. narisovalis, to further clarify the taxonomic status of Oaxacan populations and to facilitate future studies of the remaining genetically differentiated Thorius that cannot be satisfactorily assigned to any named species. Populations of all five species considered here appear to have declined dramatically over the last one or two decades and live specimens are difficult to find in nature. Thorius may be the most endangered genus of amphibians in the world. All species may go extinct before the end of this century. PMID:27896029

  19. Temporally adaptive sampling: a case study in rare species survey design with marbled salamanders (Ambystoma opacum.

    Directory of Open Access Journals (Sweden)

    Noah D Charney

    Full Text Available Improving detection rates for elusive species with clumped distributions is often accomplished through adaptive sampling designs. This approach can be extended to include species with temporally variable detection probabilities. By concentrating survey effort in years when the focal species are most abundant or visible, overall detection rates can be improved. This requires either long-term monitoring at a few locations where the species are known to occur or models capable of predicting population trends using climatic and demographic data. For marbled salamanders (Ambystoma opacum in Massachusetts, we demonstrate that annual variation in detection probability of larvae is regionally correlated. In our data, the difference in survey success between years was far more important than the difference among the three survey methods we employed: diurnal surveys, nocturnal surveys, and dipnet surveys. Based on these data, we simulate future surveys to locate unknown populations under a temporally adaptive sampling framework. In the simulations, when pond dynamics are correlated over the focal region, the temporally adaptive design improved mean survey success by as much as 26% over a non-adaptive sampling design. Employing a temporally adaptive strategy costs very little, is simple, and has the potential to substantially improve the efficient use of scarce conservation funds.

  20. Biology of tiny animals: three new species of minute salamanders (Plethodontidae: Thorius from Oaxaca, Mexico

    Directory of Open Access Journals (Sweden)

    Gabriela Parra-Olea

    2016-11-01

    Full Text Available We describe three new species of minute salamanders, genus Thorius, from the Sierra Madre del Sur of Oaxaca, Mexico. Until now only a single species, T. minutissimus, has been reported from this region, although molecular data have long shown extensive genetic differentiation among geographically disjunct populations. Adult Thorius pinicola sp. nov., T. longicaudus sp. nov., and T. tlaxiacus sp. nov. are larger than T. minutissimus and possess elliptical rather than oval nostrils; T. pinicola and T. longicaudus also have longer tails. All three new species occur west of the range of T. minutissimus, which has the easternmost distribution of any member of the genus. The new species are distinguished from each other and from other named Thorius in Oaxaca by a combination of adult body size, external morphology and osteology, and by protein characters (allozymes and differences in DNA sequences. In addition, we redescribe T. minutissimus and a related species, T. narisovalis, to further clarify the taxonomic status of Oaxacan populations and to facilitate future studies of the remaining genetically differentiated Thorius that cannot be satisfactorily assigned to any named species. Populations of all five species considered here appear to have declined dramatically over the last one or two decades and live specimens are difficult to find in nature. Thorius may be the most endangered genus of amphibians in the world. All species may go extinct before the end of this century.

  1. Male pheromone protein components activate female vomeronasal neurons in the salamander Plethodon shermani

    Directory of Open Access Journals (Sweden)

    Feldhoff Pamela W

    2006-03-01

    Full Text Available Abstract Background The mental gland pheromone of male Plethodon salamanders contains two main protein components: a 22 kDa protein named Plethodon Receptivity Factor (PRF and a 7 kDa protein named Plethodon Modulating Factor (PMF, respectively. Each protein component individually has opposing effects on female courtship behavior, with PRF shortening and PMF lengthening courtship. In this study, we test the hypothesis that PRF or PMF individually activate vomeronasal neurons. The agmatine-uptake technique was used to visualize chemosensory neurons that were activated by each protein component individually. Results Vomeronasal neurons exposed to agmatine in saline did not demonstrate significant labeling. However, a population of vomeronasal neurons was labeled following exposure to either PRF or PMF. When expressed as a percent of control level labeled cells, PRF labeled more neurons than did PMF. These percentages for PRF and PMF, added together, parallel the percentage of labeled vomeronasal neurons when females are exposed to the whole pheromone. Conclusion This study suggests that two specific populations of female vomeronasal neurons are responsible for responding to each of the two components of the male pheromone mixture. These two neural populations, therefore, could express different receptors which, in turn, transmit different information to the brain, thus accounting for the different female behavior elicited by each pheromone component.

  2. Resistance to chytridiomycosis in European plethodontid salamanders of the genus Speleomantes.

    Science.gov (United States)

    Pasmans, Frank; Van Rooij, Pascale; Blooi, Mark; Tessa, Giulia; Bogaerts, Sergé; Sotgiu, Giuseppe; Garner, Trenton W J; Fisher, Matthew C; Schmidt, Benedikt R; Woeltjes, Tonnie; Beukema, Wouter; Bovero, Stefano; Adriaensen, Connie; Oneto, Fabrizio; Ottonello, Dario; Martel, An; Salvidio, Sebastiano

    2013-01-01

    North America and the neotropics harbor nearly all species of plethodontid salamanders. In contrast, this family of caudate amphibians is represented in Europe and Asia by two genera, Speleomantes and Karsenia, which are confined to small geographic ranges. Compared to neotropical and North American plethodontids, mortality attributed to chytridiomycosis caused by Batrachochytrium dendrobatidis (Bd) has not been reported for European plethodontids, despite the established presence of Bd in their geographic distribution. We determined the extent to which Bd is present in populations of all eight species of European Speleomantes and show that Bd was undetectable in 921 skin swabs. We then compared the susceptibility of one of these species, Speleomantes strinatii, to experimental infection with a highly virulent isolate of Bd (BdGPL), and compared this to the susceptible species Alytes muletensis. Whereas the inoculated A. muletensis developed increasing Bd-loads over a 4-week period, none of five exposed S. strinatii were colonized by Bd beyond 2 weeks post inoculation. Finally, we determined the extent to which skin secretions of Speleomantes species are capable of killing Bd. Skin secretions of seven Speleomantes species showed pronounced killing activity against Bd over 24 hours. In conclusion, the absence of Bd in Speleomantes combined with resistance to experimental chytridiomycosis and highly efficient skin defenses indicate that the genus Speleomantes is a taxon unlikely to decline due to Bd.

  3. Extinction debt as a driver of amphibian declines: An example with imperiled flatwoods salamanders

    Science.gov (United States)

    Semiltsch, Raymond D; Walls, Susan; Barichivich, William J.; O'Donnell, Katherine

    2017-01-01

    A comprehensive view of population declines and their underlying causes is necessary to reverse species loss. Historically, in many cases, a narrow view may have allowed species declines to continue, virtually undetected, for long periods of time (perhaps even decades). We suggest that extinction debt is likely responsible for numerous (perhaps most) amphibian declines and that this perspective should be incorporated into the structure of amphibian research and management. Extinction debt, originally proposed to explain changes in species richness following environmental disturbance, also may refer to the proportion of populations of an individual species that is expected to eventually be lost because of habitat change. A conservation framework to address extinction debt focuses research on threats at the individual, population, and metapopulation levels. This approach will help enhance, restore, and protect specific processes and habitats at the proper scale by directing management to the most vulnerable level and stage of a species. We illustrate this approach using Flatwoods Salamanders, Ambystoma cingulatumand Ambystoma bishopi, which occurred historically throughout the Coastal Plain of the southeastern United States but have experienced a greater than 85% loss of populations in recent years. Reversal of these losses is possible only if conservation and recovery efforts encompass individual, population, and metapopulation levels. We illustrate our framework by outlining actions that could be taken at each of these levels to help guide conservation and management of amphibians with complex life cycles and provide options for how to prioritize conservation actions in the face of logistical and budgetary shortfalls.

  4. Historical Species Distribution Models Predict Species Limits in Western Plethodon Salamanders.

    Science.gov (United States)

    Pelletier, Tara A; Crisafulli, Charlie; Wagner, Steve; Zellmer, Amanda J; Carstens, Bryan C

    2015-11-01

    Allopatry is commonly used to predict boundaries in species delimitation investigations under the assumption that currently allopatric distributions are indicative of reproductive isolation; however, species ranges are known to change over time. Incorporating a temporal perspective of geographic distributions should improve species delimitation; to explore this, we investigate three species of western Plethodon salamanders that have shifted their ranges since the end of the Pleistocene. We generate species distribution models (SDM) of the current range, hindcast these models onto a climatic model 21 Ka, and use three molecular approaches to delimit species in an integrated fashion. In contrast to expectations based on the current distribution, we detect no independent lineages in species with allopatric and patchy distributions (Plethodon vandykei and Plethodon larselli). The SDMs indicate that probable habitat is more expansive than their current range, especially during the last glacial maximum (LGM) (21 Ka). However, with a contiguous distribution, two independent lineages were detected in Plethodon idahoensis, possibly due to isolation in multiple glacial refugia. Results indicate that historical SDMs are a better predictor of species boundaries than current distributions, and strongly imply that researchers should incorporate SDM and hindcasting into their investigations and the development of species hypotheses.

  5. Geographic variation, genetic structure and conservation unit designation in the larch mountain salamander( Plethodon larselli)

    Science.gov (United States)

    Wagner, R.S.; Miller, Mark P.; Crisafulli, Charles; Haig, Susan M.

    2005-01-01

    The Larch Mountain salamander (Plethodon larselli Burns, 1954) is an endemic species in the Pacific northwestern United States facing threats related to habitat destruction. To facilitate development of conservation strategies, we used DNA sequences and RAPDs (random amplified polymorphic DNA) to examine differences among populations of this species. Phylogenetic analyses of cytochrome b revealed a clade of haplotypes from populations north of the Columbia River derived from a clade containing haplotypes from the river's southwestern region. Haplotypes from southeastern populations formed a separate clade. Nucleotide diversity was reduced in northern populations relative to southern populations. These results were corroborated by analyses of RAPD loci, which revealed similar patterns of clustering and diversity. Network analyses suggested that northern populations were colonized following a range expansion mediated by individuals from populations located southwest of the river. Changes in the Columbia River's location during the Pliocene and Pleistocene likely released distributional constraints on this species, permitting their northern range expansion. Based on the barrier presented by the Columbia River's present location and differences in haplotype diversity and population structure observed between northern and southern populations, we suggest that designation of separate management units encompassing each region may assist with mitigating different threats to this species.

  6. Telocytes in gastric lamina propria of the Chinese giant salamander, Andrias davidianus

    Science.gov (United States)

    Zhang, Hui; Zhong, Shengwei; Yu, Pengcheng; Ge, Tingting; Peng, Shasha; Guo, Xiaoquan; Zhou, Zuohong

    2016-01-01

    In this study, we attempt to identify gastric telocytes (TCs) of the Chinese giant salamander Andrias davidianus, by light microscopy, immunohistochemistry and transmission electron microscopy (TEM) methods. Toluidine blue staining showed TCs with one to two very thin and long telopodes (Tps) that were located in gastric lamina propria. Tps had characteristic structures, including podoms, podomers and dichotomous branching. Immunohistochemistry showed the existence of CD34+/PDGFRα+ TCs with moniliform Tps in stroma and were close to gastric glands and blood vessels. TEM micrographs also demonstrated the presence of TCs in interstitium between gastric glands. TCs/Tps were located in close proximity to gastric glands, blood vessels, endocrine cells and stem cells. In particular, Tps frequently surrounded stem cells. TCs and Tps, Tps and stem cells established close contacts. Moreover, the exosomes were also found near TCs/Tps. Our data confirmed the presence of TCs in gastric lamina propria of the amphibian, and suggested that TCs cooperate with resident stem cells to regulate endocrine cells and gastric glands regeneration and homeostasis. PMID:27629815

  7. Beta-ionone activates and bleaches visual pigment in salamander photoreceptors.

    Science.gov (United States)

    Isayama, Tomoki; McCabe England, S L; Crouch, R K; Zimmerman, A L; Makino, C L

    2009-01-01

    Vision begins with photoisomerization of 11-cis retinal to the all-trans conformation within the chromophore-binding pocket of opsin, leading to activation of a biochemical cascade. Release of all-trans retinal from the binding pocket curtails but does not fully quench the ability of opsin to activate transducin. All-trans retinal and some other analogs, such as beta-ionone, enhance opsin's activity, presumably on binding the empty chromophore-binding pocket. By recording from isolated salamander photoreceptors and from patches of rod outer segment membrane, we now show that high concentrations of beta-ionone suppressed circulating current in dark-adapted green-sensitive rods by inhibiting the cyclic nucleotide-gated channels. There were also decreases in circulating current and flash sensitivity, and accelerated flash response kinetics in dark-adapted blue-sensitive (BS) rods and cones, and in ultraviolet-sensitive cones, at concentrations too low to inhibit the channels. These effects persisted in BS rods even after incubation with 9-cis retinal to ensure complete regeneration of their visual pigment. After long exposures to high concentrations of beta-ionone, recovery was incomplete unless 9-cis retinal was given, indicating that visual pigment had been bleached. Therefore, we propose that beta-ionone activates and bleaches some types of visual pigments, mimicking the effects of light.

  8. Understanding positional cues in salamander limb regeneration: implications for optimizing cell-based regenerative therapies.

    Science.gov (United States)

    McCusker, Catherine D; Gardiner, David M

    2014-06-01

    Regenerative medicine has reached the point where we are performing clinical trials with stem-cell-derived cell populations in an effort to treat numerous human pathologies. However, many of these efforts have been challenged by the inability of the engrafted populations to properly integrate into the host environment to make a functional biological unit. It is apparent that we must understand the basic biology of tissue integration in order to apply these principles to the development of regenerative therapies in humans. Studying tissue integration in model organisms, where the process of integration between the newly regenerated tissues and the 'old' existing structures can be observed and manipulated, can provide valuable insights. Embryonic and adult cells have a memory of their original position, and this positional information can modify surrounding tissues and drive the formation of new structures. In this Review, we discuss the positional interactions that control the ability of grafted cells to integrate into existing tissues during the process of salamander limb regeneration, and discuss how these insights could explain the integration defects observed in current cell-based regenerative therapies. Additionally, we describe potential molecular tools that can be used to manipulate the positional information in grafted cell populations, and to promote the communication of positional cues in the host environment to facilitate the integration of engrafted cells. Lastly, we explain how studying positional information in current cell-based therapies and in regenerating limbs could provide key insights to improve the integration of cell-based regenerative therapies in the future.

  9. Biology of tiny animals: three new species of minute salamanders (Plethodontidae: Thorius) from Oaxaca, Mexico.

    Science.gov (United States)

    Parra-Olea, Gabriela; Rovito, Sean M; García-París, Mario; Maisano, Jessica A; Wake, David B; Hanken, James

    2016-01-01

    We describe three new species of minute salamanders, genus Thorius, from the Sierra Madre del Sur of Oaxaca, Mexico. Until now only a single species, T. minutissimus, has been reported from this region, although molecular data have long shown extensive genetic differentiation among geographically disjunct populations. Adult Thorius pinicola sp. nov., T. longicaudus sp. nov., and T. tlaxiacus sp. nov. are larger than T. minutissimus and possess elliptical rather than oval nostrils; T. pinicola and T. longicaudus also have longer tails. All three new species occur west of the range of T. minutissimus, which has the easternmost distribution of any member of the genus. The new species are distinguished from each other and from other named Thorius in Oaxaca by a combination of adult body size, external morphology and osteology, and by protein characters (allozymes) and differences in DNA sequences. In addition, we redescribe T. minutissimus and a related species, T. narisovalis, to further clarify the taxonomic status of Oaxacan populations and to facilitate future studies of the remaining genetically differentiated Thorius that cannot be satisfactorily assigned to any named species. Populations of all five species considered here appear to have declined dramatically over the last one or two decades and live specimens are difficult to find in nature. Thorius may be the most endangered genus of amphibians in the world. All species may go extinct before the end of this century.

  10. Top 5 Spring Festival Customs in China

    Institute of Scientific and Technical Information of China (English)

    梁小明

    2016-01-01

    The Spring Festival is the largest and most important festival in China.It is the first day of the lunar calendar~1 and usually occurs somewhere between January30 and February 20,heralding~2 the beginning of spring,thus it is known as the Spring Festival.1.Spring Couplets On the Chinese New Year,families in China decorate their front doors with poetic couplets

  11. An Evaluation of Chinese Spring Festival

    Institute of Scientific and Technical Information of China (English)

    李艳蕊

    2012-01-01

    Nowadays,many Chinese people felt that Spring Festival is bored;feeling of celebrating Spring Festival is not as strong as before.Some experts stated that the physical part of Spring Festival shrouded the cultural celebrations.This article analysis the phenomenon through comparing how Chinese people had Spring Festivals in the past and now,and comparing different economic status Chinese people have in these two periods.

  12. Qatar and the Arab Spring

    KAUST Repository

    Coates Ulrichsen, Kristian

    2014-11-15

    This chapter examines how Qatar assumed an extraordinarily visible and interventionist role during the Arab Spring upheaval in 2011. It argues that, after an initial period of caution in January 2011, Qatari officials quickly recognised the changing contours of the Arab Spring and pragmatically readjusted their policy-responses. The lack of domestic constraints on decision-making enabled officials, led by the Emir and the Prime minister, to reposition Qatar (somewhat improbably) as a champion of the popular uprisings in North Africa and later as a key external player in the Syrian Civil War. The chapter also provides historical context to Qatar’s close relationship with the Muslim Brotherhood, and documents why Qatari officials saw the outbreak of the uprisings as far more of an opportunity than a challenge.

  13. Spring-forward in composite plate elements

    NARCIS (Netherlands)

    Wijskamp, S.; Lamers, E.A.D.; Akkerman, R.

    2005-01-01

    Spring-forward is a distortion of corner sections in continuous fibre reinforced composite products. The linear thermoelastic prediction for the spring-forward of single curved geometries is incorporated in a FE formulation for plate elements in order to simulate the spring-forward of doubly curved

  14. Radon in Himalayan springs: a geohydrological control

    Energy Technology Data Exchange (ETDEWEB)

    Choubey, V.M.; Bartarya, S.K. [Wadia Inst. of Himalayan Geology, Dehra Dun (India); Ramola, R.C. [Garhwal Univ., Srinagar, Uttar Pradesh (India). Dept. of Physics

    2000-04-01

    This paper presents the results of radon measurements in springs of the Himalayan region by using radon emanometry technique. The radon was measured in different springs, draining from different geohydrological setups, and from stream water in order to find the geohydrological control over radon concentration in groundwater emanating in the form of spring. The radon values were found to vary from 0.4 Bq/l to 887 Bq/l, being observed lowest for a turbulent stream and highest for the spring. The radon values were recorded highest in the springs draining through gneiss, granite, mylonite, etc. Radon concentrations have been related with four spring types viz. fracture-joint related spring, fault-lineament related spring, fluvial related spring and colluvial related spring, showing geohydrological characteristics of the rocks through which they are emanating. The high radon concentration in fracture-joint and fault-lineament springs is related to increased ratio of rock surface area to water volume and uranium mineralisation in the shear zones present in the close vicinity of fault and thrust. The low concentration of radon in fluvial and colluvial springs is possibly because of high transmissivity and turbulent flow within such deposits leading to natural de-emanation of gases. (orig.)

  15. 49 CFR 236.822 - Switch, spring.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Switch, spring. 236.822 Section 236.822 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Switch, spring. A switch equipped with a spring device which forces the points to their original...

  16. 14 CFR 27.687 - Spring devices.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Spring devices. 27.687 Section 27.687... STANDARDS: NORMAL CATEGORY ROTORCRAFT Design and Construction Control Systems § 27.687 Spring devices. (a) Each control system spring device whose failure could cause flutter or other unsafe...

  17. 14 CFR 23.687 - Spring devices.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Spring devices. 23.687 Section 23.687 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS... Systems § 23.687 Spring devices. The reliability of any spring device used in the control system must...

  18. 14 CFR 29.687 - Spring devices.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Spring devices. 29.687 Section 29.687... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Design and Construction Control Systems § 29.687 Spring devices. (a) Each control system spring device whose failure could cause flutter or other unsafe...

  19. Skillful Use of Imagery in Two Odes to Spring--Comment on The Soote Season and Spring, the Sweet Spring

    Institute of Scientific and Technical Information of China (English)

    冯海荣

    2002-01-01

    The Soote Season and Spring, the Sweet Spring are two lyrics that sing the praise of spring. The common feature of the two lyrics is that the two poets depict a series of pictures of the sweet spring by rich and varied imagery for readers.When these pictures are presented to readers ,readers feel as if they are participating in them,and the enchanting beauty of spring makes readers feel intoxicated with happiness. The two poets express their different feelings toward nature.

  20. The Arab Spring in Jordan

    OpenAIRE

    Eriksson, Elsa Annaklara; Hansen, Ditte Ingemann

    2013-01-01

    This project contains analysis and discussion of several social movements in Jordan. The uprising in Jordan and demands for more democratization are inspired by the Arab Spring observed in the Middle East. The most highlighted Jordanian social movements being the religious Muslim Brotherhood, the radical Salafi Movement and the newly proclaimed Popular Mobilization. Questions concerning the identification of them, their goals and ways of mobilizing and the hindrances for these movements to mo...

  1. Controlling proteins through molecular springs.

    Science.gov (United States)

    Zocchi, Giovanni

    2009-01-01

    We argue that the mechanical control of proteins-the notion of controlling chemical reactions and processes by mechanics-is conceptually interesting. We give a brief review of the main accomplishments so far, leading to our present approach of using DNA molecular springs to exert controlled stresses on proteins. Our focus is on the physical principles that underlie both artificial mechanochemical devices and natural mechanisms of allostery.

  2. KUNMING: The City of Spring

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    @@ Kunming is the political, economic and cultural center of Yunnan province and the most popular center for tourism in Southwest China. Kunming enjoys a pleasant climate and does its best to live up to its title of "the City of Spring". Whenever you are planning to go, the temperature is always pleasant. With its convenient transport links in and out of the city, Kunming welcomes tens of thousands of tourists every day.

  3. Spring Framework 5: Themes & Trends

    CERN Document Server

    CERN. Geneva

    2017-01-01

    Spring Framework 5.0/5.1, scheduled for release in early/late 2017, focuses on several key themes: reactive web applications based on Reactive Streams, comprehensive support for JDK 9 and HTTP/2, as well as the latest API generations in the Enterprise Java ecosystem. This talk presents the overall story in the context of wider industry trends, highlighting Spring’s unique programming model strategy.

  4. The first CERN Spring Campus

    CERN Multimedia

    CERN Bulletin

    2014-01-01

    From 14 to 16 April, the first edition of the CERN Spring Campus took place in Spain. Taking place over three intensive days, this event brought experts from CERN together at the University of Oviedo, where they met the engineers and scientists of the future in a programme of scientific and technological dissemination and cultural exchange.   The young participants of the first CERN Spring Campus and their instructors show their enthusiasm after the intensive three-day course. “This three-day school focuses on preparing young engineers for the job market, with a particular emphasis on computing,” explains Derek Mathieson, Advanced Information Systems Group Leader in the GS Department and Head of the CERN Spring Campus organising committee. “We organised talks on entrepreneurship and IT, as well as on job interviews and CV writing. It was also an important opportunity for the participants to meet CERN computing engineers to find out what it is like to work in I...

  5. Disaggregation modelling of spring discharges

    Directory of Open Access Journals (Sweden)

    Kirilova Bojilova Elena

    2004-12-01

    Full Text Available Disaggregation models are basically divided into three main groups: temporal, spatial and temporal-spatial. The focus of this paper is the application of temporal disaggregation models to disaggregate the seasonal flow in some large time intervals to sub-seasonal flows in some shorter time intervals. Two basic models are applied: the original model of Mejia and Rousselle and the corrected extended Lin model one-stage disaggregation. The flow totals from some karstic springs are used. Data for five springs in different areas of Bulgaria for the aims of the study are executed. The synthetic data generation for the chosen spring stations for a new realisation of thirty years is obtained. The multi-variate lag-one auto regressive model (AR(1 model is applied for generation of the annual flow sequences. The Lin model single- site is performed for thirty years generation period. The Lin model is an improvement compared to the original extended model. The new Lin approach succeeds in the preservation of the additivity as well as the moments. Applying the Lin model one-stage disaggregation results in consistent model parameter estimates. As a second step in the research multi-site disaggregation schemes are also applied.

  6. 约翰·巴顿犯罪成因探析--以挫折-攻击心理学理论为视角%The Exploration of John Barton ’s Criminal Cause Based on the Frustration-Aggression Hypothesis

    Institute of Scientific and Technical Information of China (English)

    李安恒

    2014-01-01

    英国女作家伊丽莎白·盖斯凯尔夫人的代表作《玛丽·巴顿》(Mary Barton)中的主人公约翰·巴顿,作为工人阶层的代表,在巨大的挫折驱使下谋杀了厂主的儿子哈利·卡森,这一暴力犯罪符合挫折-攻击心理学理论,挫折是导致其暴力犯罪的心理成因。%The workingman John Barton, the protagonist in the masterpiece novel Mary Barton by Elizabeth Gaskell, the Victorian English female novelist, driven by the enormous frustration, murders Harry Carson, the son of the employer of a cotton mill. This violent crime conforms to the frustration-aggression hypothesis, which shows the violent crime should be attributed to the psychological frustration.

  7. Calibrating abundance indices with population size estimators of red back salamanders (Plethodon cinereus in a New England forest

    Directory of Open Access Journals (Sweden)

    Ahmed A. Siddig

    2015-05-01

    Full Text Available Herpetologists and conservation biologists frequently use convenient and cost-effective, but less accurate, abundance indices (e.g., number of individuals collected under artificial cover boards or during natural objects surveys in lieu of more accurate, but costly and destructive, population size estimators to detect and monitor size, state, and trends of amphibian populations. Although there are advantages and disadvantages to each approach, reliable use of abundance indices requires that they be calibrated with accurate population estimators. Such calibrations, however, are rare. The red back salamander, Plethodon cinereus, is an ecologically useful indicator species of forest dynamics, and accurate calibration of indices of salamander abundance could increase the reliability of abundance indices used in monitoring programs. We calibrated abundance indices derived from surveys of P. cinereus under artificial cover boards or natural objects with a more accurate estimator of their population size in a New England forest. Average densities/m2 and capture probabilities of P. cinereus under natural objects or cover boards in independent, replicate sites at the Harvard Forest (Petersham, Massachusetts, USA were similar in stands dominated by Tsuga canadensis (eastern hemlock and deciduous hardwood species (predominantly Quercus rubra [red oak] and Acer rubrum [red maple]. The abundance index based on salamanders surveyed under natural objects was significantly associated with density estimates of P. cinereus derived from depletion (removal surveys, but underestimated true density by 50%. In contrast, the abundance index based on cover-board surveys overestimated true density by a factor of 8 and the association between the cover-board index and the density estimates was not statistically significant. We conclude that when calibrated and used appropriately, some abundance indices may provide cost-effective and reliable measures of P. cinereus

  8. Rapid fixation of non-native alleles revealed by genome-wide SNP analysis of hybrid tiger salamanders

    Directory of Open Access Journals (Sweden)

    Shaffer H Bradley

    2009-07-01

    Full Text Available Abstract Background Hybrid zones represent valuable opportunities to observe evolution in systems that are unusually dynamic and where the potential for the origin of novelty and rapid adaptation co-occur with the potential for dysfunction. Recently initiated hybrid zones are particularly exciting evolutionary experiments because ongoing natural selection on novel genetic combinations can be studied in ecological time. Moreover, when hybrid zones involve native and introduced species, complex genetic patterns present important challenges for conservation policy. To assess variation of admixture dynamics, we scored a large panel of markers in five wild hybrid populations formed when Barred Tiger Salamanders were introduced into the range of California Tiger Salamanders. Results At three of 64 markers, introduced alleles have largely displaced native alleles within the hybrid populations. Another marker (GNAT1 showed consistent heterozygote deficits in the wild, and this marker was associated with embryonic mortality in laboratory F2's. Other deviations from equilibrium expectations were idiosyncratic among breeding ponds, consistent with highly stochastic demographic effects. Conclusion While most markers retain native and introduced alleles in expected proportions, strong selection appears to be eliminating native alleles at a smaller set of loci. Such rapid fixation of alleles is detectable only in recently formed hybrid zones, though it might be representative of dynamics that frequently occur in nature. These results underscore the variable and mosaic nature of hybrid genomes and illustrate the potency of recombination and selection in promoting variable, and often unpredictable genetic outcomes. Introgression of a few, strongly selected introduced alleles should not necessarily affect the conservation status of California Tiger Salamanders, but suggests that genetically pure populations of this endangered species will be difficult to

  9. Retention of low-fitness genotypes over six decades of admixture between native and introduced tiger salamanders

    Directory of Open Access Journals (Sweden)

    Shaffer H Bradley

    2010-05-01

    Full Text Available Abstract Background Introductions of non-native tiger salamanders into the range of California tiger salamanders have provided a rare opportunity to study the early stages of secondary contact and hybridization. We produced first- and second-generation hybrid salamanders in the lab and measured viability among these early-generation hybrid crosses to determine the strength of the initial barrier to gene exchange. We also created contemporary-generation hybrids in the lab and evaluated the extent to which selection has affected fitness over approximately 20 generations of admixture. Additionally, we examined the inheritance of quantitative phenotypic variation to better understand how evolution has progressed since secondary contact. Results We found significant variation in the fitness of hybrids, with non-native backcrosses experiencing the highest survival and F2 hybrids the lowest. Contemporary-generation hybrids had similar survival to that of F2 families, contrary to our expectation that 20 generations of selection in the wild would eliminate unfit genotypes and increase survival. Hybrid survival clearly exhibited effects of epistasis, whereas size and growth showed mostly additive genetic variance, and time to metamorphosis showed substantial dominance. Conclusions Based on first- and second- generation cross types, our results suggest that the initial barrier to gene flow between these two species was relatively weak, and subsequent evolution has been generally slow. The persistence of low-viability recombinant hybrid genotypes in some contemporary populations illustrates that while hybridization can provide a potent source of genetic variation upon which natural selection can act, the sorting of fit from unfit gene combinations might be inefficient in highly admixed populations. Spatio-temporal fluctuation in selection or complex genetics has perhaps stalled adaptive evolution in this system despite selection for admixed genotypes within

  10. Spring Recipes A Problem-solution Approach

    CERN Document Server

    Long, Josh; Mak, Gary

    2010-01-01

    With over 3 Million users/developers, Spring Framework is the leading "out of the box" Java framework. Spring addresses and offers simple solutions for most aspects of your Java/Java EE application development, and guides you to use industry best practices to design and implement your applications. The release of Spring Framework 3 has ushered in many improvements and new features. Spring Recipes: A Problem-Solution Approach, Second Edition continues upon the bestselling success of the previous edition but focuses on the latest Spring 3 features for building enterprise Java applications.

  11. Evolution of ossification sequences in salamanders and urodele origins assessed through event-pairing and new methods.

    Science.gov (United States)

    Germain, Damien; Laurin, Michel

    2009-01-01

    Ossification sequences of the skull in extant Urodela and in Permo-Carboniferous Branchiosauridae have already been used to study the origin of lissamphibians. But most of these studies did not consider some recent methods developed to analyze the developmental sequences within a phylogenetic framework. Here, we analyze the ossification sequences of 24 cranial bones of 23 extant species of salamanders using the event-pairing method. This reveals new developmental synapomorphies for several extant salamander taxa and ancestral sequences for Urodela under four alternative reference phylogenies. An analysis with the 12 bones for which ossification sequence data are available in urodeles and in the branchiosaurid Apateon is also performed in order to compare the ancestral condition of the crown-group of Urodela to the sequence of Apateon. This reveals far more incompatibilities than previously suggested. The similarities observed between some extant salamanders and branchiosaurids may result from extensive homoplasy, as the extreme variation observed in extant Urodela suggests, or be plesiomorphic, as the conservation of some ossification patterns observed in other remotely related vertebrates like actinopterygians suggests. We propose a new, simpler method based on squared-change optimization to estimate the relative timing of ossification of various bones of hypothetical ancestors, and use independent-contrasts analysis to estimate the confidence intervals around these times. Our results show that the uncertainty of the ancestral ossification sequence of Urodela is much greater than event-pairing suggests. The developmental data do not allow to conclude that branchiosaurids are closely related to salamanders and their limited taxonomic distribution in Paleozoic taxa precludes testing hypotheses about lissamphibian origins. This is true regardless of the analytical method used (event-pairing or our new method based on squared-change parsimony). Simulations show that

  12. CACTUS SPRING ROADLESS AREA, CALIFORNIA.

    Science.gov (United States)

    Matti, Jonathan C.; Kuizon, Lucia

    1984-01-01

    Geologic, geochemical, and geophysical studies together with a review of historic mining and prospecting activities indicate that the Cactus Spring Roadless Area in California has little promise for the occurrence of mineral or energy resources. Marble bodies occur in the northern part of the roadless area and are possible resources for building stone, crushed and quarried aggregate, and lime and magnesium for Portland cement and industrial applications. It is recommended that the terrane of marble be mapped and sampled carefully in order to evaluate the quantity and quality of the carbonate resources.

  13. Ontogenetic convergence and evolution of foot morphology in European cave salamanders (Family: Plethodontidae

    Directory of Open Access Journals (Sweden)

    Nistri Annamaria

    2010-07-01

    Full Text Available Abstract Background A major goal in evolutionary biology is to understand the evolution of phenotypic diversity. Both natural and sexual selection play a large role in generating phenotypic adaptations, with biomechanical requirements and developmental mechanisms mediating patterns of phenotypic evolution. For many traits, the relative importance of selective and developmental components remains understudied. Results We investigated ontogenetic trajectories of foot morphology in the eight species of European plethodontid cave salamander to test the hypothesis that adult foot morphology was adapted for climbing. Using geometric morphometrics and other approaches, we found that developmental patterns in five species displayed little morphological change during growth (isometry, where the extensive interdigital webbing in adults was best explained as the retention of the juvenile morphological state. By contrast, three species exhibited significant allometry, with an increase in interdigital webbing during growth. Phylogenetic analyses revealed that multiple evolutionary transitions between isometry and allometry of foot webbing have occurred in this lineage. Allometric parameters of foot growth were most similar to those of a tropical species previously shown to be adapted for climbing. Finally, interspecific variation in adult foot morphology was significantly reduced as compared to variation among juveniles, indicating that ontogenetic convergence had resulted in a common adult foot morphology across species. Conclusions The results presented here provide evidence of a complex history of phenotypic evolution in this clade. The common adult phenotype exhibited among species reveals that selection plays an important part in generating patterns of foot diversity in the group. However, developmental trajectories arriving at this common morphology are distinct; with some species displaying developmental stasis (isometry, while others show an increase

  14. Dynamics and thermal sensitivity of ballistic and non-ballistic feeding in salamanders.

    Science.gov (United States)

    Deban, Stephen M; Scales, Jeffrey A

    2016-02-01

    Low temperature reduces the performance of muscle-powered movements, but in movements powered by elastic recoil mechanisms, this effect can be mitigated and performance can be increased. To better understand the morphological basis of high performance and thermal robustness of elastically powered movements, we compared feeding dynamics at a range of temperatures (5-25°C) in two species of terrestrial plethodontid salamanders, Plethodon metcalfi and Ensatina eschscholtzii, which differ in tongue muscle architecture and the mechanism of tongue projection. We found that Ensatina is capable of ballistic projection with a mean muscle mass-specific power of 2100 W kg(-1), revealing an elastic mechanism. Plethodon, in contrast, projected its tongue non-ballistically with a mean power of only 18 W kg(-1), indicating it is muscle powered. Ensatina projected its tongue significantly farther than Plethodon and with dynamics that had significantly lower thermal sensitivity at temperatures below 15°C. These performance differences were correlated with morphological differences, namely elongated collagenous aponeuroses in the projector muscle of Ensatina as compared with Plethodon, which are likely the site of energy storage, and the absence in Ensatina of projector muscle fibers attaching to the tongue skeleton that allows projection to be truly ballistic. These findings demonstrate that, in these otherwise similar species, the presence in one species of elaborated connective tissue in series with myofibers confers not only 10-fold greater absolute performance but also greater thermal robustness of performance. We conclude that changes in muscle and connective tissue architecture are sufficient to alter significantly the mechanics, performance and thermal robustness of musculoskeletal systems.

  15. Understanding positional cues in salamander limb regeneration: implications for optimizing cell-based regenerative therapies

    Directory of Open Access Journals (Sweden)

    Catherine D. McCusker

    2014-06-01

    Full Text Available Regenerative medicine has reached the point where we are performing clinical trials with stem-cell-derived cell populations in an effort to treat numerous human pathologies. However, many of these efforts have been challenged by the inability of the engrafted populations to properly integrate into the host environment to make a functional biological unit. It is apparent that we must understand the basic biology of tissue integration in order to apply these principles to the development of regenerative therapies in humans. Studying tissue integration in model organisms, where the process of integration between the newly regenerated tissues and the ‘old’ existing structures can be observed and manipulated, can provide valuable insights. Embryonic and adult cells have a memory of their original position, and this positional information can modify surrounding tissues and drive the formation of new structures. In this Review, we discuss the positional interactions that control the ability of grafted cells to integrate into existing tissues during the process of salamander limb regeneration, and discuss how these insights could explain the integration defects observed in current cell-based regenerative therapies. Additionally, we describe potential molecular tools that can be used to manipulate the positional information in grafted cell populations, and to promote the communication of positional cues in the host environment to facilitate the integration of engrafted cells. Lastly, we explain how studying positional information in current cell-based therapies and in regenerating limbs could provide key insights to improve the integration of cell-based regenerative therapies in the future.

  16. A comparative study of gland cells implicated in the nerve dependence of salamander limb regeneration.

    Science.gov (United States)

    Kumar, Anoop; Nevill, Graham; Brockes, Jeremy P; Forge, Andrew

    2010-07-01

    Limb regeneration in salamanders proceeds by formation of the blastema, a mound of proliferating mesenchymal cells surrounded by a wound epithelium. Regeneration by the blastema depends on the presence of regenerating nerves and in earlier work it was shown that axons upregulate the expression of newt anterior gradient (nAG) protein first in Schwann cells of the nerve sheath and second in dermal glands underlying the wound epidermis. The expression of nAG protein after plasmid electroporation was shown to rescue a denervated newt blastema and allow regeneration to the digit stage. We have examined the dermal glands by scanning and transmission electron microscopy combined with immunogold labelling of the nAG protein. It is expressed in secretory granules of ductless glands, which apparently discharge by a holocrine mechanism. No external ducts were observed in the wound epithelium of the newt and axolotl. The larval skin of the axolotl has dermal glands but these are absent under the wound epithelium. The nerve sheath was stained post-amputation in innervated but not denervated blastemas with an antibody to axolotl anterior gradient protein. This antibody reacted with axolotl Leydig cells in the wound epithelium and normal epidermis. Staining was markedly decreased in the wound epithelium after denervation but not in the epidermis. Therefore, in both newt and axolotl the regenerating axons induce nAG protein in the nerve sheath and subsequently the protein is expressed by gland cells, under (newt) or within (axolotl) the wound epithelium, which discharge by a holocrine mechanism. These findings serve to unify the nerve dependence of limb regeneration.

  17. The influence of a water current on the larval deposition pattern of females of a diverging fire salamander population (Salamandra salamandra)

    NARCIS (Netherlands)

    Krause, E.T.; Caspers, B.A.

    2015-01-01

    Fire salamanders are amphibians that exhibit a highly specific reproductive mode termed ovo-viviparity. The eggs develop inside their mothers, and the females give birth to fully developed larvae. The larvae in our study area cluster in two distinct genetic groups that can be linked directly to the

  18. 3D bite modeling and feeding mechanics of the largest living amphibian, the Chinese giant salamander Andrias davidianus (Amphibia:Urodela.

    Directory of Open Access Journals (Sweden)

    Josep Fortuny

    Full Text Available Biting is an integral feature of the feeding mechanism for aquatic and terrestrial salamanders to capture, fix or immobilize elusive or struggling prey. However, little information is available on how it works and the functional implications of this biting system in amphibians although such approaches might be essential to understand feeding systems performed by early tetrapods. Herein, the skull biomechanics of the Chinese giant salamander, Andrias davidianus is investigated using 3D finite element analysis. The results reveal that the prey contact position is crucial for the structural performance of the skull, which is probably related to the lack of a bony bridge between the posterior end of the maxilla and the anterior quadrato-squamosal region. Giant salamanders perform asymmetrical strikes. These strikes are unusual and specialized behavior but might indeed be beneficial in such sit-and-wait or ambush-predators to capture laterally approaching prey. However, once captured by an asymmetrical strike, large, elusive and struggling prey have to be brought to the anterior jaw region to be subdued by a strong bite. Given their basal position within extant salamanders and their "conservative" morphology, cryptobranchids may be useful models to reconstruct the feeding ecology and biomechanics of different members of early tetrapods and amphibians, with similar osteological and myological constraints.

  19. 3D bite modeling and feeding mechanics of the largest living amphibian, the Chinese giant salamander Andrias davidianus (Amphibia:Urodela).

    Science.gov (United States)

    Fortuny, Josep; Marcé-Nogué, Jordi; Heiss, Egon; Sanchez, Montserrat; Gil, Lluis; Galobart, Àngel

    2015-01-01

    Biting is an integral feature of the feeding mechanism for aquatic and terrestrial salamanders to capture, fix or immobilize elusive or struggling prey. However, little information is available on how it works and the functional implications of this biting system in amphibians although such approaches might be essential to understand feeding systems performed by early tetrapods. Herein, the skull biomechanics of the Chinese giant salamander, Andrias davidianus is investigated using 3D finite element analysis. The results reveal that the prey contact position is crucial for the structural performance of the skull, which is probably related to the lack of a bony bridge between the posterior end of the maxilla and the anterior quadrato-squamosal region. Giant salamanders perform asymmetrical strikes. These strikes are unusual and specialized behavior but might indeed be beneficial in such sit-and-wait or ambush-predators to capture laterally approaching prey. However, once captured by an asymmetrical strike, large, elusive and struggling prey have to be brought to the anterior jaw region to be subdued by a strong bite. Given their basal position within extant salamanders and their "conservative" morphology, cryptobranchids may be useful models to reconstruct the feeding ecology and biomechanics of different members of early tetrapods and amphibians, with similar osteological and myological constraints.

  20. Slightly thermal springs and non-thermal springs at Mount Shasta, California: Chemistry and recharge elevations

    Science.gov (United States)

    Nathenson, M.; Thompson, J.M.; White, L.D.

    2003-01-01

    Temperature measurements, isotopic contents, and dissolved constituents are presented for springs at Mount Shasta to understand slightly thermal springs in the Shasta Valley based on the characteristics of non-thermal springs. Non-thermal springs on Mount Shasta are generally cooler than mean annual air temperatures for their elevation. The specific conductance of non-thermal springs increases linearly with discharge temperature. Springs at higher and intermediate elevations on Mount Shasta have fairly limited circulation paths, whereas low-elevation springs have longer paths because of their higher-elevation recharge. Springs in the Shasta Valley are warmer than air temperatures for their elevation and contain significant amounts of chloride and sulfate, constituents often associated with volcanic hydrothermal systems. Data for the Shasta Valley springs generally define mixing trends for dissolved constituents and temperature. The isotopic composition of the Shasta Valley springs indicates that water fell as precipitation at a higher elevation than any of the non-thermal springs. It is possible that the Shasta Valley springs include a component of the outflow from a proposed 210??C hydrothermal system that boils to supply steam for the summit acid-sulfate spring. In order to categorize springs such as those in the Shasta Valley, we introduce the term slightly thermal springs for springs that do not meet the numerical criterion of 10??C above air temperature for thermal springs but have temperatures greater than non-thermal springs in the area and usually also have dissolved constituents normally found in thermal waters. ?? 2002 Elsevier Science B.V. All rights reserved.

  1. Two-eyed versus one-eyed salamanders: does binocularity enhance the optically evoked skin blanching reactions of Ambystoma larvae?

    Science.gov (United States)

    Pietsch, P; Schneider, C W

    1990-08-01

    A wide variety of visual functions show increases attributable to binocularity, and the question pursued here was whether a second eye enhances the visually stimulated skin blanching reaction of the larval salamander. Dermal melanin spots (produced by the aggregations of melanosomes within dermal melanophores and which contract or expand to lighten or darken the skin) were measured in eyeless (controls), one-eyed and two-eyed Ambystoma punctatum larvae after chronic adaptation of the subjects to a white background (i.e., stimulus conditions for maximum blanching). The eyeless subjects showed no blanching (thus remained dark) in white cups, and they exhibited melanin spots 7 or 8 times the size of those of the other two groups. All one-eyed or two-eyed subjects exhibited blanching reactions; planometric comparison revealed a significantly larger melanin spot area for one-eyed than for two-eyed animals; i.e., the binocular condition permitted greater contraction of the pigment spots than did the monocular condition. Analytical data compared favorably with independently ascertained pigmentation indices. The results indicate that a second eye quantitatively elevates the blanching maximum of a larval salamander.

  2. Proteomic analysis of the skin from Chinese fire-bellied newt and comparison to Chinese giant salamander.

    Science.gov (United States)

    Sun, Jingyan; Geng, Xiaofang; Guo, Jianlin; Zang, Xiayan; Li, Pengfei; Li, Deming; Xu, Cunshuan

    2016-09-01

    Animal skin that directly interfaces with the external environment has developed diverse adaptive functions to a variety of ecological conditions laden with pathogenic infection and physical harm. Amphibians exhibit various adaptations related to their "incomplete" shift from the aquatic to the terrestrial habitat. Therefore, it is very necessary to explore the molecular basis of skin function and adaptation in amphibians. Currently, the studies on the molecular mechanisms of skin functions in anuran amphibians have been reported, but in urodele amphibians are rare. This study identified the skin proteomes of Chinese fire-bellied newt Cynops orientalis by a proteomic method, and compared the results to the skin proteomes of Chinese giant salamander Andrias davidianus obtained previously. A total of 452 proteins were identified in the newt skin by MALDI-TOF/MS, and functional annotation results by DAVID analysis showed that special functions such as wound healing, immune response, defense and respiration, were significantly enriched. Comparison results showed that the two species had a great difference in the aspects of protein kinds and abundance, and the highly expressed proteins may tightly correlate with living conditions. Moreover, the newt skin might have stronger immunity, but weaker respiration than the giant salamander skin to adapt to various living environments. This research provides a molecular basis for further studies on amphibian skin function and adaptation.

  3. A 3D Musculo-Mechanical Model of the Salamander for the Study of Different Gaits and Modes of Locomotion.

    Science.gov (United States)

    Harischandra, Nalin; Cabelguen, Jean-Marie; Ekeberg, Orjan

    2010-01-01

    Computer simulation has been used to investigate several aspects of locomotion in salamanders. Here we introduce a three-dimensional forward dynamics mechanical model of a salamander, with physically realistic weight and size parameters. Movements of the four limbs and of the trunk and tail are generated by sets of linearly modeled skeletal muscles. In this study, activation of these muscles were driven by prescribed neural output patterns. The model was successfully used to mimic locomotion on level ground and in water. We compare the walking gait where a wave of activity in the axial muscles travels between the girdles, with the trotting gait in simulations using the musculo-mechanical model. In a separate experiment, the model is used to compare different strategies for turning while stepping; either by bending the trunk or by using side-stepping in the front legs. We found that for turning, the use of side-stepping alone or in combination with trunk bending, was more effective than the use of trunk bending alone. We conclude that the musculo-mechanical model described here together with a proper neural controller is useful for neuro-physiological experiments in silico.

  4. Effects of atrazine on egg masses of the yellow-spotted salamander (Ambystoma maculatum) and its endosymbiotic alga (Oophila amblystomatis).

    Science.gov (United States)

    Baxter, Leilan; Brain, Richard A; Hosmer, Alan J; Nema, Mohini; Müller, Kirsten M; Solomon, Keith R; Hanson, Mark L

    2015-11-01

    Embryonic growth of the yellow-spotted salamander (Ambystoma maculatum) is enhanced by the presence of the green alga Oophila amblystomatis, in the egg capsule. To further assess potential impacts of herbicides on this relationship, A. maculatum egg masses were exposed to atrazine (0-338 μg/L) until hatching (up to 66 days). Exposure to atrazine reduced PSII yield of the symbiotic algae in a concentration-dependent manner, but did not significantly affect visible algal growth or any metrics associated with salamander development. Algal cells were also cultured in the laboratory for toxicity testing. In the 96-h growth inhibition test (0-680 μg/L), ECx values were generally greater than those reported for standard algal test species. Complete recovery of growth rates occurred within 96-h of transferring cells to untreated media. Overall, development of A. maculatum embryos was not affected by exposure to atrazine at concentrations and durations exceeding those found in the environment.

  5. Genetic structure and diversity in an isolated population of an endemic mole salamander (Ambystoma rivulare Taylor, 1940) of central Mexico.

    Science.gov (United States)

    Heredia-Bobadilla, Rosa-Laura; Monroy-Vilchis, Octavio; Zarco-González, Martha M; Martínez-Gómez, Daniel; Mendoza-Martínez, Germán David; Sunny, Armando

    2016-12-01

    Human activities are affecting the distribution of species worldwide by causing fragmentation and isolation of populations. Isolation and fragmentation lead to populations with lower genetic variability and an increased chance of inbreeding and genetic drift, which results in a loss of biological fitness over time. Studies of the genetic structure of small and isolated populations are critically important for management and conservation decisions. Ambystoma rivulare is a micro-endemic Mexican mole salamander from central Mexico. It is found in the most ecologically disturbed region in Mexico, the Trans-Mexican Volcanic Belt. The goal of this study of the population genetics of the micro-endemic mole salamander was to provide information to be used as a basis for future research and conservation planning of this species and other species of the Ambystoma genus in Mexico. The structural analysis found two subpopulations, one for each river sampled, with no signs of admixture and very high levels of genetic differentiation. Medium to high levels of heterozygosity and few alleles and genotypes were observed. Evidence of an ancestral genetic bottleneck, low values of effective population size, small inbreeding coefficients, and low gene flow were also found.

  6. A 3D musculo-mechanical model of the salamander for the study of different gaits and modes of locomotion

    Directory of Open Access Journals (Sweden)

    Nalin eHarischandra

    2010-12-01

    Full Text Available Computer simulation has been used to investigate several aspectsof locomotion in salamanders. Here we introduce a three-dimensionalforward dynamics mechanical model of a salamander, with physicallyrealistic weight and size parameters. Movements of the four limbs and ofthe trunk and tail are generated by sets of linearly modeled skeletalmuscles. In this study, activation of these muscles were driven byprescribed neural output patterns. The model was successfully used tomimic locomotion on level ground and in water. We compare thewalking gait where a wave of activity in the axial muscles travelsbetween the girdles, with the trotting gait in simulations usingthe musculo-mechanical model. In a separate experiment, the model is usedto compare different strategies for turning while stepping; either bybending the trunk or by using side-stepping in the front legs. We foundthat for turning, the use of side-stepping alone or in combination withtrunk bending, was more effective than the use of trunk bending alone. Weconclude that the musculo-mechanical model described here together with aproper neural controller is useful for neuro-physiological experiments insilico.

  7. Ecological associations and genetic divergence in Black-bellied Salamanders (Desmognathus quadramaculatus of the Southern Appalachian Mountains

    Directory of Open Access Journals (Sweden)

    Jessica Wooten

    2011-12-01

    Full Text Available The discovery and subsequent description of cryptic biodiversity is often challenging, especially for groups that have undergone rapid lineage accumulation in the relatively recent past. Even without formal descriptions, understanding genetic diversity patterns as they relate to underlying ecological or historical processes can be important for conservation. The dusky salamanders of the genus Desmognathus, with 20 described species, comprise the second largest genus of plethodontid salamanders in the eastern United States. However, due to the presence of high genetic diversity and relatively few morphological synapomorphies, the number of species is likely to increase. For the three nominal species within the D. quadramaculatus species complex, including D. quadramaculatus, D. folkertsi, and D. marmoratus, we used a portion of the mitochondrial genome and nuclear markers in the form of amplified fragment length polymorphisms (AFLP to uncover spatial patterns of genetic diversity. Within D. quadramaculatus and D. marmoratus, we uncovered four well-supported lineages with the mitochondrial sequences; phylogeographic patterns were not congruent with the AFLP data. Both sets of markers identified a clear isolation by stream distance. Using multiple regressions, we found that historical river drainages and terrestrial ecoregions explained the phylogeographic patterning we observed for D. quadramaculatus.

  8. Diet of larval Ambystoma rivulare (Caudata: Ambystomatidae, a threatened salamander from the Volcán Nevado de Toluca, Mexico

    Directory of Open Access Journals (Sweden)

    Julio A. Lemos-Espinal

    2015-06-01

    Full Text Available Several species of salamander in the genus Ambystoma occur in the mountains surrounding Mexico City and are considered at risk of extinction. However, little is known about their ecology and natural history. The Toluca Stream Siredon (Ambystoma rivulare is classified as “Data Deficient” by the IUCN, and considered “Threatened” under Mexican law. From October 2013 to September 2014, we examined the diet of larval A. rivulare from a stream on the Volcán Nevado de Toluca in Mexico to provide insight into the suitability of the habitat to support this population of salamanders. Ostracods accounted for approximately 90% of all prey items consumed by larval A. rivulare. The number of ostracods found in stomachs increased with individual body size, but the proportion of ostracods in stomachs did not vary with body size. Nematodes were observed in approximately one third of the stomachs we examined. The diversity of prey in the diet of A. rivulare in the stream we studied is low and dominated by a single prey taxon, ostracods. Our results suggest that if environmental conditions in the stream change such that ostracods are negatively affected then the long-term persistence of this population of A. rivulare might be in jeopardy.

  9. Functional convergence of signalling by GPI-anchored and anchorless forms of a salamander protein implicated in limb regeneration.

    Science.gov (United States)

    Blassberg, Robert A; Garza-Garcia, Acely; Janmohamed, Azara; Gates, Phillip B; Brockes, Jeremy P

    2011-01-01

    The GPI-anchor is an established determinant of molecular localisation and various functional roles have been attributed to it. The newt GPI-anchored three-finger protein (TFP) Prod1 is an important regulator of cell behaviour during limb regeneration, but it is unclear how it signals to the interior of the cell. Prod1 was expressed by transfection in cultured newt limb cells and activated transcription and expression of matrix metalloproteinase 9 (MMP9) by a pathway involving ligand-independent activation of epidermal growth factor receptor (EGFR) signalling and phosphorylation of extracellular regulated kinase 1 and 2 (ERK1/2). This was dependent on the presence of the GPI-anchor and critical residues in the α-helical region of the protein. Interestingly, Prod1 in the axolotl, a salamander species that also regenerates its limbs, was shown to activate ERK1/2 signalling and MMP9 transcription despite being anchorless, and both newt and axolotl Prod1 co-immunoprecipitated with the newt EGFR after transfection. The substitution of the axolotl helical region activated a secreted, anchorless version of the newt molecule. The activity of the newt molecule cannot therefore depend on a unique property conferred by the anchor. Prod1 is a salamander-specific TFP and its interaction with the phylogenetically conserved EGFR has implications for our view of regeneration as an evolutionary variable.

  10. Lead-phase and red-stripe color morphs of red-backed salamanders Plethodon cinereus differ in hematological stress indices: A consequence of differential predation pressure?

    Directory of Open Access Journals (Sweden)

    Andrew K. DAVIS, Joseph R. MILANOVICH

    2010-04-01

    Full Text Available Throughout the animal kingdom there are species that have two or more phenotypic forms or ‘morphs’, and many of these are amphibians. In North America, the red-backed salamander Plethodon cinereus can have either a red dorsal stripe or no dorsal stripe (lead-phase form, and evidence to date indicates the lead-phase form incurs a greater number of attacks from predators. In a recent collection of 51 P. cinereus, blood smears of both color morphs (35 red-stripe, 16 lead-phase were examined to obtain numbers of circulating leukocytes (via light microscopy, which can be used to indirectly estimate levels of stress hormones in vertebrates via a ‘hematological stress index’, which is the ratio between the number of two leukocyte types (neutrophils and lymphocytes. Our results showed that lead-phase salamanders tended to have greater numbers of circulating neutrophils and lower numbers of circulating lymphocytes than red-stripe morphs, leading to higher average neutrophil-lymphocyte ratios in lead-phase individuals. Since the salamanders were held (refrigerated for 7 days before sampling, we cannot be certain if this effect is a stress reaction to the captivity or the normal level for this morph. However comparison with two sets of related salamanders that were captured and sampled immediately indicates the red-stripe salamanders were either not stressed from the captivity at all, or their white blood cell distributions had returned to normal after 7 days of captivity. Taken together, our results indicate that lead-phase forms of P. cinereus have higher stress levels than the red-stripe forms, which may be a consequence of their higher exposure to, and/or attacks from, predators. They may also indicate that the lead-phase form is less-suited to captivity than the red-stripe form of this species [Current Zoology 56 (2: 238–243, 2010].

  11. Physical Condition, Sex, and Age-Class of Eastern Red-Backed Salamanders (Plethodon cinereus in Forested and Open Habitats of West Virginia, USA

    Directory of Open Access Journals (Sweden)

    Breanna L. Riedel

    2012-01-01

    Full Text Available Nonforested habitats such as open fields and pastures have been considered unsuitable for desiccation-prone woodland salamanders such as the Eastern Red-backed Salamander (Plethodon cinereus. Recent research has suggested that Plethodon cinereus may not only disperse across but also reside within open habitats including fields, meadows, and pastures. However, presence and high densities of P. cinereus within agriculturally disturbed habitats may be misleading if these populations exhibit atypical demographic characteristics or decreased physical condition relative to forest populations. We surveyed artificial cover boards from 2004-2005 to compare physical condition, sex ratios, and age-class structure of P. cinereus among woodland, woodland-meadow edge, silvopasture, and meadow sites in the central Appalachian Mountains of southern West Virginia. Physical condition of salamanders was not significantly different among the four habitats. Furthermore, adult sex ratios of P. cinereus typically were not significantly different from 1 : 1 and were similar between forested and non-forested sites, although populations within silvopastures were biased towards females. However, adult salamanders were significantly more abundant than juveniles in all habitat types, with differences most pronounced within meadow habitats. Our study indicates that relatively small, non-forested habitats such as silvopastures and meadows may not adversely affect the overall physical condition or sex ratios of Plethodon cinereus. However, the paucity of juveniles within disturbed meadows indicates that these agriculturally modified habitats may negatively impact reproduction or that immature salamanders are at a physiological or competitive disadvantage in comparison to adults, particularly when surface cover is limited.

  12. Running springs: speed and animal size.

    Science.gov (United States)

    Farley, C T; Glasheen, J; McMahon, T A

    1993-12-01

    Trotting and hopping animals use muscles, tendons and ligaments to store and return elastic energy as they bounce along the ground. We examine how the musculoskeletal spring system operates at different speeds and in animals of different sizes. We model trotting and hopping as a simple spring-mass system which consists of a leg spring and a mass. We find that the stiffness of the leg spring (k(leg)) is nearly independent of speed in dogs, goats, horses and red kangaroos. As these animals trot or hop faster, the leg spring sweeps a greater angle during the stance phase, and the vertical excursion of the center of mass during the ground contact phase decreases. The combination of these changes to the spring system causes animals to bounce off the ground more quickly at higher speeds. Analysis of a wide size range of animals (0.1-140 kg) at equivalent speeds reveals that larger animals have stiffer leg springs (k(leg) [symbol: see text] M0.67, where M is body mass), but that the angle swept by the leg spring is nearly independent of body mass. As a result, the resonant period of vertical vibration of the spring-mass system is longer in larger animals. The length of time that the feet are in contact with the ground increases with body mass in nearly the same way as the resonant period of vertical vibration.

  13. Allegory and Event: Two ways of saying the salamander in Yves Bonnefoy

    Directory of Open Access Journals (Sweden)

    Layla Roesler

    2010-07-01

    Full Text Available L’article examine l’idée d’événement à travers la figure de la salamandre dans l’œuvre d’Yves Bonnefoy. L’image, saisissante en elle-même, est rendue plus significative encore par le fait qu’elle franchit les frontières séparant habituellement les genres littéraires. Son apparition à la fois dans un essai et dans un cycle de poèmes tend à l’ancrer dans la réalité d’un événement vécu. Nous proposons de voir dans la juxtaposition des deux textes non seulement une narration qui prend l’événement vécu en charge, mais l’agencement même des possibilités permettant de reconnaître l’événement comme tel.This paper addresses the notion of event through the prism of Yves Bonnefoy’s salamander trope. This arresting image is all the more memorable because it crosses the boundaries of generic separations, appearing both in an essay as well as in an early poetry collection. The fact that an identical image should be reiterated in such formally disparate structures seems to point insistently to its reality as a material event. I argue that juxtaposing the two texts reveals both a narration recounting an event and, simultaneously, the ordering of possibilities leading to its recognition as event.El artículo examina la idea del acontecimiento a través de la figura de la salamandra en la obra de Yves Bonnefoy. La imagen, sorprendente en sí misma, se vuelve más significativa aún debido al hecho de que cruza las fronteras que separan generalmente los géneros literarios. Su presencia tanto en un ensayo como en un ciclo de poemas tiende a situarla en la realidad de un acontecimiento vivido. En la yuxtaposición de los dos textos proponemos ver no sólo una narración que asume el acontecimiento vivido, sino también la disposición misma de las posibilidades que permiten reconocer al acontecimiento como tal.

  14. Joystick With Cable Springs Offers Better Feel

    Science.gov (United States)

    Kerley, James; Ecklund, Wayne

    1992-01-01

    Improved joystick allows motion in 6 degrees of freedom, biased toward central position and orientation by 16 segments of cable serving as springs. Improvement in feel and control results from nonlinear compliance of cable-spring assembly. Nonlinear variations accommodate natural reactions of hand and brain. Operator functions as part of feedback control loop. More comfortable, increases ability to exert control and reduces fatigue.

  15. Rocky Mountain Carbonate Spring Deposit development

    Science.gov (United States)

    Rainey, Dustin Kyle

    Relict Holocene carbonate spring deposits containing diverse biotic and abiotic depositional textures are present at Fall Creek cold sulphur springs, Alberta, Fairmont Hot Springs, British Columbia, and Hot Creek cold springs, British Columbia. The relict deposits are formed mainly of low-magnesium crystalline calcite contained in laterally continuous strata. Paleo-flow regimes were characterized by extensive sheet flow that increased the surface area of spring water exposed to the atmosphere. Calcite precipitated inorganically from spring water that attained CaCO3 supersaturation through agitation-induced CO2 degassing that was facilitated by elevated flow rates and a large surface area as spring water flowed down-slope. Thus, the deposits contain only minor amounts of detrital, mechanically deposited, and biogenic carbonate. Evaporation was only a minor contributor to CaCO3 supersaturation, mainly in quiescent environments. Photosynthetic CO2 removal did not measurably contribute to CaCO3 supersaturation. Calcite crystals precipitated in biotic facies formed from low to moderately supersaturated spring water, whereas abiotic dendrite crystals formed rapidly from highly supersaturated spring water. Calcite passively nucleated on cyanobacteria, bryophytes and macrophytes, and was probably facilitated by cyanobacterial extracellular polymeric substances. Cyanobacterial filaments and stromatolites are integral parts of all three deposits, whereas bryophytes were restricted to the Fall Creek and Hot Creek deposits. Diagenetic microbial degradation of crystalline calcite was common to all three deposits, but recrystallization was limited to the Fall Creek deposit. The amount and location of calcite precipitation relative to the vents was controlled by the concentrations of Ca2+ and HCO3- in solution, and discharge volume fluctuations. Spring water with high [Ca2+] and [HCO 3-] precipitated large amounts of calcite proximal to the vents (e.g. Fairmont), whereas spring

  16. Distribution map of hot springs in Japan

    Energy Technology Data Exchange (ETDEWEB)

    Sumi, K.

    1975-01-01

    This map (scale 1:2,000,000) provides the distribution and locations of hot springs in Japan. A hot spring is defined as hot water, mineral water, vapor or other gases (excluding natural gases containing hydrocarbons as the major component) issuing from underground at a temperature of 25/sup 0/C or higher and/or containing substances listed on the map in specific concentrations. Springs are classified according to their chemical composition. Each class of spring is assigned one of five different symbols (per class) according to its temperature. Where appropriate, the geologic age of the spring location is identified. A comprehensive place name index is provided in both Japanese and English transliteration. The map is also isothermically graduated in HFU and references are given for descriptive textual materials that may be used as supplements.

  17. 酶解法提取大鲵尾部油的工艺研究%Enzymatic extraction of oil from the tail of Giant Salamander

    Institute of Scientific and Technical Information of China (English)

    王苗苗; 罗庆华; 王海磊; 宋英杰; 王建文; 向建国

    2015-01-01

    The oil was extracted from the tail adipose tissue of Giant Salamander by enzymatic hydrolysis method so as to seek a new way for the utilization of Chinese Giant Salamander resource. Then the physi-cochemical properties and fatty acid composition of Giant Salamander tail oil were analyzed. The results showed that the optimal enzymatic extraction conditions of Giant Salamander tail oil were obtained as fol-lows:dosage of enzyme 0. 3%,ratio of solid to liquid 1∶1. 0, enzymolysis time 1. 0 h,enzymolysis temper-ature 60℃,pH 6. 5. Under the optimal conditions, the extraction rate was 98. 53%. The Giant Salaman-der tail oil extracted reached the first grade standard of crude fish oil ( SC/T 3502—2000 ) . 17 kinds of fatty acids were detected from the Giant Salamander tail oil,and the contents of MUFA and PUFA were 49. 42% and 29. 35% respectively.%为寻求我国大鲵资源利用新途径,并建立大鲵尾部油的最佳提取方法及工艺,采用酶解法从大鲵尾部脂肪组织中提取大鲵尾部油,并对所得的大鲵尾部油进行理化性质及脂肪酸组成分析。结果表明,酶解法提取大鲵尾部油的最佳工艺条件为:酶添加量0.3%,料液比1∶1.0,酶解时间1.0 h,酶解温度60℃,pH 6.5;在最佳条件下,提取率为98.53%。所提的大鲵尾部油达到我国水产行业SC/T 3502—2000粗鱼油的一级标准。酶解法所提大鲵尾部油中检测出17种脂肪酸,单不饱和脂肪酸(MUFA)含量为49.42%,多不饱和脂肪酸(PUFA)含量为29.35%。

  18. Spring plant phenology and false springs in the conterminous US during the 21st century

    Science.gov (United States)

    Allstadt, Andrew J.; Vavrus, Stephen J.; Heglund, Patricia J.; Pidgeon, Anna M.; Thogmartin, Wayne E.; Radeloff, Volker C.

    2015-01-01

    The onset of spring plant growth has shifted earlier in the year over the past several decades due to rising global temperatures. Earlier spring onset may cause phenological mismatches between the availability of plant resources and dependent animals, and potentially lead to more false springs, when subsequent freezing temperatures damage new plant growth. We used the extended spring indices to project changes in spring onset, defined by leaf out and by first bloom, and predicted false springs until 2100 in the conterminous United States (US) using statistically-downscaled climate projections from the Coupled Model Intercomparison Project 5 ensemble. Averaged over our study region, the median shift in spring onset was 23 days earlier in the Representative Concentration Pathway 8.5 scenario with particularly large shifts in the Western US and the Great Plains. Spatial variation in phenology was due to the influence of short-term temperature changes around the time of spring onset versus season long accumulation of warm temperatures. False spring risk increased in the Great Plains and portions of the Midwest, but remained constant or decreased elsewhere. We conclude that global climate change may have complex and spatially variable effects on spring onset and false springs, making local predictions of change difficult.

  19. Genetic Algorithms Based Approach for Designing Spring Brake Orthosis – Part I: Spring Parameters

    Directory of Open Access Journals (Sweden)

    M. S. Huq

    2012-01-01

    Full Text Available Spring brake orthosis (SBO concentrates purely on the knee to generate the swing phase of the paraplegic gait with the required hip flexion occurring passively as a consequence of the ipsilateral knee flexion, generated by releasing the torsion spring mounted at the knee joint. Electrical stimulation then drives the knee back to full extension, as well as restores the spring potential energy. In this paper, genetic algorithm (GA and its variant multi-objective GA (MOGA is used to perform the search operation for the ‘best’ spring parameters for the SBO spring mounted on an average sized subject simulated in the sagittal plane. Conventional torsion spring is tested against constant torque type spring in terms of swing duration as, based on first principles, it is hypothesized that constant torque spring would be able to produce slower SBO swing phase as might be preferred in assisted paraplegic gait. In line with the hypothesis, it is found that it is not possible to delay the occurrence of the flexion peak of the SBO swing phase further than its occurrence in the natural gait. The use of conventional torsion spring causes the swing knee flexion peak to appear rather faster than that of the natural gait, resulting in a potentially faster swing phase and hence gait cycle. The constant torque type spring on the other hand is able to stretch duration of the swing phase to some extent, rendering it the preferable spring type in SBO.

  20. Recombinant nAG (a Salamander-Derived Protein Decreases the Formation of Hypertrophic Scarring in the Rabbit Ear Model

    Directory of Open Access Journals (Sweden)

    Mohammad M. Al-Qattan

    2014-01-01

    Full Text Available nAG (newt-Anterrior Gradient protein is the key mediator of regrowth of amputated limbs in salamanders. In a previous work in our lab, a new nAG gene (suitable for humans was designed and cloned. The cloned vector was transfected into primary human fibroblasts. The expression of nAG in human primary fibroblasts was found to suppress collagen expression. The current study shows that local injection of recombinant nAG reduces scar hypertrophy in the rabbit ear model. This is associated with lower scar elevation index (SEI, lower levels of collagen I & III, higher levels of MMP1, and a higher degree of scar maturation in experimental wounds compared to controls.

  1. diet composition of the salamander lyciasalamandra luschani basoglui on the greek island of kastellorizo in the southeast aegean sea

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    the diet composition of the lycian salamander lyciasalamandra luschani basoglui across both age and sex groups was studied.specimens were collected from a small island in the southeast aegean sea.the dominant prey group of juveniles consisted of collembola,while coleoptera dominated the diet of males and females.the number and size of prey items consumed by males and females of l.luschani basoglui were quite similar,while juveniles ate fewer items of much smaller size.the numerical abundance along with the four measures of the size of prey permitted discrimination among males,females and juveniles.although discrimination between adults and juveniles is expected due to dissimilarity in body size,discrimination between males and females remains inexplicable despite their similarity in body size.future studies should be focused on understanding how and why prey choice differs between sexes in l.luschani basoglui.

  2. Extensive diversification of MHC in Chinese giant salamanders Andrias davidianus (Anda-MHC) reveals novel splice variants.

    Science.gov (United States)

    Zhu, Rong; Chen, Zhong-yuan; Wang, Jun; Yuan, Jiang-di; Liao, Xiang-yong; Gui, Jian-Fang; Zhang, Qi-Ya

    2014-02-01

    A series of MHC alleles (including 26 class IA, 27 class IIA, and 17 class IIB) were identified from Chinese giant salamander Andrias davidianus (Anda-MHC). These genes are similar to classical MHC molecules in terms of characteristic domains, functional residues, deduced tertiary structures and genetic diversity. The majority of variation between alleles is found in the putative peptide-binding region (PBR), which is driven by positive Darwinian selection. The coexistence of two isoforms in MHC IA, IIA, and IIB alleles are shown: one full-length transcript and one novel splice variant. Despite lake of the external domains, these variants exhibit similar subcellular localization with the full-length transcripts. Moreover, the expression of MHC isoforms are up-regulated upon in vivo and in vitro stimulation with Andrias davidianus ranavirus (ADRV), suggesting their potential roles in the immune response. The results provide insights into understanding MHC variation and function in this ancient and endangered urodele amphibian.

  3. Weldon Spring historical dose estimate

    Energy Technology Data Exchange (ETDEWEB)

    Meshkov, N.; Benioff, P.; Wang, J.; Yuan, Y.

    1986-07-01

    This study was conducted to determine the estimated radiation doses that individuals in five nearby population groups and the general population in the surrounding area may have received as a consequence of activities at a uranium processing plant in Weldon Spring, Missouri. The study is retrospective and encompasses plant operations (1957-1966), cleanup (1967-1969), and maintenance (1969-1982). The dose estimates for members of the nearby population groups are as follows. Of the three periods considered, the largest doses to the general population in the surrounding area would have occurred during the plant operations period (1957-1966). Dose estimates for the cleanup (1967-1969) and maintenance (1969-1982) periods are negligible in comparison. Based on the monitoring data, if there was a person residing continually in a dwelling 1.2 km (0.75 mi) north of the plant, this person is estimated to have received an average of about 96 mrem/yr (ranging from 50 to 160 mrem/yr) above background during plant operations, whereas the dose to a nearby resident during later years is estimated to have been about 0.4 mrem/yr during cleanup and about 0.2 mrem/yr during the maintenance period. These values may be compared with the background dose in Missouri of 120 mrem/yr.

  4. Hindcasting Historical Breeding Conditions for an Endangered Salamander in Ephemeral Wetlands of the Southeastern USA: Implications of Climate Change.

    Science.gov (United States)

    Chandler, Houston C; Rypel, Andrew L; Jiao, Yan; Haas, Carola A; Gorman, Thomas A

    2016-01-01

    The hydroperiod of ephemeral wetlands is often the most important characteristic determining amphibian breeding success, especially for species with long development times. In mesic and wet pine flatwoods of the southeastern United States, ephemeral wetlands were a common landscape feature. Reticulated flatwoods salamanders (Ambystoma bishopi), a federally endangered species, depend exclusively on ephemeral wetlands and require at least 11 weeks to successfully metamorphose into terrestrial adults. We empirically modeled hydroperiod of 17 A. bishopi breeding wetlands by combining downscaled historical climate-model data with a recent 9-year record (2006-2014) of observed water levels. Empirical models were subsequently used to reconstruct wetland hydrologic conditions from 1896-2014 using the downscaled historical climate datasets. Reconstructed hydroperiods for the 17 wetlands were highly variable through time but were frequently unfavorable for A. bishopi reproduction (e.g., only 61% of years, using a conservative estimate of development time [12 weeks], were conducive to larval development and metamorphosis). Using change-point analysis, we identified significant shifts in average hydroperiod over the last century in all 17 wetlands. Mean hydroperiods were shorter in recent years than at any other point since 1896, and thus less suitable for A. bishopi reproduction. We suggest that climate change will continue to impact the reproductive success of flatwoods salamanders and other ephemeral wetland breeders by reducing the number of years these wetlands have suitable hydroperiods. Consequently, we emphasize the importance of conservation and management for mitigating other forms of habitat degradation, especially maintenance of high quality breeding sites where reproduction can occur during appropriate environmental conditions.

  5. Hindcasting Historical Breeding Conditions for an Endangered Salamander in Ephemeral Wetlands of the Southeastern USA: Implications of Climate Change.

    Directory of Open Access Journals (Sweden)

    Houston C Chandler

    Full Text Available The hydroperiod of ephemeral wetlands is often the most important characteristic determining amphibian breeding success, especially for species with long development times. In mesic and wet pine flatwoods of the southeastern United States, ephemeral wetlands were a common landscape feature. Reticulated flatwoods salamanders (Ambystoma bishopi, a federally endangered species, depend exclusively on ephemeral wetlands and require at least 11 weeks to successfully metamorphose into terrestrial adults. We empirically modeled hydroperiod of 17 A. bishopi breeding wetlands by combining downscaled historical climate-model data with a recent 9-year record (2006-2014 of observed water levels. Empirical models were subsequently used to reconstruct wetland hydrologic conditions from 1896-2014 using the downscaled historical climate datasets. Reconstructed hydroperiods for the 17 wetlands were highly variable through time but were frequently unfavorable for A. bishopi reproduction (e.g., only 61% of years, using a conservative estimate of development time [12 weeks], were conducive to larval development and metamorphosis. Using change-point analysis, we identified significant shifts in average hydroperiod over the last century in all 17 wetlands. Mean hydroperiods were shorter in recent years than at any other point since 1896, and thus less suitable for A. bishopi reproduction. We suggest that climate change will continue to impact the reproductive success of flatwoods salamanders and other ephemeral wetland breeders by reducing the number of years these wetlands have suitable hydroperiods. Consequently, we emphasize the importance of conservation and management for mitigating other forms of habitat degradation, especially maintenance of high quality breeding sites where reproduction can occur during appropriate environmental conditions.

  6. Individual (co)variation in standard metabolic rate, feeding rate, and exploratory behavior in wild-caught semiaquatic salamanders.

    Science.gov (United States)

    Gifford, Matthew E; Clay, Timothy A; Careau, Vincent

    2014-01-01

    Repeatability is an important concept in evolutionary analyses because it provides information regarding the benefit of repeated measurements and, in most cases, a putative upper limit to heritability estimates. Repeatability (R) of different aspects of energy metabolism and behavior has been demonstrated in a variety of organisms over short and long time intervals. Recent research suggests that consistent individual differences in behavior and energy metabolism might covary. Here we present new data on the repeatability of body mass, standard metabolic rate (SMR), voluntary exploratory behavior, and feeding rate in a semiaquatic salamander and ask whether individual variation in behavioral traits is correlated with individual variation in metabolism on a whole-animal basis and after conditioning on body mass. All measured traits were repeatable, but the repeatability estimates ranged from very high for body mass (R = 0.98), to intermediate for SMR (R = 0.39) and food intake (R = 0.58), to low for exploratory behavior (R = 0.25). Moreover, repeatability estimates for all traits except body mass declined over time (i.e., from 3 to 9 wk), although this pattern could be a consequence of the relatively low sample size used in this study. Despite significant repeatability in all traits, we find little evidence that behaviors are correlated with SMR at the phenotypic and among-individual levels when conditioned on body mass. Specifically, the phenotypic correlations between SMR and exploratory behavior were negative in all trials but significantly so in one trial only. Salamanders in this study showed individual variation in how their exploratory behavior changed across trials (but not body mass, SMR, and feed intake), which might have contributed to observed changing correlations across trials.

  7. Significance of pre-Quaternary climate change for montane species diversity: insights from Asian salamanders (Salamandridae: Pachytriton).

    Science.gov (United States)

    Wu, Yunke; Wang, Yuezhao; Jiang, Ke; Hanken, James

    2013-01-01

    Despite extensive focus on the genetic legacy of Pleistocene glaciation, impacts of earlier climatic change on biodiversity are poorly understood. Because amphibians are highly sensitive to variations in precipitation and temperature, we use a genus of Chinese montane salamanders (Salamandridae: Pachytriton) to study paleoclimatic change in East Asia, which experienced intensification of its monsoon circulation in the late Miocene associated with subsequent Pliocene warming. Using both nuclear and mitochondrial DNA sequences, we reconstruct the species tree under a coalescent model and demonstrate that all major lineages originated before the Quaternary. Initial speciation within the genus occurred after the summer monsoon entered a stage of substantial intensification. Heavy summer precipitation established temporary water connectivity through overflows between adjacent stream systems, which may facilitate geographic range expansion by aquatic species such as Pachytriton. Species were formed in allopatry likely through vicariant isolation during or after range expansion. To evaluate the influence of Pliocene warming on these cold-adapted salamanders, we construct a novel temperature buffer-zone model, which suggests widespread physiological stress or even extinction during the warming period. A significant deceleration of species accumulation rate is consistent with Pliocene range contraction, which affected P. granulosus and P. archospotus the most because they lack large temperature buffer zones. In contrast, demographic growth occurred in species for which refugia persist. The buffer-zone model reveals the Huangshan Mountain as a potential climatic refugium, which is similar to that found for other East Asian organisms. Our approach can incorporate future climatic data to evaluate the potential impact of ongoing global warming on montane species (particularly amphibians) and to predict possible population declines.

  8. Histological and MS spectrometric analyses of the modified tissue of bulgy form tadpoles induced by salamander predation

    Directory of Open Access Journals (Sweden)

    Tsukasa Mori

    2012-02-01

    The rapid induction of a defensive morphology by a prey species in face of a predation risk is an intriguing in ecological context; however, the physiological mechanisms that underlie this phenotypic plasticity remain uncertain. Here we investigated the phenotypic changes shown by Rana pirica tadpoles in response to a predation threat by larvae of the salamander Hynobius retardatus. One such response is the bulgy morph phenotype, a relatively rapid swelling in size by the tadpoles that begins within 4 days and reaches a maximum at 8 to 10 days. We found that although the total volume of bodily fluid increased significantly (P<0.01 in bulgy morph tadpoles, osmotic pressure was maintained at the same level as control tadpoles by a significant increase (P<0.01 in Na and Cl ion concentrations. In our previous report, we identified a novel frog gene named pirica that affects the waterproofing of the skin membrane in tadpoles. Our results support the hypothesis that predator-induced expression of pirica on the skin membrane causes retention of absorbed water. Midline sections of bulgy morph tadpoles showed the presence of swollen connective tissue beneath the skin that was sparsely composed of cells containing hyaluronic acid. Mass spectrographic (LC-MS/MS analysis identified histone H3 and 14-3-3 zeta as the most abundant constituents in the liquid aspirated from the connective tissue of bulgy tadpoles. Immunohistochemistry using antibodies against these proteins showed the presence of non-chromatin associated histone H3 in the swollen connective tissue. Histones and 14-3-3 proteins are also involved in antimicrobial activity and secretion of antibacterial proteins, respectively. Bulgy tadpoles have a larger surface area than controls, and their skin often has bite wounds inflicted by the larval salamanders. Thus, formation of the bulgy morph may also require and be supported by activation of innate immune systems.

  9. The importance of comparative phylogeography in diagnosing introduced species: a lesson from the seal salamander, Desmognathus monticola

    Directory of Open Access Journals (Sweden)

    Wooten Jessica A

    2007-09-01

    Full Text Available Abstract Background In most regions of the world human influences on the distribution of flora and fauna predate complete biotic surveys. In some cases this challenges our ability to discriminate native from introduced species. This distinction is particularly critical for isolated populations, because relicts of native species may need to be conserved, whereas introduced species may require immediate eradication. Recently an isolated population of seal salamanders, Desmognathus monticola, was discovered on the Ozark Plateau, ~700 km west of its broad continuous distribution in the Appalachian Mountains of eastern North America. Using Nested Clade Analysis (NCA we test whether the Ozark isolate results from population fragmentation (a natural relict or long distance dispersal (a human-mediated introduction. Results Despite its broad distribution in the Appalachian Mountains, the primary haplotype diversity of D. monticola is restricted to less than 2.5% of the distribution in the extreme southern Appalachians, where genetic diversity is high for other co-distributed species. By intensively sampling this genetically diverse region we located haplotypes identical to the Ozark isolate. Nested Clade Analysis supports the hypothesis that the Ozark population was introduced, but it was necessary to include haplotypes that are less than or equal to 0.733% divergent from the Ozark population in order to arrive at this conclusion. These critical haplotypes only occur in Conclusion Our analyses suggest that the isolated population of D. monticola from the Ozarks is not native to the region and may need to be extirpated rather than conserved, particularly because of its potential negative impacts on endemic Ozark stream salamander communities. Diagnosing a species as introduced may require locating nearly identical haplotypes in the known native distribution, which may be a major undertaking. Our study demonstrates the importance of considering comparative

  10. Fabrication and experimentation of FRP helical spring

    Science.gov (United States)

    Ekanthappa, J.; Shiva Shankar, G. S.; Amith, B. M.; Gagan, M.

    2016-09-01

    In present scenario, the automobile industry sector is showing increased interest in reducing the unsprung weight of the automobile & hence increasing the fuel Efficiency. One of the feasible sub systems of a vehicle where weight reduction may be attempted is vehicle- suspension system. Usage of composite material is a proven way to lower the component weight without any compromise in strength. The composite materials are having high specific strength, more elastic strain energy storage capacity in comparison with those of steel. Therefore, helical coil spring made of steel is replaceable by composite cylindrical helical coil spring. This research aims at preparing a re-usable mandrel (mould) of Mild steel, developing a setup for fabrication, fabrication of FRP helical spring using continuous glass fibers and Epoxy Resin (Polymer). Experimentation has been conducted on fabricated FRP helical spring to determine its strength parameters & for failure analysis. It is found that spring stiffness (K) of Glass/Epoxy helical-spring is greater than steel-coil spring with reduced weight.

  11. Thermal springs of Malaysia and their potentialdevelopment

    Science.gov (United States)

    Rahim Samsudin, Abdul; Hamzah, Umar; Rahman, Rakmi Ab.; Siwar, Chamhuri; Fauzi Mohd. Jani, Mohd; Othman, Redzuan

    The study on the potential development of hot springs for the tourism industry in Malaysiawas conducted. Out of the 40 hot springs covered, the study identified 9 hot springs having a high potential for development, 14 having medium potential and the remaining 17 having low or least potential for development. This conclusion was arrived at after considering the technical and economic feasibility of the various hot springs. Technical feasibility criteria includes geological factors, water quality, temperature and flow rate. The economic feasibility criteria considers measures such as accessibility, current and market potentials in terms of visitors, surrounding attractions and existing inventory and facilities available. A geological input indicates that high potential hot springs are located close to or within the granite body and associated with major permeable fault zones. They normally occur at low elevation adjacent to topographic highs. High potential hot springs are also characterised by high water temperature, substantial flowrate and very good water quality which is important for water-body contact activities such as soaking. Economic criteria for high potential hot springs are associated with good accessibility, good market, good surrounding attractions like rural and village setting and well developed facilities and infrastructures.

  12. Industrial Development Strategy of Giant Salamander in Wanzhou District%重庆万州大鲵产业发展探讨

    Institute of Scientific and Technical Information of China (English)

    袁锡立

    2015-01-01

    Based on the development situation and existing problems of the Chinese giant salamander industry in Wanzhou district,the concrete measures were put forward. The healthy and rapid development of the Chinese giant salamander industry in Wanzhou district was promoted by relying on the scientific and technological innovation,strengthening the industry association and implementing the brand strategy.%针对万州区大鲵产业发展现状及存在的问题,提出了依靠科技创新,加强产业联合,实施品牌战略,促进万州区大鲵产业健康快速发展的具体措施。

  13. Process for Forming a High Temperature Single Crystal Canted Spring

    Science.gov (United States)

    DeMange, Jeffrey J (Inventor); Ritzert, Frank J (Inventor); Nathal, Michael V (Inventor); Dunlap, Patrick H (Inventor); Steinetz, Bruce M (Inventor)

    2017-01-01

    A process for forming a high temperature single crystal canted spring is provided. In one embodiment, the process includes fabricating configurations of a rapid prototype spring to fabricate a sacrificial mold pattern to create a ceramic mold and casting a canted coiled spring to form at least one canted coil spring configuration based on the ceramic mold. The high temperature single crystal canted spring is formed from a nickel-based alloy containing rhenium using the at least one coil spring configuration.

  14. Biogeochemistry of hypersaline springs supporting a mid-continent marine ecosystem: an analogue for martian springs?

    Science.gov (United States)

    Grasby, Stephen E; Londry, Kathleen L

    2007-08-01

    Hypersaline springs that host unique mid-continent marine ecosystems were examined in central Manitoba, Canada. The springs originate from a reflux of glacial meltwater that intrudes into underlying bedrock and dissolved buried salt beds. Two spring types were distinguished based both on flow rate and geochemistry. High flow springs (greater than 10 L/s) hosted extensive marine microbial mats, which were dominated by algae but also included diverse microbes. These varied somewhat between springs as indicated by changes in profiles of fatty acid methyl esters. Culture studies confirmed the presence of sulfate-reducing bacteria in sediments at the high flow sites. In contrast, low flow springs were affected by solar evaporation, increasing salinity, and temperature. These low flow springs behaved more like closed nutrient-limited systems and did not support microbial mats. Direct comparison of the high and low flow springs revealed interesting implications for the potential to record biosignatures in the rock record. High flow springs have abundant, well-developed microbial mats, which desiccate and are cemented along the edges of the spring pools; however, the high mass flux overwhelms any geochemical signature of microbial activity. In contrast, the nutrient-limited low flow sites develop strong geochemical signatures of sulfate reduction, even in the absence of microbial mats, due to less dilution with the lower flows. Geochemical and physical evidence for life did not correlate with the abundance of microbial life but, rather, with the extent to which the biological system formed a closed ecosystem.

  15. Executive summary: Weldon Spring Site Environmental Report for calendar year 1992. Weldon Spring Site Remedial Action Project, Weldon Spring, Missouri

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    This report has been prepared to provide information about the public safety and environmental protection programs conducted by the Weldon Spring Site Remedial Action Project. The Weldon Spring site is located in southern St. Charles County, Missouri, approximately 48 km (30 mi) west of St. Louis. The site consists of two main areas, the Weldon Spring Chemical Plant and raffinate pits and the Weldon Spring Quarry. The objectives of the Site Environmental Report are to present a summary of data from the environmental monitoring program, to characterize trends and environmental conditions at the site, and to confirm compliance with environmental and health protection standards and requirements. The report also presents the status of remedial activities and the results of monitoring these activities to assess their impacts on the public and environment. The scope of the environmental monitoring program at the Weldon Spring site has changed since it was initiated. Previously, the program focused on investigations of the extent and level of contaminants in the groundwater, surface waters, buildings, and air at the site. In 1992, the level of remedial activities required monitoring for potential impacts of those activities, particularly on surface water runoff and airborne effluents. This report includes monitoring data from routine radiological and nonradiological sampling activities. These data include estimates of dose to the public from the Weldon Spring site; estimates of effluent releases; and trends in groundwater contaminant levels. Also, applicable compliance requirements, quality assurance programs, and special studies conducted in 1992 to support environmental protection programs are reviewed.

  16. Growth, survival, longevity, and population size of the Big Mouth Cave salamander (Gyrinophilus palleucus necturoides) from the type locality in Grundy County, Tennessee, USA

    Science.gov (United States)

    Niemiller, Matthew L.; Glorioso, Brad M.; Fenolio, Dante B.; Reynolds, R. Graham; Taylor, Steven J.; Miller, Brian T.

    2016-01-01

    Salamander species that live entirely in subterranean habitats have evolved adaptations that allow them to cope with perpetual darkness and limited energy resources. We conducted a 26-month mark–recapture study to better understand the individual growth and demography of a population of the Big Mouth Cave Salamander (Gyrinophilus palleucus necturoides). We employed a growth model to estimate growth rates, age at sexual maturity, and longevity, and an open population model to estimate population size, density, detectability, and survival rates. Furthermore, we examined cover use and evidence of potential predation. Individuals probably reach sexual maturity in 3–5 years and live at least nine years. Survival rates were generally high (>75%) but declined during the study. More than 30% of captured salamanders had regenerating tails or tail damage, which presumably represent predation attempts by conspecifics or crayfishes. Most salamanders (>90%) were found under cover (e.g., rocks, trash, decaying plant material). Based on 11 surveys during the study, population size estimates ranged from 21 to 104 individuals in the ca. 710 m2 study area. Previous surveys indicated that this population experienced a significant decline from the early 1970s through the 1990s, perhaps related to silvicultural and agricultural practices. However, our data suggest that this population has either recovered or stabilized during the past 20 years. Differences in relative abundance between early surveys and our survey could be associated with differences in survey methods or sampling conditions rather than an increase in population size. Regardless, our study demonstrates that this population is larger than previously thought and is in no immediate risk of extirpation, though it does appear to exhibit higher rates of predation than expected for a species believed to be an apex predator of subterranean food webs.

  17. An integrative approach to phylogeography: Investigating the effects of ancient seaways, climate, and historical geology on multi-locus phylogeographic boundaries of the Arboreal Salamander (Aneides lugubris)

    OpenAIRE

    Reilly, SB; Corl, A; Wake, DB

    2015-01-01

    Background Phylogeography is an important tool that can be used to reveal cryptic biodiversity and to better understand the processes that promote lineage diversification. We studied the phylogeographic history of the Arboreal Salamander (Aneides lugubris), a wide-ranging species endemic to the California floristic province. We used multi-locus data to reconstruct the evolutionary history of A. lugubris and to discover the geographic location of major genetic breaks within the species. We als...

  18. New species of salamander (Caudata: Plethodontidae: Cryptotriton) from Quebrada Cataguana, Francisco Morazán, Honduras, with comments on the taxonomic status of Cryptotriton wakei.

    Science.gov (United States)

    Mccranie, James R; Rovito, Sean M

    2014-05-09

    We describe a new species of the plethodontid salamander genus Cryptotriton from Honduras after comparing morphological, molecular, and osteological data from the holotype to that of the other nominal forms of the genus. The new species differs from all of the known species of Cryptotriton in at least one character from all three datasets. We also suggest placing C. wakei in the synonymy of C. nasalis after examining the morphological and osteological characters of the single known specimen of C. wakei.

  19. Solution structure and phylogenetics of Prod1, a member of the three-finger protein superfamily implicated in salamander limb regeneration.

    Directory of Open Access Journals (Sweden)

    Acely Garza-Garcia

    Full Text Available BACKGROUND: Following the amputation of a limb, newts and salamanders have the capability to regenerate the lost tissues via a complex process that takes place at the site of injury. Initially these cells undergo dedifferentiation to a state competent to regenerate the missing limb structures. Crucially, dedifferentiated cells have memory of their level of origin along the proximodistal (PD axis of the limb, a property known as positional identity. Notophthalmus viridescens Prod1 is a cell-surface molecule of the three-finger protein (TFP superfamily involved in the specification of newt limb PD identity. The TFP superfamily is a highly diverse group of metazoan proteins that includes snake venom toxins, mammalian transmembrane receptors and miscellaneous signaling molecules. METHODOLOGY/PRINCIPAL FINDINGS: With the aim of identifying potential orthologs of Prod1, we have solved its 3D structure and compared it to other known TFPs using phylogenetic techniques. The analysis shows that TFP 3D structures group in different categories according to function. Prod1 clusters with other cell surface protein TFP domains including the complement regulator CD59 and the C-terminal domain of urokinase-type plasminogen activator. To infer orthology, a structure-based multiple sequence alignment of representative TFP family members was built and analyzed by phylogenetic methods. Prod1 has been proposed to be the salamander CD59 but our analysis fails to support this association. Prod1 is not a good match for any of the TFP families present in mammals and this result was further supported by the identification of the putative orthologs of both CD59 and N. viridescens Prod1 in sequence data for the salamander Ambystoma tigrinum. CONCLUSIONS/SIGNIFICANCE: The available data suggest that Prod1, and thereby its role in encoding PD identity, is restricted to salamanders. The lack of comparable limb-regenerative capability in other adult vertebrates could be

  20. Spring Enterprise Recipes A Problem-solution Approach

    CERN Document Server

    Mak, Gary

    2010-01-01

    The Spring Framework is a widely adopted enterprise and general Java framework. The release of Spring Framework 3.0 has added many improvements and new features for Spring development. Written by Gary Mak of the best-selling Spring Recipes and Josh Long, an expert Spring user and developer, Spring Enterprise Recipes is one of the first books on the new Spring 3. This key book focuses on Spring Framework 3.0, the latest version available, and a framework-related suite of tools, extensions, plug-ins, modules, and more-all of which you may want and need for building three-tier Java EE application

  1. Spring Creek Common Allotment habitat management plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Management plan for the Spring Creek Common Allotment on Charles M. Russell National Wildlife Refuge, in McCone and Garfield Counties, Montana. This plan discusses...

  2. SPring-8 and application of nuclear scattering

    Energy Technology Data Exchange (ETDEWEB)

    Harami, Taikan [Japan Atomic Energy Research Inst., Kamigori, Hyogo (Japan). Kansai Research Establishment

    1997-03-01

    The SPring-8 has Linac synchrotron, incidence type facility and an accumulation ring. By preparing a beam line to take out light at the accumulation ring, the SPring-8 is supplied for common applications. Development of science adopting new method to study of properties and organisms by using high brightness source is expected. Construction of the SPring-8 accelerator was finished and adjusting test and commissioning of apparatuses are now in proceeding. At pre-use inspection of the accumulation ring on March, 1997, beam lines for R and D and crystalline structure analysis are applied to the Science and Technology Agency to inspect them simultaneously. And, by activating character of the SPring-8 radiation facility of high brightness and high energy X-ray generator, property study using Moessbauer nuclide to a probe can be conducted. (G.K.)

  3. Fish Springs National Wildlife Refuge : Wildlife list

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This checklist is a comprehensive list of Fish Springs National Wildlife Refuge wildlife species. The checklist contains all wildlife species documented on the...

  4. Fish Springs National Wildlife Refuge habitat map

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Habitat map for Fish Springs National Wildlife Refuge. This habitat map was created along with the National Vegetation Classification (NVC) map of the refuge. Refuge...

  5. Coastal Energy Corporation, Willow Springs, MO

    Science.gov (United States)

    notice of a proposed Administrative Penalty Assessment against Coastal Energy Corporation, located at 232 Burnham Road, Willow Springs, Missouri, for alleged violations at the facility located at or near that facility.

  6. Optical spring effect in nanoelectromechanical systems

    Science.gov (United States)

    Tian, Feng; Zhou, Guangya; Du, Yu; Chau, Fook Siong; Deng, Jie

    2014-08-01

    In this Letter, we report a hybrid system consisting of nano-optical and nano-mechanical springs, in which the optical spring effect works to adjust the mechanical frequency of a nanoelectromechanical systems resonator. Nano-scale folded beams are fabricated as the mechanical springs and double-coupled one-dimensional photonic crystal cavities are used to pump the "optical spring." The dynamic characteristics of this hybrid system are measured and analyzed at both low and high input optical powers. This study leads the physical phenomenon of optomechanics in complex nano-opto-electro-mechanical systems (NOEMS) and could benefit the future applications of NOEMS in chip-level communication and sensing.

  7. Coffee Cravings May Spring from Your DNA

    Science.gov (United States)

    ... page: https://medlineplus.gov/news/fullstory_160628.html Coffee Cravings May Spring From Your DNA Genes appear ... research suggests that your genes influence how much coffee you drink. Researchers analyzed genetic data from more ...

  8. Stravinsky: The Rite of Spring. Canticum sacrum

    Index Scriptorium Estoniae

    1996-01-01

    Uuest heliplaadist "Stravinsky: The Rite of Spring. Canticum sacrum. Requiem canticles. Choral Variations on "Vom Himmel hoch". Lausanne Pro Arte Choir, Suisse Romande Chamber Choir and Orchestra, Neeme Järvi" Chandos CHAN 9408 (75 minutes:DDD)

  9. EASTER- a floating holiday in spring

    Institute of Scientific and Technical Information of China (English)

    周雷生

    2004-01-01

    Approximately 260 million North Americans(85%) are Christians. As in other Christian lands,the greatest religious festival of the year in Canada and the United States is Easter. Easter is a joyous spring day commemorating the res-

  10. Status report on Fish Springs pond snail

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report provides a life history of the pond snail (Lymnaea Hinkleyia pilsbryi) at Fish Springs National Wildlife Refuge. The following information is included;...

  11. Fish Springs pond snail : Refuge communication scenario

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Communication scenario between the branch of Listing and Recovery, Fish and Wildlife Enhancement, and Fish Springs National Wildlife Refuge (NWR), in regards to the...

  12. Pagosa Springs geothermal project. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    1984-10-19

    This booklet discusses some ideas and methods for using Colorado geothermal energy. A project installed in Pagosa Springs, which consists of a pipeline laid down 8th street with service to residences retrofitted to geothermal space heating, is described. (ACR)

  13. Inspection report: Fish Springs National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report discusses results of a reconnaissance trip conducted at Fish Springs National Wildlife Refuge. The following is outlined; land condition, presence of...

  14. Fire salamander (Salamandra salamandra in Larzac plateau: low occurrence, pond-breeding and cohabitation of larvae with paedomorphic palmate newts (Lissotriton helveticus

    Directory of Open Access Journals (Sweden)

    Mathieu Denoël

    2014-06-01

    Full Text Available Alternative reproductive strategies are widespread in caudate amphibians. Among them, fire salamanders (Salamandra salamandra usually rely on streams to give birth to aquatic larvae but also use ponds, whereas palmate newt larvae (Lissotriton helveticus typically metamorphose into terrestrial juveniles, but can also reproduce in retaining their gills, a process known as paedomorphosis. Here we report repeated observations of an unusual case of coexistence of these two alternative traits in the same pond (Larzac, France. The prevalence of fire salamanders in Southern Larzac was very low (pond occupancy: 0.36%. The observed abundance of fire salamander larvae and paedomorphic newts was also low in the studied pond. On one hand, the rarity of this coexistence pattern may suggest that habitat characteristics may not be optimal or that competition or predation processes might be operating. However, these hypotheses remain to be tested. On the other hand, as this is the only known case of breeding in Southern Larzac, it could be considered to be at a high risk of extirpation.

  15. Spring-back deformation in tube bending

    Institute of Scientific and Technical Information of China (English)

    Da-xin E; Hua-hui He; Xiao-yi Liu; Ru-xin Ning

    2009-01-01

    The spring-back of a bending metal tube was studied through extensive experiments and finite element method (FEM) analysis. An approximate equation for the spring-back angle of bending was deduced. It is noted that the mechanical properties of the material (in a tubular form) are quite different from those found in the standard tensile tests (when the materials are in bar forms). This is one of the major reasons that result in the discrepancies in the outcomes of experimental study, FEM calculations, and spring-back analysis. It is therefore of crucial importance to study the mechanical properties of the materials in their tubular forms. The experiments and FEM simulations prove that the spring-back angle is significantly affected by the mechanical properties of the materials. The angle decreases accordingly with plastic modulus, but changes inversely with the hardening index and elastic modulus. The spring-back angle is also affected by the conditions of tube deformation: it increases accordingly with the relative bending radius but changes inversely with the relative wall thickness. In addition, the spring-back angle increases nonlinearly with the bending an-gle.

  16. Preparation of biomimetic photoresponsive polymer springs.

    Science.gov (United States)

    Iamsaard, Supitchaya; Villemin, Elise; Lancia, Federico; Aβhoff, Sarah-Jane; Fletcher, Stephen P; Katsonis, Nathalie

    2016-10-01

    Polymer springs that twist under irradiation with light, in a manner that mimics how plant tendrils twist and turn under the effect of differential expansion in different sections of the plant, show potential for soft robotics and the development of artificial muscles. The soft springs prepared using this protocol are typically 1 mm wide, 50 μm thick and up to 10 cm long. They are made from liquid crystal polymer networks in which an azobenzene derivative is introduced covalently as a molecular photo-switch. The polymer network is prepared by irradiation of a twist cell filled with a mixture of shape-persistent liquid crystals, liquid crystals having reactive end groups, molecular photo-switches, some chiral dopant and a small amount of photoinitiator. After postcuring, the soft polymer film is removed and cut into springs, the geometry of which is determined by the angle of cut. The material composing the springs is characterized by optical microscopy, scanning electron microscopy and tensile strength measurements. The springs operate at ambient temperature, by mimicking the orthogonal contraction mechanism that is at the origin of plant coiling. They shape-shift under irradiation with UV light and can be pre-programmed to either wind or unwind, as encoded in their geometry. Once illumination is stopped, the springs return to their initial shape. Irradiation with visible light accelerates the shape reversion.

  17. 扩展Spring MVC模块的Web应用%Web Application of Extended Spring MVC

    Institute of Scientific and Technical Information of China (English)

    廖福保

    2012-01-01

    This paper described the application of Spring MVC framework. It analyzed the controller, model, and view of MVC framework. To compensate for the deficiency of Spring MVC, it introduced the AJAX technology into Spring MVC to have it extended. The extended Spring MVC is easier to maintain, and has been proved to be feasible and valid in a typical Web application.%叙述了Spring MVC模块的应用,对MVC模块中的控制器、模型和视图进行了分析,然后针对目前Spring MVC模块的不足,对此模块进行了扩展,并将AJAX技术引入到Spring MVC模块中,具有易维护性.在扩展Spring MVC模块的基础上设计了1个典型的Web应用,表明了扩展Spring MVC模块的可行性和有效性.

  18. The source, discharge, and chemical characteristics of water from Agua Caliente Spring, Palm Springs, California

    Science.gov (United States)

    : Martin, Peter; Contributors: Brandt, Justin; Catchings, Rufus D.; Christensen, Allen H.; Flint, Alan L.; Gandhok, Gini; Goldman, Mark R.; Halford, Keith J.; Langenheim, V.E.; Martin, Peter; Rymer, Michael J.; Schroeder, Roy A.; Smith, Gregory A.; Sneed, Michelle

    2011-01-01

    Agua Caliente Spring, in downtown Palm Springs, California, has been used for recreation and medicinal therapy for hundreds of years and currently (2008) is the source of hot water for the Spa Resort owned by the Agua Caliente Band of the Cahuilla Indians. The Agua Caliente Spring is located about 1,500 feet east of the eastern front of the San Jacinto Mountains on the southeast-sloping alluvial plain of the Coachella Valley. The objectives of this study were to (1) define the geologic structure associated with the Agua Caliente Spring; (2) define the source(s), and possibly the age(s), of water discharged by the spring; (3) ascertain the seasonal and longer-term variability of the natural discharge, water temperature, and chemical characteristics of the spring water; (4) evaluate whether water-level declines in the regional aquifer will influence the temperature of the spring discharge; and, (5) estimate the quantity of spring water that leaks out of the water-collector tank at the spring orifice.

  19. The Cultural Impact on the Traditional Spring Festival Activities

    Institute of Scientific and Technical Information of China (English)

    刘琳琳

    2015-01-01

    Spring Festival will surely be considered as the most important festival among Chinese colorful occasions.This study attempts to analyze several typical rituals of Spring Festival from the cultural aspects,digging out the cultural factors and cultur-al connotation from the activity like the Family Reunion Dinner,Spring Couplets,the Spring Festival Gala,etc.

  20. Seasonal Dynamics of Male and Female Reproductive Systems in the Siberian Salamander, Salamandrella keyserlingii (Caudata, Hynobiidae)

    Institute of Scientific and Technical Information of China (English)

    Vadim V. YARTSEV; Valentina N. KURANOVA

    2015-01-01

    It is not well known how low temperatures, like a subarctic steppe–tundra climate, inlfuence reproductive traits of ectothermic vertebrates. To begin answering this question, we studied male and female reproductive systems of Salamandrella keyserlingii inhabiting a Tomsk population (southeast of Western Siberia), Russia, in ecological and physiological terms. In males, before spermiation, the testicular size and weight in late April–early May were greatest of all. Spermiation occurred during breeding immigration in spring when mean air temperature was above 10°С, and at the same time rain fell. After spermiation, the testicular size and weight decreased sharply, and the diameter of the vasa deferentia increased. “Spawning” (i.e., simultaneous extrusion of sperm and oviposition) occurred from late April to late May, and this duration lfuctuated in temperature and humidity. The testicular size and weight increased in summer. Sperm mass was detected in the testes by the smear method in April–September, except in June when single fragmented unrealized sperm was detected and in July when spermatids were detected. In females, ovarian weight was greatest in spring before ovulation. From late June, vitellogenesis began in ovarian follicles, in which mint green yolks accumulated. Melanin deposited in the surface of the ovary from July when oviducts were hypertrophying. In contrast, some large-sized females did not show any sexual maturity shortly before hibernation (although these females may be subadults). These results suggest that low temperatures in Siberia induce early timing of gamete maturation in females, but the females’ reproductive cycle might also be biennial. A reproductive cycle in males was annual with the completion of the gamete maturation process in August.

  1. Experimental Investigation Of Polymeric Compound Cross Section Springs

    Directory of Open Access Journals (Sweden)

    Mayas Al-Mahasne

    2007-01-01

    Full Text Available This paper presents an experimental investigation of the characteristic of the compound cross section springs on models made from polymeric materials (organic glass. Two constructive variants of the compound spring sections were specified with the help of criteria of similarity. The criterion of similarity of natural and model springs was determined by the simulation method at particular spring deflection. The problem of simulation was brought to accurate determination of the magnitudes that characterize the physical and mechanical properties of materials for natural and model springs. It was experimentally proved that the use of the proposed new type of springs significantly increases the spring stiffness.

  2. Replacement of lateral line sensory organs during tail regeneration in salamanders: identification of progenitor cells and analysis of leukocyte activity.

    Science.gov (United States)

    Jones, J E; Corwin, J T

    1993-03-01

    It has been proposed that supporting cells may be the progenitors of regenerated hair cells that contribute to recovery of hearing in birds, but regeneration is difficult to visualize in the ear, because it occurs deep in the skull. Hair cells and supporting cells that are comparable to those in the ear are present in lateral line neuromasts, and in axolotl salamanders these cells are accessible to microscopic observation in vivo. After amputation of a segment of the tail that contains neuromasts, cells from the posteriormost neuromast on the tail stump divide rapidly and form a migratory regenerative placode. The cells of the regenerative placode represent a lineage that eventually produces both hair cells and supporting cells in replacement neuromasts. We sought to identify the progenitors of the regenerative placode by using differential interference contrast microscopy combined with time-lapse video recording in living axolotl salamanders. In response to amputation, the mantle-type supporting cells at the posteroventral edge of the neuromast that is nearest to the wound increased their frequency of cell division, and gave rise to the first cells of the placode. The increase in mitotic activity of mantle-type supporting cells was accompanied by an unexplained decrease in the frequency of divisions in the same neuromast's population of internal supporting cells. The time-lapse records suggested that the changes in the mitotic activity of supporting cells might have been linked to the presence of phagocytic leukocytes in the vicinity of the neuromast that was nearest to the wound. Leukocytes were evenly distributed around control neuromasts, but during regeneration leukocyte activity increased significantly in the vicinity of the posterior half of the posteriormost neuromast. The redistribution of leukocytes occurred early in the regenerative response, but a causal role for the leukocytes has not been conclusively established. It is possible that the leukocytes

  3. The Breeding Ecology of a Critically Endangered Salamander, Hynobius amjiensis (Caudata:Hynobiidae), Endemic to Eastern China

    Institute of Scientific and Technical Information of China (English)

    Cangsong CHEN; Jia YANG; Yunke WU; Zhongyong FAN; Weiwei LU; Shuihua CHEN; Lipeng YU

    2016-01-01

    Hynobius amjiensis is a critically endangered salamander species (IUCN Red List) endemic to eastern China. It currently has three known populations: one in Longwangshan, Zhejiang Province (type locality), and two in Qingliangfeng between Anhui and Zhejiang Provinces. We examined the relatively unstudied breeding ecology of this species in the field and at laboratory from March 2007 to May 2014. Adult males and females were year-round terrestrial, except for the February–April breeding season. During this period, we captured only a total of 16 breeding adults (11 males and 5 females). As few as 100 breeding females were estimated based on the number of egg sacs observed since 2007. This number was significantly reduced from the estimated number between 1992 and 1998. Males (mean total length = 16.21 cm, mean body mass = 18.8 g) were slightly smaller than females (16.51 cm, 19.2 g). Size of breeding pools ranged from 0.2 m2 to 1.2 m2 (0.1–1.2 m depths). Each female deposits a pair of egg sacs by attaching the adhesive tips of the sacs to aquatic plants or dead twigs. Fifteen pairs of egg sacs had an average length of 28.6 cm and a diameter of 3.3 cm. On average, each egg sac contained 75 eggs with a diameter of 0.3 cm. Our field survey revealed that H. amjiensis used oviposition sites in small, cool, and weakly acidic pools at high elevations (1 300–1 600 m) where peat moss was abundant. Reduction in wetland size and disappearance of suitable breeding pools suggest that this salamander species is under threat of extinction, particularly at Longwangshan, where 5 of the 9 breeding pools have either dried up or disappeared. Combined size of the remaining 4 pools is less than 2 m2. We urge immediate implementation of more effective conservation measures and suggest that preservation priority should be given to habitat that contains suitable breeding pools.

  4. Geothermal energy and hot springs in Ethiopia

    Energy Technology Data Exchange (ETDEWEB)

    Koga, T. (Hot Springs Therapeutics Research Institute, Kyushu, Univ., Japan)

    1971-01-01

    The hot springs in Ethiopia are concentrated in two areas: the North Afar depression and adjacent Red Sea shore, and a geothermal field 100 km from northeast to southwest in the central part of Ethiopia. The latter extends not only to the Great Rift Valley but also to the Aden Gulf. In the lake district in the central Great Rift Valley, there are a number of hot springs on the lake shore. These are along NE-SW fault lines, and the water is a sodium bicarbonate-type rich in HCO/sub 3/ and Na but low in C1 and Ca. In Dallol in the North Afar depression, CO/sub 2/-containing hot springs with high temperatures (110/sup 0/C) and a specific gravity of 1.4, were observed. In the South Afar depression, located in the northeastern part of the Rift Valley, there are many active volcanoes and hot springs between the lake district and the Danakil depression. The spring water is a sodium bicarbonate saline type. Nine graphs and maps are included.

  5. Spring Bird Migration Phenology in Eilat, Israel

    Directory of Open Access Journals (Sweden)

    Reuven Yosef

    2009-12-01

    Full Text Available Analysis of the mean date of first captures and median arrival dates of spring migration for 34 species of birds at Eilat, Israel, revealed that the earlier a species migrates through Eilat, the greater is the inter-annual variation in the total time of its passage. Birds arrive during spring migration in Eilat in four structured and independent waves. The annual fluctuation in the initial arrival dates (initial capture dates and median dates (median date of all captures, not including recaptures, did not depend on the length of the migratory route. This implies that migrants crossing the Sahara desert depart from their winter quarters on different Julian days in different years. We suggest that negative correlations between the median date of the spring migration of early and late migrants depends upon the easterly (Hamsin wind period. Moreover, we believe that the phenology of all birds during spring migration in Eilat is possibly also determined by external factors such as weather conditions on the African continent or global climatic processes in the Northern hemisphere. Orphean Warblers (Sylvia hortensis show a strong positive correlation (rs=-0.502 of initial capture date with calendar years, whereas other species such as Barred Warbler (S. nisoria; rs = -0.391 and Spotted Flycatcher (Muscicapa striata; rs = -0.398 display an insignificant trend. The Dead Sea Sparrow (Passer moabiticus and Red-Backed Shrike (Lanius collurio are positively correlated regarding initial arrival date and medians of spring migration.

  6. Prediction of Spring Rate and Initial Failure Load due to Material Properties of Composite Leaf Spring

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Sung Ha [Maxoft Inc., Seongnam (Korea, Republic of); Choi, Bok Lok [Gangneung-Wonju National University, Gangneung (Korea, Republic of)

    2014-12-15

    This paper presented analysis methods for adapting E-glass fiber/epoxy composite (GFRP) materials to an automotive leaf spring. It focused on the static behaviors of the leaf spring due to the material composition and its fiber orientation. The material properties of the GFRP composite were directly measured based on the ASTM standard test. A reverse implementation was performed to obtain the complete set of in-situ fiber and matrix properties from the ply test results. Next, the spring rates of the composite leaf spring were examined according to the variation of material parameters such as the fiber angles and resin contents of the composite material. Finally, progressive failure analysis was conducted to identify the initial failure load by means of an elastic stress analysis and specific damage criteria. As a result, it was found that damage first occurred along the edge of the leaf spring owing to the shear stresses.

  7. 76 FR 46288 - Adequacy Determination for Colorado Springs, Cañon City, Greeley, Pagosa Springs, and Telluride...

    Science.gov (United States)

    2011-08-02

    ... AGENCY Adequacy Determination for Colorado Springs, Ca on City, Greeley, Pagosa Springs, and Telluride... Carbon Monoxide Attainment/Maintenance Plan Colorado Springs Attainment/ Maintenance Area'' and ``Revised...,'' ``Final Revised PM10 Maintenance Plan for the Pagosa Springs Attainment/Maintenance Area,'' and...

  8. ANALYSIS OF COMPOSITE LEAF SPRING BY USING ANALYTICAL & FEA

    OpenAIRE

    Ranjeet Mithari; Amar Patil; Prof. E. N. Aitavade

    2012-01-01

    Leaf spring are of the oldest suspension component they are still frequently used. The current leaf spring is multiple leaf spring types with a steel material. It has high weight, low natural frequency, high corrosion, more noise. Therefore current multiple leaf spring is replaced by mono composite (E- Glass epoxy) leaf spring which has high natural frequency, low weight etc. The maximum stress produced at the cylindrically joint than fixed joint. Therefore stress analysis of composite materi...

  9. FATIGUE PROPERTIES OF SPRING REINFORCES POLYMER GEARS

    Directory of Open Access Journals (Sweden)

    Hilal CAN

    2005-03-01

    Full Text Available Failure of gears, occur surface pressure stress and fracture at base of teeth. For steel gears, it is known that process of carburizing increases fatigue strength. Internal stress on the surface increases of fracture fatigue strength. In this study fatigue properties of polypropylene gear reinforced with 1.2 mm wire diameter metallic springs was investigated. Extension springs were used as reinforcement element and placed into the mould and stretched before injection of polypropylene material into the mould. After injection of polypropylene, stretched springs were loosened in order to obtain pre-stressing. Fatigue tests were performed on the produced gear. Reinforcement increased the strength of gears. At result of experiments, pre-stressing increase in service life 12 times more than that of specimens without reinforcement.

  10. Archaeal diversity in Icelandic hot springs

    DEFF Research Database (Denmark)

    Kvist, Thomas; Ahring, Birgitte Kiær; Westermann, Peter

    2007-01-01

    Whole-cell density gradient extractions from three solfataras (pH 2.5) ranging in temperature from 81 to 90 degrees C and one neutral hot spring (81 degrees C, pH 7) from the thermal active area of Hveragerethi (Iceland) were analysed for genetic diversity and local geographical variation...... of Archaea by analysis of amplified 16S rRNA genes. In addition to the three solfataras and the neutral hot spring, 10 soil samples in transects of the soil adjacent to the solfataras were analysed using terminal restriction fragment length polymorphism (t-RFLP). The sequence data from the clone libraries...... enzymes AluI and BsuRI. The sequenced clones from this solfatara belonged to Sulfolobales, Thermoproteales or were most closest related to sequences from uncultured Archaea. Sequences related to group I.1b were not found in the neutral hot spring or the hyperthermophilic solfatara (90 degrees C)....

  11. Spring-Assisted Cranioplasty for Bicoronal Synostosis

    DEFF Research Database (Denmark)

    Tovetjärn, Robert; Maltese, Giovanni; Kölby, Lars;

    2012-01-01

    surgical technique with advancement and remodeling of the forehead combined with spring distraction of the occipital area. The aim of the current study was to evaluate this operative technique. Eighteen consecutive patients (9 boys and 9 girls) with bicoronal synostosis operated on using this technique......, with a mean perioperative bleeding of 237 (SD, 95) mL. The mean hospital stay was 6.3 (SD, 1.5) days, of which the mean intensive care unit stay was 1.6 (SD, 1.2) days. In 2 patients, one of the springs had to be reinserted because of postoperative dislocation. No other major complications were observed....... CONCLUSIONS: Spring-assisted cranioplasty for bicoronal synostosis is a safe technique, is less invasive than many other cranioplasties, and results in marked improvement in the calvarial shape....

  12. Bayesian salamanders: analysing the demography of an underground population of the European plethodontid Speleomantes strinatii with state-space modelling

    Directory of Open Access Journals (Sweden)

    Salvidio Sebastiano

    2010-02-01

    Full Text Available Abstract Background It has been suggested that Plethodontid salamanders are excellent candidates for indicating ecosystem health. However, detailed, long-term data sets of their populations are rare, limiting our understanding of the demographic processes underlying their population fluctuations. Here we present a demographic analysis based on a 1996 - 2008 data set on an underground population of Speleomantes strinatii (Aellen in NW Italy. We utilised a Bayesian state-space approach allowing us to parameterise a stage-structured Lefkovitch model. We used all the available population data from annual temporary removal experiments to provide us with the baseline data on the numbers of juveniles, subadults and adult males and females present at any given time. Results Sampling the posterior chains of the converged state-space model gives us the likelihood distributions of the state-specific demographic rates and the associated uncertainty of these estimates. Analysing the resulting parameterised Lefkovitch matrices shows that the population growth is very close to 1, and that at population equilibrium we expect half of the individuals present to be adults of reproductive age which is what we also observe in the data. Elasticity analysis shows that adult survival is the key determinant for population growth. Conclusion This analysis demonstrates how an understanding of population demography can be gained from structured population data even in a case where following marked individuals over their whole lifespan is not practical.

  13. Initial characterization of the large genome of the salamander Ambystoma mexicanum using shotgun and laser capture chromosome sequencing.

    Science.gov (United States)

    Keinath, Melissa C; Timoshevskiy, Vladimir A; Timoshevskaya, Nataliya Y; Tsonis, Panagiotis A; Voss, S Randal; Smith, Jeramiah J

    2015-11-10

    Vertebrates exhibit substantial diversity in genome size, and some of the largest genomes exist in species that uniquely inform diverse areas of basic and biomedical research. For example, the salamander Ambystoma mexicanum (the Mexican axolotl) is a model organism for studies of regeneration, development and genome evolution, yet its genome is ~10× larger than the human genome. As part of a hierarchical approach toward improving genome resources for the species, we generated 600 Gb of shotgun sequence data and developed methods for sequencing individual laser-captured chromosomes. Based on these data, we estimate that the A. mexicanum genome is ~32 Gb. Notably, as much as 19 Gb of the A. mexicanum genome can potentially be considered single copy, which presumably reflects the evolutionary diversification of mobile elements that accumulated during an ancient episode of genome expansion. Chromosome-targeted sequencing permitted the development of assemblies within the constraints of modern computational platforms, allowed us to place 2062 genes on the two smallest A. mexicanum chromosomes and resolves key events in the history of vertebrate genome evolution. Our analyses show that the capture and sequencing of individual chromosomes is likely to provide valuable information for the systematic sequencing, assembly and scaffolding of large genomes.

  14. COI is better than 16S rRNA for DNA barcoding Asiatic salamanders (Amphibia: Caudata: Hynobiidae).

    Science.gov (United States)

    Xia, Yun; Gu, Hai-Feng; Peng, Rui; Chen, Qin; Zheng, Yu-Chi; Murphy, Robert W; Zeng, Xiao-Mao

    2012-01-01

    The 5' region of the mitochondrial DNA (mtDNA) gene cytochrome c oxidase I (COI) is the standard marker for DNA barcoding. However, because COI tends to be highly variable in amphibians, sequencing is often challenging. Consequently, another mtDNA gene, 16S rRNA gene, is often advocated for amphibian barcoding. Herein, we directly compare the usefulness of COI and 16S in discriminating species of hynobiid salamanders using 130 individuals. Species identification and classification of these animals, which are endemic to Asia, are often based on morphology only. Analysis of Kimura 2-parameter genetic distances (K2P) documents the mean intraspecific variation for COI and 16S rRNA genes to be 1.4% and 0.3%, respectively. Whereas COI can always identify species, sometimes 16S cannot. Intra- and interspecific genetic divergences occasionally overlap in both markers, thus reducing the value of a barcoding gap to identify genera. Regardless, COI is the better DNA barcoding marker for hynobiids. In addition to the comparison of two potential markers, high levels of intraspecific divergence in COI (>5%) suggest that both Onychodactylus fischeri and Salamandrella keyserlingii might be composites of cryptic species.

  15. The effects of simulated solar UVB radiation on early developmental stages of the Northwestern Salamander (Ambystoma gracile) from three lakes

    Science.gov (United States)

    Calfee, Robin D.; Little, Edward E.; Pearl, Christopher A.; Hoffman, Robert L.

    2010-01-01

    Solar ultraviolet radiation (UV) has received much attention as a factor that could play a role in amphibian population declines. UV can be hazardous to some amphibians, but the resultant effects depend on a variety of environmental and behavioral factors. In this study, the potential effects of UV on the Northwestern Salamander, Ambystoma gracile, from three lakes were assessed in the laboratory using a solar simulator. We measured the survival of embryos and the survival and growth of larvae exposed to four UV treatments in controlled laboratory studies, the UV absorbance of egg jelly, oviposition depths in the lakes, and UV absorbance in water samples from the three lakes. Hatching success of embryos decreased in the higher UV treatments as compared to the control treatments, and growth of surviving larvae was significantly reduced in the higher UVB irradiance treatments. The egg jelly exhibited a small peak of absorbance within the UVB range (290–320 nm). The magnitude of UV absorbance differed among egg jellies from the three lakes. Oviposition depths at the three sites averaged 1.10 m below the water surface. Approximately 66% of surface UVB radiation was attenuated at 10-cm depth in all three lakes. Results of this study indicate that larvae may be sensitive to UVB exposure under laboratory conditions; however, in field conditions the depths of egg deposition in the lakes, absorbance of UV radiation by the water column, and the potential for behavioral adjustments may mitigate severe effects of UV radiation.

  16. Development and Evaluation of a Loop-mediated Isothermal Ampliifcation (LAMP) Assay for Rapid Detection of Chinese Giant Salamander Ranavirus

    Institute of Scientific and Technical Information of China (English)

    Yi GENG; Xingxing LIU; Yan ZHOU; Kaiyu WANG; Xi PENG; Zhijun ZHONG; Xiaoli HUANG; Defang CHEN

    2015-01-01

    Loop-mediated isothermal ampliifcation (LAMP) is a novel nucleic acid diagnostic method that can amplify rapidly a target template under isothermal conditions. In this study, a LAMP assay for rapid detection of Chinese giant salamander ranavirus(CGSRV) was developed from culture isolates and clinical samples. The LAMP assay was developed by designing one set of four speciifc primers, targeting the major capsid protein (MCP) gene of CGSRV. Reaction time and temperature were optimal for 40 min at 62°C. The developed LAMP assay is speciifc and highly sensitive for CGSRV detection, the detection limit could reach about 5 copies of cloned viral genomic fragments. The sensitivity of the LAMP assay was about 1000 and 10-fold higher than that of both conventional and nested PCR, respectively. The LAMP ampliifcation produces a typical ladder-like pattern of products on an agarose gel that can be visually inspected after addition of ethidium bromide. The LAMP assay was evaluated further with clinical samples, and the results indicated the suitability and simplicity of the test as a rapid diagnostic tool for the detection of CGSRV.

  17. The role of thermal niche selection in maintenance of a colour polymorphism in redback salamanders (Plethodon cinereus

    Directory of Open Access Journals (Sweden)

    Niewiarowski Peter H

    2006-07-01

    Full Text Available Abstract Background In eastern North America two common colour morphs exist in most populations of redback salamanders (Plethodon cinereus. Previous studies have indicated that the different morphs may be adapted to different thermal niches and the morphological variation has been linked to standard metabolic rate at 15°C in one population of P. cinereus. It has therefore been hypothesized that a correlated response to selection on metabolic rate across thermal niches maintains the colour polymorphism in P. cinereus. This study tests that hypothesis. Results We found that the two colour morphs do sometimes differ in their maintenance metabolic rate (MMR profiles, but that the pattern is not consistent across populations or seasons. We also found that when MMR profiles differ between morphs those differences do not indicate that distinct niches exist. Field censuses showed that the two colour morphs are sometimes found at different substrate temperatures and that this difference is also dependent on census location and season. Conclusion While these morphs sometimes differ in their maintenance energy expenditures, the differences in MMR profile in this study are not consistent with maintenance of the polymorphism via a simple correlated response to selection across multiple niches. When present, differences in MMR profile do not indicate the existence of multiple thermal niches that consistently mirror colour polymorphism. We suggest that while a relationship between colour morph and thermal niche selection appears to exist it is neither simple nor consistent.

  18. Potential rapid evolution of foot morphology in Italian plethodontid salamanders (Hydromantes strinatii) following the colonization of an artificial cave.

    Science.gov (United States)

    Salvidio, S; Crovetto, F; Adams, D C

    2015-07-01

    How organisms respond to environmental change is a long-standing question in evolutionary biology. Species invading novel habitats provide an opportunity to examine contemporary evolution in action and decipher the pace of evolutionary change over short timescales. Here, we characterized phenotypic evolution in the Italian plethodontid salamander, Hydromantes strinatii, following the recent colonization of an artificial cave by a forest floor population. When compared with a nearby and genetically related population in the natural forest floor and a nearby cave population, the artificial cave population displayed significant differences in overall foot shape, with more interdigital webbing relative to the other populations. Further, this population evolved significantly larger feet, which corresponded more closely to those found in other cave populations than to forest floor populations to which the cave population is closely related. Finally, we quantified the rate of evolution for both foot shape and foot area, and found that both traits displayed large and significant evolutionary rates, at levels corresponding to other classic cases of rapid evolution in vertebrates. Together, these findings reveal that the response to novel environmental pressures can be large and rapid and that the anatomical shifts observed in the artificial cave population of H. strinatii may represent a case of rapid evolution in response to novel environmental pressures.

  19. Correction: Homyack, J.A. and Kroll, A.J. Slow Lives in the Fast Landscape: Conservation and Management of Plethodontid Salamanders in Production Forests of the United States. Forests 2014, 5, 2750–2772

    Directory of Open Access Journals (Sweden)

    Jessica A. Homyack

    2015-03-01

    Full Text Available The authors wish to correct a statement in the published paper [1], doi:10.3390/f5112750, website: http://www.mdpi.com/1999-4907/5/11/2750/htm. After publication, we discovered that two numbers were mistakenly switched. Section, 4.1, should read “Oregon slender salamanders were detected in 144/420 (34% plots and 101/378 (27% plots in 2013 and 2014, respectively; ensatina salamanders were detected in 53/420 (13% plots and 73/378 (19% plots in 2013 and 2014, respectively”. The authors would like to apologize for any inconvenience caused to the readers by these changes.[...

  20. 大鲵幼鲵适宜投喂频率的研究%Suitable Feeding Frequency of Juvenile Chinese Giant Salamander

    Institute of Scientific and Technical Information of China (English)

    杨振江; 肖汉兵; 田海峰; 孟彦; 胡乔木; 王芳

    2015-01-01

    Chinese giant salamander (Andrias davidianus) juveniles (18 months old) were reared in 193 cm × 167 cm cement tanks at a rate of 80 individuals per tank and fed in various feeding regimes at water tem‐perature of 19 ± 1 ℃ to evaluate the suitable feeding frequency via grow th performance ,body composition and digestive enzyme activity in an intensive aquaculture .The results showed that there were elevated food intake and digestive enzyme activity in the fasted salamander .The maximal weight gain rate (WGR) and specific growth rate (SGR) and minimal food conversion ratio (FCR) were observed in the salamander fed and fasted alternatively in a 6 day interval ,significantly higher or lower than those in the other groups(P<0.05) .The salamander fed and fasted alternatively in a 2 day interval(S2F2) had high protein content and low fat content ,and there was lower survival rate in the salamander fed and fasted alternatively in a 6 or 8 day interval (S6F6 and S8F8) than that in other groups .When very high survival rate and body nutri‐ents were hoped ,the suitable feeding frequency was of feeding and fasting alternatively in a 2 day interval . If not ,suitable feeding frequency was of feeding and fasting alternatively in a 6 day interval ,which the ju‐venile salamander had relatively high survival rate ,grow th performance and body nutrients .%在温度可人为控制在(19±1)℃的室内,于内壁光滑的面积为193 cm ×167 cm的水泥池中,按照每个池内80尾的密度人工饲养幼体大鲵。测量大鲵试验始末体长体质量,通过生长指标,组织营养成分及消化酶活性对比分析,探究大鲵幼体的适宜投喂频率。结果表明:饥饿处理使大鲵摄食率增加,消化酶活性增强。投喂频率为饥饿6d再连续投喂6d,特定生长率和质量增加率出现最大值,显著高于其他组(P<0.05),且饵料系数最低。投喂频率为饥饿2d再连续投喂2d,蛋白含量高且脂

  1. Foreign Friends Join Spring Tea Picking

    Institute of Scientific and Technical Information of China (English)

    Rong; You

    2013-01-01

    <正>Foreign Friends Picking Spring Tea, one of the activities of the Fourth China Tea Festival, was held in Pujiang County, Sichuan Province on March 17. Pang Te Cheng, Singaporean Consul General in Chengdu, Komate Kamalanavin, Thai Consul General in Chengdu, and Claudia Spahl, German

  2. Experimental demonstration of coupled optical springs

    Science.gov (United States)

    Gordon, N. A.; Barr, B. W.; Bell, A.; Graef, C.; Hild, S.; Huttner, S. H.; Leavey, S. S.; Macarthur, J.; Sorazu, B.; Wright, J.; Strain, K. A.

    2017-02-01

    Optical rigidity will play an important role in improving the sensitivity of future generations of gravitational wave (GW) interferometers, which employ high laser power in order to reach and exceed the standard quantum limit. Several experiments have demonstrated the combined effect of two optical springs on a single system for very low-weight mirror masses or membranes. In this paper we investigate the complex interactions between multiple optical springs and the surrounding apparatus in a system of comparable dynamics to a large-scale GW detector. Using three 100 g mirrors to form a coupled cavity system capable of sustaining two or more optical springs, we demonstrate a number of different regimes of opto-mechanical rigidity and measurement techniques. Our measurements reveal couplings between each optical spring and the control loops that can affect both the achievable increase in sensitivity and the stability of the system. Hence this work establishes a better understanding of the realisation of these techniques and paves the way to their application in future GW observatories, such as upgrades to Advanced LIGO.

  3. Spring Season Habitat Suitability Index raster

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This raster represents a continuous surface of sage-grouse habitat suitability index (HSI, created using ArcGIS 10.2.2) values for Nevada during spring, which is a...

  4. Registration of ‘Faller’ Spring Wheat

    Science.gov (United States)

    ‘Faller’ (Reg. No. CV-1026, PI 648350) hard red spring wheat (HRSW) (Triticum aestivum L.) was developed at North Dakota State University(NDSU) and released by the North Dakota Agricultural Experiment Station (NDAES). Faller was derived from the ND2857/ND2814 cross made at NDSU in fall 1997. ND2857 ...

  5. Magnetically Coupled Magnet-Spring Oscillators

    Science.gov (United States)

    Donoso, G.; Ladera, C. L.; Martin, P.

    2010-01-01

    A system of two magnets hung from two vertical springs and oscillating in the hollows of a pair of coils connected in series is a new, interesting and useful example of coupled oscillators. The electromagnetically coupled oscillations of these oscillators are experimentally and theoretically studied. Its coupling is electromagnetic instead of…

  6. Keqiao Spring Expo: More Professional, More Opportunities

    Institute of Scientific and Technical Information of China (English)

    Wang Ting

    2009-01-01

    @@ 2009 (China-Keqiao) International Textile Fabrics & Accessories Exhibition (here named "Spring Expo" for short), organized by Shaoxing County People's Government, China Textile City Exhibition & Convention Co., Ltd., Shanghai Gehua Exhibition Plan Co.,Ltd. as well as Shaoxing City Xingji Exhibition Co.,Ltd., was held during May 8-10, 2009at the China Textile City International Convention & Exhibition Center.

  7. Hard Spring Wheat Technical Committee 2016 Crop

    Science.gov (United States)

    Seven experimental lines of hard spring wheat were grown at up to five locations in 2016 and evaluated for kernel, milling, and bread baking quality against the check variety Glenn. Wheat samples were submitted through the Wheat Quality Council and processed and milled at the USDA-ARS Hard Red Spri...

  8. Failure Analysis of Aviation Torsional Springs

    Institute of Scientific and Technical Information of China (English)

    HOU Weiguo; ZHANG Weifang; LIU Xiao; WANG Zongren; DING Meili

    2011-01-01

    Cracks and fractures occur during the assembly process to a type of torsional springs used in the aviation mechanism.Besides visual examination,other experimental techniques used for the investigation are:1) fracture characteristics,damage morphology and ffactography by scanning electron microscopy(SEM),2) spectrum analysis of covering,3) metallographic observation of cracks and 4) hydrogen content testing.The results are obtained through the analysis of manufacture process and experimental data.Since no changes of microstructure are found,failures are irrelevant to the material.The cracks and fractures initiate on the inner surface,cracks initiate before the cadmium plating and after the winding.No obvious stress corrosion cracks are found near the crack source region.The opening direction of cracks is consistent with the residual tensile stress of the spring inner surface,and the springs are easy to contact hydrogen media between the spring winding and the cadmium plating.The cracks are caused by hydrogen-induced delayed cracking under the action of the residual tensile stress and hydrogen.

  9. Hydrogeochemistry of Damt thermal springs, Yemen Republic

    Energy Technology Data Exchange (ETDEWEB)

    Fara, M. [Sana' a University, Yemen Republic (Yemen). Dept. of Geology; Chandrasekharam, D. [Indian Institute of Technology, Bombay (India). Dept. of Earth Sciences; C.N.R. Center for Minerogenesis and Applied Geochemistry, Florence (Italy); Minissale, A. [C.N.R. Center for Minerogenesis and Applied Geochemistry, Florence (Italy)

    1999-04-01

    The Damt thermal springs (40-45{sup o}C), flowing through travertine deposits, belong to the Na-HCO{sub 3} type of water, and have higher pCO{sub 2} (from -1.18 to -0.58 = PCO{sub 2} from 0.07 to 0.26 atm) relative to cold Ca-SO{sub 4}-(Cl) groundwaters. The cold waters have pCO{sub 2} ranging from -1.86 to -2.50 (= PCO{sub 2} from 0.014 to 0.0035 atm). The chemical composition of the cold springs is controlled by evaporate deposits present in the Tawilah sandstone and Amran limestone formations, while simple crustal dissolution, coupled with CO{sub 2}-rich fluid-rock interaction control the chemical signature of the hot spring waters. The temperature of the feeding system, based on the K{sup 2}/Mg geothermometer, varies between 80 and 120{sup o}C. Damt thermal springs appear to be related to a 10,000 year-old volcanic activity that led to the appearance of several craters in the area. (author)

  10. Cold Spring Harbor symposia on quantitative biology

    Energy Technology Data Exchange (ETDEWEB)

    1990-01-01

    Volume 55 of the Cold Spring Harbor Symposium on Quantitative Biology is dedicated to the study of the brain. The symposium was subdivided into four major sections. Papers were presented in Molecular Mechanisms for Signalling; Neural Development; Sensory and Motor Systems; and Cognitive Neuroscience. Individual papers from the symposium are abstracted separately. (MHB)

  11. Cold Spring Harbor symposia on quantitative biology

    Energy Technology Data Exchange (ETDEWEB)

    1989-01-01

    This volume contains the first part of the proceeding of the 53rd Cold Springs Harbor Symposium on Quantitative Biology. This years topic was Immune Recognition. Part 1, this volume, contains papers prepared by presenters of the sessions entitled Introduction, Lymphocyte Development and Receptor Selection, and Recognition by Antibodies, Antigen Recognition by T cells. (DT)

  12. Cold Spring Harbor symposia on quantitative biology

    Energy Technology Data Exchange (ETDEWEB)

    1989-01-01

    This volume contains the second part of the proceedings of the 53rd Cold Springs Harbor Symposium on Quantitative Biology. This years topic was Immune Recognition. This volume, part 2, contains papers prepared by presenters for two sessions entitled Signals for Lymphocyte Activation, Proliferation, and Adhesion, and entitled Tolerance and Self Recognition. (DT)

  13. Nonlinear Study of Industrial Arc Spring Dampers

    DEFF Research Database (Denmark)

    Lahriri, Said; Santos, Ilmar; Hartmann, Henning

    2011-01-01

    The objective of this paper is to present a numerical approach for analyzing parameter excited vibrations on a gas compressor, induced by the nonlinear characteristic of the arc spring feature of certain designs of squeeze film dampers, SFDs. The behavior of the journal is studied in preparation ...

  14. Effects of Different Water Temperature,Water Quality and Culturing Density on Survival Rate of Giant Salamander in Caducibranchiate Period%不同水温水质及饲养密度对大鲵脱鳃期成活率的影响

    Institute of Scientific and Technical Information of China (English)

    吴学祥; 聂福顺; 唐黎; 欧德渊; 吴荣华

    2014-01-01

    In order to increase survival rate of giant salamander during the period of caducibranchiate, j uvenile giant salamander was cultured in the box, with trickle water. Effect of different water temperature,culturing density,water quality on survival rate was studied.The results showed that at 1 2~22℃ water temperature range,survival rate of giant salamander during the period of caducibranchiate with the water temperature increased first and then decreased,it is the highest,92.5%,at 18 ℃,increased by 15%,10%,5.0%,2.5% and 10%,respectively,compared to 12℃,14℃,16℃,20℃ and 22℃.It is the highest,90% at culturing density of 20 fish/m2 ,increased by 1.7%,7.5% and 12%,respectively, compared with 30 fish/m2 ,40 fish/m2 and 50 fish/m2 .It is insignificantly cultured with mountain spring water and surface water,88% and 84%,respectively.%为提高大鲵养殖脱鳃期的成活率,采用室内饲养池微流水人工养殖方法,研究了不同水温水质及饲养密度对大鲵脱鳃期成活率的影响。结果表明:在12~22℃水温范围内,大鲵脱鳃期的养殖成活率随水温的升高呈先上升后下降的趋势,18℃水温条件下大鲵脱鳃期养殖成活率最高,达92.5%,分别较12℃、14℃、16℃、20℃和22℃的水温条件下提高15%、10%、5.0%、2.5%和10%;饲养密度为20尾/m2时大鲵脱鳃期养殖成活率最高,达90%,分别较30尾/m2、40尾/m2和50尾/m2提高1.7%、7.5%和12%。山泉水和地表水养殖条件下大鲵脱鳃期养殖成活率差异不大,分别为88%和84%。

  15. ANALYSIS OF COMPOSITE LEAF SPRING BY USING ANALYTICAL & FEA

    Directory of Open Access Journals (Sweden)

    Ranjeet Mithari

    2012-12-01

    Full Text Available Leaf spring are of the oldest suspension component they are still frequently used. The current leaf spring is multiple leaf spring types with a steel material. It has high weight, low natural frequency, high corrosion, more noise. Therefore current multiple leaf spring is replaced by mono composite (E- Glass epoxy leaf spring which has high natural frequency, low weight etc. The maximum stress produced at the cylindrically joint than fixed joint. Therefore stress analysis of composite material mono leaf spring is carried out. The result of finite element method is verified with analytical calculation. Also compare the natural frequency by FFT analyzer with FEA.

  16. 大鲵亲鲵的培育研究%Cultivation of the Giant Salamander(Andrias davidanus)Brood Stock

    Institute of Scientific and Technical Information of China (English)

    张红星; KOUBA Andy; 沈建忠; 赵虎; 王启军; 王中乾

    2012-01-01

    2003-2005年在西安市大鲵(Andrias daviddanus)生态繁育养殖基地对大鲵亲体进行培育,分别采取单池群养培育、单池单养培育、雌雄一对一隔网单养培育三种培育方式开展试验.三种方式培育结果显示,雌雄素鲵参繁率为雌雄一对一隔网单养培育>单池单养培育>单池群养培育,且雌鲵整体发育优于雄鲵;产卵量为雌雄一对一隔网单养培育>单池单养培育>单池群养培育;亲鲵产后成活率为雌雄一对一隔网单荞培育=单地单养培育>单池群养培育.雌雄一对一隔网单养对亲鲵培育较为有利,可以减少干扰与伤残.%From 2003 to 2005, giant salamanders brood stock were breeded in three different conditions in Xi'an ecological breeding farm, including group breeding in one pond, individual breeding in one pond, pair breeding, a male and a female in one pond, and separated by net or not. The results showed the total reproduction rate was pair breeding > individual breeding > group breeding in both male and female, and the overall development of female giant salamander was better than male. The oviposition rate was pair breeding > individual breeding > group breeding; the survival rate of post-spawning salamander was pair breeding = individual breeding > group breeding. In conclusion, the pair breeding method, especially separated by net was the most appropriate way to breed of the giant salamander, as it reduced interference and harm.

  17. 张家界市大鲵产业发展战略分析%Analysis of Development Strategy for Chinese Giant Salamander Industry in Zhangjiajie City

    Institute of Scientific and Technical Information of China (English)

    罗庆华; 谢文海; 王朝群; 陈秋宇; 王金平; 朱深海

    2013-01-01

    In order to ascertain the development strategy for Chinese giant salamander (Andrias davidianus) industry in Zhangjiajie City, the internal conditions and external circumstances of Chinese giant salamander industry in Zhangjiajie City were analyzed systematically by SWOT analysis, and the basic model on the development strategy was set up. After four strategies were discriminated and discussed detailed, it was selected as the development strategy that SO strategy was main and WT strategy was supplemented, because its strength(S) was more than weakness in internal conditions, its opportunity(O) was more than its threat(T) in external circumstances and weakness and threat must been valued. The implementation ways of development strategy were explored, they were thought the feasible implement approaches that resource protection of Chinese giant salamander was strengthened, standardized mass production was advanced, industrial chain was stretched, related industries were advanced, brand strategy was implemented and service system was improved. It can provide reference for strategy decision and planning for Chinese giant salamander industry in Zhangjiajie City.%为了明确张家界市大鲵产业发展战略,应用SWOT分析法,对张家界市大鲵产业内部条件的和外部环境进行了系统分析,构建了产业发展战略模型。对4种战略进行甄别与选择,认为:张家界市大鲵产业的内部优势大于劣势;外部机遇大于威胁;同时,必须重视产业劣势与威胁的存在,张家界市大鲵产业发展战略应以增长型战略(SO)为主,以防御型战略(WT)为辅。探讨大鲵产业战略的实现途径,认为加强大鲵资源保护、推进标准化规模生产、延伸产业链、推进产业关联、实施品牌战略与健全服务体系为其可行的实施途径。为张家界市大鲵产业战略决策与产业规划提供借鉴。

  18. Refining and fatty acid composition of crude giant salamander oil%粗大鲵油的精制及其脂肪酸组成分析

    Institute of Scientific and Technical Information of China (English)

    罗秦; 孙强; 叶欣; 冉旭; 高安友

    2014-01-01

    The impurities in crude giant salamander oil such as phospholipids, protein, free fatty acid and pigment could be removed through refining process. The results showed that the optimal refining parame-ters of crude giant salamander oil were obtained as follows:dosage of 40% H3 PO4 1% ( based on the oil mass) , degumming for 1 min at 70℃; dosage of 3% NaOH solution 1. 5% ( based on the oil mass) , deacidification for 30 min at 65℃;dosage of activated clay 1% ( based on the oil mass) , bleaching for 30 min at 60℃;reduced pressure deodorization for 30 min at 85℃. Under these conditions,the refined giant salamander oil was clear, transparent and light yellow with little fishlike smell. Twenty-five kinds of fatty acids in refined giant salamander oil were identified by GC. The contents of unsaturated fatty acids ( UFA ) , polyunsaturated fatty acids ( PUFA ) and saturated fatty acids ( SFA ) were 69. 81%, 27. 60% and 22. 64%, respectively.%粗大鲵油通过精制可除去其中的一些磷脂、蛋白质、游离脂肪酸和色素等杂质。结果表明:粗大鲵油精制工艺最佳参数为采用40%磷酸,添加量为1%(占油质量),70℃脱胶1 min;采用3%氢氧化钠溶液,添加量为1.5%(占油质量),65℃脱酸30 min;添加1%(占油质量)的活性白土,60℃脱色30 min;85℃下减压蒸馏脱臭30 min。在最佳工艺条件下,所得精制大鲵油澄清透明,略显淡黄色,鱼腥味较轻。对精制后的大鲵油采用气相色谱法共鉴定出25种脂肪酸,其中不饱和脂肪酸( UFA)含量为69.81%,多不饱和脂肪酸( PUFA )含量为27.60%,饱和脂肪酸( SFA )含量为22.64%。

  19. The palaeoclimatic significance of Eurasian Giant Salamanders (Cryptobranchidae: Zaissanurus, Andrias) - indications for elevated humidity in Central Asia during global warm periods (Eocene, late Oligocene warming, Miocene Climate Optimum)

    Science.gov (United States)

    Vasilyan, Davit; Böhme, Madelaine; Winklhofer, Michael

    2010-05-01

    Cryptobranchids represent a group of large sized (up to 1.8 m) tailed amphibians known since the Middle Jurassic (Gao & Shubin 2003). Two species are living today in eastern Eurasia: Andrias davidianus (China) and A. japonicus (Japan). Cenozoic Eurasian fossil giant salamanders are known with two genera and two or three species from over 30 localities, ranging from the Late Eocene to the Early Pliocene (Böhme & Ilg 2003). The Late Eocene species Zaissanurus beliajevae is restricted to the Central Asian Zaissan Basin (SE-Kazakhstan, 50°N, 85°E), whereas the Late Oligocene to Early Pliocene species Andrias scheuchzeri is distributed from Central Europe to the Zaissan Basin. In the latter basin the species occur during two periods; the latest Oligocene and the late Early to early Middle Miocene (Chkhikvadse 1982). Andrias scheuchzeri is osteological indistinguishable from both recent species, indicating a similar ecology (Westfahl 1958). To investigate the palaeoclimatic significance of giant salamanders we analyzed the climate within the present-day distribution area and at selected fossil localities with independent palaeoclimate record. Our results indicate that fossil and recent Andrias species occur in humid areas where the mean annual precipitation reach over 900 mm (900 - 1.300 mm). As a working hypothesis (assuming a similar ecology of Andrias and Zaissanurus) we interpret occurrences of both fossil Eurasian giant salamanders as indicative for humid palaeoclimatic conditions. Based on this assumption the Late Eocene, the latest Oligocene (late Oligocene warming) and the late Early to early Middle Miocene (Miocene Climatic Optimum) of Central Asia (Zaissan Basin) are periods of elevated humidity, suggesting a direct (positive) relationship between global climate and Central Asian humidity evolution. Böhme M., Ilg A. 2003: fosFARbase, www.wahre-staerke.com/ Chkhikvadze V.M. 1982. On the finding of fossil Cryptobranchidae in the USSR and Mongolia. Vertebrata

  20. Radioactivity of the Bulgarian spring waters. I. Springs in the region Svidnja (Province Svoge)

    Energy Technology Data Exchange (ETDEWEB)

    Karamihaylova, E.; Zhelev, Zh.T.

    1975-01-01

    The methods of determining radon, radium and elements of the thorium row in spring waters used in this paper are considered. The various factors and their interrelations which are mainly responsible for the radioactivity of given waters are reviewed. Seventeen cold springs in the region Svidnja (Province Svoge, Sofia District) were investigated. Activity over 44 em was not observed. The radon concentrations in the various springs correspond to the rock composition. Seasonal measurements of the radioactivity and temperature were undertaken for three spring waters. Lesser radioactivity of the water is observed during October after the summer drought and an increase in the radon during May--July before the drought. Radium up to 10/sup -11/ g/dm/sup 3/ and elements of the thorium row up to 5 x 10/sup -4/ g/dm/sup 3/ were not found.