
Sample records for barium 151

  1. Barium

    International Nuclear Information System (INIS)

    Present article is devoted to barium content in fluoride. In order to obtain the comprehensive view on barium distribution in fluorite 303 mono mineral fractions of various geologic deposits and ores of Kazakhstan, Uzbekistan, Tajikistan and some geologic deposits of Russia were analyzed. The barium content in fluorite of geologic deposits of various mineralogical and genetic type was defined. The basic statistical estimation of barium distribution in fluorite were evaluated.

  2. Barium enema (United States)

    Barium enema is a special x-ray of the large intestine, which includes the colon and rectum. ... to a bag that holds a liquid containing barium sulfate. This is a contrast material that highlights ...

  3. Barium Sulfate (United States)

    Barium sulfate is used to help doctors examine the esophagus (tube that connects the mouth and stomach), ... dimensional pictures of the inside of the body). Barium sulfate is in a class of medications called ...

  4. Barium Sulfate (United States)

    ... using x-rays or computed tomography (CAT scan, CT scan; a type of body scan that uses ... be clearly seen by x-ray examination or CT scan. ... more times before an x-ray examination or CT scan.If you are using a barium sulfate ...


    Blanco, R.E.


    A method of separating barium from nuclear fission products is described. In accordance with the invention, barium may be recovered from an acidic solution of neutron-irradiated fissionable material by carrying ihe barium cut of solution as a sulfate with lead as a carrier and then dissolving the barium-containing precipitate in an aqueous solution of an aliphatic diamine chelating reagent. The barium values together with certain other metallic values present in the diamine solution are then absorbed onto a cation exchange resin and the barium is selectively eluted from the resin bed with concentrated nitric acid.

  6. Barium enema (image) (United States)

    A barium enema is performed to examine the walls of the colon. During the procedure, a well lubricated enema tube is inserted gently into the rectum. The barium, a radiopaque (shows up on X-ray) contrast ...

  7. Radioisotope analyzer of barium

    International Nuclear Information System (INIS)

    Principle of operation and construction of radioisotope barium sulphate analyzer type MZB-2 for fast determination of barium sulphate content in barite ores and enrichment products are described. The gauge equipped with Am-241 and a scintillation detector enables measurement of barium sulphate content in prepared samples of barite ores in the range 60% - 100% with the accuracy of 1%. The gauge is used in laboratories of barite mine and ore processing plant. 2 refs., 2 figs., 1 tab. (author)

  8. Processing science of barium titanate (United States)

    Aygun, Seymen Murat

    barium titanate phase formation. The exhaust gases emitted during the firing of barium titanate films were monitored using a residual gas analyzer (RGA) to investigate the effects of ramp rate and oxygen partial pressure. The dielectric properties including capacitor yield were correlated to the RGA data and microstructure. This information was used to tailor a thermal profile to obtain the optimum dielectric response. A ramp rate of 20°C/min and a pO2 of 10-13 atm resulted in a permittivity of 1500, a loss tangent of 0.035 and a 90% capacitor yield in 0.5 mm dot capacitors. Yield values above 90% represent a significant advantage over preexisting reports and can be attributed to an improved ability to control final porosity. Finally, the dramatic enhancement in film density was demonstrated by understanding the processing science relationships between organic removal, crystallization, and densification in chemical solution deposition. The in situ gas analysis was used to develop an each-layer-fired approach that provides for effective organic removal, thus pore elimination, larger grain sizes, and superior densification. The combination of large grain size and high density enabled reproducing bulk-like dielectric properties in a thin film. A room temperature permittivity of 3000, a 5 muF/cm2 capacitance density, and a dielectric tunability of 15:1 were achieved. By combining the data sets generated in this thesis with those of comparable literature reports, we were able to broadly rationalize scaling effects in polycrystalline thin films. We show that the same models successfully applied to bulk ceramic systems are appropriate for thin films, and that models involving parasitic interfacial layers are not needed. Developing better models for scaling effects were made possible solely by advancing our ability to synthesize materials thus eliminating artifacts and extrinsic effects.

  9. Tailored Barium Swallow Study (United States)

    ... View Denver Pollen Count You are here: Programs & Services > Tests We Offer > Imaging Tests Tailored Barium Swallow Study The TBS is a special study that is completed in radiology. The test evaluates the mouth and the throat ...

  10. Lower GI Series (Barium Enema) (United States)

    ... barium into a bedpan or nearby toilet. A health care professional may give you an enema to flush out the rest of the barium. An x-ray technician and a radiologist perform a lower gastrointestinal (GI) series at a ...

  11. Observed Barium Emission Rates (United States)

    Stenbaek-Nielsen, H. C.; Wescott, E. M.; Hallinan, T. J.


    The barium releases from the CRRES satellite have provided an opportunity for verifying theoretically calculated barium ion and neutral emission rates. Spectra of the five Caribbean releases in the summer of 1991 were taken with a spectrograph on board a U.S. Air Force jet aircraft. Because the line of sight release densities are not known, only relative rates could be obtained. The observed relative rates agree well with the theoretically calculated rates and, together with other observations, confirm the earlier detailed theoretical emission rates. The calculated emission rates can thus with good accuracy be used with photometric observations. It has been postulated that charge exchange between neutral barium and oxygen ions represents a significant source for ionization. If so. it should be associated with emissions at 4957.15 A and 5013.00 A, but these emissions were not detected.

  12. New barium tantalum sulphides

    International Nuclear Information System (INIS)

    The authors discuss a new barium tantalum sulphide, Ba3Ta2S8, prepared by sulphurization of a mixture of BaCO3 and Ta2O5. The electron and powder X-ray diffraction patterns of the compound are indexed on the basis of a monoclinic cell with lattice constants. A structure model is proposed. The refinement based on the powder X-ray diffraction intensities is performed

  13. 151Tb positron decay

    International Nuclear Information System (INIS)

    The positron and (K251-β+)-coincidence spectra produced in the 151Tb are studied decay. The positron spectrum was detected by means of toroidal beta-spectrometers. The content of the 152Tb isotope impurity in 151Tb monoisotope sources was not more than 0.3 per cent. The β+-spectrum components and the Fermi-Curie diagram are shown. The ratio of positron intensity of that of K-conversion electrons of the 287.2 keV transition has been found Isub(β+)/Isub(K287.2)=0.36+-0.02. The 151Tb positron decay intensity has been determined: Isub(β+)=0.92+-0.12%. A fragment of the 1+H51Cd excited state scheme is shown. The experimental lg ft values for β-transitions in the 151Tb decay into excited states of 151Cd with the energies of 838.3 2 and 395.2 keV, equal to 6.46+-0.10 and 7.9+-0.1, are consistent with the ground state spin of 1/2 found for 151Tb by other authors

  14. Barium calcium hydroxyapatite solid solutions

    International Nuclear Information System (INIS)

    The replacement of calcium by barium in the hydroxyapatite structure by solid-state reaction at different temperatures and by precipitation from an aqueous system has been investigated by X-ray diffraction and i.r. absorption analyses. The products obtained by solid-state reaction at 1200 deg C are solid solutions over the range of barium concentration 60 to 100 atom %. The lattice dimensions and the i.r. frequencies of the solid solutions vary linearly with the atom % of barium. Only small amounts of barium can be incorporated in hydroxyapatite by precipitation from the aqueous system. (author)

  15. Barium zirconate base ceramics

    International Nuclear Information System (INIS)

    The chemical corrosion at high temperatures is a serious problem in the refractory materials field, leading to degradation and bath contamination by elements of the refractory. The main objective of this work was to search for ceramics that could present higher resistance to chemical attack by aggressive molten oxides. The general behaviour of a ceramic material based on barium zirconate (Ba Zr O3) with the addition of different amounts of liquid phase former was investigated. The densification behaviour occurred during different heat treatments, as well as the microstructure development, as a function of the additives and their reactions with the main phase, were observed and are discussed. (author)

  16. MR Colonography with fecal tagging: Barium vs. barium ferumoxsil

    DEFF Research Database (Denmark)

    Achiam, M.P.; Chabanova, E.; Logager, V.B.; Thomsen, H.S.; Rosenberg, J.


    . Materials and Methods. Twenty patients referred to CC underwent dark lumen MRC prior to the colonoscopy. Two groups of patients received two different oral contrast agents (barium sulfate and barium sulfate/ferumoxsil) as a laxative-free fecal tagging prior to the MRC. After MRC, the contrast agent was...... rated qualitatively (with the standard method using contrast-to-wall ratio) and subjectively (using a visual analog scale [VAS]) by three different blinded observers. Results. Evaluated both qualitatively and subjectively, the tagging efficiency of barium sulfate/ferumoxsil was significantly better (P...... <.05) than barium sulfate alone. The VAS method for evaluating the tagging efficiency of contrast agents showed a high correlation (observer 11, r = 0.91) to the standard method using contrast-to-wall ratio and also a high interclass correlation (observer 11 and III = 0.89/0.85). MRC found I of 22 (5...

  17. Doped barium titanate nanoparticles

    Indian Academy of Sciences (India)

    T K Kundu; A Jana; P Barik


    We have synthesized nickel (Ni) and iron (Fe) ion doped BaTiO3 nanoparticles through a chemical route using polyvinyl alcohol (PVA). The concentration of dopant varies from 0 to 2 mole% in the specimens. The results from X-ray diffractograms and transmission electron micrographs show that the particle diameters in the specimen lie in the range 24–40 nm. It is seen that the dielectric permittivity in doped specimens is enhanced by an order of magnitude compared to undoped barium titanate ceramics. The dielectric permittivity shows maxima at 0.3 mole% doping of Fe ion and 0.6 mole% of Ni ion. The unusual dielectric behaviour of the specimens is explained in terms of the change in crystalline structure of the specimens.

  18. New barium tantalum sulphides

    International Nuclear Information System (INIS)

    A new barium tantalum sulphide has been synthesized by the reaction of CS2 with a mixture of BaCO3 and Ta2O5. The chemical analysis of the compound was performed for 3 components (Ba, Ta and S), and the chemical composition was found to be BaTa2S5. The powder X-ray diffraction peaks were indexable on the basis of a hexagonal cell with lattices constants of a=3.32A, c=25.13A. However, the electron diffraction measurements show that the structure is more complex than that observed by powder X-ray diffraction. The compound indicates metallic behavior and Pauli paramagnetism

  19. Abundance analysis of barium and mild barium stars

    CERN Document Server

    Smiljanic, R; Silva, L


    High signal to noise, high resolution spectra were obtained for a sample of normal, mild barium, and barium giants. Atmospheric parameters were determined from the FeI and FeII lines. Abundances for Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Sr, Y, Zr, Ba, La, Ce, Nd, Sm, Eu, and Gd, were determined from equivalent widths and model atmospheres in a differential analysis, with the red giant Eps Vir as the standard star. The different levels of s-process overabundances of barium and mild barium stars were earlier suggested to be related to the stellar metallicity. Contrary to this suggestion, we found in this work no evidence for barium and mild barium to have a different range in metallicity. However, comparing the ratio of abundances of heavy to light s-process elements, we found some evidence that they do not share the same neutron exposure parameter. The exact mechanism controlling this difference is still not clear. As a by-product of this analysis we identify two normal red giants misclass...

  20. Barium aluminate cement: its application

    International Nuclear Information System (INIS)

    The technology of manufacturing barium aluminate cement from barium sulfate and alumina, using a rotary kiln for firing the clinker is described. The method of granulation of the homogenized charge was used. Conditions of using the ''to mud'' method in industry were indicated. The physical and chemical properties of barium aluminate cement are determined and the quality of several batches of cement prepared on a semi-industrial scale and their suitability for making highly refractory concretes are tested. The optimal composition of the concretes is determined as a function of the mixing water and barium aluminate cement contents. Several experimental batches of concretes were used in the linings of furnaces in the steel industry. The suitability of these cements for use in fields other than steelmaking is examined. It is established that calcium aluminate cement has certain limited applications

  1. Discovery of the Barium Isotopes


    SHORE, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; Schuh, A.; Thoennessen, M


    Thirty-eight barium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  2. Barium light source method and apparatus (United States)

    Curry, John J. (Inventor); MacDonagh-Dumler, Jeffrey (Inventor); Anderson, Heidi M. (Inventor); Lawler, James E. (Inventor)


    Visible light emission is obtained from a plasma containing elemental barium including neutral barium atoms and barium ion species. Neutral barium provides a strong green light emission in the center of the visible spectrum with a highly efficient conversion of electrical energy into visible light. By the selective excitation of barium ionic species, emission of visible light at longer and shorter wavelengths can be obtained simultaneously with the green emission from neutral barium, effectively providing light that is visually perceived as white. A discharge vessel contains the elemental barium and a buffer gas fill therein, and a discharge inducer is utilized to induce a desired discharge temperature and barium vapor pressure therein to produce from the barium vapor a visible light emission. The discharge can be induced utilizing a glow discharge between electrodes in the discharge vessel as well as by inductively or capacitively coupling RF energy into the plasma within the discharge vessel.

  3. Study on the 151Gd → 151Eu decay

    International Nuclear Information System (INIS)

    By means of semiconductor detectors and a coincidence spectrometer on the base of iron-free magnetic beta-spectrometer of ''Organe'' type and a Ge(Li)-detector spectra of gamma-rays, of internal conversion electrons and of esub(γ)-coincidences at the 151Gd decay are studied. A monoisotopic 151Gd spesimen is used. Three new transitions with 109.74; 195.18 and 284.72 keV energies have been discovered. For the first time with a high accuracy internal conversion coefficients have been measured for four electromagnetic transitions. On the basis of analysing an assembly of experimental data a scheme of 151Gd → 151Eu decay is constructed. A new level 216.66 keV is introduced, and previously introduced 260.5; 307.5; 349.8; 358.6 and 416.3 keV levels are confirmed. Physical analysis of obtained results is performed

  4. The half-lives of 151Tb and 151Gd and the absolute gamma ray intensities of 151Gd

    International Nuclear Information System (INIS)

    The gamma rays accompanying the electron capture/positron decay of 151Tb and the electron capture decay of its 151Gd daughter have been studied. The half life of 151Tb has been found to be 17.609+-.014 hours. The half life of 151Gd has been found to be 123.9+-1.0 days and the absolute intensities of the 151Gd gamma rays have been determined. (orig.)

  5. The problem of the barium stars (United States)

    Bohm-Vitense, E.; Nemec, J.; Proffitt, C.


    Ultraviolet observations of barium stars and other cool stars with peculiar element abundances are reported. Those observations attempted to find hot white dwarf companions. Among six real barium stars studied, only Zeta Cap was found to have a white dwarf companion. Among seven mild, or marginal, barium stars studied, at least three were found to have hot subluminous companions. It is likely that all of them have white dwarf companions.

  6. Radioisotope barium sulphate gauge MZB-2

    International Nuclear Information System (INIS)

    A method and the gauge for measuring content of barium sulphate are described. The gauge is intended for fast determination of barium sulphate in barite ore and in output products of the enrichment process. The measuring range 60-100% of BaSO4, accuracy ±1% and measuring time 60 s were reached. The barium sulphate gauge is used in barite mine ''Boguszow'' in Poland. (author)


    Institute of Scientific and Technical Information of China (English)

    GE Qin-min; BIAN Fan; WANG Shu-yun; SHEN Sheng-hui


    @@ Most barium poisoning cases were caused by oral intake by mistake. Recent years, barium carbonate poisoning has been rare to be reported. Here we reported a case of acute barium carbonate toxication taken orally on purpose.

  8. Barium Depletion in Hollow Cathode Emitters (United States)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira


    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the ow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  9. Barium methylphosphonates: synthesis, characterization and mutual interconversions

    Czech Academy of Sciences Publication Activity Database

    Beneš, L.; Melánová, Klára; Svoboda, Jan; Zima, Vítězslav

    Strasbourg: University of Strasbourg, Francie, 2015. P64. [ISIC18 International Symposium on Intercalation Compounds. 31.05.2015-04.06.2015, Strasbourg] R&D Projects: GA ČR(CZ) GA14-13368S Institutional support: RVO:61389013 Keywords : hydrates of barium methylphosphonate * barium hydrogen methylphosphonate * powder X-ray diffraction Subject RIV: CA - Inorganic Chemistry

  10. A new double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jun Sang; Cho, Won Sik; Lee, Sung Woo; Lee, Mun Gyu; Jeon, Jeong Dong; Jaun, Woo Ki; Han, Chung Yul [Inje College Paik Hospital, Pusan (Korea, Republic of)


    A new technic of the barium enema was proposed for the better colonic double contrast study with the average 204ml of 50w/v% barium, applied to 109 serial patients. The barium was introduced to sigmoid colon, and then pushed to a mid transverse colon by the air insufflation through an enema syringe, a new device. An advance to cecum is accomplished by the air insufflation and/or the position change of the patient. The barium transfer method was developed for the best spot film exposure, through colon, by the position change of the patient, the tilting of the x-ray table and the air insufflation with the enema syringe. The mean angle of the x-ray table tilted was -10 .deg. at the beginning the barium enema till the barium sent past the splenic flexure, -15 . deg. for the best lateral view of rectum and -18 .deg. for the bet prone PA view of rectosigmoid colon. This was a simple, better and economic double contrast barium enema for the cooperative patients.

  11. 46 CFR 151.50-60 - Benzene. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Benzene. 151.50-60 Section 151.50-60 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-60 Benzene. The person in charge of...

  12. 46 CFR 151.40-2 - Materials. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Materials. 151.40-2 Section 151.40-2 Shipping COAST... LIQUID HAZARDOUS MATERIAL CARGOES Temperature or Pressure Control Installations § 151.40-2 Materials. Materials used in the construction of temperature or pressure control systems shall be suitable for...

  13. 46 CFR 151.03-47 - Service. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Service. 151.03-47 Section 151.03-47 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Definitions § 151.03-47 Service. The waters upon which a vessel may...

  14. 33 CFR 151.29 - Foreign ships. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Foreign ships. 151.29 Section 151.29 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Pertains to Pollution from Ships Oil Pollution § 151.29 Foreign ships. (a) Each oil tanker of 150...

  15. 46 CFR 151.03-39 - Ocean. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Ocean. 151.03-39 Section 151.03-39 Shipping COAST GUARD... HAZARDOUS MATERIAL CARGOES Definitions § 151.03-39 Ocean. A designation for all vessels normally navigating the waters of any ocean or the Gulf of Mexico more than 20 nautical miles offshore....

  16. 25 CFR 151.13 - Title examination. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Title examination. 151.13 Section 151.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER LAND ACQUISITIONS § 151.13 Title examination. If the Secretary determines that he will approve a request for the acquisition of land...

  17. 1 CFR 15.1 - Cooperation. (United States)


    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Cooperation. 15.1 Section 15.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL, AND PROCESSING OF DOCUMENTS SERVICES TO FEDERAL AGENCIES General § 15.1 Cooperation. The Director of the Federal...

  18. 28 CFR 551.151 - Definitions. (United States)


    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Definitions. 551.151 Section 551.151 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE INSTITUTIONAL MANAGEMENT MISCELLANEOUS Victim and/or Witness Notification § 551.151 Definitions. (a) For purpose of this rule, victim is generally defined as someone who suffers direct...

  19. 19 CFR 151.30 - Sugar closets. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Sugar closets. 151.30 Section 151.30 Customs... (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Sugars, Sirups, and Molasses § 151.30 Sugar closets. Sugar closets for samples shall be substantially built and secured by locks furnished by...

  20. 46 CFR 151.03-19 - Environment. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Environment. 151.03-19 Section 151.03-19 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Definitions § 151.03-19 Environment. This term refers to the atmosphere within a cargo tank and the...

  1. 29 CFR 1926.151 - Fire prevention. (United States)


    ... 29 Labor 8 2010-07-01 2010-07-01 false Fire prevention. 1926.151 Section 1926.151 Labor... (CONTINUED) SAFETY AND HEALTH REGULATIONS FOR CONSTRUCTION Fire Protection and Prevention § 1926.151 Fire prevention. (a) Ignition hazards. (1) Electrical wiring and equipment for light, heat, or power...

  2. 42 CFR 456.151 - Definitions. (United States)


    ... 42 Public Health 4 2010-10-01 2010-10-01 false Definitions. 456.151 Section 456.151 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals § 456.151 Definitions. As...

  3. Synthesis of barium titanium oxide from barium sulphate and anatase. Study of equimolar mixtures under different atmospheres

    International Nuclear Information System (INIS)

    To enable the ceramization of a barium sulphate-rich radioactive waste the synthesis of barium titanium oxide is studied by using anatase and barium sulphate. As a function of the calcination atmosphere, helium (or air) and Ar/H2, two reactions are studied. A mechanism of barium titanium oxide synthesis in helium (or in air) is proposed

  4. Double contrast barium meal and acetylcysteine

    International Nuclear Information System (INIS)

    In a prospective double blind study, acetylcysteine, a local and systemic respiratory tract mucolytic agent, or a placebo, were given to 100 patients prior to a double contrast barium meal to decrease the gastric mucus viscosity and to make the mucus layer thinner, in order to permit barium to outline the furrows surrounding the areae gastricae instead of the overlying thick mucus. However, acetylcysteine failed to improve either visualization of the areae gastricae or the general quality of the double contrast barium meal. (orig.)

  5. Barium adsorption on the (110) and (111) molybdenum faces

    Energy Technology Data Exchange (ETDEWEB)

    Azizov, U.V.; Sabirov, S.T.; Dzhalilov, S.T. (Tashkentskij Gosudarstvennyj Univ. (USSR))


    Barium adsorption on Mo faces (110) and (111) was investigated by thermoemission and Cs surface ionization methods to obtain a more broad representation of barium adsorption at higher temperatures of cathode. Experiments show that the substrate temperature increase at a constant barium concentration results in the formation of small barium islands. At that, barium is under similar energy conditions in the small islands formed on the face (110) independent of relative areas of the islands.

  6. Barium Isotopes in Single Presolar Grains (United States)

    Pellin, M. J.; Davis, A. M.; Savina, M. R.; Kashiv, Y.; Clayton, R. N.; Lewis, R. S.; Amari, S.


    Barium isotopic compositions of single presolar grains were measured by laser ablation laser resonant ionization mass spectrometry and the implications of the data for stellar processes are discussed. Additional information is contained in the original extended abstract.

  7. ED151, A Flawed Approach

    Directory of Open Access Journals (Sweden)

    Brian Andrew


    Full Text Available This paper argues the recent proposals expressed by the Australian Accounting StandardBoard in Exposure Draft 151 contradicts the historical trend of standard setters attemptingto achieve the objective of financial reporting, that is, the provision of decision-usefulinformation for users of general purpose financial reports. Historically, standard settershave tried to achieve this objective by reducing alternative treatments in accountingstandards and providing increasing levels of information for users. Exposure Draft 151affects many standards, however, this paper focuses on the proposal to allow preparers theoption of selecting between the direct or indirect method of presenting cash flows fromoperations in the statement of cash flows. We argue that this discretion contradicts thestated objective of financial reporting, as stated in the Conceptual Framework, as it will leadto the widespread adoption of the less informative indirect method, due to a structural biasin the requirements of AASB 107 and IASB 7, the relevant standards relating to thestatement of cash flows.

  8. An experimental study on barium peritonitis in rats

    International Nuclear Information System (INIS)

    Barium sulfate is universally used contrast media in gastrointestinal roentgenology, and spillage of barium into peritoneal cavity can occur. The references on effect of barium sulfate in the peritoneal cavity have been scattered and the results are varied. In 80 rats, body weight of 130 gm to 150 gm, sterile pure barium, sterile commercial barium, intestinal content, and mixed pure barium and intestinal content were experimentally injected into the peritoneal cavity. Consecutive weekly laparotomy and microscopic examination were done for 4 weeks. The results are as followings: 1. Mind inflammatory reaction and mild adhesion after sterile pure barium injection. 2. Mild inflammatory reaction and moderate adhesion after sterile commercial barium injection. 3. Acute peritonitis and abscess formation after intestinal content injection. 4. High mortality due to severe acute peritonitis, and severe adhesion in survivors after injection of both pure barium and intestinal content.

  9. Bacterial Reduction Of Barium Sulphate By Sulphate-Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Luptáková Alena


    Full Text Available Acid mine drainage (AMD is a worldwide problem leading to contamination of water sources. AMD are characterized by low pH and high content of heavy metals and sulphates. The barium salts application presents one of the methods for the sulphates removing from AMD. Barium chloride, barium hydroxide and barium sulphide are used for the sulphates precipitation in the form of barium sulphate. Because of high investment costs of barium salts, barium sulphide is recycled from barium sulphate precipitates. It can be recycled by thermic or bacterial reduction of barium sulphate. The aim of our study was to verify experimentally the possibility of the bacterial transformation of BaSO4 to BaS by sulphate-reducing bacteria. Applied BaSO4 came from experiments of sulphates removal from Smolnik AMD using BaCl2.

  10. Venous barium embolization, a rare, potentially fatal complication of barium enema: 2 case reports

    International Nuclear Information System (INIS)

    Venous embolization of barium has been recognized for 4 decades as one of the most dreaded complications of barium enema. Fortunately, the condition is extremely rare. In this report, the radiographic findings in 2 cases of venous embolization (one involving the portal vein and one systematic) are described, and ways to decrease the risk of this complication are discussed. (author)

  11. Thermochemical hydrogen production via a cycle using barium and sulfur - Reaction between barium sulfide and water (United States)

    Ota, K.; Conger, W. L.


    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653-866 C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. An expression was derived for the rate of hydrogen formation.

  12. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮


    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  13. Chemical abundances and kinematics of barium stars (United States)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Silva, J. V. Sales


    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, alpha-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of alpha-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anti-correlated with the metallicity. Our kinematical analysis showed that 90% of the barium stars belong to the thin disk population. Based on their luminosities, none of the barium stars are luminous enough to be an AGB star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  14. Chemical abundances and kinematics of barium stars (United States)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Sales Silva, J. V.


    In this paper, we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scaleheight, radial velocities, abundances of the Na, Al, α-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars cannot be represented by a single Gaussian distribution. The abundances of α-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anticorrelated with the metallicity. Our kinematical analysis showed that 90 per cent of the barium stars belong to the thin disc population. Based on their luminosities, none of the barium stars are luminous enough to be an asymptotic giant branch star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  15. 14 CFR Appendix F to Part 151 - Appendix F to Part 151 (United States)


    ...) AIRPORTS FEDERAL AID TO AIRPORTS Pt. 151, App. F Appendix F to Part 151 There is set forth below an.... Transformer or generator vaults. 11. Control panels for field lighting. 12. Control equipment for...

  16. 7 CFR 987.151 - Interhandler transfers. (United States)


    ... IN RIVERSIDE COUNTY, CALIFORNIA Administrative Rules Qualification to Regulation § 987.151 Interhandler transfers. When any handler transfers dates, other than product dates, to another handler,...

  17. 40 CFR 721.10011 - Barium calcium manganese strontium oxide. (United States)


    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium...

  18. Coprecipitation of iron and silver with barium fluoride

    International Nuclear Information System (INIS)

    Distribution of trace contaminants of iron and silver at coprecipitation of barium fluoride is studied in present work. It is defined that iron almost completely coprecipitated with barium fluoride in wide range of ph 5.5-12. Silver coprecipitated with barium fluoride in ph range 4-7. The value of coprecipitation varies from 94% to 100%.

  19. Recrystallization of 223Ra with barium sulfate

    International Nuclear Information System (INIS)

    In this work, the kinetics of barium sulfate recrystallization has been studied in acidic 0.01 mol dm-3 sodium sulfate solution using 223Ra and 133Ba tracers at very low total radium concentration, i.e. less than 10-13 mol dm-3. It was found that the system follows the homogeneous recrystallization model and that recrystallization rates, inferred by the decrease of 223Ra and 133Ba in the aqueous solution, are fast. Therefore, even at very low concentrations, below the solubility limit, radium will be retained by barium sulfate-a mineral present in the deep underground repository. (author)

  20. Printed Barium Strontium Titanate capacitors on silicon

    International Nuclear Information System (INIS)

    In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography

  1. Printed Barium Strontium Titanate capacitors on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Sette, Daniele [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg); Kovacova, Veronika [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Defay, Emmanuel, E-mail: [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg)


    In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography.

  2. 9 CFR 151.4 - Pedigree certificate. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pedigree certificate. 151.4 Section... Purebred Animals § 151.4 Pedigree certificate. A pedigree certificate for an animal of a breed listed in... English in the pedigree certificate for the animal or in a separate certificate appended to the...

  3. 40 CFR 436.151 - Specialized definitions. (United States)


    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 436.151 Section 436.151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Sodium Sulfate Subcategory §...

  4. 40 CFR 98.151 - Reporting threshold. (United States)


    ....151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING HCFC-22 Production and HFC-23 Destruction § 98.151 Reporting threshold... HFC-23 destruction process and the facility meets the requirements of either § 98.2(a)(1) or (a)(2)....

  5. 29 CFR 1952.151 - Developmental schedule. (United States)


    ... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.151 Section 1952.151 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... schedule. The North Carolina Plan is developmental. The following is the schedule of the...

  6. 14 CFR 151.39 - Project eligibility. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Project eligibility. 151.39 Section 151.39 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRPORTS... located; and (ii) Adequate replacement housing that is open to all persons, regardless of race,...

  7. 40 CFR 205.151 - Definitions. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 205.151 Section 205.151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION... the rounded off volumetric engine capacity used for marketing purposes by the motorcycle...

  8. Enterogastroesophageal reflux during barium enema: Report of a case

    International Nuclear Information System (INIS)

    Enterogastric reflux during barium enema examination has been ascribed to various causes including incompetence of the ilepcecal valve, shunt, fistula, excessive barium etc. Recently we have encountered a case of complete enterogastroesphageal regurgitation during barium enema examination performed for the reduction of the ileocolic intuosusception in 6 months old baby. The regurgitation occurred only in the first of two barium enema examinations conducted at one month interval for recurring intussusception. The barium-saline solution used in the present study was not more than 350 ml in quantity. No organic or physical causes of such a complete regurgitation could be determined

  9. 75 FR 19657 - Barium Chloride From China (United States)


    ... Commission found that the domestic interested party group response to its notice of institution (74 FR 31757... COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Notice of Commission determination to conduct a full five-year review concerning the antidumping duty order on...

  10. Impurities in barium titanate posistor ceramics

    Czech Academy of Sciences Publication Activity Database

    Korniyenko, S. M.; Bykov, I. P.; Glinchuk, M. J.; Laguta, V. V.; Belous, A. G.; Jastrabík, Lubomír


    Roč. 239, - (2000), s. 1209-1218. ISSN 0015-0193 Institutional research plan: CEZ:AV0Z1010914 Keywords : barium titanate phase transition * ESR * positive temperature coefficient of resistivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.547, year: 2000

  11. 75 FR 20625 - Barium Chloride From China (United States)


    ... established a schedule for the conduct of this review (74 FR 62587, November 30, 2010). Subsequently, counsel... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION:...

  12. Thermal decomposition of barium valerate in argon

    DEFF Research Database (Denmark)

    Torres, P.; Norby, Poul; Grivel, Jean-Claude


    The thermal decomposition of barium valerate (Ba(C4H9CO2)(2)/Ba-pentanoate) was studied in argon by means of thermogravimetry, differential thermal analysis, IR-spectroscopy, X-ray diffraction and hot-stage optical microscopy. Melting takes place in two different steps, at 200 degrees C and 280...

  13. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    International Nuclear Information System (INIS)

    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound

  14. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, J.P. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Duarte, G.W. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Research Group in Technology and Information, Centro Universitário Barriga Verde (UNIBAVE), Santa Catarina, SC (Brazil); Caldart, C. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Kniess, C.T. [Post-Graduate Program in Professional Master in Management, Universidade Nove de Julho, São Paulo, SP (Brazil); Montedo, O.R.K.; Rocha, M.R. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Riella, H.G. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Fiori, M.A., E-mail: [Post-Graduate Program in Environmental Science, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil); Post-Graduate Program in Technology and Management of the Innovation, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil)


    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound.

  15. 29 CFR 1917.151 - Machine guarding. (United States)


    ... (CONTINUED) MARINE TERMINALS Related Terminal Operations and Equipment § 1917.151 Machine guarding. (a... wheels shall turn at a speed that is compatible with the rated speed of the wheel. (7) Flanges...

  16. 46 CFR 151.56-1 - Prohibited materials. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Prohibited materials. 151.56-1 Section 151.56-1 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Prohibited Materials of Construction § 151.56-1 Prohibited materials. When one of the following paragraphs of this section is referenced in table 151.05, the...

  17. Radioactive Barium Ion Trap Based on Metal-Organic Framework for Efficient and Irreversible Removal of Barium from Nuclear Wastewater. (United States)

    Peng, Yaguang; Huang, Hongliang; Liu, Dahuan; Zhong, Chongli


    Highly efficient and irreversible capture of radioactive barium from aqueous media remains a serious task for nuclear waste disposal and environmental protection. To address this task, here we propose a concept of barium ion trap based on metal-organic framework (MOF) with a strong barium-chelating group (sulfate and sulfonic acid group) in the pore structures of MOFs. The functionalized MOF-based ion traps can remove >90% of the barium within the first 5 min, and the removal efficiency reaches 99% after equilibrium. Remarkably, the sulfate-group-functionalized ion trap demonstrates a high barium uptake capacity of 131.1 mg g(-1), which surpasses most of the reported sorbents and can selectively capture barium from nuclear wastewater, whereas the sulfonic-acid-group-functionalized ion trap exhibits ultrafast kinetics with a kinetic rate constant k2 of 27.77 g mg(-1) min(-1), which is 1-3 orders of magnitude higher than existing sorbents. Both of the two MOF-based ion traps can capture barium irreversibly. Our work proposes a new strategy to design barium adsorbent materials and provides a new perspective for removing radioactive barium and other radionuclides from nuclear wastewater for environment remediation. Besides, the concrete mechanisms of barium-sorbent interactions are also demonstrated in this contribution. PMID:26999358

  18. Prospects for Barium Tagging in Gaseous Xenon

    International Nuclear Information System (INIS)

    Tagging events with the coincident detection of a barium ion would greatly reduce the background for a neutrino-less double beta decay search in xenon. This paper describes progress towards realizing this goal. It outlines a source that can produce large quantities of Ba++ in gas, shows that this can be extracted to vacuum, and demonstrates a mechanism by which the Ba++ can be efficiently converted to Ba+ as required for laser identification.

  19. Production of translationally cold barium monohalide ions


    DePalatis, M. V.; Chapman, M.S.


    We have produced sympathetically cooled barium monohalide ions BaX$^+$ (X = F, Cl, Br) by reacting trapped, laser cooled Ba$^+$ ions with room temperature gas phase neutral halogen-containing molecules. Reaction rates for two of these (SF$_6$ and CH$_3$Cl) have been measured and are in agreement with classical models. BaX$^+$ ions are promising candidates for cooling to the rovibrational ground state, and our method presents a straightforward way to produce these polar molecular ions.

  20. Dicty_cDB: SSK151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSK151 (Link to dictyBase) - - - Contig-U00319-1 SSK151P (Link to Original site) SS...K151F 720 SSK151Z 574 SSK151P 1294 - - Show SSK151 Library SS (Link to library) Clone ID SS...e URL Representative seq. ID SS...K151P (Link to Original site) Representative DNA sequence >SSK151 (SSK151Q) /CSM/SS/SSK1-C/SSK...***nk*wik**fts*hq***cww*irfrg*w*w*w*yktnklfit*k*ww*f nk*lk**sss**q*qrr**rk**s*eqq

  1. Chemical abundances and kinematics of barium stars

    CERN Document Server

    de Castro, D B; Roig, F; Jilinski, E; Drake, N A; Chavero, C; Silva, J V Sales


    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, $alpha$-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code {\\sc moog}. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of $alpha$-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heav...

  2. Barium hexaferrite nanoparticles: Synthesis and magnetic properties

    Energy Technology Data Exchange (ETDEWEB)

    Martirosyan, K.S., E-mail: [Department of Chemical and Biomolecular Engineering, University of Houston, Houston, TX 77204 (United States); Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Department of Electrical and Computer Engineering, University of Houston, Houston, TX 77204 (United States); Galstyan, E. [Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Hossain, S.M.; Wang Yiju [Department of Electrical and Computer Engineering, University of Houston, Houston, TX 77204 (United States); Litvinov, D. [Department of Chemical and Biomolecular Engineering, University of Houston, Houston, TX 77204 (United States); Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Department of Electrical and Computer Engineering, University of Houston, Houston, TX 77204 (United States)


    Carbon combustion synthesis is applied to rapid and energy efficient fabrication of crystalline barium hexaferrite nanoparticles with the average particle size of 50-100 nm. In this method, the exothermic oxidation of carbon nanoparticles with an average size of 5 nm with a surface area of 80 m{sup 2}/g generates a self-propagating thermal wave with maximum temperatures of up to 1000 deg. C. The thermal front rapidly propagates through the mixture of solid reactants converting it to the hexagonal barium ferrite. Carbon is not incorporated in the product and is emitted from the reaction zone as a gaseous CO{sub 2}. The activation energy for carbon combustion synthesis of BaFe{sub 12}O{sub 19} was estimated to be 98 kJ/mol. A complete conversion to hexagonal barium ferrite is obtained for carbon concentration exceeding 11 wt.%. The magnetic properties H{sub c}{approx}3000 Oe and M{sub s}{approx}50.3 emu/g of the compact sintered ferrites compare well with those produced by other synthesis methods.

  3. Barium hexaferrite nanoparticles: Synthesis and magnetic properties

    International Nuclear Information System (INIS)

    Carbon combustion synthesis is applied to rapid and energy efficient fabrication of crystalline barium hexaferrite nanoparticles with the average particle size of 50-100 nm. In this method, the exothermic oxidation of carbon nanoparticles with an average size of 5 nm with a surface area of 80 m2/g generates a self-propagating thermal wave with maximum temperatures of up to 1000 deg. C. The thermal front rapidly propagates through the mixture of solid reactants converting it to the hexagonal barium ferrite. Carbon is not incorporated in the product and is emitted from the reaction zone as a gaseous CO2. The activation energy for carbon combustion synthesis of BaFe12O19 was estimated to be 98 kJ/mol. A complete conversion to hexagonal barium ferrite is obtained for carbon concentration exceeding 11 wt.%. The magnetic properties Hc∼3000 Oe and Ms∼50.3 emu/g of the compact sintered ferrites compare well with those produced by other synthesis methods.

  4. Lanthanide doped strontium-barium cesium halide scintillators (United States)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew


    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  5. Spasmolytic effect of peppermint oil in barium during double-contrast barium enema compared with Buscopan

    Energy Technology Data Exchange (ETDEWEB)

    Asao, T.; Kuwano, H.; Ide, M.; Hirayama, I.; Nakamura, J.-I.; Fujita, K.-I.; Horiuti, R


    AIM: To evaluate the efficacy of peppermint oil in barium as a spasmolytic agent during a double-contrast barium enema (DCBE). MATERIALS AND METHODS: A total of 383 DCBEs with positive results from occult blood tests were assessed. Patients were assigned to one of four groups: peppermint in barium (n=91), peppermint in tube (n=90), Buscopan (n=105), or no treatment (n=97). After a screening sigmoidoscopy, the DCBEs were performed using air as a distending gas. In the Buscopan group, the DCBE was performed with an intramuscular injection of 20 mg Buscopan at the start of the examination. Patients in the no-treatment group underwent DCBE without any spasmolytic agent. A peppermint oil preparation (30 ml) was mixed in the barium solution for patients in the peppermint-in-barium group, and the same dose of peppermint oil was included in the enema tube in the peppermint-in-tube group. The presence of spasm on a series of spot films was evaluated without information about the type of spasmolytic agent used. RESULTS: The percentage of patients in the four groups (no treatment, Buscopan, peppermint in tube, and peppermint in barium) with absence of spasm in the entire colon on the series of spot films was 13.4, 38.1, 41.8, and 37.8%, respectively. In the group using peppermint oil or Buscopan, the rate of patients with non-spasm examination was higher than that in no-treatment group (p<0.0005). Peppermint oil had the same spasmolytic effect as the systemic administration of Buscopan in the transverse and descending colon. Peppermint oil had a stronger effect in the caecum and the ascending colon than a Buscopan injection (p<0.005). There was no advantage to placing peppermint oil in the enema tube over mixing it in the barium solution. A total of 157 polyps were found during the DCBE procedures, and no differences were observed in the number of lesions among the four groups. Peppermint oil did not impair image quality. CONCLUSION: Barium solution mixed with peppermint oil

  6. 46 CFR Table 151.05 to Subpart 151... - Summary of Minimum Requirements (United States)


    ... Cargo handling space Fireprotection required Special requirements in 46 CFR Part 151 Electrical hazard... Fireprotection required Special requirements in 46 CFR Part 151 Electrical hazard class and group Temp. control... SR Restr. II-L P-1 NR Vent F No .40-1(a).50-30 .50-36 NA .40-1(a) G 1- or 2-Nitropropane Atmos....

  7. The Tetraspanin CD151 in Papillomavirus Infection

    Directory of Open Access Journals (Sweden)

    Konstanze D. Scheffer


    Full Text Available Human papillomaviruses (HPV are non-enveloped DNA tumor viruses that infect skin and mucosa. The most oncogenic subtype, HPV16, causes various types of cancer, including cervical, anal, and head and neck cancers. During the multistep process of infection, numerous host proteins are required for the delivery of virus genetic information into the nucleus of target cells. Over the last two decades, many host-cell proteins such as heparan sulfate proteoglycans, integrins, growth factor receptors, actin and the tetraspanin CD151 have been described to be involved in the process of infectious entry of HPV16. Tetraspanins have the ability to organize membrane microdomains and to directly influence the function of associated molecules, including binding of receptors to their ligands, receptor oligomerization and signal transduction. Here, we summarize the current knowledge on CD151, and CD151-associated partners during HPV infection and discuss the underlying mechanisms.

  8. Barium enema findings of milk allergy in infants

    International Nuclear Information System (INIS)

    We wanted to evaluate the barium enema findings of milk allergy in infants. Retrospective evaluation of the plain abdominal radiography and barium enema findings was performed in fifteen young infants suffering with milk allergy. The presence of gaseous distension, rectal gas, paralytic ileus and mechanical obstruction was evaluated on the plain radiography. The presence of spasm, a transitional zone, a reversed rectosigmoid index and mucosal irregularity was analyzed on the barium enema; the presence of barium retention was also evaluated on 24-hour-delayed plain radiography. Paralytic ileus was the most common finding on the plain radiography (93%). On the barium enema, continuous spasm of the colon, ranging from the rectum to the descending colon, was revealed in ten infants (67%). A transitional zone was observed in one infant and a reversed rectosigmoid index was revealed in four. Mucosal irregularity was observed in two infants. Barium retention was demonstrated in 11 of fifteen cases: throughout the entire colon (n = 3), from the rectum to the descending colon (n = 7), and up to the transverse colon (n = 1). The most common barium enema finding of milk allergy in infants was spasm of the distal colon. The other findings were a transitional zone, a reversed rectosigmoid index, mucosal irregularity and barium retention

  9. Synthesis of double perxenate of lanthanum and barium

    International Nuclear Information System (INIS)

    Synthesis of double perxenate of lanthanum and barium on the basis of sodium perxenate and lanthanum and barium acetates, is described. The obtained compound is characterized by means of element analysis, x-ray-electron-, IR- and RS-spectroscopy. Its thermal stability and water solubility are determined


    A study was conducted to determine the biological availability of naturally occurring barium in a municipal drinking water by the analysis of barium in deciduous teeth of children. The grade school children of two Illinois towns were chosen for the study. The towns were chosen ba...

  11. Colour centres in barium hexaaluminate (phase I)

    International Nuclear Information System (INIS)

    Colour centres produced by X-ray irradiation of barium hexaaluminate (phase I) with β-alumina structure are studied by electron paramagnetic resonance, optical absorption, and thermally stimulated luminescence. It is shown that in addition to the F+ centres characteristic of β-alumina phases, this compound presents other colour centres such as F, O-, and possibly V-type centres. The stability of these defects is investigated by means of thermal bleaching experiments and thermally stimulated luminescence. An alternative model to the generally accepted one is proposed, for the F+ centres, together with a mechanism of defect formation. (author)

  12. Short-cavity squeezing in barium (United States)

    Hope, D. M.; Bachor, H-A.; Manson, P. J.; Mcclelland, D. E.


    Broadband phase sensitive noise and squeezing were experimentally observed in a system of barium atoms interacting with a single mode of a short optical cavity. Squeezing of 13 +/- 3 percent was observed. A maximum possible squeezing of 45 +/- 8 percent could be inferred for out experimental conditions, after correction for measured loss factors. Noise reductions below the quantum limit were found over a range of detection frequencies 60-170 MHz and were best for high cavity transmission and large optical depths. The amount of squeezing observed is consistent with theoretical predictions from a full quantum statistical model of the system.

  13. Duodenal diverticula demonstrated by barium examination

    Energy Technology Data Exchange (ETDEWEB)

    Christiansen, T.; Thommesen, P.

    An investigation for biliary tract calculi and food-stimulated gastro-oesophageal reflux was carried out in 37 patients with duodenal diverticula demonstrated by barium examination. Sixty per cent of the diverticula were located in the descending part of the duodenum. Biliary tract calculi were demonstrated in 38 per cent and food-stimulated gastro-oesophageal reflux in 81 per cent of the patients. The detection of a duodenal diverticulum should result in a supplementary investigation for gallstones and gastrooesophageal reflux and its sequelae.

  14. Barium dithionate as an EPR dosemeter. (United States)

    Baran, M P; Bugay, O A; Kolesnik, S P; Maksimenko, V M; Teslenko, V V; Petrenko, T L; Desrosiers, M F


    Electron paramagnetic resonance (EPR) dosimetry is growing in popularity and this success has encouraged the search for other dosimetric materials. Previous studies of gamma-irradiated barium dithionate (BaS(2)O(6) x 2H(2)O) have shown promise for its use as a radiation dosemeter. This work studies in greater detail several essential attributes of the system. Special attention has been directed to the study of EPR response dependences on microwave power, irradiation temperature, minimum detectable dose and post-irradiation stability. PMID:16565205

  15. Scattering lengths of calcium and barium isotopes


    Dammalapati, U.; Willmann, L.; Knoop, S.


    We have calculated the s-wave scattering length of all the even isotopes of calcium (Ca) and barium (Ba), in order to investigate the prospect of Bose-Einstein condensation (BEC). For Ca we have used an accurate molecular potential based on detailed spectroscopic data. Our calculations show that Ca does not provide other isotopes alternative to the recently Bose condensed 40Ca that suffers strong losses because of a very large scattering length. For Ba we show by using a model potential that ...

  16. Barium cardiotoxicity: Relationship between ultrastructural damage and mechanical effects. (United States)

    Delfino, G; Amerini, S; Mugelli, A


    The ultrastructural damage in guinea-pig ventricular strips caused by barium was analysed. At a concentration of 1 mmol/litre, barium chloride caused a dramatic increase in the developed tension associated with the onset of automaticity. The ultrastructural analysis demonstrated that barium caused notable and consistent alterations which affected most myocyte components. Various degenerative aspects were observed in mitochondria and in the contractile apparatus. Glycogen deposits were completely depleted. Preparations driven at 4 Hz (i.e. the rate of spontaneous firing of barium-treated preparations) showed moderate ultrastructural alterations, thus demonstrating that the increase in the rate of beating is not the only determinant of the observed damage. These results suggest that the myocardial toxicity of barium is due not only to the well-known modifications in membrane permeability, but possibly also to alterations in cell function. PMID:20702358

  17. Barium and radium migration in unconsolidated Canadian geological materials

    International Nuclear Information System (INIS)

    This report describes the results of laboratory studies on the distribution coefficients of radium and barium in samples of unconsolidated geologic materials. Graphs of Ksub(d) versus solution concentration for the respective elements showed constant Ksub(d) values in the low concentration range suggesting that, at low concentrations, a distribution coefficient is a valid means of representing the geochemical reactions of both barium and radium. The Ksub(d) values for barium range between 60 and 3500 ml/g. The values appear to be influenced by the amount of barium occurring naturally in the soil materials and thus there is little possiblility of using barium as an analog of radium in laboratory experiments. The Ksub(d) values of radium vary from 50 to 1000 ml/g indicating that a wide range of geological materials have a substantial capacity to retard the migration of radium

  18. The Novel Formation of Barium Titanate Nanodendrites

    Directory of Open Access Journals (Sweden)

    Chien-Jung Huang


    Full Text Available The barium titanate (BaTiO3 nanoparticles with novel dendrite-like structures have been successfully fabricated via a simple coprecipitation method, the so-called BaTiO3 nanodendrites (BTNDs. This method was remarkable, fast, simple, and scalable. The growth solution is prepared by barium chloride (BaCl2, titanium tetrachloride (TiCl4, and oxalic acid. The shape and size of BaTiO3 depend on the amount of added BaCl2 solvent. To investigate the influence of amount of BaCl2 on BTNDs, the amount of BaCl2 was varied in the range from 3 to 6 mL. The role of BaCl2 is found to have remarkable influence on the morphology, crystallite size, and formation of dendrite-like structures. The thickness and length of the central stem of BTND were ~300 nm and ~20 μm, respectively. The branchings were found to occur at irregular intervals along the main stem. Besides, the formation mechanism of BTND is proposed and discussed.

  19. High resolution studies of barium Rydberg states

    International Nuclear Information System (INIS)

    The subtle structure of Rydberg states of barium with orbital angular momentum 0, 1, 2 and 3 is investigated. Some aspects of atomic theory for a configuration with two valence electrons are reviewed. The Multi Channel Quantum Defect Theory (MQDT) is concisely introduced as a convenient way to describe interactions between Rydberg series. Three high-resolution UV studies are presented. The first two, presenting results on a transition in indium and europium serve as an illustration of the frequency doubling technique. The third study is of hyperfine structure and isotope shifts in low-lying p states in Sr and Ba. An extensive study of the 6snp and 6snf Rydberg states of barium is presented with particular emphasis on the 6snf states. It is shown that the level structure cannot be fully explained with the model introduced earlier. Rather an effective two-body spin-orbit interaction has to be introduced to account for the observed splittings, illustrating that high resolution studies on Rydberg states offer an unique opportunity to determine the importance of such effects. Finally, the 6sns and 6snd series are considered. The hyperfine induced isotope shift in the simple excitation spectra to 6sns 1S0 is discussed and attention is paid to series perturbers. It is shown that level mixing parameters can easily be extracted from the experimental data. (Auth.)


    Directory of Open Access Journals (Sweden)

    GRISHINA Anna Nikolaevna


    Full Text Available Cement concretes are the most used materials in modern civil engineering. Due to that such materials draw great attention both in the Russian Federation and abroad. The possibility to enhance the manufacturability and operational properties of concretes results in significant reduction of overall operating costs. Many enhancement methods have been elaborated. Among them there is one based on introduction of calcium hydrosilicates into construction composition. The authors set up a hypothesis that similarity between properties and structures of different hydrosilicates (for example, alkaline earth metals and metals of the second group will provide similar increased operational characteristics. The specialists of Research and Educational Center «Nanotechnology» are developing cement composites nanomodification methods which include introduction of nanodimensional barium hydrosilicates particles. The synthesis of barium hydrosilicates particles can be done with the use of many technologies, different by energy consumption or performing complexity. Taking into account both these factors, one can assume that low-temperature sol-gel synthesis from diluted water solutions is the proper technology. The present paper shows that this assumption is correct. The selection of certain technology is made by the means of multiobjective optimization, which is in turn is performed by the means of linear scalarization. This method, while not always giving the Pareto optimal solutions, can be easily implemented. The particle size distribution is taken into consideration during selection of objectives and weights. It is shown that selected technology allows manufacturing nanoparticles with median size about 30 nm.

  1. Coprecipitation of europium with barium sulphate

    International Nuclear Information System (INIS)

    The distribution behaviour of the trivalent europium ion at a micro-component scale, between barium sulphate and aqueous solution, was studied at ambient temperature. Experiments were carried out using radioactive tracers. Results indicate an enrichment of the micro component in the solid phase relative to the solution. The effects of the concentrations of the micro and macro-elements on the coprecipitation have been examined. Europium distribution coefficient DEu increases from 1.1 ± 0.2 to 3.2 ± 0.4 when initial europium concentration decreases from more than 17 x 10-5 to 1.4 x 10-5 M, in sulphuric media with SO42- in excess or CBa2+/CSO42- Eu. The coprecipitation of europium with barium sulphate as a heterovalent solid-solution is described by heterogeneous model obeying the Doerner and Hoskins logarithmic partition law. The weaker partition coefficients lower than unity (λ = 0.25 when CEu(III) ∼ 1.4 x 10-5 M and λ = 0.13 when CBa2+/CSO42- -5 ≤ CEu(III) = 153.5 x 10-5 M) lead to crystals increasingly enriched in the trace element. (orig.)

  2. Photon attenuation characteristics of barium enriched cement

    International Nuclear Information System (INIS)

    Nuclear radiations are widely used in several applications of nuclear sciences, medicine and industry. In the design and construction of installations housing high intensity radioactive sources and other radiation generating equipment, a variety of shielding materials are used to minimise the exposure to the individuals. Among the materials used, lead is best known for radiation shielding due to its high density and atomic number. However, in construction of radiation facilities, lead in the form of bricks or slabs cannot be substituted for cement as building material. As an alternative, barium enriched cement, which apart from better compressive strength, smoother surface finish and high abrasive resistance, offers adequate shielding to gamma radiations. In the present work, attenuation properties of commercial as well as barium enriched cements have been studied and compared with that of lead for photons of 662 and 1250 keV emitted from 137Cs and 60Co, respectively. Although photon attenuation data can be obtained by mixture rule theoretically, it is necessary to determine this data experimentally before use

  3. 27 CFR 9.151 - Puget Sound. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Puget Sound. 9.151 Section... Sound. (a) Name. The name of the viticultural area described in this section is “Puget Sound.” (b) Approved maps. The appropriate maps for determining the boundary of the Puget Sound viticultural area...

  4. 44 CFR 206.151 - Food commodities. (United States)


    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Food commodities. 206.151... Food commodities. (a) The Administrator will assure that adequate stocks of food will be ready and... section, the Administrator may direct the Secretary of Agriculture to purchase food commodities...

  5. 43 CFR 15.1 - Scope. (United States)


    ...: Interior Office of the Secretary of the Interior KEY LARGO CORAL REEF PRESERVE § 15.1 Scope. The State of Florida has established a similar coral reef preserve on an area situated shoreward of a line three geographic miles from Key Largo and contiguous to the Key Largo Coral Reef Preserve. It is the policy of...

  6. 20 CFR 655.151 - Newspaper advertisements. (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Newspaper advertisements. 655.151 Section 655... advertisements. (a) The employer must place an advertisement (in a language other than English, where the CO... job opportunity. Newspaper advertisements must satisfy the requirements set forth in § 655.152. (b)...

  7. 33 CFR 151.30 - Applicability. (United States)


    ....30 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Pertains to Pollution from Ships Noxious Liquid Substance Pollution § 151.30 Applicability. (a) Except as... miles from land; (4) Is operated under the authority of the United States and operates at any...

  8. 33 CFR 151.09 - Applicability. (United States)


    ....09 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Pertains to Pollution from Ships Oil Pollution § 151.09 Applicability. (a) Except as provided in paragraph... United States and is certificated for coastwise service beyond three nautical miles from land; (4)...

  9. 33 CFR 151.55 - Recordkeeping requirements. (United States)


    ... (CONTINUED) POLLUTION VESSELS CARRYING OIL, NOXIOUS LIQUID SUBSTANCES, GARBAGE, MUNICIPAL OR COMMERCIAL WASTE... Antarctic Treaty as it Pertains to Pollution from Ships Garbage Pollution and Sewage § 151.55 Recordkeeping...) Plastic material. (ii) Floating dunnage, lining, or packing material. (iii) Ground paper products,...

  10. 34 CFR 300.151 - Adoption of State complaint procedures. (United States)


    ... 34 Education 2 2010-07-01 2010-07-01 false Adoption of State complaint procedures. 300.151 Section 300.151 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF... EDUCATION OF CHILDREN WITH DISABILITIES State Eligibility State Complaint Procedures § 300.151 Adoption...

  11. 14 CFR 151.121 - Procedures: Offer; sponsor assurances. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Procedures: Offer; sponsor assurances. 151.121 Section 151.121 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... Engineering Proposals § 151.121 Procedures: Offer; sponsor assurances. Each sponsor must adopt the...

  12. 46 CFR 151.58-1 - Required materials. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Required materials. 151.58-1 Section 151.58-1 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Required Materials of Construction § 151.58-1 Required materials... materials listed in that paragraph may be used in components that contact the cargo or its vapor:...

  13. 46 CFR 160.151-37 - Servicing manual. (United States)


    ... 46 Shipping 6 2010-10-01 2010-10-01 false Servicing manual. 160.151-37 Section 160.151-37 Shipping...: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Inflatable Liferafts (SOLAS) § 160.151-37 Servicing manual. (a) The servicing manual must provide instructions on performing the following tasks: (1) Removing...

  14. 46 CFR 151.03-21 - Filling density. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Filling density. 151.03-21 Section 151.03-21 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Definitions § 151.03-21 Filling density. The ratio, expressed...

  15. 9 CFR 151.5 - Alteration of pedigree certificate. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Alteration of pedigree certificate. 151.5 Section 151.5 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... Certification of Purebred Animals § 151.5 Alteration of pedigree certificate. No pedigree certificate which...

  16. 46 CFR 151.25-2 - Cargo handling space. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Cargo handling space. 151.25-2 Section 151.25-2 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Environmental Control § 151.25-2 Cargo handling space. Pump rooms, compressor rooms, refrigeration rooms, heating rooms, instrument rooms or other closed...

  17. 46 CFR 160.151-9 - Independent laboratory. (United States)


    ... 46 Shipping 6 2010-10-01 2010-10-01 false Independent laboratory. 160.151-9 Section 160.151-9...: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Inflatable Liferafts (SOLAS) § 160.151-9 Independent laboratory. Tests and inspections that this subpart requires to be conducted by an independent laboratory must...

  18. 46 CFR 151.50-21 - Sulfuric acid. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Sulfuric acid. 151.50-21 Section 151.50-21 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-21 Sulfuric acid. (a) How sulfuric acid may be carried. (1) Sulfuric acid...

  19. 46 CFR 151.13-5 - Cargo segregation-tanks. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Cargo segregation-tanks. 151.13-5 Section 151.13-5... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Cargo Segregation § 151.13-5 Cargo segregation—tanks. (a... and list the various degrees of segregation required. Paragraphs and (2) of this section explain...

  20. 46 CFR 151.45-7 - Shipping papers. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Shipping papers. 151.45-7 Section 151.45-7 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Operations § 151.45-7 Shipping papers. Each barge carrying dangerous cargo shall have on board a bill of lading, manifest, or shipping document giving the name...

  1. 46 CFR 151.03-33 - Lakes, bays, and sounds. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Lakes, bays, and sounds. 151.03-33 Section 151.03-33... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Definitions § 151.03-33 Lakes, bays, and sounds. A designation for all vessels navigating the waters of any of the lakes, bays, or sounds other than the...

  2. 46 CFR 151.03-29 - Great Lakes. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Great Lakes. 151.03-29 Section 151.03-29 Shipping COAST... LIQUID HAZARDOUS MATERIAL CARGOES Definitions § 151.03-29 Great Lakes. A designation for all vessels in Great Lakes service....

  3. 19 CFR 151.25 - Mixing classes of sugar. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Mixing classes of sugar. 151.25 Section 151.25... TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Sugars, Sirups, and Molasses § 151.25 Mixing classes of sugar. No regulations relative to the weighing, taring, sampling,...

  4. 19 CFR 151.22 - Estimated duties on raw sugar. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Estimated duties on raw sugar. 151.22 Section 151.22 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Molasses § 151.22 Estimated duties on raw sugar. Estimated duties shall be taken on raw sugar, as...

  5. 7 CFR 58.151 - Packaging and repackaging. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Packaging and repackaging. 58.151 Section 58.151... Specifications for Dairy Plants Approved for USDA Inspection and Grading Service 1 Packaging and General Identification § 58.151 Packaging and repackaging. (a) Packaging dairy products or cutting and repackaging...

  6. 46 CFR 151.50-6 - Motor fuel antiknock compounds. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Motor fuel antiknock compounds. 151.50-6 Section 151.50... BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-6 Motor fuel antiknock compounds. When transporting motor fuel antiknock compounds containing tetraethyl lead...

  7. 19 CFR 151.54 - Testing by Customs laboratory. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Testing by Customs laboratory. 151.54 Section 151.54 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Other Metal-Bearing Materials § 151.54 Testing by Customs laboratory. Samples taken in accordance...

  8. 29 CFR 1910.151 - Medical services and first aid. (United States)


    ... 29 Labor 5 2010-07-01 2010-07-01 false Medical services and first aid. 1910.151 Section 1910.151..., DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Medical and First Aid § 1910.151 Medical services and first aid. (a) The employer shall ensure the ready availability of medical personnel...

  9. 19 CFR 151.83 - Method of sampling. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Method of sampling. 151.83 Section 151.83 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Cotton § 151.83 Method of sampling. For determining the staple length of any lot...

  10. Do all barium stars have a white dwarf companion? (United States)

    Dominy, J. F.; Lambert, D. L.


    International Ultraviolet Explorer short-wavelength, low-dispersion spectra were analyzed for four barium, two mild barium, and one R-type carbon star in order to test the hypothesis that the barium and related giants are produced by mass transfer from a companion now present as a white dwarf. An earlier tentative identification of a white dwarf companion to the mild barium star Zeta Cyg is confirmed. For the other stars, no ultraviolet excess attributable to a white dwarf is seen. Limits are set on the bolometric magnitude and age of a possible white dwarf companion. Since the barium stars do not have obvious progenitors among main-sequence and subgiant stars, mass transfer must be presumed to occur when the mass-gaining star is already on the giant branch. This restriction, and the white dwarf's minimum age, which is greater than 8 x 10 to the 8th yr, determined for several stars, effectively eliminates the hypothesis that mass transfer from an asymptotic giant branch star creates a barium star. Speculations are presented on alternative methods of producing a barium star in a binary system.

  11. Designed microstructures in textured barium hexaferrite (United States)

    Hovis, David Brian

    It is a fundamental principle of materials science that the microstructure of a material defines its properties and ultimately its performance for a given application. A prime example of this can be found in the large conch shell Strombus gigas, which has an intricate microstructure extending across five distinct length scales. This microstructure gives extraordinary damage tolerance to the shell. The structure of Strombus gigas cannot be replicated in a modern engineering ceramic with any existing processing technique, so new processing techniques must be developed to apply this structure to a model material. Barium hexaferrite was chosen as a model material to create microstructures reminiscent of Strombus gigas and evaluate its structure-property relations. This work describes novel processing methods to produce textured barium hexaferrite with no coupling between the sample geometry and the texture direction. This technique, combining magnetic field-assisted gelcasting with templated grain growth, also allows multilayer samples to be fabricated with different texture directions in adjacent layers. The effects of adding either B2O3 or excess BaCO 3 on the densification and grain growth of barium hexaferrite was studied. The texture produced using this technique was assessed using orientation imaging microscopy (OIM) at Oak Ridge National Laboratory. These measurements showed peak textures as high as 60 MRD and sharp interfaces between layers cast with different texture directions. The effect of oxygen on the quality of gelcasting is also discussed, and it is shown that with proper mold design, it is possible to gelcast multiple layers with differing texture directions without delamination. Monolithic and multilayer samples were produced and tested in four point bending to measure the strength and work of fracture. Modulus measurements, made with the ultrasonic pulse-echo technique, show clear signs of microcracking in both the isotropic and textured samples

  12. Chemical composition of Eu2+ luminescence in the barium hexaaluminates

    International Nuclear Information System (INIS)

    This paper consists of two parts. In the first part the chemical composition of two kinds of barium hexaaluminate (one poor and one rich in barium) is explained using the local electroneutrality concept. In the second part a reinvestigation of the Eu2+ luminescence in these compounds is reported. The emission spectrum of each of the two compounds shows a blue and a green emission bank. The blue emission bank is ascribed to Eu2+ ions at barium sites, whereas the green emission band is identified with Eu2+ ions incorporated at aluminum sites within spinel blocks of the structure

  13. Magic Wavelength of an Optical Clock Transition of Barium

    International Nuclear Information System (INIS)

    Similar to most of the other alkaline earth elements, barium atoms can be candidates for optical clocks, thus the magic wavelength for an optical lattice is important for the clock transition. We calculate the magic wavelength of a possible clock transition between 6s21S0 and 6s5d3 D2 states of barium atoms. Our theoretical result shows that there are three magic wavelengths 615.9nm, 641.2nm and 678.8nm for a linearly polarized optical lattice laser for barium. (atomic and molecular physics)

  14. A novel barium polymeric membrane sensor for selective determination of barium and sulphate ions based on the complex ion associate barium(II)-Rose Bengal as neutral ionophore

    Energy Technology Data Exchange (ETDEWEB)

    Othman, A.M. [Genetic Engineering and Biotechnology Research Institute (GEBRI), Minufiya University, Sadat City (Egypt); El-Shahawi, M.S. [Chemistry Department, Faculty of Science at Damiatta, Mansoura University, Damiatta, Dumyat 34517 (Egypt)]. E-mail:; Abdel-Azeem, M. [Chemistry Department, Faculty of Science at Damiatta, Mansoura University, Damiatta, Dumyat 34517 (Egypt)


    A simple, long life, rapid response and sensitive barium(II)-PVC membrane sensor that typically follows Nernstian behavior has been developed for the assay of barium(II) ions. The developed sensor has been made by incorporating the complex ion associate of barium(II)-Rose Bengal (Ba-RB) as an ionophore into a plasticized PVC matrix. The sensor is stable and exhibited fast potential response of 20 s and gave a good linear response with a Nernstian slope of 28.5 {+-} 0.4 mV/decade of activity within the concentration range 5 x 10{sup -5} to 10{sup -1} M over a wide range of pH 4.5-10.0 for barium(II) ions. The developed sensor showed comparatively good selectivity for barium(II) ions with respect to other alkali, alkaline earth, transition and heavy metal ions. The plasticizer o-nitrophenyloctyl ether controlled significantly the calibration slope and the lifetime of the fabricated sensor. The proposed sensor was used successfully for the analysis of barium(II) ions in wastewater samples and in lithophone pigment with excellent recovery percentages in the range 98.9-99.8 {+-} 1.6%. The determination of sulphate in fresh and potable water samples with the developed sensor has been also achieved successfully. The described sensor provides a reliable means with good correlation with the data obtained by atomic absorption spectrometry (AAS) and other spectrophotometric methods for the analysis of trace amounts of barium(II) and/or sulphate ions in different matrices.

  15. A novel barium polymeric membrane sensor for selective determination of barium and sulphate ions based on the complex ion associate barium(II)-Rose Bengal as neutral ionophore

    International Nuclear Information System (INIS)

    A simple, long life, rapid response and sensitive barium(II)-PVC membrane sensor that typically follows Nernstian behavior has been developed for the assay of barium(II) ions. The developed sensor has been made by incorporating the complex ion associate of barium(II)-Rose Bengal (Ba-RB) as an ionophore into a plasticized PVC matrix. The sensor is stable and exhibited fast potential response of 20 s and gave a good linear response with a Nernstian slope of 28.5 ± 0.4 mV/decade of activity within the concentration range 5 x 10-5 to 10-1 M over a wide range of pH 4.5-10.0 for barium(II) ions. The developed sensor showed comparatively good selectivity for barium(II) ions with respect to other alkali, alkaline earth, transition and heavy metal ions. The plasticizer o-nitrophenyloctyl ether controlled significantly the calibration slope and the lifetime of the fabricated sensor. The proposed sensor was used successfully for the analysis of barium(II) ions in wastewater samples and in lithophone pigment with excellent recovery percentages in the range 98.9-99.8 ± 1.6%. The determination of sulphate in fresh and potable water samples with the developed sensor has been also achieved successfully. The described sensor provides a reliable means with good correlation with the data obtained by atomic absorption spectrometry (AAS) and other spectrophotometric methods for the analysis of trace amounts of barium(II) and/or sulphate ions in different matrices

  16. Theoretical isotope shifts in neutral barium

    CERN Document Server

    Nazé, Cédric; Godefroid, Michel


    The present work deals with a set of problems in isotope shifts of neutral barium spectral lines. Some well known transitions ($6s^2~^1S_0-6s6p~^{1,3}P^o_1$ and $6s^2~^1S_0-6p^2~^3P_0$) are first investigated. Values of the changes in the nuclear mean-square charge radius are deduced from the available experimental isotope shifts using our ab initio electronic factors. The three sets $\\{ \\delta\\langle r^2\\rangle^{A,A'}\\} $ obtained from these lines are consistent with each other. The combination of the available nuclear mean-square radii with our electronic factors for the $6s5d~^3D_{1,2} -6s6p~^{1}P^o_1$ transitions produces isotope shift values in conflict with the laser spectroscopy measurements of Dammalapati et al. (Eur. Phys. J. D 53, 1 (2009)).

  17. Chemical abundance analysis of 19 barium stars

    CERN Document Server

    Yang, G C; Spite, M; Chen, Y Q; Zhao, G; Zhang, B; Liu, G Q; Liu, Y J; Liu, N; Deng, L C; Spite, F; Hill, V; Zhang, C X


    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures, surface gravities, metallicity and microturbulent velocity) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their light elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn and Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-ca...

  18. Analysis of europium doped luminescent barium thioaluminate

    Institute of Scientific and Technical Information of China (English)

    张东璞; 喻志农; 薛唯; 章婷; 丁瞾; 王武育


    Europium-doped barium thioaluminate sputtering target was synthesized by powder sintering method and thin film was deposited by radio frequency(RF) sputtering.X-ray diffractometer(XRD) pattern indicated that the main compound of the target was BaAl4S7.Oxygen was the main impurity which led to the formation of BaAl2O4.It was shown that both BaAl4S7 and BaAl2S4 were contained in the as-grown thin films and a 471.7 nm emission peak in the PL spectra appeared due to a combination of BaAl4S7:Eu2+ and BaAl2S4:Eu2...

  19. Barium hexaferrite ferrofluids - preparation and physical properties (United States)

    Müller, R.; Hiergeist, R.; Steinmetz, H.; Ayoub, N.; Fujisaki, M.; Schüppel, W.


    Barium hexaferrite BaFe 12-2 xTi xCo xO 19 ferrofluids have been prepared for the first time using oleic acid as surfactant and Isopar M ® as carrier liquid. The initial susceptibility versus temperature for zero-field cooling of the ferrofluid was obtained by a vibrating sample magnetometer. TEM pictures of the fluid show isolated particles and only small agglomerates and a mean particle diameter of approx. 8 nm. Numerical calculations of the magneto-viscous effect, based on the local-equilibrium magnetic state model, clearly show the benefit for Ba-ferrite ferrofluids resulting from the high uniaxial anisotropy compared to magnetite ferrofluids. Rheological measurements were performed with a rotational-type viscometer with magnetic field perpendicular to the hydrodynamic vortex axis.

  20. Radar absorption properties of doped barium hexaferrite

    International Nuclear Information System (INIS)

    Full text: Since the 1950s, it has been known that barium hexaferrite exhibits a ferrimagnetic resonance at about 48 GHz. Early research was directed at finding dopants that would increase this frequency to enable the preparation of lossless waveguide components. However, more recent efforts have explored the potential of doped barium hexaferrite as a radar absorbing material in the low GHz frequency range. In particular, Nedkov et al demonstrated that partial substitution of the iron with cobalt-titanium, to give Ba(Co0.5Ti0.5)xFe11.9-xMn0.1O19 with x = 1.6, could reduce the ferrimagnetic resonance frequency to 15 GHz. The small amount of manganese was included 'to improve the dielectric properties' of the material. In this work we increased the doping to x = 2.2 to arrive at a resonance frequency of just 1.35 GHz, which lies within the operational frequency range of typical airborne early warning and control (AEWAC) radar systems. An increase in the resonance signal at this concentration is believed to be associated with the onset of a switch from axial to planar magnetocrystalline anisotropy, as reported by Kreisel et al . It is uncertain why our resonance frequency for x = 2.2 is significantly lower than the value of 2.56 GHz reported elsewhere for a Mn-free specimen with x = 2.6. Chromium was also tested as a new dopant material but proved unsuccessful in reducing the resonant frequency below 40 GHz, the upper limit of the microwave network analyser that was employed. All specimens were prepared using solid state reaction of stoichiometric amounts of oxides and carbonates, and characterised using x-ray powder diffraction and 57Fe Moessbauer spectroscopy

  1. The Karlsruhe 4π barium fluoride detector

    International Nuclear Information System (INIS)

    A new experimental approach has been implemented for accurate measurements of neutron capture cross sections in the energy range from 5 to 200 keV. The Karlsruhe 4π Barium Fluoride Detector consists of 42 crystals shaped as hexagonal and pentagonal truncated pyramids forming a spherical shell with 10 cm inner radius and 15 cm thickness. All crystals are supplied with reflector and photomultiplier, thus representing independent gamma-ray detectors. Each detector module covers the same solid angle with respect to a gamma-ray source located in the centre. The energy resolution of the 4π detector is 14% at 662 keV and 7% at 2.5 MeV gamma-ray energy, the overall time reslution is 500 ps and the peak efficiency 90% at 1 MeV. The detector allows to register capture cascades with 95% probability above a threshold energy of 2.5 MeV in the sum energy spectrum. Neutrons are produced via the 7Li(p,n)7Be reaction using the pulsed proton beam of a Van de Graaff accelerator. The neutron spectrum can be taylored according to the experimental requirements in an energy range from 5 to 200 keV by choosing appropriate proton energies. A collimated neutron beam is passing through the detector and hits the sample in the centre. The energy of captured neutrons is determined via time of flight, the primary flight path being 77 cm. The combination of short primary flight path, a 10 cm inner radius of the spherical BaF2 shell, and the low capture cross section of barium allows to discriminate background due to capture of sample scattered neutrons in the scintillator by time of flight, leaving part of the neutron energy range completely undisturbed. (orig./HSI)

  2. Upper gastrointestinal barium evaluation of duodenal pathology: A pictorial review

    Institute of Scientific and Technical Information of China (English)

    Pankaj; Gupta; Uma; Debi; Saroj; Kant; Sinha; Kaushal; Kishor


    Like other parts of the gastrointestinal tract(GIT), duodenum is subject to a variety of lesions both congenital and acquired. However, unlike other parts of the GIT viz. esophagus, rest of the small intestine and large intestine, barium evaluation of duodenal lesions is technically more challenging and hence not frequently reported. With significant advances in computed tomography technology, a thorough evaluation including intraluminal, mural and extramural is feasible in a single non-invasive examination. Notwithstanding, barium evaluation still remains the initial and sometimes the only imaging study in several parts of the world. Hence,a thorough acquaintance with the morphology of various duodenal lesions on upper gastrointestinal barium examination is essential in guiding further evaluation. We reviewed our experience with various common and uncommon barium findings in duodenal abnormalities.

  3. Liquid-phase-deposited barium titanate thin films on silicon

    International Nuclear Information System (INIS)

    Using a mixture of hexafluorotitanic acid, barium nitrate and boric acid, high refractive index (1.54) barium titanate films can be deposited on silicon substrates. The deposited barium titanate films have featureless surfaces. The deposition temperature is near room temperature (800C). However, there are many fluorine and silicon incorporations in the films. The refractive index of the as-deposited film is 1.54. By current-voltage measurement, the leakage current of the as-deposited film with a thickness of 1000 A is about 9.48x10-7 A cm-2 at the electrical field intensity of 0.3 MV cm-1. By capacitance-voltage measurement, the effective oxide charge of the liquid-phase-deposited barium titanate film is 3.06x1011 cm-2 and the static dielectric constant is about 22. (author)

  4. Synthesis, photoluminescence and magnetic properties of barium vanadate nanoflowers

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Jing [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Chongqing University of Science and Technology, Chongqing 401331 (China); Hu, Chenguo, E-mail: [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Xi, Yi [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Peng, Chen [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Wan, Buyong; He, Xiaoshan [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China)


    Graphical abstract: The flower-shaped barium vanadate was obtained for the first time. The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. Research highlights: {yields} In the paper, the flower-shaped barium vanadate were obtained for the first time. The CHM method used here is new and simple for preparation of barium vanadate. {yields} The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. The strong bluish-green emission was observed. {yields} The ferromagnetic behavior of the barium vanadate nanoflowers was found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g. {yields} The mechanisms of PL and magnetic property of barium vanadate nanoflowers have been discussed. -- Abstract: The flower-shaped barium vanadate has been obtained by the composite hydroxide mediated (CHM) method from V{sub 2}O{sub 5} and BaCl{sub 2} at 200 {sup o}C for 13 h. XRD and XPS spectrum of the as-synthesized sample indicate it is hexagonal Ba{sub 3}V{sub 2}O{sub 8} with small amount of Ba{sub 3}VO{sub 4.8} coexistence. Scan electron microscope and transmission electron microscope display that the flower-shaped crystals are composed of nanosheets with thickness of {approx}20 nm. The UV-visible spectrum shows that the barium vanadate sample has two optical gaps (3.85 eV and 3.12 eV). Photoluminescence spectrum of the barium vanadate flowers exhibits a visible light emission centered at 492 and 525 nm which might be attributed to VO{sub 4} tetrahedron with T{sub d} symmetry in Ba{sub 3}V{sub 2}O{sub 8}. The ferromagnetic behavior of the barium vanadate nanoflowers has been found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g, which is mainly due to the presence of a non

  5. Lifetime Measurement for 6snp Rydberg States of Barium

    Institute of Scientific and Technical Information of China (English)

    SHEN Li; WANG Lei; YANG Hai-Feng; LIU Xiao-Jun; LIU Hong-Ping


    @@ We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states.This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence.The lifetimes determined with our method for barium Rydberg 6snp(n=37-59)series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J.Phys.B 14(1981)4489, 29(1996)655]on experiments.%We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states. This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence. The lifetimes determined with our method for barium Rydberg 6snp (n=37-59) series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J. Phys. B 14 (1981) 4489, 29 (1996) 655] onexperiments.

  6. Electrooptic and piezoelectric measurements in photorefractive barium titanate and strontium barium niobate

    International Nuclear Information System (INIS)

    The authors measured the low-frequency (''unclamped'') electrooptic and piezoelectric coefficients in undoped BaTiO/sub 3/ and Sr/sub x/Ba/sub 1-x/Nb/sub 2/O/sub 6/ (chi - 0.61) crystals using interferometric techniques. The contribution of the piezoelectric effect to the Pockels measurement is discussed. For an applied ac electric field in the range 0.1-200 V/cm, the electrooptic and piezoelectric effects are linear in the magnitude of of the applied field and independent of its frequency in the range of 10 Hz-100 kHz. The unclamped electrooptic coefficients of poled BaTiO/sub 3/ single crystals are r/sub 13/ = 19.5 +- 1 pm/V and r/sub 33/ = 97 +- 7 pm/V, and for strontium barium niobate are r/sub 13/ = 47 +- 5 pm/V and r/sub 33/ = 235 +- 21 pm/V, all measured at a wavelength of 514.5 nm and at T = 230C. For the barium titanate samples the measured Pockels coefficient r/sub c/ identical to r/sub 33/ - (n/sub 1//n/sub 3/)/sup 3/r/sub 13/ = 79 +- 6 pm/V in good agreement with the value r/sub c/ = 76 +- 7 pm/V computed from the above values of r/sub 13/ and r/sub 33/, where n/sub 1/ and n/sub 3/ are the ordinary and extraordinary indexes of refraction, respectively. The measured piezoelectric coefficient is d/sub 23/ = +28.7 +- 2 pm/V for barium titanate, and is d/sub 23/ = +24.6 +- 2 pm/V for strontium barium niobate. They also measured the photoreflective coupling of two optical beams in the crystals, and they show that the dependence of the coupling strength on beam polarization is in fair agreement with the measured values of the Pockels coefficients

  7. Robotic Reverberation Mapping of Arp 151 (United States)

    Valenti, S.; Sand, D. J.; Barth, A. J.; Horne, K.; Treu, T.; Raganit, L.; Boroson, T.; Crawford, S.; Pancoast, A.; Pei, L.; Romero-Colmenero, E.; Villforth, C.; Winkler, H.


    We present the first results from the Las Cumbres Observatory Global Telescope (LCOGT) Network's Active Galactic Nuclei (AGNs) Key Project, a large program devoted to using the robotic resources of LCOGT to perform time domain studies of active galaxies. We monitored the Seyfert 1 galaxy Arp 151 (Mrk 40) for ∼200 days with robotic imagers and with the FLOYDS robotic spectrograph at Faulkes Telescope North. Arp 151 was highly variable during this campaign, with V-band light curve variations of ∼0.3 mag and Hβ flux changing by a factor of ∼3. We measure robust time lags between the V-band continuum and the Hα, Hβ, and Hγ emission lines, with {τ }{cen}={13.89}-1.41+1.39, {7.52}-1.06+1.43, and {7.40}-1.32+1.50 days, respectively. The lag for the He iiλ4686 emission line is unresolved. We measure a velocity-resolved lag for the Hβ line, which is clearly asymmetric with higher lags on the blue wing of the line that decline to the red, possibly indicative of radial inflow, and is similar in morphology to past observations of the Hβ transfer function shape. Assuming a virialization factor of f = 5.5, we estimate a black hole mass of {M}{BH}={6.2}-1.2+1.4 × 106 M⊙, also consistent with past measurements for this object. These results represent the first step to demonstrate the powerful robotic capabilities of LCOGT for long-term AGN time domain campaigns that human intensive programs cannot easily accomplish. Arp 151 is now one of just a few AGNs where the virial product is known to remain constant against substantial changes in Hβ lag and luminosity.

  8. Magnetoresistance studies on barium doped nanocrystalline manganite

    International Nuclear Information System (INIS)

    An energetically attractive, simple, fast and a novel low temperature (300 deg. C) solution combustion route for the synthesis of crystalline and homogeneous nanoparticles of lanthanum barium manganese oxide La0.9Ba0.1MnO3+δ (LBMO) is reported. Formation and homogeneity of the solid solutions have been confirmed by powder X-ray diffraction (PXRD) and energy dispersive X-ray analysis (EDS) respectively. The Rietveld analysis shows both as-formed as well as calcined samples are in cubic phase with space group pm3m. The microstructure and agglomerated particle size of the compounds are examined by scanning electron microscope. Infrared spectroscopy revealed that both Mn-O-Mn bending mode and Mn-O stretching mode are influenced by calcination temperature. The magnetoresistance measurement on sintered LBMO pellet exhibits a broad metal-insulator transition (TM-I) at around 228 K. At 1 T applied magnetic field, LBMO shows magnetoresistance (MR) of 10%, whereas for 4 and 7 T, the negative magnetoresistance values are in the range 51 and 59% respectively at TM-I. The experimental resistivity data of the present investigation are fitted to a simple empirical equation in order to understand conduction mechanism in this compound

  9. Optical properties of calcium barium niobate

    International Nuclear Information System (INIS)

    We report on optical measurements on the novel tungsten bronze type calcium barium niobate. [001]-oriented transparent and colorless single crystals were grown by the Czochralski method with dimensions of 12 mm in diameter and about 80 mm in length. With its relatively high Curie temperature of about 538 K for the congruently melting composition of 28.1 mole% calcium and its high nonlinear coefficients, CBN is a promising material for future applications. Recent experiments revealed, that the application of an external electric field of several kV/cm to CBN at room temperature leads to an increasing opacity of the sample. This might be a drawback considering the future usability of CBN in optical systems. We present investigations on the transmittance behaviour of CBN under external electric fields, demonstrating the erasement of the clouding without affecting the polarization. Experiments have been performed at temperatures ranging from room temperature to approximately 480 K. When heating up the sample, its colorless appearance changes to a light yellow, which can be attributed to a shift of the band edge to longer wavelengths with increasing temperature. To further investigate the transmittance properties of CBN, measurements of the band edge under various temperatures up to the ferroelectric phase transition have been performed.

  10. Leachability of barium-radium sulphate sludges

    International Nuclear Information System (INIS)

    This paper presents results from the first phase of a research program designed to examine the leachability of radium-226 from barium-radium sulphate sludges. Batch leaching tests were performed. Results showed that liquid:solid contact time was relatively unimportant; radium in the sludge was stable in the presence of deionized water with a slight increase in the amount leached per gram of sludge occurring at higher liquid:solid ratios. Not unexpectedly, low and high values of leachant pH increased radium leaching. Both monovalent and divalent salt solutions also increased leaching; however, dissolved radium-226 activity levels in the leachate decreased as leachant molarity increased. For divalent salts this can be explained by the common ion effect; for monovalent salts it is opposite to results expected from solubility considerations. The interpretation of all results is complicated by the fact that in most tests, the amount of radium-226 present in the leachate was lower than the calculated contribution from the mother liquour present with the sludge. This apparent ability of the sludge to absorb radium from solution may be related to dissolution and reprecipitation of the sludge during the leaching tests

  11. Chemical compositions of four barium stars

    CERN Document Server

    Liang, Y C; Chen, Y Q; Qiu, H M; Zhang, B


    Chemical compositions of four barium stars HD 26886, HD 27271, HD 50082 and HD 98839 are studied based on high resolution, high signal-to-noise Echelle spectra. Results show that all of them are disk stars. Their \\alpha and iron peak elements are similar to the solar abundances. The neutron-capture process elements are overabundant relative to the Solar. The heavy-element abundances of the strong Ba star HD 50082 are higher than those of other three mild Ba stars. Its mass is 1.32Msun (+0.28,-0.22Msun), and is consistent with the average mass of strong Ba stars (1.5Msun). For mild Ba star HD 27271 and HD 26886, the derived masses are 1.90Msun (+0.25,-0.20Msun) and 2.78Msun (+0.75,-0.78M_sun), respectively, which are consistent with the average mass of mild Ba stars. We also calculate the theoretical abundances of Ba stars by combining the AGB stars nucleosynthesis and wind accretion formation scenario of Ba binary systems. The comparisons between the observed abundance patterns of the sample stars with the th...

  12. The diagnostic value of barium enema in acute appendicitis

    International Nuclear Information System (INIS)

    Acute appendicitis is the most common acute surgical condition of the abdomen. When the clinical presentation is atypical, barium enema has proven to be safe and useful in confirming the diagnosis and reducing the negative surgical exploration. However, the performance of barium enema in acute appendicitis has known contraindication primarily because of fear of leakage by perforation of the inflamed appendix. This study using barium enema as a diagnostic aid in acute appendicitis with atypical clinical presentation was performed to further support the previously noted efficacy and safety of this procedure. The results were as followings: 1. In case of acute appendicitis with atypical clinical presentation, the use of barium enema as a diagnostic aid increased the accuracy of diagnosis and decreased the negative surgical exploration. In women between 11 to 50 years old age, especially, it played important role differentiating appendicitis from nonsurgical acute abdomen. 2. The results of the study were 92.31% in sensitivity, 7.69% in false positive, 6.9% in false negative, and 10.26% in negative appendectomy. 3. None of case of leakage of barium by perforation of the inflamed appendix was noted, therefore, barium enema was thought to be safe as a diagnostic aid in acute appendicitis. 4. A simple partial or non filling of appendix without other associated positive finding could not exclude appendicitis, therefore, close clinical observation was necessary. 5. The positive findings of barium enema and their sensitivity were as followings: 1. Non filling of appendix: 90% 2. Partial filling of appendix: 91.7% 3. Displacement or a local impression on terminal ileum: 100%

  13. 46 CFR 151.05-1 - Explanation of column headings in Table 151.05. (United States)


    ... Section 151.05-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Summary of Minimum Requirements for...) Hull type. This column refers to the flotation features of the barge. Terms used are explained...

  14. Robotic Reverberation Mapping of Arp 151

    CERN Document Server

    Valenti, S; Barth, A J; Horne, K; Treu, T; Raganit, L; Boroson, T; Crawford, S; Pancoast, A; Pei, L; Romero-Colmenero, E; Villforth, C; Winkler, H


    We present the first results from the Las Cumbres Observatory Global Telescope (LCOGT) Network's Active Galactic Nuclei Key Project, a large program devoted to using the robotic resources of LCOGT to perform time domain studies of active galaxies. We monitored the Seyfert 1 galaxy Arp~151 (Mrk~40) for $\\sim$200 days with robotic imagers and with the FLOYDS robotic spectrograph at Faulkes Telescope North. Arp~151 was highly variable during this campaign, with $V$-band light curve variations of $\\sim$0.3 mag and H$\\beta$ flux changing by a factor of $\\sim$3. We measure robust time lags between the $V$-band continuum and the H$\\alpha$, H$\\beta$ and H$\\gamma$ emission lines, with $\\tau_\\mathrm{cen} = 13.89^{+1.39}_{-1.41}$, 7.52$^{+1.43}_{-1.06}$ and 7.40$^{+1.50}_{-1.32}$ days, respectively. The lag for the \\ion{He}{2} $\\lambda4686$ emission line is unresolved. We measure a velocity-resolved lag for the H$\\beta$ line, which is clearly asymmetric with higher lags on the blue wing of the line which decline to the ...

  15. Preparation of barium hexaferrite powders using oxidized steel scales waste (United States)

    Septiani, Ardita; Idayanti, Novrita; Kristiantoro, Tony


    Research on preparation of barium hexaferrite powders has been done using Hot Strip Mill scales as raw materials. Hot Strip Mill scales are oxidized steel scales waste from steel industrial process. The method used for preparing the barium hexaferrite powders was solid state reaction method. Oxidized steel scales were milled using ball mill for 10 hours, then screened through a 250 mesh sieve to obtain powders with maximum size of 63 µm. Powders were roasted at 600°C temperature for 4 hours to obtain hematite (Fe2O3) phase. Roasted powders were then mixed with barium carbonate, and were subsequently milled for 16 hours. After mixing, powders were calcined with an increasing rate of 10°C/min and maintained at 1100°C for 3 hours. Calcination process was performed to acquire barium hexaferrite phase. X-ray Diffraction (XRD) characterization in conjunction with RIR analysis showed that 85 wt. % of barium hexaferrite is formed. The magnetic properties of powders were characterized using Permagraph. It is found the value of remanent induction is 1.09 kG, coercivity of 2.043 kOe, and the maximum energy product of 0.25 MGOe.

  16. Barium Depletion in the NSTAR Discharge Cathode After 30,000 Hours of Operation (United States)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira


    Dispenser hollow cathodes rely on a consumable supply of barium released by impregnant materials in the pores of a tungsten matrix to maintain a low work function surface. Examinations of cathode inserts from long duration ion engine tests show deposits of tungsten at the downstream end that appear to block the flow of barium from the interior. In addition, a numerical model of barium transport in the insert plasma indicates that the barium partial pressure in the insert may exceed the equilibrium vapor pressure of the dominant barium-producing reaction, and it was postulated previously that this would suppress barium loss in the upstream part of the insert. New measurements of the depth of barium depletion from a cathode insert operated for 30,352 hours reveal that barium loss is confined to a narrow region near the downstream end, confirming this hypothesis.

  17. Studies of hexacelsian and celsian barium aluminosilicates (United States)

    Lee, Kuo-Tong


    The first part of this work (chapter 3) describes the reaction paths leading to the formation of BaAlsb2Sisb2Osb8 (BAS) from a mixture of gamma-BaCOsb3,\\ alpha-Alsb2Osb3, and amorphous SiOsb2 powders. Heat treatments conducted from 600 to 1200sp°C in air were used to transform the powder mixtures into hexacelsian BAS. The phase evolution to BAS was examined by x-ray diffraction. Several experiments were designed to microscopically reproduce the solid-solid interfaces expected during the synthesis of BAS and enabled the author to describe the different stages of the reaction. There exist two reaction paths in formation of BAS in this study: (1) formation of a series of barium silicates leading to BaO*2SiOsb2 (BSsb2) which then reacts with Alsb2Osb3 to form BAS and (2) formation of BaO*Alsb2Osb3 (BA) which then reacts with SiOsb2 to form BAS. The kinetics of the latter is slower than that of the former because the reaction between BaO*Alsb2Osb3 and SiOsb2 to form BAS includes a bond breaking process. The second part (chapter 4) of this research was undertaken to study the role of additives on the kinetics of the transformation of hexacelsian to celsian. Pre-synthesized hexacelsian powders doped with various additives were heated at temperatures ranging from 850 to 1400sp°C for 4 hrs. Semi-quantitative analysis of XRD was used to determine the extent of the hexacelsian-to-celsian transformation. This work was extended further to investigate the mechanisms involved in the transformation. Defect structures developed in the additive-containing celsian provide insights about the sites occupied by the cations added. Experimental results indicate that the doping of ˜0.99A cations in promoting the conversion of hexacelsian to celsian is by forming an interstitial solid solution in hexacelsian and ˜0.66A cations form a substitutional solid solution. In a kinetic study on the CaO- or MgO-enhanced transformation, values of rate constant, k, and Avlami constant, n, at

  18. Occupational doses in pediatric barium meal procedures

    International Nuclear Information System (INIS)

    Ionizing radiation has become an indispensable tool when it comes to diagnosis and therapy. However, its use should happen in a rational manner, taking into account the risks to which the staff is being exposed. Barium meal (BM), or upper gastrointestinal (GI) studies, using fluoroscopy, are widely used for gastroesophageal reflux disease diagnostic in children and professionals are required to stay inside the examination room to position and immobilize pediatric patients during the procedure. Therefore, it is very important that proffessionals strictly follow the technical standards of radiation protection. According to the ICRP and the NCRP recommendations, the annual limit equivalent doses for eyes, thyroid and hands are, espectively, 20 mSv, 150 mSv and 500 mSv. Based on those data, the aim of the current study is to estimate the annual equivalent dose for eyes, thyroid and hands of professionals who perform BM procedures in children. This was done using properly package LiF:Mg,Cu,P thermoluminescent dosimeters in 37 procedures; 2 pairs were positioned near each staff´s eye, 2 pairs on each professional´s neck (on and under the lead protector) and 2 pairs on both staff´s hands. The range of the estimative annual equivalent doses, for eyes, thyroid and hands, are, respectively: 14 – 36 mSv, 7 – 22 mSv and 14 – 58 mSv. Only the closest staff to the patient exceeded the annual equivalent doses in the eyes (around 80% higher than the limit set by ICRP). However, the results from this study, for hands and thyroid, compared to similar studies, show higher values. Therefore, the optimization implementation is necessary, so that the radiation levels can be reduced. (authors)

  19. Method for the extraction chromatographic separation of barium from other elements with dibenzo-18-crown-6

    International Nuclear Information System (INIS)

    A method has been developed for the extraction chromatographic separation of barium from 0.01 M picric acid solution with dibenzo-18-crown-6 coated on hydrophobic silica gel as the stationary phase. Various mineral acids can be used as stripping agents. Barium was separated from other elements by selective extraction and the separation of barium from alkali and alkaline earth metals, uranium, thorium and lead was achieved. The method was applied to the determination of barium in real samples. (author)

  20. Electron microscopy of barium bismuth titanate multilayer ceramics

    International Nuclear Information System (INIS)

    For a number of years bismuth containing compounds have been used with pre-calcined barium titanate to reduce the sintering temperature of the capacitor formulations. As reported earlier the backscattered electron (BSE) SEM micrographs of the bismuth containing barium titanate ceramic reveal that the grains having an average size of 1.2μm consist of a two phase structure consisting of relatively pure barium titanate grain cores surrounded by bismuth rich grain shells. The TEM and STEM studies along with the EDS analyses show that the bismuth concentration increases sharply as one steps towards the grain boundary with a maximum bismuth content at the grain boundary. It is the purpose of this work to investigate the distribution of bismuth in these formulations including the bismuth content, if any, at the ceramic metal interface as affected by the sintering temperature. The subsequent effect on the electrical resistivity of these ceramics in the multilayer configuration is reported

  1. Economically dissolving barium sulfate scale with a chelating agent

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, E.A.; Scheuerman, R.E.


    A composition is described for dissolving a barium sulfate scale from a subterranean or other relatively remote location into which fluid can be flowed. Fluid is flow-flowed into the remote location so that a stream of fluid contacts and flows along the surface of the scale. The composition and flow rate of the fluid are adjusted so that (1) the scale is contacted by a stream of aqueous solution in which each portion contains enough dissolved aminopolyacetic acid salt chelating agent to dissolve barium sulfate, and (2) substantially all upstream portions of the scale are contacted by a succession of portions of the aqueous liquid which are substantially unsaturated with respect to dissolved barium-chelant complex. (5 claims)

  2. Barium titanate thick films prepared by screen printing technique

    Directory of Open Access Journals (Sweden)

    Mirjana M. Vijatović


    Full Text Available The barium titanate (BaTiO3 thick films were prepared by screen printing technique using powders obtained by soft chemical route, modified Pechini process. Three different barium titanate powders were prepared: i pure, ii doped with lanthanum and iii doped with antimony. Pastes for screen printing were prepared using previously obtained powders. The thick films were deposited onto Al2O3 substrates and fired at 850°C together with electrode material (silver/palladium in the moving belt furnace in the air atmosphere. Measurements of thickness and roughness of barium titanate thick films were performed. The electrical properties of thick films such as dielectric constant, dielectric losses, Curie temperature, hysteresis loop were reported. The influence of different factors on electrical properties values was analyzed.

  3. Radiation dose in mass screening for gastric cancer with high-concentration barium sulphate compared with moderate-concentration barium sulphate

    International Nuclear Information System (INIS)

    Full text: Recently, high-concentration barium sulfate has been developed and is used in many medical facilities. This study compared radiation dose using high-concentration and moderate-concentration barium sulfate. The dose was evaluated with an experimental method using a gastric phantom and with a clinical examination. In the former, the dose and X-ray tube load were measured on the phantom with two concentrations of barium sulfate. In the latter, the fluoroscopic dose-area product (DAP), the radiographic DAP and their sum, the total DAP, were investigated in 150 subjects (112 males, 38 females) treated with both concentrations of barium sulfate. The effective dose was calculated by the software of PCXMC in every case. The results of the experimental evaluation indicated that the effective dose and X-ray tube load were greater with high-concentration barium sulfate than with moderate-concentration barium sulfate (p < 0.05). The results of the clinical evaluation indicated that the fluoroscopic DAP was greater with moderate-concentration barium sulfate than with high-concentration barium sulfate (p < 0.05), but the radiographic DAP was quite the reverse, so the total DAP and effective dose were almost same with both concentrations of barium sulfate. We conclude that high-concentration barium sulfate does not increase radiation dose in mass screening for gastric cancer.

  4. Reaction sintering of a zirconia-containing barium feldspar ceramic

    International Nuclear Information System (INIS)

    Zircon (ZrSiO4) is a natural mineral resource known to react with certain oxides to produce a dispersion of zirconia particles within ceramic or glass-ceramic matrices. Barium aluminosilicates, particularly the celsian polymorphs of BaO- Al2O3 2SiO2 display oxidation resistance and refractory characteristics commensurate with the properties required of high temperature materials. Such properties, coupled with the high melting point of ZrO2 (2680 deg C), suggest that barium aluminosilicates and zirconia are an ideal combination from which to fabricate high temperature materials. A recent study has indicated that a barium aluminosilicate containing up to 40mol% ZrO2 can be prepared via a sol-gel process. However, the desire to utilise a natural resource in the form of zircon in the present work has led to the choice of reaction sintering as an alternative processing route. The current work was undertaken to investigate the possibility of forming a zirconia-containing barium feldspar composite material using the reaction sintering of zircon and assuming the following stoichiometric reaction: 2ZrSiO4 + BaCO3 + Al2O3 → 2ZrO2 + BaO-Al2O3-2SiO2 + CO2 ↑. The reaction sintering of zircon with alumina and barium carbonate produces a composite material comprising distributed ZrO2 in a continous barium feldspar matrix. Yttria added during processing allows a significant fraction of the ZrO2 to be retained as tetragonal phase to room temperature and thus the potential for a measure of transformation toughening

  5. Reaction sintering of a zirconia-containing barium feldspar ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Nordmann, A.; Cheng, Y-B.; Muddle, B. C. [Monash Univ., Clayton, VIC (Australia). Dept. of Materials Engineering


    Zircon (ZrSiO{sub 4}) is a natural mineral resource known to react with certain oxides to produce a dispersion of zirconia particles within ceramic or glass-ceramic matrices. Barium aluminosilicates, particularly the celsian polymorphs of BaO- Al{sub 2}O{sub 3} 2SiO{sub 2} display oxidation resistance and refractory characteristics commensurate with the properties required of high temperature materials. Such properties, coupled with the high melting point of ZrO{sub 2} (2680 deg C), suggest that barium aluminosilicates and zirconia are an ideal combination from which to fabricate high temperature materials. A recent study has indicated that a barium aluminosilicate containing up to 40mol% ZrO{sub 2} can be prepared via a sol-gel process. However, the desire to utilise a natural resource in the form of zircon in the present work has led to the choice of reaction sintering as an alternative processing route. The current work was undertaken to investigate the possibility of forming a zirconia-containing barium feldspar composite material using the reaction sintering of zircon and assuming the following stoichiometric reaction: 2ZrSiO{sub 4} + BaCO{sub 3} + Al{sub 2}O{sub 3} {yields} 2ZrO{sub 2} + BaO-Al{sub 2}O{sub 3}-2SiO{sub 2} + CO{sub 2} {up_arrow}. The reaction sintering of zircon with alumina and barium carbonate produces a composite material comprising distributed ZrO{sub 2} in a continous barium feldspar matrix. Yttria added during processing allows a significant fraction of the ZrO{sub 2} to be retained as tetragonal phase to room temperature and thus the potential for a measure of transformation toughening. 14 refs., 2 tabs., 6 figs.

  6. Compact pulse forming line using barium titanate ceramic material (United States)

    Kumar Sharma, Surender; Deb, P.; Shukla, R.; Prabaharan, T.; Shyam, A.


    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO3) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber.

  7. Compact pulse forming line using barium titanate ceramic material. (United States)

    Kumar Sharma, Surender; Deb, P; Shukla, R; Prabaharan, T; Shyam, A


    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO(3)) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber. PMID:22129008

  8. 49 CFR 173.182 - Barium azide-50 percent or more water wet. (United States)


    ... 49 Transportation 2 2010-10-01 2010-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or...

  9. 21 CFR 201.304 - Tannic acid and barium enema preparations. (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished...

  10. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3). (United States)


    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  11. The adhesiometer: a simple device to measure adherence of barium sulfate to intestinal mucosa. (United States)

    Salomonowitz, E; Frick, M P; Cragg, A H; Lund, G


    A simple, inexpensive device assessing barium sulfate adherence to alimentary tract mucosa was tested in an animal study using pigs and dogs. Interaction of gastric, intestinal, and colonic mucosal lining with three different barium preparations was studied. In both pigs and dogs, barium adherence to gastric mucosa was significantly stronger when compared with colonic mucosa. PMID:6608230

  12. 33 CFR 151.08 - Denial of entry. (United States)


    ... prewashed under 46 CFR part 153, may enter any port or terminal under § 158.110(a) of this chapter unless...: Sections 151.09 through 151.25 appear by CGD 75-124a, 48 FR 45709, Oct. 6, 1983, unless otherwise noted....

  13. 33 CFR 151.25 - Oil Record Book. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Oil Record Book. 151.25 Section... Treaty as it Pertains to Pollution from Ships Oil Pollution § 151.25 Oil Record Book. (a) Each oil tanker... fixed or floating drilling rig or other platform shall maintain an Oil Record Book Part I...

  14. 19 CFR 151.13 - Approval of commercial gaugers. (United States)


    ... requirements: (1) To comply with the requirements of part 151, Customs Regulations (19 CFR part 151), and to... approval to execute a bond in accordance with part 113, Customs Regulations (19 CFR part 113), and submit... Executive Director will determine the applicant's overall competence, independence, and character...

  15. 29 CFR 780.151 - Particular operations on commodities. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Particular operations on commodities. 780.151 Section 780... AGRICULTURE, PROCESSING OF AGRICULTURAL COMMODITIES, AND RELATED SUBJECTS UNDER THE FAIR LABOR STANDARDS ACT General Scope of Agriculture Preparation for Market § 780.151 Particular operations on...

  16. 14 CFR 151.99 - Modifications of programming standards. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Modifications of programming standards. 151... (CONTINUED) AIRPORTS FEDERAL AID TO AIRPORTS Project Programming Standards § 151.99 Modifications of programming standards. The Director, Airports, Service, or the Regional Director concerned may, on...

  17. 27 CFR 19.151 - General requirements for registration. (United States)


    ... registration. 19.151 Section 19.151 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... law, operations as a distiller, warehouseman, or processor may be conducted only on the bonded... conduct at such plant operations as a distiller, as a warehouseman, or as both. (c) Registration....

  18. 19 CFR 151.8 - Examination after assembly. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Examination after assembly. 151.8 Section 151.8... assembly. (a) Application by importer. Upon application by the importer, machinery, altars, shrines, and... to identify the merchandise with the invoice. (c) Removal of merchandise and notification of...

  19. 7 CFR 948.151 - Colorado Potato Committee membership. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Colorado Potato Committee membership. 948.151 Section... POTATOES GROWN IN COLORADO Rules and Regulations Modification of Inspection Requirements § 948.151 Colorado Potato Committee membership. The Colorado Potato Committee shall be comprised of six members...

  20. 19 CFR 151.75 - Final determination of clean yield. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Final determination of clean yield. 151.75 Section 151.75 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT... Final determination of clean yield. The port director shall base his final determination of clean...

  1. 21 CFR 146.151 - Orange juice for manufacturing. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Orange juice for manufacturing. 146.151 Section... Fruit Juices and Beverages § 146.151 Orange juice for manufacturing. (a) Orange juice for manufacturing is the food prepared for further manufacturing use. It is prepared from unfermented juice...

  2. 33 CFR 151.1508 - Revocation of clearance. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Revocation of clearance. 151.1508 Section 151.1508 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION VESSELS CARRYING OIL, NOXIOUS LIQUID SUBSTANCES, GARBAGE, MUNICIPAL OR COMMERCIAL WASTE, AND BALLAST WATER Ballast Water...

  3. 46 CFR 151.01-2 - Incorporation by reference. (United States)


    ... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES General § 151.01-2 Incorporation by reference. (a) Certain..., are: American Society for Nondestructive Testing (ASNT) 4153 Arlingate Road, Caller #28518, Columbus... Certification in Nondestructive Testing” 151.04-7(c)(2) American Society of Mechanical Engineers...

  4. 9 CFR 151.11 - Form of books of record. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Form of books of record. 151.11... AGRICULTURE ANIMAL BREEDS RECOGNITION OF BREEDS AND BOOKS OF RECORD OF PUREBRED ANIMALS Recognition of Breeds and Books of Record § 151.11 Form of books of record. (a) If a registry association has not...

  5. 33 CFR 151.1510 - Ballast water management. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Ballast water management. 151..., AND BALLAST WATER Ballast Water Management for Control of Nonindigenous Species in the Great Lakes and Hudson River § 151.1510 Ballast water management. (a) The master of each vessel subject to this...

  6. 46 CFR 151.50-41 - Carbon disulfide (carbon bisulfide). (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Carbon disulfide (carbon bisulfide). 151.50-41 Section... CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-41 Carbon disulfide (carbon bisulfide). (a) All openings shall be in the top of the tank. (b) Loading lines...

  7. 14 CFR 151.21 - Procedures: Application; general information. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Procedures: Application; general information. 151.21 Section 151.21 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... (built, if necessary), without regard to their race, color, religion, sex, or national origin, before...

  8. 19 CFR 151.24 - Unlading facilities for bulk sugar. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Unlading facilities for bulk sugar. 151.24 Section... OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Sugars, Sirups, and Molasses § 151.24 Unlading facilities for bulk sugar. When dutiable sugar is to be imported in bulk, a...

  9. 46 CFR 151.40-11 - Refrigeration systems. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Refrigeration systems. 151.40-11 Section 151.40-11... Refrigeration systems. (a) Boiloff systems. The venting of cargo boiloff to atmosphere shall not be used as a...) Vapor compression, tank refrigeration, and secondary refrigeration systems: The required...

  10. 19 CFR 151.26 - Molasses in tank cars. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Molasses in tank cars. 151.26 Section 151.26....26 Molasses in tank cars. When molasses is imported in tank cars, the importer shall file with the... sugars or the character of the molasses in the different cars....

  11. 19 CFR 151.82 - Information on invoices. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Information on invoices. 151.82 Section 151.82... invoices. Invoices of cotton provided for in subheading 5201.00.10, 5201.00.20, 5201.00.50, Harmonized... covered by the invoice: (1) This is harsh or rough cotton under 19.05 millimeters in staple length;...

  12. 19 CFR 151.62 - Information on invoices. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Information on invoices. 151.62 Section 151.62... on invoices. Invoices of wool or hair subject to duty at a rate per clean kilogram under Chapter 51... grade of each lot covered by the invoice, specifying the standard or basis used, that is, whether...

  13. Dicty_cDB: SFI151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFI151 (Link to dictyBase) - - - Contig-U16313-1 SFI151P (Link to Original ... ession in good prognostic human neuroblastoma upon comparison ... between good prognostic human neuroblastoma and po ...

  14. 9 CFR 151.7 - Examination of animal. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Examination of animal. 151.7 Section 151.7 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL BREEDS RECOGNITION OF BREEDS AND BOOKS OF RECORD OF PUREBRED ANIMALS Certification...

  15. 19 CFR 151.70 - Method of sampling by Customs. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Method of sampling by Customs. 151.70 Section 151.70 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Method of sampling by Customs. A general sample shall be taken from each sampling unit, unless it is...

  16. Esophageal intramural pseudodiverticulosis characterized by barium esophagography: a case report

    LENUS (Irish Health Repository)

    O'Connor, Owen J


    Abstract Introduction Esophageal intramural pseudodiverticulosis is a rare condition characterized by the dilatation of the submucosal glands. Case presentation We present a case of esophageal intramural pseudodiverticulosis in a 72-year-old Caucasian man who presented with dysphagia and with a background history of alcohol abuse. An upper gastrointestinal endoscopy of our patient showed an esophageal stricture with abnormal mucosal appearances, but no malignant cells were seen at biopsy. Appearances on a barium esophagram were pathognomonic for esophageal intramural pseudodiverticulosis. Conclusion We demonstrate the enduring usefulness of barium esophagography in the characterization of abnormal mucosal appearances at endoscopy.

  17. Kinetics of thermal decomposition of barium zirconyl oxalate

    International Nuclear Information System (INIS)

    Kinetics of the thermal decomposition of anhydrous barium zirconyl oxalate and a carbonate intermediate have been studied. Decomposition of the anhydrous oxalate, though it could be explained based on a contracting-cube model, is quite complex. Kinetics of decomposition of the intermediate carbonate Ba2Zr2O5CO3 is greatly influenced by thermal effects during its formation. (α-t) curves are sigmoidal and obey a power law equation followed by first order decay. Presence of carbon in the vacuum-prepared carbonate has a strong deactivating effect. Decomposition of the carbonate is accompanied by growth in particle size of the product barium zirconate. (Author)

  18. Photoionization and Photoelectric Loading of Barium Ion Traps

    CERN Document Server

    Steele, A V; Churchill, L R; Griffin, P F


    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading technique that employs an in-expensive UV epoxy curing lamp to generate photoelectrons.

  19. Photoionization and Photoelectric Loading of Barium Ion Traps


    Steele, A. V.; Churchill, L. R.; Griffin, P. F.; Chapman, M. S.


    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading t...

  20. Equations of state for barium in high-pressure phases

    International Nuclear Information System (INIS)

    The universal equation of state with an arbitrary reference point presented by the author (Fang Zheng-Hua 1998 Phys. Rev. B 50 16 238) is applied successfully to the analysis of the experimental compression data of barium in different structural phases (I, II, and V). The comparison given in this paper shows that this equation suits for the isothermal compression behaviour of barium in the high-pressure phases (II and V) better than the Birch-Murnaghan equation. The applicability of equations of state for solids in high-pressure phases is also discussed. (author)

  1. Chemical abundance analysis of 19 barium stars (United States)

    Yang, Guo-Chao; Liang, Yan-Chun; Spite, Monique; Chen, Yu-Qin; Zhao, Gang; Zhang, Bo; Liu, Guo-Qing; Liu, Yu-Juan; Liu, Nian; Deng, Li-Cai; Spite, Francois; Hill, Vanessa; Zhang, Cai-Xia


    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures Teff, surface gravities log g, metallicity [Fe/H] and microturbulence velocity ξt) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants as indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their Na, Al, α- and iron-peak elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-capture) process elements relative to the Sun. Their median abundances of [Ba/Fe], [La/Fe] and [Eu/Fe] are 0.54, 0.65 and 0.40, respectively. The Y I and Zr I abundances are lower than Ba, La and Eu, but higher than the α- and iron-peak elements for the strong Ba stars and similar to the iron-peak elements for the mild stars. There exists a positive correlation between Ba intensity and [Ba/Fe]. For the n-capture elements (Y, Zr, Ba, La), there is an anti-correlation between their [X/Fe] and [Fe/H]. We identify nine of our sample stars as strong Ba stars with [Ba/Fe] >0.6 where seven of them have Ba intensity Ba=2-5, one has Ba=1.5 and another one has Ba=1.0. The remaining ten stars are classified as mild Ba stars with 0.17<[Ba/Fe] <0.54.


    The primary objective of this study was to determine the applicability of weak acid exchange resin in the hydrogen form for removal of hardness, barium and radium from groundwater. Weak acid resin in the hydrogen form eliminates the addition of sodium to drinking water. The capac...


    The Integrated Risk Information System (IRIS) is a database of EPA's consensus opinion of the human health effects that may result from exposure to various substances found in the environment. A Toxicological Review and IRIS Summary were prepared for barium and compounds in 1998 ...

  4. Barium titanate inverted opals-synthesis, characterization, and optical properties

    Energy Technology Data Exchange (ETDEWEB)

    Soten, I.; Miguez, H.; Yang, S.M.; Petrov, S.; Coombs, N.; Tetreault, N.; Ozin, G.A. [Toronto Univ., ON (Canada). Dept. of Chemistry; Matsuura, N.; Ruda, H.E. [Toronto Univ., ON (Canada). Dept. of Metallurgy and Materials Science


    The engineering of cubic or tetragonal polymorphs of nanocrystalline barium titanate inverted opals has been achieved by thermally induced transformations. Optical characterization demonstrated photonic crystal behavior of the opals. The tuning of the ferroelectric-paraelectric transition around the Curie temperature is shown in this paper. (orig.)

  5. Nanocrystals formation on Ho3+ doped strontium barium niobate glass

    International Nuclear Information System (INIS)

    The study of two different methods to obtain strontium barium niobate nanocrystals immersed in a glass matrix has been carried out. Ho2O3-doped SrO-BaO-Nb2O5-B2O3 glasses were fabricated using the melt quenching method. Glass ceramic samples were obtained from the precursor glass by thermal treatment in a furnace and by laser irradiation. These glass ceramic samples are formed by a glassy phase and a crystalline phase of strontium barium niobate nanocrystals. This structure was confirmed by X-ray diffraction and Atomic Force Microscope images. The incorporation of Ho3+ ions in the strontium barium niobate nanocrystals were corroborated by optical measurements, which produced an increment in the luminescence intensity compared to the precursor glass. - Research Highlights: →Ho doped strontium barium niobate nanocrystals have been obtained. →XRD, AFM and optical measurements corroborate the formation of SBN. →A laser irradiation technique has been carried out successfully.

  6. Removal of barium and radium from groundwater. Environmental research brief

    International Nuclear Information System (INIS)

    A research project was undertaken to investigate processes for removing barium and radium from drinking water. Special emphasis was placed on ion exchange processes that can be used without adding large concentrations of sodium to the water. The wastes from radium and barium removal processes were also characterized, and processes suitable for treatment of ion-exchange brines were evaluated. The report discusses two ion-exchange processes that can be used for barium and radium removal accompanied by either partial or no hardness removal. The calcium-form, strong-acid ion-exchange resin can be used for barium and radium removal without significant change in hardness or the concentration of other salts. This resin can be regenerated with CaC12 brine. The radium-selective complexer (RSC) will remove radium without altering hardness or other salt concentration. The capacity of this resin for waters with low total dissolved solids (TDS) (<1000 to 2000 mg/L TDS) is in excess of 30,000 pCi/dry g; however, if the TDS is increased to about 40,000 mg/L, the capacity drops to 200 to 300 pCi/dry g. Thus using this resin to remove radium from spent brine does not appear feasible

  7. CNO and F abundances in the barium star HD 123396

    CERN Document Server

    Alves-Brito, Alan; Yong, David; Meléndez, Jorge; Vásquez, Sergio


    [Abridged] Barium stars are moderately rare chemically peculiar objects which are believed to be the result of the pollution of an otherwise normal star by material from an evolved companion on the asymptotic giant branch (AGB). We aim to derive carbon, nitrogen, oxygen, and fluorine abundances for the first time from infrared spectra of the barium red giant star HD 123396 to quantitatively test AGB nucleosynthesis models for producing barium stars via mass accretion. High-resolution and high S/N infrared spectra were obtained using the Phoenix spectrograph mounted at the Gemini South telescope. The abundances were obtained through spectrum synthesis of individual atomic and molecular lines, using the MOOG stellar line analysis program together with Kurucz's stellar atmosphere models. The analysis was classical, using 1D stellar models and spectral synthesis under the assumption of local thermodynamic equilibrium. We confirm that HD 123396 is a metal-deficient barium star ([Fe/H] = -1.05), with A(C) = 7.88, A...

  8. Ultra-low temperature processing of barium tellurate dielectrics (United States)

    Kwon, Do-Kyun

    Ceramics, metals and polymers have unique electrical properties that are combined for electronic devices and systems. It necessitates lower processing temperatures for ceramics to be compatible with metal and polymer systems. In this thesis, the synthesis, crystal structure, and dielectric properties of barium tellurate are studied for temperatures between 500 and 900°C. Barium tellurate dielectric ceramics (BaTe4O9, BaTe 2O5, BaTe2O6, BaTeO3, BaTeO 4, and Ba2TeO5) are extensively investigated as new LTCC (Low-Temperature Cofired Ceramics) dielectric systems integrated with low resistivity metal electrodes such as silver and aluminum for microwave application. Studies on the phase formation and crystal structure through thermal analyses (Differential Scanning Calorimetry and Thermogravimetric Analysis, DSC-TGA) and X-ray diffraction phase analysis attest that barium tellurates are formed in the temperature range of 500 ˜ 900°C, through the sequential phase formations from Te-rich to Ba-rich phases. The oxygen coordination of the tellurium ion progresses from TeO4 to TeO6 via TeO 3+1 and TeO3 with increasing barium content as confirmed by structural analysis using infrared spectroscopy. High density barium tellurate ceramics are achieved at temperatures as low as 550°C, which provides the potential to be co-fired with low-melting aluminum metal electrodes in LTCC processing. Dielectric permittivity, loss, and temperature stability of barium tellurate dielectric ceramics were measured from 100 Hz to 13 GHz. Barium tellurate ceramics exhibit excellent microwave dielectric properties with intermediate dielectric permittivities and high quality factors (Q). The dielectric properties at microwave frequencies are epsilonr = 17.5, Qxf = 54700 GHz, TCf = -90 ppm/°C for BaTe4O9, epsilonr = 21, Qxf = 50300 GHz, TCf = -51 ppm/°C for BaTe2O6, epsilonr = 10, Qxf = 34000 GHz, TCf = -54 ppm/°C for BaTeO3, and epsilonr = 17, Qx f = 49600 GHz, TCf = -124 ppm/°C for Ba 2TeO5

  9. Barium Swallow Examination: Radiographer and radiologist compliance to National Diagnostic Reference Levels

    International Nuclear Information System (INIS)

    Objectives: Compliance to the National Diagnostic Reference Levels (NDRLs) ensures the radiation dose to patients is maintained at an acceptable level thereby reducing the element of risk and should not be exceeded wherever possible. The aim of the audit was to determine compliance to NDRLs for Dose Area Product (DAP) and fluoroscopy screening time in patients having Barium Swallow Examinations (BSE) between a specialist radiographer (SR) and radiologists. Methods: 157 BSEs DAP and screening time values were collected retrospectively over a five-month period. 34 specialist radiographer (SR)-led, 65 trainee radiologist (TR)-led and 52 consultant radiologist (CR)-led were included in the analysis. Six were excluded. These values were compared to the NDRL; both by individual and group mean value. Statistical analysis was mean, standard deviation and Mann–Whitney U to assess for significant differences between the operator groups. Results: 129 of 151 BSEs were below the NDRL for either DAP, screening time or both, equating to 85.4% compliance. For the three operator group BSE mean DAP values were 2 and mean screening time values 2) and SR-led produced the highest mean DAP value (5.56 Gycm2). DAP values: no significant difference between SR-led and TR-led (p > 0.05); a significant difference was noted between SR-led and CR-led and TR-led and CR-led (p 0.05) was shown; a significant difference was noted between SR-led and TR-led, and SR-led and CR-led (p < 0.05). Conclusions: This audit shows good compliance with the NDRLs for both DAP and screening time. Differences were demonstrated for both DAP values and screening time between the different operator groups. The highest mean values for both DAP and screening time were produced by examinations performed by the newly introduced specialist radiographer-led service

  10. Dicty_cDB: VHB151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB151 (Link to dictyBase) - - - Contig-U12075-1 | Contig-U12549-1 VHB151P ... metagenome genomic clone 1061002567331 5', genomic survey ... sequence. 56 4e-14 4 EJ320655 |EJ320655.1 10954033 ... metagenome genomic clone 1061005545253 3', genomic survey ... sequence. 68 3e-11 2 EJ450566 |EJ450566.1 10930154 ...

  11. Surface studies of barium and barium oxide on tungsten and its application to understanding the mechanism of operation of an impregnated tungsten cathode (United States)

    Forman, R.


    Surface studies have been made of multilayer and monolayer films of barium and barium oxide on a tungsten substrate. The purpose of the investigation was to synthesize the surface conditions that exist on an activated impregnated tungsten cathode and obtain a better understanding of the mechanism of operation of such cathodes. The techniques employed in these measurements were Auger spectroscopy and work-function measurements. The results of this study show that the surface of an impregnated cathode is identical to that observed for a synthesized monolayer or partial monolayer of barium on oxidized tungsten by evaluating Auger spectra and work-function measurements. Data obtained from desorption studies of barium monolayers on a tungsten substrate in conjunction with Auger and work-function results have been interpreted to show that throughout most of its life an impreganated cathode has a partial monolayer, rather than a monolayer, of barium on its surface.

  12. Design, testing, fabrication and launch support of a liquid chemical barium release payload (utilizing the liquid fluorine-barium salt/hydrazine system) (United States)

    Stokes, C. S.; Smith, E. W.; Murphy, W. J.


    A payload was designed which included a cryogenic oxidizer tank, a fuel tank, and burner section. Release of 30 lb of chemicals was planned to occur in 2 seconds at the optimum oxidizer to fuel ratio. The chemicals consisted of 17 lb of liquid fluorine oxidizer and 13 lb of hydrazine-barium salt fuel mixture. The fuel mixture was 17% barium chloride, 16% barium nitrate, and 67% hydrazine, and contained 2.6 lb of available barium. Two significant problem areas were resolved during the program: explosive valve development and burner operation. The release payload was flight tested, from Wallops Island, Virginia. The release took place at an altitude of approximately 260 km. The release produced a luminous cloud which expanded very rapidly, disappearing to the human eye in about 20 seconds. Barium ion concentration slowly increased over a wide area of sky until measurements were discontinued at sunrise (about 30 minutes).

  13. On separation and purification of 151Sm in connection with creation of 151Sm based sources for NGR spectroscopy

    International Nuclear Information System (INIS)

    The data on 151Sm purification from rare earths, actinides and other elements present in the fraction which is a waste of fission products processing with the use of extraction-chromatography separation technique (hdehp is extracting agent, teflon is the carrier), are presented. Results of γ-spectrometric analysis of purified preparations are considered, as well as some problems of preparing 151Sm-based Moessbauer sources, namely, the choice of the chemical form of active material and source design

  14. Electromagnetic properties of photodefinable barium ferrite polymer composites

    Directory of Open Access Journals (Sweden)

    Olusegun Sholiyi


    Full Text Available This article reports the magnetic and microwave properties of a Barium ferrite powder suspended in a polymer matrix. The sizes for Barium hexaferrite powder are 3–6 μm for coarse and 0.8–1.0 μm for the fine powder. Ratios 1:1 and 3:1 (by mass of ferrite to SU8 samples were characterized and analyzed for predicting the necessary combinations of these powders with SU8 2000 Negative photoresist. The magnetization properties of these materials were equally determined and were analyzed using Vibrating Sample Magnetometer (VSM. The Thru, Reflect, Line (TRL calibration technique was employed in determining complex relative permittivity and permeability of the powders and composites with SU8 between 26.5 and 40 GHz.

  15. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine (United States)

    Graziana Genchi, Giada; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni


    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these ‘smart’ nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation.


    Institute of Scientific and Technical Information of China (English)


    Polyaniline-barium titanate (PAn-BaTiO3) ultrafine composite particles were prepared by the oxidative polymerization of aniline with H2O2 while barium titanate nanoparticles were synthesized with a sol-gel method. The infrared spectrogram shows that the polymerization of PAn in the hybrid process of PAn-BaTiO3 is similar with the polymeric process of pure aniline, and there is interaction of PAn and BaTiO3 in the PAn-BaTiO3. SEM and TEM results show that the average diameter of the composite particles is 1.50 μm and the diameters of BaTiO3 nanoparticles are 5-15 nm in the composite particle. The electrical conductivity of the ultrafine composite particles is transformable from 100 to 10-11S/cm by equilibrium doping or dedoping method using various concentration of HCl or NaOH solutions.

  17. Thermophysical properties of americium-containing barium plutonate

    International Nuclear Information System (INIS)

    Polycrystalline specimens of americium-containing barium plutonate have been prepared by mixing the appropriate amounts of (Pu0.91Am0.09)O2 and BaCO3 powders followed by reacting and sintering at 1600 K under the flowing gas atmosphere of dry-air. The sintered specimens had a single phase of orthorhombic perovskite structure and were crack-free. Elastic moduli were determined from longitudinal and shear sound velocities. Debye temperature was also determined from sound velocities and lattice parameter measurements. Thermal conductivity was calculated from measured density at room temperature, literature values of heat capacity and thermal diffusivity measured by laser flash method in vacuum. Thermal conductivity of americium-containing barium plutonate was roughly independent of temperature and registered almost the same magnitude as that of BaPuO3 and BaUO3. (author)

  18. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine. (United States)

    Genchi, Giada Graziana; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni


    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these 'smart' nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation. PMID:27145888

  19. Barium ferrite powders prepared by milling and annealing

    Directory of Open Access Journals (Sweden)

    R. Nowosielski


    Full Text Available Purpose: Microstructure and magnetic properties analysis of barium ferrite powder obtained by milling and heat treatment.Design/methodology/approach: The milling process was carried out in a vibratory mill, which generated vibrations of the balls and milled material inside the container during which their collisions occur. After milling process the powders were annealed in electric chamber furnace. The X-ray diffraction methods were used for qualitative phase analysis of studied powder samples. The distribution of powder particles was determined by a laser particle analyzer. The magnetic hysteresis loops of examined powder material were measured by resonance vibrating sample magnetometer (R-VSM.Findings: The milling process of iron oxide and barium carbonate mixture causes decrease of the crystallite size of involved phases. The X-ray investigations of tested mixture milled for 30 hours and annealed at 950 °C enabled the identification of hard magnetic BaFe12O19 phase and also the presence of Fe2O3 phase in examined material. The Fe2O3 phase is a rest of BaCO3 dissociation in the presence of Fe2O3, which forms a compound of BaFe12O19. The best coercive force (HC for mixture of powders annealed at 950 °C for 10, 20 and 30 hours is 349 kA/m, 366 kA/m and 364 kA/m, respectively. The arithmetic mean of diameter of Fe2O3 and BaCO3 mixture powders after 30 hours of milling is about 6.0 μm.Practical implications: The barium ferrite powder obtained by milling and annealing can be suitable components to produce sintered and elastic magnets with polymer matrix.Originality/value: The results of tested barium ferrite investigations by different methods confirm their utility in the microstructure and magnetic properties analysis of powder materials.

  20. Barium borohydride chlorides: synthesis, crystal structures and thermal properties. (United States)

    Grube, Elisabeth; Olesen, Cathrine H; Ravnsbæk, Dorthe B; Jensen, Torben R


    Here we report the synthesis, mechanism of formation, characterization and thermal decomposition of new barium borohydride chlorides prepared by mechanochemistry and thermal treatment of MBH4-BaCl2, M = Li, Na or K in ratios 1 : 1 and 1 : 2. Initially, orthorhombic barium chloride, o-BaCl2 transforms into o-Ba(BH4)xCl2-x, x ∼ 0.15. Excess LiBH4 leads to continued anion substitution and a phase transformation into hexagonal barium borohydride chloride h-Ba(BH4)xCl2-x, which accommodates higher amounts of borohydride, possibly x ∼ 0.85 and resembles h-BaCl2. Thus, two solid solutions are in equilibrium during mechano-chemical treatment of LiBH4-BaCl2 (1 : 1) whereas LiBH4-BaCl2 (2 : 1) converts to h-Ba(BH4)0.85Cl1.15. Upon thermal treatment at T > ∼200 °C, h-Ba(BH4)0.85Cl1.15 transforms into another orthorhombic barium borohydride chloride compound, o-Ba(BH4)0.85Cl1.15, which is structurally similar to o-BaBr2. The samples with M = Na and K have lower reactivity and form o-Ba(BH4)xCl2-x, x ∼ 0.1 and a solid solution of sodium chloride dissolved in solid sodium borohydride, Na(BH4)1-xClx, x = 0.07. The new compounds and reaction mechanisms are investigated by in situ synchrotron radiation powder X-ray diffraction (SR-PXD), Fourier transform infrared spectroscopy (FT-IR) and simultaneous thermogravimetric analysis (TGA), differential scanning calorimetry (DSC), mass spectroscopy (MS) and temperature programmed photographic analysis (TPPA). PMID:27109871

  1. Thermoelectric power of barium up to 8 GPa

    Energy Technology Data Exchange (ETDEWEB)

    Ramani, G.; Divakar, C.; Singh, A.K.


    The present measurements indicate that the thermoelectric power (TEP) of barium at room temperature and pressure is 15 K/sup -1/, and decreases with increasing pressure, reaching about 4 K/sup -1/ just before the bcc..-->..hcp transition. The TEP shows a discontinuous increase at the bcc..-->..hcp transition beyond which it continues to decrease with increasing pressure.

  2. Effect of Silver Coating on Barium Titanium Oxide Nanoparticle Toxicity


    Obregon, Isidro D.; Betts-Obregon, Brandi S.; Yust, Brian; Pedraza, Francisco; Ortiz, Alexandra; Sardar, Dhiraj; Tsin, Andrew T.


    Nanoparticles are presently being studied for optical and biomedical applications such as medical imaging and drug delivery. Nanoparticles impact the cellular environment due to many variables such as size, shape, and composition. How these factors affect cell viability is not fully understood. The purpose of this study is to test the toxicity effects of silver coating (Ag@) Barium Titanium Oxide (BaTiO3) nanoparticles on Rhesus Monkey Retinal Endothelial cells (RhREC’s) in culture. The addit...

  3. Microstructure and magnetic properties of commercial barium ferrite powders

    Directory of Open Access Journals (Sweden)

    R. Nowosielski


    Full Text Available Purpose: Microstructural and magnetic properties analysis of commercial barium ferrite powder BaFe12O19.Design/methodology/approach: The X-ray diffraction methods were utilized not only for qualitative andquantitative phase analysis of studied powder sample, but also for the determination of lattice parameters, crystallitesize and the lattice distortion. The Rietveld method was used in the verification of the qualitative phase compositionand in the determination of phase abundance. Hill and Howard procedure was applied for quantitative phaseanalysis. The parameters of the individual diffraction line profiles were determined by PRO-FIT Toraya procedure.The morphology of barium ferrite powders was analyzed using the scanning electron miroscopy (SEM method.The distribution of powder particles was determined by a laser particle analyzer. Moreover, the magnetic hysteresisloop of examined powder material were measured by resonance vibrating sample magnetometer (R-VSM.Findings: The X-ray diffraction analysis revealed the presence of hexagonal BaFe12O19 and rhombohedralFe2O3 phases in examined powder samples. The barium ferrite phase appeared to be the main component of thesamples (97.8 wt.%. The crystallite size of BaFe12O19 phase is above 100 nm. The size of studied powders isin the range from 0.2 μm to 40.5 μm. The arithmetic mean diameter of BaFe12O19 powders population is 10.335μm. The SEM images showed irregular shape and size of powder particles. The coercive force (HC obtainedfrom hysteresis loop has a value about 159 kA/m.Practical implications: Structure analysis of commercial barium ferrite powder is helpful to prepare thismaterial by laboratory methods.Originality/value: The obtained results of investigations by different methods of structure characterizationconfirm their utility in the microstructure analysis of powder materials.

  4. Dielectric Properties of Barium Titanate Prepared by Spark Plasma Sintering

    Czech Academy of Sciences Publication Activity Database

    Ctibor, Pavel; Sedláček, J.; Dopita, M.; Pala, Zdeněk

    Bratislava: Slovak Expert Group of Solid State Chemistry and Physics , 2011 - (Koman, M.; Mikloš, D.), s. 68-69 ISBN 978-80-8134-002-4. [Joint Seminar – Development of materials science in research and education (DMRSE)/ Kežmarské Žlaby (SK), 29.08.2011-02.09.2011] Institutional research plan: CEZ:AV0Z20430508 Keywords : spark plasma sintering * barium titanate * dielectric properties Subject RIV: JK - Corrosion ; Surface Treatment of Materials

  5. Preparation and Characterization of Nano-particle Substituted Barium Hexaferrite


    Atassi, Yomen; Darwich, Iyad Seyd; Tally, Mohammad


    High density magnetic recording requires high coercivity magnetic media and small particle size. Barium hexaferrite has been considered as a leading candidate material because of its chemical stability, fairly large crystal anisotropy and suitable magnetic characteristics. In this work, we present the preparation of the hexagonal ferrite BaFe12O19 and one of its derivative; the Zn-Sn substituted hexaferrite by the chemical co-precipitation method. The main advantage of this method on the conv...

  6. Microwave-hydrothermal synthesis of barium strontium titanate nanoparticles

    International Nuclear Information System (INIS)

    Research highlights: → Barium strontium titanate nanoparticles were obtained by the Hydrothemal microwave technique (HTMW) → This is a genuine technique to obtain nanoparticles at low temperature and short times → Barium strontium titanate free of carbonates with tetragonal structure was grown at 130 oC. - Abstract: Hydrothermal-microwave method (HTMW) was used to synthesize crystalline barium strontium titanate (Ba0.8Sr0.2TiO3) nanoparticles (BST) in the temperature range of 100-130 oC. The crystallization of BST with tetragonal structure was reached at all the synthesis temperatures along with the formation of BaCO3 as a minor impurity at lower syntheses temperatures. Typical FT-IR spectra for tetragonal (BST) nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH- groups, commonly found in materials obtained by HTMW process. FE/SEM revealed that lower syntheses temperatures led to a morphology that consisted of uniform grains while higher syntheses temperature consisted of big grains isolated and embedded in a matrix of small grains. TEM has shown BST nanoparticles with diameters between 40 and 80 nm. These results show that the HTMW synthesis route is rapid, cost effective, and could serve as an alternative to obtain BST nanoparticles.

  7. Preparation of Nanoparticles of Barium Ferrite from Precipitation in Microemulsions

    International Nuclear Information System (INIS)

    Magnetic nanoparticles of barium ferrite (BaFe12O19) have been synthesized using a microemulsion mediated process. The aqueous cores of water-in-oil microemulsions were used as constrained microreactors for the precipitation of precursor carbonate and hydroxide particles. These precursors were then calcined at 925 deg. C for 12 h, during which time they were transformed to the hexagonal ferrite. The pH of reaction was varied between 5 and 12, and it was found that the fraction of non-magnetic hematite (α-Fe2O3) in the particles varied with the pH of reaction, thus affecting the magnetic properties of the particles. The same precursor particles were also prepared by bulk co-precipitation reaction for comparison. It was found that the microemulsion derived nanoparticles of barium ferrite had both higher intrinsic coercivity (Hc) and saturation magnetization (σs) than the particles derived from bulk co-precipitation. Particles were analyzed by electron microscopy, X-ray diffraction, differential thermal analysis (DTA), thermogravimetric analysis (TGA) and vibrating sample magnetometry (VSM). The best barium ferrite particles produced by the microemulsion synthesis method yielded an intrinsic coercivity of 4310 Oe and a saturation magnetization of 60.48 emu/g

  8. Role of hexadecapole interaction in proton rich barium isotopes

    International Nuclear Information System (INIS)

    From the systematic analysis of the experimental data on proton rich barium isotopes, it is observed that nuclei in the region z ≥ 50 and N≤82 are the transitional nuclei as they show a shape transition from spherical to deformed shape. An interesting feature of the observed yrast spectra in barium isotopic mass chain is the systematic variation of E2+, E4+ and E6+ excitation energy states from 120Ba to 136Ba. It is observed that these states follow a systematic decreasing trend as move away from 136Ba towards 120Ba. The isotopes 120-128Ba can be taken to be quasi-deformed nuclei having E4+/E2+ ratio larger than 2.7. Based on the systematics of low-lying states and the experimental data of quadrupole moments and B(E2) transition probabilities, the stable barium isotopes range from the approximately spherical 138Ba to l30Ba which is close to the deformed 120-128Ba isotopes. The purpose of the paper is to determine the importance of octupole-octupole and hexadecapole- hexadecapole parts of the two body interaction in reproducing the observed nuclear structure properties of 120-136Ba isotopes

  9. CT and barium features of gastrointestinal and peritoneal tuberculosis

    Directory of Open Access Journals (Sweden)

    Makanjuola Dorothy


    Full Text Available The radiological features in barium gastrointestinal studies and computed tomographic (CT examinations of 22 consecutive cases of proven peritoneal and/or intestinal tuberculosis were analyzed in order to highlight the radiological features which could provide ready identification of the disease. There were 15 cases of intestinal tuberculosis and 7 cases of peritoneal tuberculosis and 3 patients had both. The commonest location of intestinal tuberculosis was the ileocecal region (N=10 which occurred in association with colonic or ilea] disease. Bowel wall thickening in CT was largely asymmetrical but minimal and symmetrical wall thickening occurred with peritonitis. Luminal narrowing with or without mucosal tethering were seen in both CT and Barium studies. Peritoneal TB had either high density ascites with smudge or nodular omental surface with a thickened omental lining. Also detected was fibrinous dry peritonitis with thickened mesenteric tissue. Lymphadenopathy in the peripancreatic, mesenteric or paracaval were common to both intestinal or peritoneal tuberculosis (21 out of 22. Fifty percent of the patients showed some lymph nodes with necrotic centers. The differential diagnosis included malignant peritonitis and intestinal or mesenteric carcinoid. The study shows that a combination of barium gastrointestinal study and computed tomography can provide distinct features which could strongly suggest the diagnosis of intestinal or peritoneal tuberculosis.

  10. Scanning electron and tunneling microscopy of palladium-barium emitters

    International Nuclear Information System (INIS)

    The results of study of metal-alloyed palladium-barium emitters' of modern very high frequency high-powered electronic vacuum tubes by scanning electron microscopy (SEM) and scanning tunneling microscopy/spectroscopy (STM/STS) are presented. Since the Pd/Ba foil surface is fairly smooth and is not oxidized in air STM/STS investigations are carried out in air in normal laboratory environment. SEM and STM images show that the emitter surface has a complex porous structure. The cathode surface study by STS in tunneling gap modulation mode allowed to take a map of phase distribution with various work function values and high lateral resolution. Obtained images demonstrate the presence of three phases on the Pd/Ba emitter surface, viz. barium-oxygen compounds, intermetallic, and palladium. As it is seen from presented STS image the phase with a low work function value (barium oxides) is concentrated along boundaries of the substance inclusions with work function corresponding to the intemetallic compound Pd5Ba. This supports the model of low work function areas obtained via Ba segregation from the intermetallic compound and oxidation. The presented methods may be used in the Pd/Ba cathode manufacturing process for increasing the yield of electronic devices in microwave tube production and optimize the emitters' characteristics

  11. Early colon cancer : findings on double contrast barium enema

    International Nuclear Information System (INIS)

    The purpose of this study is to describe the radiologic findings of early colon cancer on double-contrast barium enema. We retrospectively reviewed the double-contrast barium enemas of eight patients (M:F = 6:2; mean age : 67 yrs; range : 48-77 yrs) who were pathologically proven to be early colon cancer. The location, size and gross morphology of lesions was evaluated using double-contrast barium enema, while depth of invasion, degree of differentiation, precancerous lesions and lymph node metastasis were evaluated histopathologically. Early colon cancer was found in the rectum (n=4), sigmoid colon (n=3) and ascending colon (n=1). The size of mass ranged from 2.3 ∼ 8.3 (mean, 4.6) cm. And the polypoid type was most common (n=7); this was subdivided into sessile (Is, n=5), semipedunculated (Isp, n=1) and pedunculated type (Ip, n=1). Another mass was a sessile polypoid combined with a flat depressed lesion. In eight cases, four cancers were confined to the mucosa, while the remaining four had infiltrated the submucosa. Most cancers arose from villous and villotubular adenoma. All cases were well-differentiated adenocarcinoma and no metastasis to lymph nodes had occurred. In early colon cancer, lesions were mainly polypoid and large. Most arose from villous and villotubular adenoma. (author). 19 refs., 1 tab., 3 figs

  12. Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium

    International Nuclear Information System (INIS)

    Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation

  13. Barium and Tc-poor S stars: Binary masqueraders among carbon stars


    Jorissen, A; Van Eck, S.


    The current understanding of the origin of barium and S stars is reviewed, based on new orbital elements and binary frequencies. The following questions are addressed: (i) Is binarity a necessary condition to produce a barium star? (ii) What is the mass transfer mode (wind accretion or RLOF?) responsible for their formation? (iii) Do barium stars form as dwarfs or as giants? (iv) Do barium stars evolve into Tc-poor S stars? (v) What is the relative frequency of Tc-rich and Tc-poor S stars?

  14. Mechanism of action of barium ion on rat aortic smooth muscle. (United States)

    Hansen, T R; Dineen, D X; Petrak, R


    The mechanism of action of barium ion on the aortic smooth muscle of the normal rat was investigated using in vitro calcium-depleted aortic strips. Aortic strips were depleted of calcium by repeated exposure to norepinephrine in a calcium-free bathing solution. Although calcium depletion abrogated the response of strips to catecholamines and depolarizing agents, the response to barium chloride remained quantitatively intact. The calcium influx blocker D 600 prevented the contractile response to barium but not to catecholamines, whereas phentolamine prevented the response to catecholamines but not barium. The strip response to barium was depressed by a twofold increase in extracellular magnesium concentration whether the strip was intact or calcium depleted. Although increased concentrations of calcium in the extracellular medium inhibited the contractile response to potassium ion, increases in barium merely potentiated the potassium contracture. These findings indicate that barium produces its contractile effect on vascular smooth muscle by a direct intracellular interaction with the contractile or regulatory proteins. Barium enters these cells via calcium influx channels and is probably not sequestered in a physiologically releasable pool. Unlike calcium, barium does not stabilize the smooth muscle sarcolemma when present in high concentration. PMID:6703038

  15. Barium can replace calcium in calmodulin-dependent contractions of skinned renal arteries of the rabbit. (United States)

    Kreye, V A; Hofmann, F; Mühleisen, M


    Renal arteries of the rabbit were chemically skinned using Triton X-100. In EGTA-buffered solutions containing calmodulin and ATP, small strips of the skinned preparations were found to develop contractile force which was dependent on the concentrations of either free calcium or of free barium. However, a 220 times greater concentration of barium than of calcium was necessary for comparable effects. Quantitatively, the response to barium was dependent on the concentration of calmodulin added to the test solutions. The contractile effect of barium was partly antagonized by the calmodulin antagonist, trifluoperazine. PMID:3960707

  16. High Resolution Computed Tomography Appearences of late sequelae of Barium Aspiration in an asymptomatic young child

    International Nuclear Information System (INIS)

    Barium aspiration is a well-known complication of upper gastro-intestinal studies. Consequences of aspiration are generally insignificant and leave no permanent changes in the lung parenchyma. However, large quantities of high density barium, if aspirated, lead to silent interstitial changes and fibrosis. High-resolution computed tomography HRCT appearances of lung changes have been demonstrated in adults; few such reports are available in the pediatric literature. We report a case of a child who aspirated barium 3 months before this presentation. The HRCT appearances of barium aspiration are presented with a review of the literature. (author)

  17. Solubility and stability of barium arsenate and barium hydrogen arsenate at 25oC

    International Nuclear Information System (INIS)

    The inconsistency among current thermodynamic data of Ba3(AsO4)2(c) and BaHAsO4.H2O(c) led the authors to obtain independent solubility data of barium arsenate by both precipitation and dissolution experiments. Low and neutral pH (3.63-7.43) favored the formation of BaHAsO4.H2O(c). Both BaHAsO4.H2O(c) and Ba3(AsO4)2(c) formed at the neutral pH conditions (7.47, 7.66), whereas Ba3(AsO4)2(c) was the only solid phase precipitated at high pH (13.03, 13.10). The Ba3(AsO4)2(c) precipitate acquired at 50oC appeared as small leafy crystal, while the Ba3(AsO4)2(c) solid precipitated at 25oC comprised granular aggregate with some smaller crystal clusters. XRD and SEM analyses of Ba3(AsO4)2(c) and BaHAsO4.H2O(c) indicated that the solids were indistinguishable before and after the dissolution experiments. In the present work, the solubility products (Ksp) for Ba3(AsO4)2(c) and BaHAsO4.H2O(c) were determined to be 10-23.53(10-23.01 to 10-24.00) and 10-5.60(10-5.23 to 10-5.89), respectively. ΔGfo for Ba3(AsO4)2(c) and BaHAsO4.H2O(c) were calculated to be -3113.40 and -1544.47kJ/mol, respectively. There was no difference between the solubility products of the leafy and the granular Ba3(AsO4)2(c) solids

  18. Dicty_cDB: SSE151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 |U49650.1 Dictyostelium discoideum calcium-dependent cell adhesion molecule-1 DdCAD-1 (cadA) mRNA, complet...nts: (bits) Value ( P54657 ) RecName: Full=Calcium-dependent cell adhesion molecule ... 317 2e-85 U20997_1( U20997 |pid:non...otein mRNA, partial cds. 795 0.0 5 AF340153 |AF340153.1 Dictyostelium discoideum calcium-dependent cell adhesi...lgi 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for SSE151 Representative seq. ID SSE151Z (Link to Original si

  19. Tungsten and barium transport in the internal plasma of hollow cathodes (United States)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.


    The effect of tungsten erosion, transport, and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from 8200 h and 30 352 h ion engine wear tests. Erosion and subsequent redeposition of tungsten in the electron emission zone at the downstream end of the insert reduce the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  20. Dicty_cDB: CFK151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficant alignments: (bits) Value N L16578 |L16578.1 Dictyostelium discoideum HIV1 TAT-binding protein...CF (Link to library) CFK151 (Link to dictyBase) - - - Contig-U15589-1 - (Link to Original site...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15589-1 Original site URL Representative seq. ID - (Link to Original site) Represen...svifvffffxkg--- Frame C: ff*fliflyiyiniyfyfyffl*fsnitisnynlvliv*ylffffxkk--- H

  1. Dicty_cDB: VFJ151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficant alignments: (bits) Value N ( L16578 ) Dictyostelium discoideum HIV1 TAT-binding protein...VF (Link to library) VFJ151 (Link to dictyBase) - - - Contig-U15589-1 - (Link to Original site...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15589-1 Original site URL Representative seq. ID - (Link to Original site) Represen...svifvffffxkk--- Frame C: f*fliflyiyiniyfyfyffl*fsnitisnynlvliv*ylfffffxkr--- Homo

  2. Anion and cation diffusion in barium titanate and strontium titanate

    International Nuclear Information System (INIS)

    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO3 single crystals has been studied by means of 18O2/16O2 isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial pressure and temperature. The data

  3. Microstructure of polymer composite with barium ferrite powder

    Directory of Open Access Journals (Sweden)

    R. Nowosielski


    Full Text Available Purpose: The aim of the paper is the microstructure characterization of commercial BaFe12O19 powder and its composite material in polymer matrix; XRD (X-Ray Diffraction and SEM (Scanning Electron Microscopy methods were applied.Design/methodology/approach: The Rietveld method appeared to be very useful in the verification of the qualitative phase composition and in the determination of phase abundance. Hill and Howard procedure was applied for quantitative phase analysis. The parameters of the individual diffraction line profiles were determined by PRO-FIT Toraya procedure. The morphology of barium ferrite powders and a fracture surface of the examined composite material was analyzed using the scanning electron microscope.Findings: The X-ray diffraction analysis enabled the identification of BaFe12O19 and Fe2O3 phases in examined material. Basing on Rietveld and Toraya methods the determination of lattice parameters, crystallite size and the lattice distortion was performed. Distribution of powders of barium ferrite in polymer matrix is irregular and powder particles are of irregular shapes and different sizes.Research limitations/implications: Maked researches are limited only to characterization the microstructure of commercial material, because obtained results will be helpful to prepare barium ferrite powders by mechanical alloying and subsequent annealing in the future. As prepared BaFe12O19 powders will be used as the starting material for magnets bonded with polymer material.Originality/value: The obtained results of investigations by different methods of structure analysis confirm their useful in the microstructure analysis of powder materials.

  4. Infarto cerebelar: análise de 151 pacientes Cerebellar infarction: analysis of 151 patients

    Directory of Open Access Journals (Sweden)

    Jefferson Rosi Jr


    Full Text Available Este estudo apresenta o tratamento de 151 pacientes com infarto cerebelar, sendo 98 homeNs (65% e 53 mulheres (35%, com média de idade de 62,4 anos. Hidrocefalia obstrutiva foi diagnosticada em 7,9% dos pacientes associada com um infarto cerebelar extenso e em todos os 11 pacientes operados (7,2%. Quatro pacientes foram submetidos a derivação ventricular externa com 3 óbitos (75% e 7 foram submetidos a craniectomia descompressiva suboccipital com 2 óbitos (28,5%. A mortalidade no grupo clínico foi de 15 pacientes (10,7%. Vertigem, vômito, sinal de Romberg e dismetria foram os sinais e sintomas de envolvimento cerebelar mais frequentemente observados. Infarto cerebelar devido a embolismo provocado por cirurgia cardiovascular ocorreu em 57 pacientes (37,7%.Infarto cerebelar como fato isolado ocorreu em 59 pacientes (39% e infartos cerebelares associados a infartos de outras regiões ocorreram em 92 pacientes (61%. A ressonância magnética foi o melhor método para o diagnóstico das lesões, embora a tomografia pôde mostrar infarto cerebelar em 68 pacientes (78%.This report presents the treatment of 151 patients with cerebellar infarction, 98 men (65% and 53 women (35%, mean age 62.4 years old. Occlusive hydrocephalus was diagnosed in 7.9% of the patients associated with an extensive cerebellar infarction and in all 11 surgical patients (7.2%. Four patients underwent an external ventricular drainage with 3 deaths (75% and 7 underwent a decompressive suboccipital craniectomy with 2 deaths (28.5%. Mortality of the clinical group was 15 patients (10.7%. Vertigo, vomiting, Romberg sign and dysmetria were the signs and symptoms of cerebellar involvement that were more frequentely observed. Cerebellar infarction from embolism after cardiovascular surgery occurred in 57 patients (37.7%.Cerebellar infarction, as a isolated fact, occurred in 59 patients (39% and cerebellar plus infarction in other regions occurred in 92 patients (61%. Magnetic

  5. 75 FR 36629 - Barium Chloride From the People's Republic of China: Continuation of Antidumping Duty Order (United States)


    ... Barium Chloride From China, 75 FR 33824 (June 15, 2010), and Barium Chloride from China (Inv. No. 731-TA... Five-year (``Sunset'') Review, 74 FR 31412 (July 1, 2009). As a result of its review, the Department... China: Final Results of Expedited Third Sunset Review of Antidumping Duty Order, 74 FR 55814 (October...

  6. New efficient catalyst for ammonia synthesis: barium-promoted cobalt on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus; Jacobsen, Claus J.H.; Teunissen, Herman T; Ståhl, Kenny; Chorkendorff, Ib


    Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia......Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia...


    Higher cardiovascular mortality has been associated in a single epidemiological study with higher levels of barium in drinking water. he purpose of this study was to determine whether drinking water barium at levels found in some U.S. communities alters the known risk factors for...

  8. Acute respiratory failure caused by aspiration of high density barium: A case report

    International Nuclear Information System (INIS)

    Accidental aspiration of barium contrast medium during the upper gastrointestinal study can occur in patients with swallowing disorder, especially in the elderly patients. We experienced a case of respiratory failure followed by death within a few hours in 85 year-old patient after barium aspiration

  9. Medical radiation shielding effect by composition of barium compounds

    International Nuclear Information System (INIS)

    Highlight: ► Radiation shielding sheet was manufactured using BaSO4 and a combination of tourmaline, tungsten, silicon and rubber polymer. ► The particle packing of barium tends to be related to the tensile strength. ► The tensile strength was most excellent in the sheets containing rubber. ► The shielding ability of the tungsten and silicon combination with BaSO4 was the same as that of a 0.3 mm lead equivalent. - Abstract: Shielding aprons were manufactured from barium sulfate as a potential substitute for the lead aprons used most commonly for medical radiation shielding. Six types of radiation shielding sheets made from a combination of tungsten, molybdenum, rubber and silicon with a barium sulfate base were manufactured, and their transmission doses were compared with those of a lead standard. In the process of producing the radiation shielding sheets, the particle packing and porosity of the materials, appropriate weight-average molecular weight to number-average molecular weight ratio and tensile strength were investigated to determine the optimal mixing process. The transmission dose was measured by applying a lead equivalent test method () of X-ray protective supplies in the Korea Industrial Standard. The transmission doses of the lead standard with a thickness of 0.05, 0.1, 0.15, 0.2, 0.25, 0.3 and 0.35 mm, as well as the six types of radiation shielding sheet were obtained at a tube voltage of 50, 80, 100, 120 and 150 kVp. According to the results, the combination of barium, tungsten, molybdenum and silicon recorded a dose of a 0.3 mm lead equivalent and its particle packing and porosity were 28–36% and 12–22%, respectively. Nevertheless, satisfactory shielding ability could be obtained with a porosity >20% and particle packing of 30%. Therefore, it is a potential replacement for lead sheet and can be considered a proper medical radiation shielding sheet with good economic feasibility.

  10. Enhanced flexoelectricity through residual ferroelectricity in barium strontium titanate

    International Nuclear Information System (INIS)

    Residual ferroelectricity is observed in barium strontium titanate ceramics over 30 °C above the global phase transition temperature, in the same temperature range in which anomalously large flexoelectric coefficients are reported. The application of a strain gradient leads to strain gradient-induced poling or flexoelectric poling. This was observed by the development of a remanent polarization in flexoelectric measurements, an induced d33 piezoelectric response even after the strain gradient was removed, and the production of an internal bias of 9 kV m−1. It is concluded that residual ferroelectric response considerably enhances the observed flexoelectric response

  11. Strain engineered barium strontium titanate for tunable thin film resonators

    Energy Technology Data Exchange (ETDEWEB)

    Khassaf, H.; Khakpash, N. [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Sun, F. [Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States); Sbrockey, N. M.; Tompa, G. S. [Structured Materials Industries, Inc., Piscataway, New Jersey 08854 (United States); Kalkur, T. S. [Department of Electrical and Computer Engineering, University of Colorado at Colorado Springs, Colorado Springs, Colorado 80918 (United States); Alpay, S. P., E-mail: [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States)


    Piezoelectric properties of epitaxial (001) barium strontium titanate (BST) films are computed as functions of composition, misfit strain, and temperature using a non-linear thermodynamic model. Results show that through adjusting in-plane strains, a highly adaptive rhombohedral ferroelectric phase can be stabilized at room temperature with outstanding piezoelectric response exceeding those of lead based piezoceramics. Furthermore, by adjusting the composition and the in-plane misfit, an electrically tunable piezoelectric response can be obtained in the paraelectric state. These findings indicate that strain engineered BST films can be utilized in the development of electrically tunable and switchable surface and bulk acoustic wave resonators.

  12. Heterometallic β-diketonates containing barium and rare earth elements

    International Nuclear Information System (INIS)

    Potentiality of formation of heterobimetallic complexes of the composition Ba[LnLn] (Ln = La, Er; L - hexafluoroacetylacetonate, pivaloyltrifluoroacetonate-(Pta), dipivaloylmethanate-anion, is studied by mass spectrometry (MALDI-MS) method. The compounds prepared are characterized by the methods of element analysis. IR spectroscopy of gaseous phase, thermal analysis in vacuum. Compound Ba[La(Pta)5] features increased thermal stability compared with Ba(Pta)2 and La(Pta)3 and it can be offered for practical use as barium and lanthanum source in preparation of oxide films

  13. Barium strontium titanate powders prepared by spray pyrolysis

    International Nuclear Information System (INIS)

    Ultasonic spray pyrolysis (SP) has been investigated for the production of the barium strontium titanate (BST) powders from the polymeric precursors. The processing parameters, such as flux of aerosol and temperature profile inside the furnace, were optimized to obtain single phase BST. The powders were characterized by the methods of X-ray diffraction analysis, SEM, EDS and TEM. The obtained powders were submicronic, consisting of spherical, polycrystalline particles, with internal nanocrystalline structure. Crystallite size of 10 nm, calculated using Rietveld refinement, is in a good agreement with results of HRTEM

  14. Mechanism of thermoluminescence in europium-doped barium fluorochloride

    International Nuclear Information System (INIS)

    The paper concerns the optical properties of europium-doped barium fluorochloride. Thermoluminescence (TL) and emission studies have been carried out with this material and the results are reported. The irradiation was by γ-rays from a 60Co source, the dose rate being 5000rad min-1. Glow curves of γ-irradiated BaFCl:Eu2+ are presented, along with the glow curves resolved into component peaks. TL emission spectra of BaFCl:Eu2+ at room temperature, 345K, 395K and 500K are also described. (U.K.)

  15. The Kerr nonlinearity of the beta-barium borate crystal


    Bache, Morten; Guo, Hairun; Zhou, Binbin; Zeng, Xianglong


    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e...

  16. K-shell fluorescence yields of barium and lanthanum

    International Nuclear Information System (INIS)

    K-shell fluorescence yields for barium and lanthanum have been measured adopting simple 2π geometrical configuration and employing a weak 57Co radioactive source. A scintillation spectrometer with an NaI(Tl) detector of dimensions 44.5 mm diameterx50 mm thickness was employed for the detection and measurement of radiation. The results obtained are in good agreement with the best-fitted values of and also with the other experimental values, indicating that our simple method can be extended to determine fluorescence parameters of high Z materials.

  17. Colloidal stability of aqueous suspensions of barium zirconate


    Boschini, Frédéric; Rulmont, André; Cloots, Rudi; Moreno, R.


    In this article, the colloidal behaviour of aqueous suspensions of barium zirconate is investigated. The variation of zeta-potential as a consequence of changing the pH and the concentration of an anionic polyelectrolyte is studied, the isoelectric point occurring at pH 5.3. The IEP shifts down on calcining the powder and also when anionic polyelectrolytes are added. Rheological studies have been made on suspensions prepared to a solids loading of 27 vol.% (72 wt.%). Optimum dispersing condit...

  18. Experiences with Cascara-Salax preparating children for barium enema

    International Nuclear Information System (INIS)

    30 children prepared for barium enema using Cascara-Salax are reported on. The results are: 1. A satisfactory preparation is possible in out-patient children older than ten years. 2. For children aged 6 to 10 years only the half dose early in the afternoon before the X-ray examination is necessary. 3. In most cases the colon is completely clear, if not, the X-ray study is generally not influenced by rests of stool. 4. It should be considered that other - and often unreliable - cleaning manoevers aren't necessary, the Cascara-Salax - method ist time - saving and side-effects are not of value. (orig.)

  19. Bis(chlorido)(dimethyl­sulfoxide-κO)barium(II)


    Gschwind, Fabienne; Jansen, Martin


    The title compound, [BaCl2(C2H6SO)], forms a Ba6Cl9 cluster in which the BaCl2 units are connected via dimethyl­sulfoxide (DMSO) and chloride bridges. The central Cl atom of the Ba6Cl9 cluster is located on a threefold inversion axis and is coordinated octa­hedrally to six barium cations. In the crystal, the clusters are arranged in rows, which are inter­connected by the DMSO mol­ecules, forming a three-dimensional network.

  20. Magnetic and structural investigations on barium hexaferrite ferrofluids (United States)

    Müller, R.; Hiergeist, R.; Gawalek, W.; Hoell, A.; Wiedenmann, A.


    Barium hexaferrite BaFe 12-2 xTi xCo xO 19 ferrofluids have been prepared using oleic acid as surfactant and Isopar M ® or dodecane as carrier liquid. The ferrite particles were prepared by glass crystallization. Hysteresis parameters, the initial susceptibility versus temperature and the magnetic particle size were obtained by VSM. Ferrofluids with a partly deuterated carrier liquid were investigated by small angle neutron scattering (SANS). SANS curves lead to a bimodal size distribution consisting of single magnetic particles with an organic shell and aggregated particles with an incomplete organic layer.

  1. Radium and barium in the Amazon River system

    International Nuclear Information System (INIS)

    Data for 226Ra and 228Ra in the Amazon River system show that the activity of each radium isotope is strongly correlated with barium concentrations. Two trends are apparent, one for rivers which drain shield areas and another for all other rivers. These data suggest that there has been extensive fractionation of U, Th, and Ba during weathering in the Amazon basin. The 226Ra data fit a flux model for the major ions indicating that 226Ra behaves conservatively along the main channel of the Amazon River

  2. A comparison study between diagnostic value of sonography and Barium swallow in gasteroesophageal reflux in pediatrics

    Directory of Open Access Journals (Sweden)

    Fallahi G


    Full Text Available One of the common problems in children and specially in infants is gasteroesophageal reflux (G.E.R. Present study was performed to compare diagnostic value of lower esophageal sonography with barium swallow. This study was conducted on 50 patients 1 month to 15 years age in center of pediatric clinic of Tehran, during the years 1999-2000. Patients suspected to have G.E.R studied with lower esophageal sonography and barium swallow and at the end, their results were compared with esophageal PH monitoring as a standard test. In this study sensevity of sonography was 90 percent against 50 percent for barium swallow but specifity of two test was the same 35 percent. We can concluded that sonography is a non invasive, low cost, with less side effects than barium swallow. We recommend sonography in place of barium swallow in diagnosis of G.E.R.

  3. A Comparison between the Diagnostic Value of Sonography vs. Barium Swallow In Gastroesdophageal Reflux in Children

    Directory of Open Access Journals (Sweden)

    F. Zandie


    Full Text Available Background: One of the common problems in children, especially infants, is gastroesophageal reflux (GER. Objectives:This study was performed to compare the diagnostic value of lower esophageal sonography with that of barium swallow. Patients and method: Our trial was a triple-blind, performed on 50 patients of 1 month to 15 years of age. The patients suspicious of having GER were evaluated by sonography and barium swallow. Esophageal pH monitoring was the standard test, and both the ultrasound and barium swallow were compared to it. Results: The results showed that sonography was 90% sensitive, vs. 50% for barium swallow. Both tests had the same specificity equal to 35%. Conclusion: We concluded that sonography was a better test than barium swallows, for evaluation of suspected patients with GER, and screening of the infants.

  4. Barium sulfate suspension as a negative oral contrast agent for MR imaging

    International Nuclear Information System (INIS)

    Proton spectroscopy with linewidth measurements and MR imaging were performed on various commercially available barium sulfate suspensions as well as inorganic sulfates and barium salts. Approximately 500 mL of 20%, 40%, 60%, and 70% wt/wt single-contrast oral barium sulfate suspensions were administered to four normal volunteers, and MR imaging was performed with both a 1.5-T and a 0.15-T MR imager. As much as 80% of the small bowel and the entire colon were well visualized with the 60% or 70% wt/wt single-contrast barium sulfate suspensions. The authors conclude that barium sulfate suspensions are useful as oral MR contrast agents

  5. Anion and cation diffusion in barium titanate and strontium titanate; Anionen- und Kationendiffusion in Barium- und Strontiumtitanat

    Energy Technology Data Exchange (ETDEWEB)

    Kessel, Markus Franz


    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO{sub 3} single crystals has been studied by means of {sup 18}O{sub 2}/{sup 16}O{sub 2} isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial

  6. 46 CFR 151.50-30 - Compressed gases. (United States)


    ... top of any tank or house located above the weatherdeck. (2) Safety valves on cargo tanks in barges may... shall be adequately trained in the use of the respiratory equipment. (e) Filling densities and container... densities and minimum design pressure of container as indicated in Table 151.50-30(e) shall...

  7. 46 CFR 151.04-5 - Inspection for certification. (United States)


    ... § 151.04-7. (e) If the Officer in Charge, Marine Inspection considers a hydrostatic test necessary to determine the condition of the tanks, the owner shall perform the test at a pressure of 11/2 times the tank... examination and a hydrostatic test of 11/2 times the maximum pressure to which the hose will be subjected...

  8. 19 CFR 151.71 - Laboratory testing for clean yield. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Laboratory testing for clean yield. 151.71 Section... Laboratory testing for clean yield. (a) Test and report by Customs laboratory. The clean yield of all general... clean yield. A report of the percentage clean yield of each general sample as established by the...

  9. 32 CFR 151.4 - Procedures and responsibilities. (United States)


    ... TO MILITARY JUSTICE STATUS OF FORCES POLICIES AND INFORMATION § 151.4 Procedures and responsibilities... procedural criminal law of the foreign country, and shall contain a comparison thereof with the procedural... the procedural safeguards secured by a pertinent status of forces agreement, and (ii) whether...

  10. 46 CFR 151.45-2 - Special operating requirements. (United States)


    ... a tank barge in the tow into the water, as required by 33 CFR 151.15; and (vii) Ensuring that the... sign at or on each tank or by a single sign similar to the following example: Tank No. Cargo IP /xxxx/ IS /xxxx/ 2P /xxxx/ 2S /xxxx/ These signs may be printed, handwritten, permanent or changeable,...

  11. 33 CFR 151.26 - Shipboard oil pollution emergency plans. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Shipboard oil pollution emergency... SECURITY (CONTINUED) POLLUTION VESSELS CARRYING OIL, NOXIOUS LIQUID SUBSTANCES, GARBAGE, MUNICIPAL OR... Protection to the Antarctic Treaty as it Pertains to Pollution from Ships Oil Pollution § 151.26...

  12. 19 CFR 151.12 - Accreditation of commercial laboratories. (United States)


    ... (19 CFR part 151), and to conduct professional services in conformance with approved standards and..., Customs Regulations (19 CFR part 113), and submit it to the Customs port nearest to the applicant's main... the misstatement of a material fact by the laboratory; (B) The laboratory, a principal of...

  13. 27 CFR 17.151 - Use of distilled spirits. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Use of distilled spirits..., DEPARTMENT OF THE TREASURY LIQUORS DRAWBACK ON TAXPAID DISTILLED SPIRITS USED IN MANUFACTURING NONBEVERAGE PRODUCTS Claims for Drawback Spirits Subject to Drawback § 17.151 Use of distilled spirits....

  14. Deexcitation of superdeformed bands in the nucleus Tb-151

    NARCIS (Netherlands)

    Finck, C; Appelbe, D; Beck, FA; Byrski, T; Cullen, D; Curien, D; deFrance, G; Duchene, G; Erturk, S; Haas, B; Khadiri, N; Kharraja, B; Prevost, D; Rigollet, C; Stezowski, O; Twin, P; Vivien, JP; Zuber, K


    The aim of this work is to get more informations about the decay-out of superdeformed bands. One of the best candidates in the mass A similar or equal to 150 region for that kind of research is the nucleus Tb-151. From previous works, it has been established that the first excited band goes lower in

  15. Quadrupole moment of superdeformed bands in Tb-151

    NARCIS (Netherlands)

    Finck, C; Stezowski, O; Beck, FA; Appelbe, DE; Byrski, T; Courtin, S; Cullen, DM; Curien, D; de France, G; Duchene, G; Erturk, S; Gall, BJP; Garg, U; Haas, B; Khadiri, N; Kharraja, B; Kintz, N; Nourreddine, A; Prevost, D; Rigollet, C; Savajols, H; Twin, PJ; Vivien, JP; Zuber, K


    The quadrupole moments of the first two superdeformed (SD) bands in the nucleus Tb-151 have been measured with the Doppler Shift Attenuation Method (DSAM) using the EUROGAM gamma-ray spectrometer, The first excited band (B2) is identical to the yrast SD band of Dy-152 in terms of dynamical moments o

  16. Tungsten and Barium Transport in the Internal Plasma of Hollow Cathodes (United States)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.


    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushedback to the emitter surface by the electric field and drag from the xenon ion flow. Thisbarium ion flux is sufficient to maintain a barium surface coverage at the downstream endgreater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length,so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollowcathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  17. Ruthenium and hafnium abundances in giant and dwarf barium stars

    CERN Document Server

    Allen, D M


    We present abundances for Ru and Hf, compare them to abundances of other heavy elements, and discuss the problems found in determining Ru and Hf abundances with laboratory gf-values in the spectra of barium stars. We determined Ru and Hf abundances in a sample of giant and dwarf barium stars, by the spectral synthesis of two RuI (4080.574A and 4757.856A) and two HfII (4080.437A and 4093.155A) transitions. The stellar spectra were observed with FEROS/ESO, and the stellar atmospheric parameters lie in the range 4300 < Teff/K < 6500, -1.2 < [Fe/H] <= 0 and 1.4 <= log g < 4.6. The HfII 4080A and the RuI 4758A observed transitions result in a unreasonably high solar abundance, given certain known uncertainties, when fitted with laboratory gf-values. For these two transitions we determined empirical gf-values by fitting the observed line profiles of the spectra of the Sun and Arcturus. For the sample stars, this procedure resulted in a good agreement of Ru and Hf abundances given by the two availa...

  18. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.


    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  19. Materials Synthesis Of Barium Hexa ferrite Used Local Natural Resources

    International Nuclear Information System (INIS)

    The magnetic materials of barium hexa ferrites, Ba O.6Fe2O3 successfully synthesized by powder metallurgy method used local natural resources from materials waste of steel fabrication (HSM, CRM), waste of polymer fabrication (LK) as well as iron sands (PBA). These waste as well as iron sands were the main resources of iron oxide, Fe2O3. The barium oxide used in this experiments are from BaCO3 product of Merck, and BaCO4 which is commercially available in the market as barite. Phase identification by x-ray diffraction technique show the synthesized magnetic materials are agreed with the available commercial product, (SUMI). The energy product maximum (BH)max measured by vibrating sample magnetometer (VSM) for the samples used HSM-, CRM- and BaCO3 as basic materials are 1.141 MGOe and 1.136 MGOe while SUMI is 1.142 MGOe. However for the samples made from LK-, PBA- used of BaCO3 or CRM- with barite, the energy product maximum (BH)max are relatively lower than commercial product

  20. Brillouin function characteristics for La-Co substituted barium hexaferrites

    International Nuclear Information System (INIS)

    La-Co substituted barium hexaferrites with the chemical formula of Ba1−xLaxFe12−xCoxO19 (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f1, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ωbf2, ωkf1, ωaf1, ωkf2, and ωbk of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f1, 4f2, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ωbf2 and ωaf1 decrease constantly, while the molecular-field coefficients ωkf1, ωkf2, and ωbk show a slight change

  1. Thermal expansion behaviour of barium and strontium zirconium phosphates

    Indian Academy of Sciences (India)

    P Srikari Tantri; K Geetha; A M Umarji; Sheela K Ramasesha


    Ba1.5–SrZr4P5SiO24 compounds with = 0, 0.25, 0.5, 0.75, 1.0, 1.25 and 1.5, belonging to the low thermal expansion NZP family were synthesized by the solid state reaction method. The XRD pattern could be completely indexed with respect to R$\\bar{3}$ space group indicating the ordering of vacancy at the divalent cation octahedral sites. The microstructure and bulk thermal expansion coefficient from room temperature to 800°C of the sintered samples have been studied. All the samples show very low coefficient of thermal expansion (CTE), with = 0 samples showing negative expansion. A small substitution of strontium in the pure barium compound changes the sign of CTE. Similarly, = 1.5 sample (pure strontium) shows a positive CTE and a small substitution of barium changes its sign. = 1.0 and 1.25 samples have almost constant CTE over the entire temperature range. The low thermal expansion of these samples can be attributed to the ordering of the ions in the crystal structure of these materials.

  2. Microstructure of composite material with powders of barium ferrite

    Directory of Open Access Journals (Sweden)

    R. Nowosielski


    Full Text Available Purpose: The aim of the present work is the microstructure characterization of commercial powder BaFe12O19 (as-prepared and composite material with BaFe12O19 powders and polymer matrix, using XRD (X-Ray Diffraction and SEM (Scanning Electron Microscopy methods.Design/methodology/approach: The morphology of barium ferrite powders and a fracture surface of the examined composite material was realized by using the scanning electron microscope. The methods of X-ray diffraction were used for the qualitative phase analysis. The parameters of diffraction line profiles were determined by PRO-FIT Toraya procedure.Findings: The X-ray diffraction analysis permitted on identification the BaFe12O19 and Fe2O3 phases in an examined material. Basing on Toraya method is determination of: lattice parameters, crystallite size (D and the lattice distortion (. Distribution of powders of barium ferrite in polymer matrix is irregular and powder particles have irregular shapes and dimensions.Research limitations/implications: For future research the X-ray analysis should be performed by the Rietveld method, which allows to characterization the microstructure of tested material and verification of its qualitative phase composition.Originality/value: The applied Toraya method of structure analysis appeared to be very useful in the microstructure analysis.

  3. Redox processes in highly yttrium-doped barium titanate

    International Nuclear Information System (INIS)

    The changes of microstructure occurring during oxidation of the reduced form of yttrium-doped barium titanate (Ba1-xYx?Ti1-x4+Tix3+O3) have been studied. Samples were sintered under reduction conditions at PO2=10-4Pa and oxidized by annealing at high temperatures (1150 and 1350 deg. C) in air. Depending on yttrium concentration, the oxidation of the reduced form of the yttrium-doped BaTiO3 caused precipitation of the phase Ba6Ti17O40 or the phases Ba6Ti17O40 and Y2Ti2O7. The precipitates had well-defined orientational relationships with the perovskite matrix. Oxidation of the reduced form of doped barium titanate results in formation of the phase Ba1-xYx?Ti1-x/44+(VTi-bar )x/4O3 responsible for increase in the resistance of outer grain layers, which lie between grain boundaries and grain

  4. The Kerr nonlinearity of the beta-barium borate crystal

    DEFF Research Database (Denmark)

    Bache, Morten; Guo, Hairun; Zhou, Binbin;


    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond experime......A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond...... experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e. generate a self-defocusing Kerr-like nonlinearity. However, the material Kerr nonlinearity nI 2......, Kerr is self-focusing and competes with the cascading nonlinearity. Therefore, precise knowledge of its strength is crucial. We perform an experiment measuring the main c ü tensor component, and together with literature experimental data [1], we propose a cu value composed of 14 different data points...

  5. Liquid-Phase Processing of Barium Titanate Thin Films (United States)

    Harris, David Thomas

    Processing of thin films introduces strict limits on the thermal budget due to substrate stability and thermal expansion mismatch stresses. Barium titanate serves as a model system for the difficulty in producing high quality thin films because of sensitivity to stress, scale, and crystal quality. Thermal budget restriction leads to reduced crystal quality, density, and grain growth, depressing ferroelectric and nonlinear dielectric properties. Processing of barium titanate is typically performed at temperatures hundreds of degrees above compatibility with metalized substrates. In particular integration with silicon and other low thermal expansion substrates is desirable for reductions in costs and wider availability of technologies. In bulk metal and ceramic systems, sintering behavior has been encouraged by the addition of a liquid forming second phase, improving kinetics and promoting densification and grain growth at lower temperatures. This approach is also widespread in the multilayer ceramic capacitor industry. However only limited exploration of flux processing with refractory thin films has been performed despite offering improved dielectric properties for barium titanate films at lower temperatures. This dissertation explores physical vapor deposition of barium titanate thin films with addition of liquid forming fluxes. Flux systems studied include BaO-B2O3, Bi2O3-BaB2O 4, BaO-V2O5, CuO-BaO-B2O3, and BaO-B2O3 modified by Al, Si, V, and Li. Additions of BaO-B2O3 leads to densification and an increase in average grain size from 50 nm to over 300 nm after annealing at 900 °C. The ability to tune permittivity of the material improved from 20% to 70%. Development of high quality films enables engineering of ferroelectric phase stability using residual thermal expansion mismatch in polycrystalline films. The observed shifts to TC match thermodynamic calculations, expected strain from the thermal expansion coefficients, as well as x-ray diffract measurements

  6. 9 CFR 381.151 - Adulteration of product by polluted water; procedure for handling. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Adulteration of product by polluted water; procedure for handling. 381.151 Section 381.151 Animals and Animal Products FOOD SAFETY AND...; Processing Requirements § 381.151 Adulteration of product by polluted water; procedure for handling. (a)...

  7. 9 CFR 151.10 - Recognition of additional breeds and books of record. (United States)


    ... books of record. 151.10 Section 151.10 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL BREEDS RECOGNITION OF BREEDS AND BOOKS OF RECORD OF PUREBRED ANIMALS Recognition of Breeds and Books of Record § 151.10 Recognition of additional breeds and books...

  8. 10 CFR 1.51 - Description and custody of NRC seal. (United States)


    ... 10 Energy 1 2010-01-01 2010-01-01 false Description and custody of NRC seal. 1.51 Section 1.51 Energy NUCLEAR REGULATORY COMMISSION STATEMENT OF ORGANIZATION AND GENERAL INFORMATION NRC Seal and Flag § 1.51 Description and custody of NRC seal. (a) Pursuant to section 201(a) of the...

  9. 19 CFR 151.47 - Optional entry of net quantity of petroleum or petroleum products. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Optional entry of net quantity of petroleum or petroleum products. 151.47 Section 151.47 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... Petroleum and Petroleum Products § 151.47 Optional entry of net quantity of petroleum or petroleum...

  10. 40 CFR 68.151 - Assertion of claims of confidential business information. (United States)


    ... business information. 68.151 Section 68.151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CHEMICAL ACCIDENT PREVENTION PROVISIONS Risk Management Plan § 68.151 Assertion of claims of confidential business information. (a) Except as provided in paragraph (b) of...

  11. 33 CFR 151.2035 - What are the required ballast water management practices for my vessel? (United States)


    ... water management practices for my vessel? 151.2035 Section 151.2035 Navigation and Navigable Waters... SUBSTANCES, GARBAGE, MUNICIPAL OR COMMERCIAL WASTE, AND BALLAST WATER Ballast Water Management for Control of Nonindigenous Species in Waters of the United States § 151.2035 What are the required ballast water...

  12. 19 CFR 151.91 - Brix values of unconcentrated natural fruit juices. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Brix values of unconcentrated natural fruit juices. 151.91 Section 151.91 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Fruit Juices § 151.91 Brix values of...

  13. 33 CFR 151.79 - Operating requirements: Discharge of sewage within Antarctica. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Operating requirements: Discharge of sewage within Antarctica. 151.79 Section 151.79 Navigation and Navigable Waters COAST GUARD... Pollution and Sewage § 151.79 Operating requirements: Discharge of sewage within Antarctica. (a) A...

  14. 27 CFR 31.151 - General requirements as to distilled spirits. (United States)


    ... distilled spirits. 31.151 Section 31.151 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Dealers' Records and Reports § 31.151 General requirements as to distilled spirits. Except as otherwise... receipt and disposition of distilled spirits in accordance with §§ 31.155 and 31.156. When required...

  15. Tier 2 safety Basis Document for the B151 Complex (B151, B152, and B154)

    Energy Technology Data Exchange (ETDEWEB)

    Cooper, G A


    This Safety Basis Document (SBD) has been prepared for the B151 Complex at Site 200 to meet the current contractual requirements at Lawrence Livermore National Laboratory (LLNL). B151 Complex consists of three separate complex and distinct buildings: B151, B152, and B154, represented within this document as facility segments. Based upon its chemical and radiological inventories, Segment B151 is classified as a Low Hazard facility segment. All other hazards associated with Segment B151 operations have been determined to be LSI. Based upon their inventories, Segment B152 and Segment B154 are each classified as LSI facility segments. However, for operational flexibility involving radiological materials, CMS chooses to classify each of these as Low Hazard facility segments. Changes in operations, maximum inventories, materials, or release potential that could result in larger consequences, or that could negatively impact the safety of the facility, will necessitate a re-evaluation of these facility classifications. This SBD is governed by the LLNL Non-Nuclear Work Smart Standards (WSSs) requirements including the ES&H Manual, Document 3.1, Non-Nuclear Safety Basis Program [LLNL, 2004a] and the DOE Explosives Safety Manual (ESM) [LLNL, 2004b]. This SBD demonstrates that the three segments of B151 Complex can be operated as Low Hazard facility segments without undue risks to co-located workers, the public, or the environment. This SBD: (1) Provides a systematic identification of the safety and health hazards associated with operations in the B151 Complex, (2) Compares facility inventories of explosives, biological materials, chemicals, radioisotopes with LLNL threshold values for each facility hazard classification criteria, (3) Examines standard and non-standard industrial hazards, (4) Examines the hazards of greatest significance, (5) Qualitatively discusses the programs that evaluate and control these hazards to ensure the protection of co-located workers, the public

  16. Preparation and properties of yttria doped tetragonal zirconia polycrystal/Sr-doped barium hexaferrite ceramic composites

    International Nuclear Information System (INIS)

    Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m1/2. - Abstract: The effects of substitution of Ba2+ by Sr2+ on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba1−xSrxFe12O19, x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m1/2 for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase

  17. Bio-based barium alginate film: Preparation, flame retardancy and thermal degradation behavior. (United States)

    Liu, Yun; Zhang, Chuan-Jie; Zhao, Jin-Chao; Guo, Yi; Zhu, Ping; Wang, De-Yi


    A bio-based barium alginate film was prepared via a facile ionic exchange and casting approach. Its flammability, thermal degradation and pyrolysis behaviors, thermal degradation mechanism were studied systemically by limiting oxygen index (LOI), vertical burning (UL-94), microscale combustion calorimetry (MCC), thermogravimetric analysis (TGA) coupled with Fourier transform infrared analysis (FTIR) and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS). It showed that barium alginate film had much higher LOI value (52.0%) than that of sodium alginate film (24.5%). Moreover, barium alginate film passed the UL-94 V-0 rating, while the sodium alginate film showed no classification. Importantly, peak of heat release rate (PHRR) of barium alginate film in MCC test was much lower than that of sodium alginate film, suggested that introduction of barium ion into alginate film significantly decreased release of combustible gases. TG-FTIR and Py-GC-MS results indicated that barium alginate produced much less flammable products than that of sodium alginate in whole thermal degradation procedure. Finally, a possible degradation mechanism of barium alginate had been proposed. PMID:26794953

  18. Barium titanate core – gold shell nanoparticles for hyperthermia treatments

    Directory of Open Access Journals (Sweden)

    FarrokhTakin E


    Full Text Available Elmira FarrokhTakin,1,2 Gianni Ciofani,1 Gian Luigi Puleo,1 Giuseppe de Vito,3,4 Carlo Filippeschi,1 Barbara Mazzolai,1 Vincenzo Piazza,3 Virgilio Mattoli1 1Center for Micro-BioRobotics @SSSA, Fondazione Istituto Italiano di Tecnologia, Pontedera, Pisa, Italy; 2The Biorobotics Institute, Scuola Superiore Sant'Anna, Pontedera, Pisa, Italy; 3Center for Nanotechnology Innovation @NEST, Fondazione Istituto Italiano di Tecnologia, Pisa, Italy; 4NEST, Scuola Normale Superiore, Pisa, Italy Abstract: The development of new tools and devices to aid in treating cancer is a hot topic in biomedical research. The practice of using heat (hyperthermia to treat cancerous lesions has a long history dating back to ancient Greece. With deeper knowledge of the factors that cause cancer and the transmissive window of cells and tissues in the near-infrared region of the electromagnetic spectrum, hyperthermia applications have been able to incorporate the use of lasers. Photothermal therapy has been introduced as a selective and noninvasive treatment for cancer, in which exogenous photothermal agents are exploited to achieve the selective destruction of cancer cells. In this manuscript, we propose applications of barium titanate core–gold shell nanoparticles for hyperthermia treatment against cancer cells. We explored the effect of increasing concentrations of these nanoshells (0–100 µg/mL on human neuroblastoma SH-SY5Y cells, testing the internalization and intrinsic toxicity and validating the hyperthermic functionality of the particles through near infrared (NIR laser-induced thermoablation experiments. No significant changes were observed in cell viability up to nanoparticle concentrations of 50 µg/mL. Experiments upon stimulation with an NIR laser revealed the ability of the nanoshells to destroy human neuroblastoma cells. On the basis of these findings, barium titanate core–gold shell nanoparticles resulted in being suitable for hyperthermia treatment

  19. Wideband and enhanced microwave absorption performance of doped barium ferrite

    International Nuclear Information System (INIS)

    To achieve stronger microwave attenuation and larger bandwidth in electromagnetic absorber, the nickel ions (Ni2+) and manganese ions (Mn2+) were employed to partially replace the cobalt ions (Co2+) in BaCoTiFe10O19, and the doped barium hexaferrite (Ba(MnNi)0.2Co0.6TiFe10O19 and Ba(MnNi)0.25Co0.5TiFe10O19) powders were synthesized via the sol–gel combustion method. Subsequently, the microwave absorbing composites were prepared by mixing the ferrite powders with the paraffin. The X-ray diffraction (XRD) patterns of the doped ferrites confirmed the formation of the M-type barium ferrite, and no other types of barium ferrite could be found. Based on the electromagnetic parameters measured by the vector net-analyzer, it was found that the composite (Ba(MnNi)0.2Co0.6TiFe10O19) possessed a minimum reflection loss of −52.8 dB at 13.4 GHz with a matching thickness of 1.8 mm and the bandwidth below −15 dB was 5.8 GHz. Moreover, the maximum attenuation of Ba(MnNi)0.25Co0.5TiFe10O19 could reach −69 dB when its thickness was 1.8 mm, and also the bandwidth less than −20 dB was ranging from 13.2 GHz to 18 GHz. Thus, Ba(MnNi)0.2Co0.6TiFe10O19 and Ba(MnNi)0.25Co0.5TiFe10O19 could be the good microwave absorbers, which have great potentials to be applied in the high frequency fields of the microwave absorbing materials. - Highlights: • The Co was first time substituted by Mn–Ni in ferrites. • The substituted ferrites had good microwave absorption. • The doped ferrites had broad bandwidth and low reflection loss

  20. Wideband and enhanced microwave absorption performance of doped barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Pingyuan; Xiong, Kun [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Ju, Kui [Guizhou Institute of Metallurgy and Chemical Engineering, Guiyang 550002 (China); Li, Shengnan [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Xu, Guangliang, E-mail: [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China)


    To achieve stronger microwave attenuation and larger bandwidth in electromagnetic absorber, the nickel ions (Ni{sup 2+}) and manganese ions (Mn{sup 2+}) were employed to partially replace the cobalt ions (Co{sup 2+}) in BaCoTiFe{sub 10}O{sub 19}, and the doped barium hexaferrite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19}) powders were synthesized via the sol–gel combustion method. Subsequently, the microwave absorbing composites were prepared by mixing the ferrite powders with the paraffin. The X-ray diffraction (XRD) patterns of the doped ferrites confirmed the formation of the M-type barium ferrite, and no other types of barium ferrite could be found. Based on the electromagnetic parameters measured by the vector net-analyzer, it was found that the composite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19}) possessed a minimum reflection loss of −52.8 dB at 13.4 GHz with a matching thickness of 1.8 mm and the bandwidth below −15 dB was 5.8 GHz. Moreover, the maximum attenuation of Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could reach −69 dB when its thickness was 1.8 mm, and also the bandwidth less than −20 dB was ranging from 13.2 GHz to 18 GHz. Thus, Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could be the good microwave absorbers, which have great potentials to be applied in the high frequency fields of the microwave absorbing materials. - Highlights: • The Co was first time substituted by Mn–Ni in ferrites. • The substituted ferrites had good microwave absorption. • The doped ferrites had broad bandwidth and low reflection loss.

  1. Overexpression of CD151 Predicts Prognosis in Patients with Resected Gastric Cancer


    Yang, Yue-Ming; Zhang, Zhong-wei; Liu, Qing-Meng; Sun, Yi-Feng; Yu, Ji-Ren; Xu, Wei-Xing


    Purpose The tetraspanin CD151 acts as a promoter of metastasis and invasion in several tumors. However, the role of CD151 in human gastric cancer (HGC) remains unclear. Methods Twenty HGC specimens and matched nontumor samples, human gastric epithelial cells (HGEC), and four gastric cancer cell lines were used to analyze CD151 expression. Short hairpin RNA-mediated downregulation of CD151 expression in HGC cells was performed to examine the role of CD151 in the proliferation and metastasis/in...

  2. Synthesis and Characterization of Barium-Vanadium Oxide Nanocomposite Using a Facile thermolysis Approach


    Niloufar Akbarzadeh-T; Leila Amiri-O


    In this investigation, we report synthesis of new cationic-anionic Barium-Vanadium complex with 2, 6- pyridinedicarboxylic acid ligand. This compound [Ba(H2O)8][VO2(dipic)]2(1) has been characterized using elemental analyses, FT-IR, UV–Vis and Cyclic voltammetry (CV) techniques. Also in this study we report facile synthesis of Barium-Vanadium Oxide nanoparticle under thermal decomposition, using precursor complex (1). Characterization of Barium-Vanadium Oxide nanocomposites was carried out by...

  3. Barium ferrite nanoparticles prepared by self-propagating low-temperature combustion method and its characterization

    Indian Academy of Sciences (India)

    P M Prithviraj Swamy; S Basavaraja; Vijayanand Havanoor; N V Srinivas Rao; R Nijagunappa; A Venkataraman


    The barium ferrite particles were prepared using a self-propagating low-temperature combustion method using polyethylene glycol (PEG) as a fuel. The process was investigated with simultaneous thermogravimetric-differential thermal analysis (TG–DTA). The crystalline structure, morphology and the magnetic properties of the barium ferrite particles were studied by means of X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM) and SQUID susceptometer. The results show that the ignition temperature of PEG is lower compared with other combustion methods and gives nanocrystalline barium ferrite.

  4. A Comparative Study on Magnetostructural Properties of Barium Hexaferrite Powders Prepared by Polyethylene Glycol

    Directory of Open Access Journals (Sweden)

    Zehra Durmus


    Full Text Available Nanocrystalline particles of barium hexaferrite were synthesized by a sol-gel combustion route using nitrate-citrate gels prepared from metal nitrates and citric acid solutions with Fe/Ba molar ratio 12. The present paper aims to study the effect of addition of polyethylene glycol (PEG solutions with different molecular weights (MW: 400, 2000, and 10.000 g/mol on magnetostructural properties of barium hexaferrite. The formation of the barium hexaferrite was inspected using X-ray diffraction (XRD analysis, Fourier transform infrared (FT-IR analysis, thermogravimetric (TGA analysis, scanning electron microscopy (SEM analysis and vibrating sample magnetometer (VSM analysis for magnetic measurements.

  5. Microscopic insight into nuclear structure properties of proton-rich barium isotopes

    International Nuclear Information System (INIS)

    Variation after projection (VAP) calculations with Hartree-Bogoliubov (HB) Ansatz have been carried out for A=120-136 barium isotopes. In this framework, the yrast spectra with Jmaxπ=10+, B(E2) transition probabilities, quadrupole (β2) and hexadecapole (β4) deformation parameters for even-even barium isotopes have been obtained. The results of the calculation give an indication that it is important to include the hexadecapole-hexadecapole component of the two-body interaction for obtaining various nuclear structure quantities in these barium isotopes. (author)

  6. Orbital elements of barium stars formed through a wind accretion scenario

    CERN Document Server

    Liu, J H; Liang, Y C; Peng, Q H


    Taking the total angular momentum conservation in place of the tangential momentum conservation, and considering the square and higher power terms of orbital eccentricity e, the changes of orbital elements of binaries are calculated for wind accretion scenario. These new equations are used to quantitatively explain the observed (e,logP) properties of normal G, K giants and barium stars. Our results reflect the evolution from G, K giant binaries to barium binaries, moreover, the barium stars with longer orbital periods P>1600 days may be formed by accreting part of the ejecta from the intrinsic AGB stars through wind accretion scenario.

  7. The high-temperature sulphation behavior of barium-based sorbents during coal combustion

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, J.; Li, N.; Zhou, J.; Cao, X.; Liu, J.; Zhao, X.; Cen, K.


    In order to promote the sulfur removal efficiency during coal combustion, the high-temperature sulfation behavior of barium-based sorbents was studied. The sulfation product BaSO{sub 4} which did not decompose until 1,580 C had much better thermal stability than CaSO{sub 4} which rapidly decomposed at about 1,300 C. The desulfurization effect of barium salt Ba{sup 2+} was much better than calcium salt Ca{sup 2+} during coal combustion at about 1,200{approximately}1,300 C. The sulfur removal efficiency of barium-based sorbents could achieve 35.5% in industrial grate furnace.

  8. Application of barium fluoride for sulfur selective extraction at X-ray spectroscopic analysis of steel

    International Nuclear Information System (INIS)

    In order to increase the sensitivity of X-ray spectroscopic identification of sulphur in steels the application of barium fluoride for selective extraction of sulphate ions was proposed by authors of present work. The influence of concentration of sulphate ions, iron, nickel, chromium and titanium cations as well as acidity of solutions on the coefficient of distribution of sulphate ions in the system barium fluoride-water was studied. The distribution coefficients were calculated, the completeness of extraction was calculated as well. It is defined that sulphate ions from solutions containing cations of heavy metals and other anions can be extracted by means of barium fluoride.

  9. Dicty_cDB: SSH151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH151 (Link to dictyBase) - - - Contig-U01152-1 SSH151P (Link to Original ... complete sequence. 1166 0.0 2 CD062033 |CD062033.1 MA1 -0023U-M005-G04-U.B MA1 -0023 Schistosoma mansoni cD ... NA clone MA1 -0023U-M005-G04.B, mRNA sequence. 50 5e-14 4 BU8019 ... NA, mRNA sequence. 52 2e-13 3 CD062134 |CD062134.1 MA1 -0024G-M011-B06-U.B MA1 -0024 Schistosoma mansoni cD ... NA clone MA1 -0024G-M011-B06.B, mRNA sequence. 44 3e-12 4 BU7223 ...

  10. Search for excited superdeformed bands in {sup 151}Dy

    Energy Technology Data Exchange (ETDEWEB)

    Nisius, D.; Janssens, R.V.F.; Crowell, B. [and others


    Following the first report of superdeformed (SD) bands with identical transition energies in the pairs ({sup 151}Tb*,{sup 152}Dy), ({sup 150}Gd*, {sup 151}Tb) and ({sup 153}Dy*, {sup 152}Dy) (where * denotes an excited SD band), it was proposed by Nazarewicz et al. that the observations could be understood in a strong-coupling approach if pseudo SU(3) symmetry were invoked. In this model there are three limiting values of the decoupling parameter; i.e. a = 0, {plus_minus}1. In the first two cases mentioned above the pairs of bands have nearly identical transition energies and are interpreted as proton excitations involving the [200]1/2 pseudospin orbital coupled to the {sup 152}Dy core, for which the value of the decoupling parameter is calculated to be a =+1.

  11. Solvothermal synthesis and Curie temperature of monodispersed barium titanate nanoparticles

    International Nuclear Information System (INIS)

    Barium titanate (BaTiO3) nanoparticles with various particle sizes were prepared by a solvothermal method. X-ray powder diffraction (XRPD) patterns show that the as-prepared powders are of pure perovskite BaTiO3. Scanning electron microscopy (SEM) reveals that all the particles of BaTiO3 with different sizes are dispersed homogenously and have uniform size. The room temperature and in situ high temperature XRD analyses indicate that both the proportion of the tetragonal phase and the Curie temperature of BaTiO3 increase with increasing particles size. The effects of the reaction parameters, such as the concentration of reactants, the polarity of solvent, the reaction temperature and the amount of surfactant, on the size, morphology and uniformity of BaTiO3 nanoparticles are studied in detail.

  12. Infrared Spectroscopic Characterization of Calcium and Barium Hydrazone Complexes

    Directory of Open Access Journals (Sweden)

    *A. Adeniyi


    Full Text Available Hydrazones have attracted considerable interest on account of their biological activities. Introduction of calcium and barium metal ions into m- and p-nitrobenzoic hydrazones is expected to modify these biological properties for enhanced activity and versatility. The ligands were synthesized from the parent acids. The complexes have been characterized using C, H and N microanalyses and IR spectrometry. The IR spectral data of the ligands and complexes revealed bonding via the C=O and C=N groups. The suggested metal to ligand stoichiometries are: [M (m-NBHx]Cl2.yH2O, x, y = 1 and 4 for M = Ca; x, y = 2 and 3 for M = Ba respectively. [M(p-NBHx]Cl2.yH2O, x, y = 1 and 12 for M = Ca; x, y = 1 and 3 for M = Ba respectively. The structural deductions are tentative pending future X-ray structural studies.

  13. Preparation and Characterization of Nano-particle Substituted Barium Hexaferrite

    CERN Document Server

    Atassi, Yomen; Tally, Mohammad


    High density magnetic recording requires high coercivity magnetic media and small particle size. Barium hexaferrite has been considered as a leading candidate material because of its chemical stability, fairly large crystal anisotropy and suitable magnetic characteristics. In this work, we present the preparation of the hexagonal ferrite BaFe12O19 and one of its derivative; the Zn-Sn substituted hexaferrite by the chemical co-precipitation method. The main advantage of this method on the conventional glass-ceramic one, resides in providing a small enough particle size for magnetic recording. We demonstrate using the X-ray diffraction patterns that the particle size decreases when substituting the hexaferrite by the Zn-Sn combination. This may improve the magnetic properties of the hexaferrite as a medium for HD magnetic recording

  14. Synthesis and optical study of barium magnesium aluminate blue phosphors

    International Nuclear Information System (INIS)

    Europium doped barium magnesium aluminate (BaMgAl10O17:Eu2+) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl10O17(JCPDS 26-0163) along with an additional phase BaAl2O4(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f6 5d → 4f7 transition of Eu2+ which lies in the blue region of the visible spectrum

  15. Conoscopic study of strontium-barium niobate single crystals

    International Nuclear Information System (INIS)

    Optically transparent single crystals of strontium-barium niobate, SrxBa1-xNb2O6, of different compositions (x = 0.26...0.7) were examined with the aid of conoscopic light interference figures. A regular change of the isochrome concentric ring number and diameters consistent with the temperature variation of the value of birefringence is demonstrated by direct observations of polar cuts of optically uniaxial samples. Anomalous violations of the conventional (uniaxial) interference patterns occur occasionaly in some samples being indicative of the existence of biaxial trait in their behaviour even though no voltage is applied. These features may depend on annealing treatments at elevated temperatures. The results of the study show that conoscopic images may serve as a sensitive indicator of the structural state of SBN crystals related to the effects of stress–induced change of optical anisotropy and temperature dependent birefringence parameters

  16. Pulsating aurora induced by upper atmospheric barium releases (United States)

    Deehr, C.; Romick, G.


    The paper reports the apparent generation of pulsating aurora by explosive releases of barium vapor near 250 km altitude. This effect occurred only when the explosions were in the path of precipitating electrons associated with the visible aurora. Each explosive charge was a standard 1.5 kg thermite mixture of Ba and CuO with an excess of Ba metal which was vaporized and dispersed by the thermite explosion. Traces of Sr, Na, and Li were added to some of the charges, and monitoring was achieved by ground-based spectrophotometric observations. On March 28, 1976, an increase in emission at 5577 A and at 4278 A was observed in association with the first two bursts, these emissions pulsating with roughly a 10 sec period for approximately 60 to 100 sec after the burst.

  17. Behaviour of barium and strontium oxides in liquid nitrogen tetroxide

    International Nuclear Information System (INIS)

    Chemical transformations of barium and strontium oxides (MeO, MeO2) in liquid nitrogen tetroxide are considered in the temperature range of 290-493 K. The data on IR and Raman spectra of the reaction products in the region of 2500-600 cm-1 are presented. No formation of nitrosonium complexes of the type NO[Me(NOsub(3))sub(n)]sub(m) and adducts of the type Me(NO3)2xmN2O4 is detected. It has been established that MeO2 possess a higher reactivity in liquid nitrogen tetroxide than MeO. Using the methods of vibrational spectroscopy the bands, characteristic of MeO2 are signled out in MeO samples being in contact with nitrogen tetroxide

  18. Stark effect in Rydberg states of helium and barium

    International Nuclear Information System (INIS)

    This thesis, which deals with the effect of an electric field up to moderate field strengths on atoms with two valence electrons outside closed shells, in casu helium and barium, contains chapter in which the linear Stark effect in the 1 snp 1,3p Rydberg states of helium (n around 40) has been studied in a CW laser-atomic beam experiment. The evolution of the angular momentum manifolds into the n-mixing regime was followed and avoided level crossings were observed. Stark manifolds were also calculated by diagonalization of the complete energy matrix in the presence of an electric field. It turned out to be necessary to include up to five n-values in the calculations already at moderate values of the field to reproduce the data within the experimental accuracy (a few MHz), especially in the regime of the avoided crossings. (author). 147 refs.; 30 figs.; 8 tabs

  19. Small polarons and point defects in barium cerate (United States)

    Swift, Michael; Janotti, Anderson; Van de Walle, Chris G.


    Barium cerate (BaCeO3) is a well-known ionic conductor of both hydrogen and oxygen. In applications, it is frequently doped (for instance with Y) to increase stability and promote diffusion. However, the effects of doping and native defects are not fully understood. Computational studies have been stymied by the nature of the conduction band, which is made up of cerium 4 f states. These states present a challenge to ab initio techniques based on density functional theory within the standard approximations for exchange and correlation. Using a hybrid functional, we investigate the effects of hydrogen impurities and native defects on the electrical and optical properties of BaCeO3. We discuss the tendency of excess electrons or holes to localize in the form of small polarons. We also explore the interactions of polarons with hydrogen impurities and oxygen vacancies, and their impact on luminescence properties.

  20. Nonlinear optical properties of calcium barium niobate epitaxial thin films. (United States)

    Bancelin, Stéphane; Vigne, Sébastien; Hossain, Nadir; Chaker, Mohammed; Légaré, François


    We investigate the potential of epitaxial calcium barium niobate (CBN) thin film grown by pulsed laser deposition for optical frequency conversion. Using second harmonic generation (SHG), we analyze the polarization response of the generated signal to determine the ratios d15 / d32 and d33 / d32 of the three independent components of the second-order nonlinear susceptibility tensor in CBN thin film. In addition, a detailed comparison to the signal intensity obtained in a y-cut quartz allows us to measure the absolute value of these components in CBN thin film: d15 = 5 ± 2 pm / V, d32 = 3.1 ± 0.6 pm / V and d33 = 9 ± 2 pm / V. PMID:27464195

  1. Barium titanate nanocomposite capacitor FY09 year end report.

    Energy Technology Data Exchange (ETDEWEB)

    Stevens, Tyler E.; DiAntonio, Christopher Brian; Yang, Pin; Chavez, Tom P.; Winter, Michael R.; Monson, Todd C.; Roesler, Alexander William; Fellows, Benjamin D.


    This late start RTBF project started the development of barium titanate (BTO)/glass nanocomposite capacitors for future and emerging energy storage applications. The long term goal of this work is to decrease the size, weight, and cost of ceramic capacitors while increasing their reliability. Ceramic-based nanocomposites have the potential to yield materials with enhanced permittivity, breakdown strength (BDS), and reduced strain, which can increase the energy density of capacitors and increase their shot life. Composites of BTO in glass will limit grain growth during device fabrication (preserving nanoparticle grain size and enhanced properties), resulting in devices with improved density, permittivity, BDS, and shot life. BTO will eliminate the issues associated with Pb toxicity and volatility as well as the variation in energy storage vs. temperature of PZT based devices. During the last six months of FY09 this work focused on developing syntheses for BTO nanoparticles and firing profiles for sintering BTO/glass composite capacitors.

  2. Ultrasonic de-agglomeration of barium titanate powder. (United States)

    Marković, S; Mitrić, M; Starcević, G; Uskoković, D


    BaTiO3 (BT) powder, with average particle size of 1.4 microm, was synthesized by solid-state reaction. A high-intensity ultrasound irradiation (ultrasonication) was used to de-agglomerate micro-sized powder to nano-sized one. The crystal structure, crystallite size, morphology, particle size, particle size distribution, and specific surface area of the BT powder de-agglomerated for different ultrasonication times (0, 10, 60, and 180 min) were determined. It was found that the particles size of the BT powder was influenced by ultrasonic treatment, while its tetragonal structure was maintained. Therefore, ultrasonic irradiation can be proposed as an environmental-friendly, economical, and effective tool for the de-agglomeration of barium titanate powders. PMID:17845864

  3. Synthesis and optical study of barium magnesium aluminate blue phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Jeet, Suninder, E-mail:; Pandey, O. P., E-mail: [School of Physics and Materials Science, Thapar University, Patiala (147003), Punjab (India); Sharma, Manoj, E-mail: [Department of Nanotechnology, Sri Guru Granth Sahib World University, Fatehgarh Sahib(146406), Punjab (India)


    Europium doped barium magnesium aluminate (BaMgAl{sub 10}O{sub 17}:Eu{sup 2+}) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl{sub 10}O{sub 17}(JCPDS 26-0163) along with an additional phase BaAl{sub 2}O{sub 4}(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f{sup 6} 5d → 4f{sup 7} transition of Eu{sup 2+} which lies in the blue region of the visible spectrum.

  4. Bronchography in dogs. Comparative study with two barium sulphate solutions

    International Nuclear Information System (INIS)

    Two solutions of barium sulphate, 60 and 30% w/v, were compared with the ''overflow'' Bronchographic method. Two groups of eight healthy adult does of both sexes, weighing 7 to 18 kg were used for the study. The dogs were anaesthetised with thiopentone sodium 2% (20 mg/kg iv). After intubation, each dog received contrast medium by a catheter connected to a syringe, in a 9 mi dose. Two series of two x-rays plates were taken in left lateral recumbent, 3 and 6 min after administering the contrast medium and in ventrodorsal projection, 30 sec. later. The x-ray plates obtained were analysed and compared intra and inter group considering the advance speed of the contrast medium, the radiographic density and outlines. Adverse reactions were controlled

  5. Barium depletion study on impregnated cathodes and lifetime prediction (United States)

    Roquais, J. M.; Poret, F.; le Doze, R.; Ricaud, J. L.; Monterrin, A.; Steinbrunn, A.


    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK).

  6. Barium depletion study on impregnated cathodes and lifetime prediction

    International Nuclear Information System (INIS)

    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK)

  7. Structural and functional characterization of barium zirconium titanate / epoxy composites

    Directory of Open Access Journals (Sweden)

    Filiberto González Garcia


    Full Text Available The dielectric behavior of composite materials (barium zirconium titanate / epoxy system was analyzed as a function of ceramic concentration. Structure and morphologic behavior of the composites was investigated by X-ray Diffraction (XRD, Fourier transformed infrared spectroscopy (FT-IR, Raman spectroscopy, field emission scanning electron microscopy (FE-SEM and transmission electron microscopy (TEM analyses. Composites were prepared by mixing the components and pouring them into suitable moulds. It was demonstrated that the amount of inorganic phase affects the morphology of the presented composites. XRD revealed the presence of a single phase while Raman scattering confirmed structural transitions as a function of ceramic concentration. Changes in the ceramic concentration affected Raman modes and the distribution of particles along into in epoxy matrix. Dielectric permittivity and dielectric losses were influenced by filler concentration.

  8. Gamma radiation induced darkening in barium gallo-germanate glass. (United States)

    Chen, Xiaodong; Heng, Xiaobo; Tang, Guowu; Zhu, Tingting; Sun, Min; Shan, Xiujie; Wen, Xin; Guo, Jingyuan; Qian, Qi; Yang, Zhongmin


    Barium gallo-germanate (BGG) glass is an important glass matrix material used for mid-infrared transmission and mid-infrared fiber laser. In this study, we investigated the γ-ray irradiation induced darkening effect of BGG glass. Optical transmittance spectra, electron paramagnetic resonance (EPR) and thermoluminescence (TL) spectra were employed to investigate the γ-ray irradiation induced defects. Two kinds of Ge-related defects in the irradiated BGG glass, named Ge-related non-bridging oxygen hole center (Ge-NBOHC) and Ge-related electron centers (GEC), were verified. In addition, the absorption bands of the two defects have been separated and the peak absorptivity of Ge-NBOHC and GEC defects is at 375 nm and 315 nm, respectively. PMID:27137531

  9. Effect of Nb on barium titanate prepared from citrate solutions

    Directory of Open Access Journals (Sweden)

    Stojanović Biljana D.


    Full Text Available The influence of the addition of dopants on the microstructure development and electrical properties of BaTiO3 doped with 0.2, 0.4, 0.6, 0.8 mol% of Nb and 0.01 mol% of Mn based compounds was studied. Doped barium titanate was prepared using the polymeric precursor method from citrate solutions. The powders calcined at 700°C for 4 hours were analysed by infrared (IR spectroscopy to verify the presence of carbonates, and by X-ray diffraction (XRD for phase formation. The phase composition, microstructure and dielectric properties show a strong dependence on the amount of added niobium.

  10. Ionoluminescence of trivalent rare-earth-doped strontium barium niobate

    Energy Technology Data Exchange (ETDEWEB)

    Calvo del Castillo, H. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain); Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Ruvalcaba, J.L. [Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Bettinelli, M.; Speghini, A. [Dipartimento Scientifico e Tecnologico, Universita di Verona and INSTM, UdR Verona, Ca Vignal, Strada Le Grazie 15, I-37134 Verona (Italy); Barboza Flores, M. [Centro de Investigacion en Fisica, Universidad de Sonora, Hermosillo, Sonora (Mexico); Calderon, T. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain)], E-mail:; Jaque, D.; Garcia Sole, J. [Departamento de Fisica de Materiales, Universidad Autonoma de Madrid, 28049 Cantoblanco, Madrid (Spain)


    Ionoluminescence spectra for different rare-earth ion (Pr{sup 3+} and Eu{sup 3+})-activated Sr{sub x}Ba{sub 1-x}Nb{sub 2}O{sub 6} strontium barium niobate crystals (x=0.33 and 0.60) have been induced with a 3 MeV proton beam for a variety of beam current intensities (45, 40 and 20 nA). The proton-beam induced luminescent spectra have shown features associated with the presence of the rare-earth ion and some spectral features mostly related to the host crystal, which appear only for high beam current intensities. We have compared the ionoluminescence results to those obtained under UV light excitation (photoluminescence technique) where a direct excitation of the band gap would occur.

  11. Microwave absorption properties of barium titanate/epoxide resin composites

    International Nuclear Information System (INIS)

    Nano-barium titanate (BT) was prepared by a sol-gel method. The prepared powders were characterized by x-ray powder diffraction and transmission electron microscopy. The complex relative dielectric permittivity (ε = ε' - jε-prime) and magnetic permeability (μ = μ' - jμ-prime) of the BT powders were measured in the frequency range 8 ∼ 18 GHz. The BT/epoxide resin (EP) composite with different volume contents was investigated. The effects of thickness on the BT/EP composite were studied. It was found that an optimum thickness and contents of the absorber can yield the maximum reflection loss which could be obtained over a broad frequency region in the X and Ku bands. Our results indicate that BT could be a promising microwave absorption material

  12. Study on a flexoelectric microphone using barium strontium titanate (United States)

    Kwon, S. R.; Huang, W. B.; Zhang, S. J.; Yuan, F. G.; Jiang, X. N.


    In this study, a flexoelectric microphone was, for the first time, designed and fabricated in a bridge structure using barium strontium titanate (Ba0.65Sr0.35TiO3) ceramic and tested afterwards. The prototyped flexoelectric microphone consists of a 1.5 mm  ×  768 μm  ×  50 μm BST bridge structure and a silicon substrate with a cavity. The sensitivity and resonance frequency were designed to be 0.92 pC/Pa and 98.67 kHz, respectively. The signal to noise ratio was measured to be 74 dB. The results demonstrate that the flexoelectric microphone possesses high sensitivity and a wide working frequency range simultaneously, suggesting that flexoelectricity could be an excellent alternative sensing mechanism for microphone applications.

  13. Enthalpy of formation of (In, Gd)-doped barium cerate

    International Nuclear Information System (INIS)

    Highlights: • BaCe0.7Gd0.2In0.1O2.85 was prepared by solid-state reaction. • The standard formation enthalpy was determined. • The stabilization energy (ΔstH°) was calculated. • ΔstH° of BaCe0.7Gd0.2In0.1O2.85 is higher than BaCe0.7Nd0.2In0.1O2.85 and BaCeO3. - Abstract: Solution enthalpies of barium cerate doped by gadolinium and indium and a mixture of BaCl2 + 0.7CeCl3 + 2GdCl3 + 0.1InCl3 have been measured in 1 mol dm−3 HCl with 0.1 mol dm−3 KI. For the first time the standard molar formation enthalpy of BaCe0.7Gd0.2In0.1O2.85 has been determined by solution calorimetry as follows: ΔfH° (298.15 K) = −1615.84 ± 9.01 kJ mol−1. The stabilization energy for above-mentioned compound has been calculated as well. It has been shown that barium cerate doped gadolinium and indium has higher stabilization energy than BaCe0.7Nd0.2In0.1O2.85 and BaCeO3. The reaction enthalpy with CO2 interaction has been calculated for BaCe0.7Gd0.2In0.1O2.85

  14. Brillouin function characteristics for La-Co substituted barium hexaferrites

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Chuanjian, E-mail:, E-mail:; Yu, Zhong; Sun, Ke, E-mail:, E-mail:; Guo, Rongdi; Jiang, Xiaona; Lan, Zhongwen [State Key Laboratory of Electronic Thin Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Yang, Yan [Department of Communication and Engineering, Chengdu Technological University, Chengdu 611730 (China)


    La-Co substituted barium hexaferrites with the chemical formula of Ba{sub 1−x}La{sub x}Fe{sub 12−x}Co{sub x}O{sub 19} (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f{sub 1}, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ω{sub bf2}, ω{sub kf1}, ω{sub af1}, ω{sub kf2}, and ω{sub bk} of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f{sub 1}, 4f{sub 2}, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ω{sub bf2} and ω{sub af1} decrease constantly, while the molecular-field coefficients ω{sub kf1}, ω{sub kf2}, and ω{sub bk} show a slight change.

  15. Neutron capture cross sections of 151,153Eu

    International Nuclear Information System (INIS)

    The neutron capture cross section of 151,153Eu nuclei was measured using the Detector for Advanced Neutron Capture Experiments (DANCE) at the Los Alamos Neutron Science Center (LANSCE). Neutrons were produced at the Lujan Neutron Scattering Center and their energies were determined by the time-of-flight technique. The relative yield versus neutron incident energy from 0.1 eV to 2.0 keV for both 151Eu(n,) and 153Eu(n,) reactions was derived from events gated on the total energy and multiplicity measured by the DANCE array. The absolute cross section was determined by scaling the relative yield to the measured cross sections of well-known resonances. The shape of the yield curve agrees well with previous measurements in the resonance region for both 151Eu and 153Eu capture cross sections. New data are reported for neutron incident energies between 100 eV and 2.0 keV. The trend of data in the 0.3 keV to 2.0 keV region of neutron incident energy is consistent with the ENDF/BVI and the measurements of Macklin and Young. Crucial skills, acquired from these measurements in the early implementation of DANCE, are important to plan future experiments, which will yield results up to a few hundred keV neutron incident energy

  16. Sensitivity of single contrast barium enema with regard to colorectal disease as diagnosed by colonoscopy

    International Nuclear Information System (INIS)

    The results of single contrast barium enema were retrospectively correlated with colonoscopically diagnosed colorectal disease in 54 patients (75 lesions). Altogether 66 lesions (88%) were correctly diagnosed. The sensitivity of barium enema for polyps was 81% (26/32). There were three perceptive errors and three polyps 5 mm or less in size were not demonstrated by barium enema. Twenty-nine cases of inflammatory disorders were all correctly diagnosed. One of 12 malignancies was missed by perceptive error. In two cases with vascular malformations the barium enema was normal. 4/9 (44%) of missed lesions were perceptive errors and could have been probably avoided by a second independent reading of films. (orig.)

  17. How changes in a radiologist's technique can reduce patient dose in barium enema studies

    International Nuclear Information System (INIS)

    Changes in a radiologist's technique, especially utilising digital technology, can lead to substantial dose savings in barium enema examinations. Data will be provided showing a 20% saving with only minimal change in technique. (author)

  18. Barium isotopes in Allende meteorite - Evidence against an extinct superheavy element (United States)

    Lewis, R. S.; Anders, E.; Shimamura, T.; Lugmair, G. W.


    Carbon and chromite fractions from the Allende meteorite that contain isotopically anomalous xenon-131 to xenon-136 (carbonaceous chondrite fission or CCF xenon) at up to 5 x 10 to the 11th atoms per gram show no detectable isotopic anomalies in barium-130 to barium-138. This rules out the possibility that the CCF xenon was formed by in situ fission of an extinct superheavy element. Apparently the CCF xenon and its carbonaceous carrier are relics from stellar nucleosynthesis.

  19. Calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid

    International Nuclear Information System (INIS)

    Present article is devoted to calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid. The calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid was carried out in order to determine the thermal effects of reactions. The results of interaction of Ba(OH)4·8H2O with 5, 10, and 20% solution of hydrofluoric acid were considered.

  20. Comparison of barium swallow and ultrasound in diagnosis of gastro-oesophageal reflux in children.


    Naik, D R; Bolia, A; Moore, D. J.


    Fifty one infants and older children with suspected gastro-oesophageal reflux entered a study comparing the diagnostic accuracy of a standard barium swallow examination with that of ultrasound scanning. All children were examined by both techniques. In 40 cases there was unequivocal agreement between the examinations. Of the remaining patients, four had definite reflux by ultrasonic criteria but showed no evidence of reflux on barium swallow examination, four had positive findings on ultrasou...

  1. Whipple's disease demonstrated by double contrast small bowel enema with barium and methylcellulose

    International Nuclear Information System (INIS)

    The radiologic findings on small bowel enema examination using barium and methylcellulose (SBE+Ba+MC) in a patient with Whipple's disease before and after treatment are described. The changes on SBE+Ba+MC corresponded well to the clinical and morphologic picture. The advantages of this double contrast technique compared to the enteroclysis with barium alone are demonstrated. The SBE+Ba+MC is a good method to demonstrate the manifestations of Whipple's disease involving the small bowel and the mesentery. (orig.)

  2. Impact of Biofield Treatment on Atomic and Structural Characteristics of Barium Titanate Powder


    Trivedi, Mahendra; Nayak, Gopal


    Barium titanate, perovskite structure is known for its high dielectric constant and piezoelectric properties, which makes it interesting material for fabricating capacitors, transducer, actuator, and sensors. The perovskite crystal structure and lattice vibrations play a crucial role in its piezoelectric and ferroelectric behavior. In the present study, the barium titanate powder was subjected to biofield treatment. Further, the control and treated samples were characterized using X-ray diffr...

  3. Kinetics of barium sulphate reaction crystallization in crystallizers with internal circulation


    Koralewska, J.; Piotrowski, K; B. Wierzbowska; A. Matynia


    Kinetic calculation results describing the observed nucleation and growth rates of barium sulphate crystals precipitated in an integrated reaction-crystallization process in a barium sulphate-ammonium chloride-water system are presented and analyzed. The scope of experiments included two continuous model DTM-type crystallizers (Draft Tube Magma) with internal circulation of the suspension forced by a liquid jet-pump device responsible for stable and intensive enough ascending/descending flow ...

  4. The impact of digital imaging on patient doses during barium studies

    International Nuclear Information System (INIS)

    Barium studies performed on 10 digital and four non-digital fluoroscopic systems were monitored with dose-area product meters as part of a Regional Patient Dosimetry Audit programme. The data have been collected using a computer to read and reset the dose-area product meter and also to collect patient and examination details. A comparison of dose-area product measurements from digital and non-digital fluoroscopy units on over 10 000 barium studies is presented. The data have been corrected according to patient size. The mean size corrected dose-area product for a barium meal examination was found to be 7.62 Gy cm-2 for a digital set compared with 15.45 Gy cm-2 for a non-digital set with 2462 and 1308 patients included in each measurement series, respectively. Dose-area products were also a factor of approximately two lower for barium enema, barium swallow and barium follow-through examinations performed on digital systems. (author)

  5. Preparation of porous nano barium ferrite and its adsorption properties on uranium

    International Nuclear Information System (INIS)

    The porous nano barium ferrite was made of Fe(NO3)3 and Ba(NO3)2 as raw materials, CTAB as surfactant by method of sol-gel and self-propagating combustion. The composition, morphology and magnetic properties of nano-rod barium ferrite were characterized by XRD, SEM and vibrating sample magnetometer. The adsorption properties of porous nano barium ferrite on uranium were studied with static adsorption and the effects of pH, adsorption temperature and oscillation time on adsorption properties were discussed. The results indicate that the average particle size of porous nano barium ferrite is 45-65 nm, the saturation magnetization and coercivity are 62.83 emu/g and 5481.0 Oe, respectively. Under the condition of the porous nano barium ferrite amount of 0.02 g, pH of 6, adsorption temperature of 25℃ and oscillation time of 30 min, the adsorption capacity of uranium on the porous nano barium ferrite reaches 921 μg/g. (authors)

  6. Comparison of Calcium and Barium Microcapsules as Scaffolds in the Development of Artificial Dermal Papillae. (United States)

    Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu


    This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and calcium microcapsules maintained xenogenic dermal papilla cells in an immunoisolated environment and induced the formation of hair follicle structures. Calcium microcapsules showed better biocompatibility, permeability, and cell viability in comparison with barium microcapsules. Before 18 weeks, calcium microcapsules gathered together, with no substantial immune response. After 32 weeks, some microcapsules were near inflammatory cells and wrapped with fiber. A few large hair follicles were found. Control samples showed no marked changes at the implantation site. Barium microcapsules were superior to calcium microcapsules in structural and mechanical stability. The cells encapsulated in hydrogel barium microcapsules exhibited higher short-term viability. This study established a model to culture DPCs in 3D culture conditions. Barium microcapsules may be useful in short-term transplantation study. Calcium microcapsules may provide an effective scaffold for the development of artificial dermal papilla. PMID:27123456

  7. Virtual colonoscopy with electron beam CT: correlation with barium enema, colonoscopy and pathology

    International Nuclear Information System (INIS)

    To perform virtual colonoscopy using electron beam tomography(EBT) in patients in whom a colonic mass was present, and to compare the results with those obtained using barium enema, colonoscopy and gross pathologic specimens. Materials and Methods : Ten patients in whom colonic masses were diagnosed by either barium enema or colonoscopy were involved in this study. There were nine cases of adenocarcinoma and one of tubulovillous adenoma. Using EBT preoperative abdominopelvic CT scans were performed. Axial scans were then three-dimensionally reconstructed to produce virtual colonoscopic images and were compared with barium enema, colonoscopy and gross pathologic specimens. Virtual colonoscopic images of the masses were classified as either 1)polyploid, 2)sessile,3)fungating, or 4)annular constrictive. We also determined whether ulcers were present within the lesions and whether there was obstruction. Results : After virtual colonoscopy, two lesions were classified as polyploid, one as sessile, five as fungating and two as annular constrictive. Virtual colonoscopic images showed good correlation with the findings of barium enema, colonoscopy and gross pathologic specimens. Three of six ulcerative lesions were observed on colonoscopy; in seven adenocarcinomas with partial or total luminal obstruction, virtual colonoscopy visualized the colon beyond the obstructed sites. In one case, barium contrast failed to pass through the obstructed portion and in six cases, the colonoscope similarly failed. Conclusion : Virtual colonoscopies correlated well with barium enema, colonoscopy and gross pathologic specimens. They provide three dimensional images of colonic masses and are helpful for the evaluation of obstructive lesions

  8. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough

    Directory of Open Access Journals (Sweden)

    Carlos Shuler Nin


    Full Text Available OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons.RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6% of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6% of the patients, whereas the treatment was ineffective in 1 (8.4%. We observed no complications related to barium swallow, such as contrast aspiration.CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.

  9. Excess Barium as a Paleoproductivity Proxy: A Reevaluation (United States)

    Eagle, M.; Paytan, A.


    Marine barite may serve as a proxy to reconstruct past export production (Dymond, 1992). In most studies sedimentary barite accumulation is not measured directly, instead a parameter termed excess barium (Baexs), also referred to as biogenic barium, is used to estimate the barite content. Baexs is defined as the total Ba concentration in the sediment minus the Ba associated with terrigenous material. Baexs is calculated by normalization to a constant Ba/Al ratio, typically the average shale ratio. This application assumes that (1) all the Ba besides the fraction associated with terrigenous Al is in the form of barite (the phase related to productivity) (2) the Ba/Alshale is constant in space and time (3) all of the Al is associated with terrigenous matter. If these assumptions are invalidated however, this approach lead to significant errors in calculating export production rates. To test the validity of the use of Baexs as a proxy for barite we compared the Baexs in a wide range of core top sediments from different oceanic settings to the barite content in the same cores. We found that Baexs frequently overestimated the Ba fraction associated with barite and in several cases significant Baexs was measured in the cores where no barite was observed. We have also used a sequential leaching protocol (Collier and Edmond 1984) to determine Ba association with organic matter, carbonates, Fe-Mn hydroxides and silicates. While terrigenous Ba remains an important fraction, in our samples 25-95% of non-barite Ba was derived from other fractions, with Fe-Mn oxides contributing the most Ba. In addition we found that the Ba/Al ratio in the silicate fraction of our samples varied considerably from site to site. The above results suggest that at least two of the underlying assumptions for employing Baexs to reconstruct paleoproductivity are not always valid and previously published data from (Murray and Leinen 1993) indicate that the third assumption may also not hold in every

  10. Monte Carlo estimation for pediatric barium meal procedures

    International Nuclear Information System (INIS)

    Fluoroscopic barium meal (BM) series involve an X-ray examination of the esophagus, stomach, and duodenum, by the use of a contrast media – the barium sulfate (BaSO4). They are widely used to observe digestive functions or to diagnose abnormalities such as ulcers; tumors; inflammation of the esophagus, stomach, and duodenum; malrotations; vascular rings; and gastroesophageal reflux disease (a common ailment in children). However, this procedure uses long fluoroscopy times and multiple radiographies, resulting in high effective doses to pediatric patients, whose radiosensitivity and life expectancy are higher than in adults. Based on those data, the aims of the current study are to: determine the PK,A (kerma-area product) values, on the patient chest area, and the effective doses to 5 and 10 years old children. Thirty-seven different pediatric patients were studied and stratified into two group sizes: 5 and 10 years old. For each procedure, the following data was recorded: sex, age and upper chest thickness, from the patients; technical parameters of the procedure (kV, fluoroscopy time and number of radiographies); distances (focus-detector and focus-table) and field size on the examination table. Three pairs of LiF:Mg,Ti thermoluminescent dosimeters were positioned at the center of the child´s sternum. After that, upper chest thickness was subtracted from focus-table distance, so focus-patient distance was obtained. Using the field size on the table and applying similar triangles concepts, the field size on the patient was measured, which was multiplied by the mean kerma (from the dosimeters), so that PK,A could be determined. To estimate the effective dose, PK,A and technical parameters of the procedure (kV, total filtration, focus-detector distance and field size on the patient) were written in a Monte Carlo software simulation. The results of PK,A and effective doses were higher than studies used for comparison, which shows the importance of an optimization

  11. Barium oxide, calcium oxide, magnesia, and alkali oxide free glass (United States)

    Lu, Peizhen Kathy; Mahapatra, Manoj Kumar


    A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.

  12. Abundance analysis of s-process enhanced barium stars (United States)

    Mahanta, Upakul; Karinkuzhi, Drisya; Goswami, Aruna; Duorah, Kalpana


    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ˜42000) of these objects spanning a wavelength range from 4000 to 6800 Å, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature Teff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] ≥ 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars with [Ba/Fe] ˜ 0.4. The derived abundances of the elements are interpreted on the basis of existing theories for understanding their origin and evolution.

  13. Structural and magnetic properties of barium-gadolinium hexaferrites

    Energy Technology Data Exchange (ETDEWEB)

    Litsardakis, G. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)]. E-mail:; Manolakis, I. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Serletis, C. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Efthimiadis, K.G. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)


    A series of Gd-substituted M-type barium hexaferrites has been prepared by the ceramic route, according to the formula (Ba{sub 1-x}Gd{sub x})O.5.25Fe{sub 2}O{sub 3} (x=0-0.30). XRD analysis revealed that all the samples present primarily an M-type structure. Samples x=0 and x=0.05 are single-phase. Hematite (Fe{sub 2}O{sub 3}) and GdFeO{sub 3} were detected in the remaining samples. Coercivity (H{sub c}) shows remarkably high values, {approx}293kA/m for x=0.20 and 0.30 with a maximum of 322kA/m for x=0.25. Specific saturation magnetization ({sigma}{sub sat}) of the samples presents a small increase up to x=0.10. The microstructure examination indicates that Gd may act as a grain growth inhibitor.

  14. Barium from a mini r-process in supernovae (United States)

    Heymann, D.


    McCulloch and Wasserburg (1978) have reported nonlinear isotopic anomalies in barium for two Ca-Al-rich inclusions of the Allende carbonaceous chondrite, known as EK-1-4-1 and C-1. In an attempt to account for these anomalies, it has been proposed that Ba from an r-process of nucleosynthesis, containing Ba-135 and Ba-137, was injected into the primeval color system but was not totally homogenized. Questions arise in connection with the relations of Xe isotopes in carbonaceous chondrites. This has prompted Heymann and Dziczkaniec (1979, 1980, 1981) to study the formation of r-Xe, r-Kr, and r-Te by the mini r-process which is thought to occur in the O, Ne-rich shells of Type II supernovae. Lee et al. (1979) have studied the formation of r-Ba, r-Nd, and r-Sm by the same process. Certain differences regarding the approaches used by Lee et al. and by Heymann and Dziczkaniec make it necessary to restudy the work of Lee et al. Attention is given to the survival probabilities of nuclear species of interest, taking into accounts the elements Cs, Ba, I, and Xe.

  15. On-line ultrasonic characterisation of barium doped lanthanum perovskites

    International Nuclear Information System (INIS)

    Perovskite manganite samples La1−xBaxMnO3 with the composition of x=0.30, 0.33 and 0.36 were prepared by employing solid state reaction technique. The X-ray diffraction (XRD) patterns confirmed the rhombhedral structure with R3c space group of the samples. The obtained energy dispersive analysis X-rays (EDX) spectra of the samples have confirmed the elemental composition of the samples. The scanning electron microscope (SEM) images of the samples were used to find out the size of the particles. In-situ ultrasonic measurements were carried out on the samples by through transmission method. The temperature dependence of the ultrasonic parameters revealed interesting features of the samples. The observed ultrasonic velocities and attenuation both in longitudinal and shear mode are related to the paramagnetic (PM) to ferromagnetic (FM) phase transition in the prepared samples. The results confirmed that an increase in the barium content in the sample leads to an increase in the phase transition temperature TC

  16. Properties of barium strontium titanate at millimeter wave frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Osman, Nurul [Department of Physics, Universiti Putra Malaysia (Malaysia); Free, Charles [Department of Engineering and Design, University of Sussex (United Kingdom)


    The trend towards using higher millimetre-wave frequencies for communication systems has created a need for accurate characterization of materials to be used at these frequencies. Barium Strontium Titanate (BST) is a ferroelectric material whose permittivity is known to change as a function of applied electric field and have found varieties of application in electronic and communication field. In this work, new data on the properties of BST characterize using the free space technique at frequencies between 145 GHz and 155 GHz for both thick film and bulk samples are presented. The measurement data provided useful information on effective permittivity and loss tangent for all the BST samples. Data on the material transmission, reflection properties as well as loss will also be presented. The outcome of the work shows through practical measurement, that BST has a high permittivity with moderate losses and the results also shows that BST has suitable properties to be used as RAM for high frequency application.

  17. Properties of barium strontium titanate at millimeter wave frequencies

    International Nuclear Information System (INIS)

    The trend towards using higher millimetre-wave frequencies for communication systems has created a need for accurate characterization of materials to be used at these frequencies. Barium Strontium Titanate (BST) is a ferroelectric material whose permittivity is known to change as a function of applied electric field and have found varieties of application in electronic and communication field. In this work, new data on the properties of BST characterize using the free space technique at frequencies between 145 GHz and 155 GHz for both thick film and bulk samples are presented. The measurement data provided useful information on effective permittivity and loss tangent for all the BST samples. Data on the material transmission, reflection properties as well as loss will also be presented. The outcome of the work shows through practical measurement, that BST has a high permittivity with moderate losses and the results also shows that BST has suitable properties to be used as RAM for high frequency application

  18. Radiochemical studies of the sorption behavior of strontium and barium

    International Nuclear Information System (INIS)

    The sorption behavior strontium and barium on kaolinite, bentonite and chlorite-illite mixed clay was studied by radioanalytical techniques using the batch method. 90Sr(29.1 y) and 133Ba(10.5y) were used as radiotracers. Characterization of the solid matrices was done by FTIR and XRD spectrometers and specific surface area measurements. Synthetic groundwater was used as the aqueous phase. The variation of the distribution ratio Rd, as a function of metal ion loading was examined. The sorption isotherms were fitted to various iso term models. The sorption energies were calculated to be in the range of 8-10kJ/mol suggesting an ion exchange type of sorption mechanism. In detailed experiments, chlorite-illite mixed clay was first presatured with K+, Sr2+, Ca2+ and Al 3= ions, respectively, prior to sorption studies with Ba2+ ions. The results of Ca2+ pretreated chlorite-illite were very similar to those of natural chlorite-illite, suggesting that the Ba2+ ion exchanges primarily with the Ca2+ ion on the clay minerals. (author). 15 refs., 3 figs., 5 tabs

  19. Removal of uranyl ions from aqueous solutions using barium titanate

    International Nuclear Information System (INIS)

    Remediation of water sources contaminated with radioactive waste products is a major environmental issue that demands new and more efficient technologies. For this purpose, we report a highly efficient ion-exchange material for the removal of radioactive nuclides from aqueous solutions. The kinetic characteristics of adsorption of uranyl ions on the surface of barium titanate were investigated using a spectrophotometric method under a wide range of conditions. By controlling the pH it was possible to exert fine control over the speciation of uranium, and by optimizing the temperature and grain size of the exchanger, almost total removal was achieved in a matter of just hours. The highest efficiency (>90 % removal) was realized at high temperature (80 deg C). Moreover, the effect of competitive ion adsorption from a range of different cations and anions was quantified. Adsorption was found to follow first-order kinetics and both Freundlich and Langmuir isotherms could be applied to this system. The results of a mathematical treatment of the kinetic data combined with the observation that adsorption was independent of stirring speed and dependent on the ion-exchanger grain size, indicate that the dominant mechanism influencing adsorption is particle spreading. The adsorption behavior was not influenced by exposure to high-intensity gamma radiation, indicating potential for use of this ion-exchanger in systems containing radioactive material. These results will be of use in the development of uranium extraction systems for contaminated water sources. (author)

  20. Colonic diverticulosis: evaluation with double contrast barium enema

    International Nuclear Information System (INIS)

    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west

  1. Colonic diverticulosis: evaluation with double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja [Korea Veterans Hospital, Seoul (Korea, Republic of)


    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west.

  2. Barium in landscape components of the western Transbaikal region (United States)

    Kashin, V. K.


    Barium concentrations in parent materials, soils, and plants of the forest-steppe, steppe, and dry steppe landscapes of the Transbaikal region have been studied. The average concentration of this element in rocks and soils of this region exceeds its clarke by 1.8-2.1 times. A positive correlation between the contents of Ba in soils, soil-forming rocks, and plants has been found. The concentration of Ba in soils does not correlate with the soil pH and humus content. Distribution patterns of Ba in the soil profiles have been characterized. With respect to the coefficient of the biological uptake by plants, Ba is assigned to the group of low accumulation (0.55-0.65) for mineral soils and of strong accumulation (6.0) for alluvial bog soils. Average concentrations of Ba in the steppe, meadow, and cultivated vegetation of the region are 1.9-2.3 times higher in comparison with the average concentration of this element in plants of the continents. The biological migration of Ba is most active in meadow landscapes, whereas steppe landscapes are characterized by the least active biological migration of this element.

  3. Abundance analysis of s-process enhanced barium stars

    CERN Document Server

    Mahanta, Upakul; Goswami, Aruna; Duorah, Kalpana


    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ~ 42000) of these objects spanning a wavelength range from 4000 to 6800 A, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature T_eff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] > 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars wit...

  4. On-line ultrasonic characterisation of barium doped lanthanum perovskites

    Energy Technology Data Exchange (ETDEWEB)

    Thamilmaran, P.; Arunachalam, M. [Department of Physics, Sri SRNM College, Sattur 626203, Tamil Nadu (India); Research scholars in Physics, Manonmanium Sundaranar University, Tirunelveli 627012 Tamil Nadu (India); Sankarrajan, S. [Department of Physics, Unnamalai Institute of Technology, Kovilpatti 628503, Tamil Nadu (India); Sakthipandi, K., E-mail: [Department of Physics, Sethu Institute of Technology, Kariapatti 626115, Tamil Nadu (India)


    Perovskite manganite samples La{sub 1−x}Ba{sub x}MnO{sub 3} with the composition of x=0.30, 0.33 and 0.36 were prepared by employing solid state reaction technique. The X-ray diffraction (XRD) patterns confirmed the rhombhedral structure with R3c space group of the samples. The obtained energy dispersive analysis X-rays (EDX) spectra of the samples have confirmed the elemental composition of the samples. The scanning electron microscope (SEM) images of the samples were used to find out the size of the particles. In-situ ultrasonic measurements were carried out on the samples by through transmission method. The temperature dependence of the ultrasonic parameters revealed interesting features of the samples. The observed ultrasonic velocities and attenuation both in longitudinal and shear mode are related to the paramagnetic (PM) to ferromagnetic (FM) phase transition in the prepared samples. The results confirmed that an increase in the barium content in the sample leads to an increase in the phase transition temperature T{sub C}.

  5. The thermophysical properties of calcium and barium zirconium phosphate

    Energy Technology Data Exchange (ETDEWEB)

    Gregg, Daniel J., E-mail:; Karatchevtseva, Inna; Triani, Gerry; Lumpkin, Gregory R.; Vance, Eric R.


    The thermophysical and structural properties of calcium and barium zirconium phosphate ceramics (CZP and BZP) have been investigated for their potential candidacy as actinide hosts for inert matrix fuels (IMF) in nuclear reactors. These phosphate ceramics, which can accommodate minor actinides as well as the resulting fission products, are found to be thermally stable to 1600 °C in air, however they begin to decompose in an inert atmosphere above approximately 1400 °C. The heat capacity, thermal conductivity and bulk thermal-expansion were measured from room temperature up to 1200 °C. Structural changes in this temperature region as well as the anisotropic thermal-expansion behaviour were studied using high-temperature X-ray diffraction. A phase change from R-3 to R-3c was identified for Ba{sub 0.5}Zr{sub 2}(PO{sub 4}){sub 3} near 880 °C. The thermal conductivity for these ceramics at 1000 °C was found to be 1.0 W m{sup −1} K{sup −1}, a relatively low thermal conductivity that was increased to 5.0 W m{sup −1} K{sup −1} at 1000 °C for BZP:Ni (25:75 mass ratio) cermet composites.

  6. Preparation and properties of yttria doped tetragonal zirconia polycrystal/Sr-doped barium hexaferrite ceramic composites

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Shanshan; Zhang, Chao; Guo, Ruisong, E-mail:; Liu, Lan; Yang, Yuexia; Li, Kehang


    Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m{sup 1/2}. - Abstract: The effects of substitution of Ba{sup 2+} by Sr{sup 2+} on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba{sub 1−x}Sr{sub x}Fe{sub 12}O{sub 19}, x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m{sup 1/2} for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase.

  7. Skylab-barium alpha and beta L = 6 field-line tracing experiments

    International Nuclear Information System (INIS)

    Events SKYLAB-BARIUM ALPHA (27 November 1973) and BETA (4 December 1973) were shaped-charge barium field-line tracing experiments near L approximately equal to 6, conducted jointly by the Los Alamos Scientific Laboratory and the University of Alaska Geophysical Institute. Image-orthicon and pulsed intensified auroral cameras provided data for triangulating the fast ion streaks. Using the POGO 10-68, epoch 1965.0, field-line model with Mead-Fairfield corrections for the outer field, the triangulated positions of the fast ion streak were projected down to the 100 km altitude northern conjugate surface. The projected positions moved toward magnetic east with a velocity of 725 m/sec for both SKYLAB-BARIUM ALPHA and BETA. Assuming only an E x B/B2 force, this drift velocity is consistent with an electric field toward magnetic south of 39 mV/m. Radiometric analysis of the filtered, intensified auroral camera records gave observed peak radiance values of about 2 x 10-11 watts/cm2-Sr in the 455.4 nm line of Ba+. The barium in the portion of the ion streak for which radiometric data were obtained had initial injection velocities of 9.5 to 13.5 km/sec in both events. This portion of the ion streak for both SKYLAB-BARIUM ALPHA and BETA contained approximately 4 x 1023 ions compared to the 6.4 x 1024 atoms contained in the barium liner. Ion inventory estimates are based on a solution of the statistical equilibrium equations. Corrections have been made in the ion inventory calculations for Doppler shifts of the solar spectrum as received in the rest frame of the high-velocity barium ions

  8. An 8-year review of barium studies in the diagnosis of gastroparesis

    International Nuclear Information System (INIS)

    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings

  9. Obtaining of a barium compound by combustion chemistry and their evaluation as Co adsorbent

    International Nuclear Information System (INIS)

    In this work, barium carbonate synthesized by chemical combustion method using a chemical precursor prepared by the combination of barium nitrate and urea as a fuel, with a 1:1 molar ratio in aqueous solution, the chemical precursor was heated to evaporate excess water, producing a homogeneous viscous liquid, that when heated to 900 centi grades for 5 minutes an exothermic reaction was produced very quickly and abruptly, forming a white powder final product, fine porous, little spongy, dry and crystalline ready to be used as material adsorbent. Additionally, the effect of water on the synthesis by chemical combustion was studied. Simultaneously, and with the purpose of comparing the advantages and disadvantages of the method by chemical combustion, barium carbonate was synthesized by precipitation method using barium nitrate salts and sodium carbonate. Synthesized barium carbonate, was characterized by X-ray diffraction, thermal gravimetric analysis, infrared spectrometry and scanning electron microscopy. We studied the adsorption capacity of Co present in aqueous solution by static tests on materials synthesized at room temperature using the neutron activation analysis. It was found that the synthesis by chemical combustion provides an interesting alternative compared to the synthesis by precipitation because it offers simplicity of synthesis and speed to have a good adsorbent material. It was found that the barium carbonate synthesized by the chemical combustion method using in their synthesis 1.0 ml of water, was the one who achieved the maximum adsorption capacity of 95.6% compared with the barium carbonate prepared by precipitation, which reached a capacity adsorption of 51.48%. (Author)

  10. Accelerating the transit time of barium sulphate suspensions in small bowel examinations

    International Nuclear Information System (INIS)

    Purpose: To determine whether hyperosmolar and effervescent agents proven individually to accelerate transit time in the barium small bowel examination have an additive effect when combined, surpassing that of either agent alone. Materials and methods: One hundred and forty-nine patients were randomised to four groups. Three hundred milliliters of barium sulphate alone was given to the first group. Fifteen milliliters of iodinated hyperosmolar contrast agent (Gastrografin, meglumine/sodium diatrizoate, Schering) was given in addition to barium sulphate to the second group while six packets of effervescent granules (Carbex, Ferring) were added for the third group. The final group was given a combination of both additives and barium sulphate. The time taken following ingestion for the contrast column to reach the caecum, as assessed by frequent interval fluoroscopy, was recorded. A subgroup of 32 patients were selected randomly from the four groups, 8 from each and assessed for quality of examination. Statistical assessments were made using Kruskal-Wallis and Mann-Whitney tests. Results: One hundred and nineteen patients were analysed after exclusions. The addition of accelerant to barium sulphate, both individually and in combination significantly reduced the small bowel transit time (p < 0.001). No significant difference existed between the additives when used with barium alone. The combined group had significantly faster transit times compared to the hyperosmolar group (p = 0.02). Differences between combined and effervescent groups tended towards significance (p = 0.09). No significant difference existed between groups when examination quality was assessed. Conclusion: These results suggest that the addition of combined effervescent and hyperosmolar agents to the barium suspension may significantly shorten the small bowel transit time without adversely affecting examination quality. This has implications for patient acceptability of the examination as well as

  11. An 8-year review of barium studies in the diagnosis of gastroparesis

    Energy Technology Data Exchange (ETDEWEB)

    Levin, A.A. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States); Levine, M.S. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)], E-mail:; Rubesin, S.E.; Laufer, I. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)


    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings.

  12. Studies of normal deformation in {sup 151}Dy

    Energy Technology Data Exchange (ETDEWEB)

    Nisius, D.; Janssens, R.V.F.; Crowell, B. [and others


    The wealth of data collected in the study of superdeformation in {sup 151}Dy allowed for new information to be obtained on the normally deformed structures in this nucleus. At high spin several new yrast states have been identified for the first time. They were associated with single-particle excitations. Surprisingly, a sequence was identified with energy spacings characteristic of a rotational band of normal ({beta}2 {approximately} 0.2) deformation. The bandhead spin appears to be 15/2{sup -} and the levels extend up to a spin of 87/2{sup -}. A clear backbend is present at intermediate spins. While a similar band based on a bandhead of 6{sup +} is known in {sup 152}Dy, calculations suggest that this collective prolate band should not be seen in {sup 151}Dy. In the experiment described earlier in this report that is aimed at determining the deformations associated with the SD bands in this nucleus and {sup 152}Dy, the deformation associated with this band will be determined. This will provide further insight into the origin of this band.

  13. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, N.G. [University of Otago, Department of Radiology, Christchurch (New Zealand); Butler, A.P. [University of Otago, Department of Radiology, Christchurch (New Zealand); University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Scott, N.J.A. [University of Otago, Department of Medicine, Christchurch (New Zealand); Cook, N.J. [Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Butzer, J.S. [Karlsruhe Institute of Technology, Physics Department, Karlsruhe (Germany); Schleich, N. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Firsching, M. [Friedrich Alexander University, Physics Department, Erlangen (Germany); Grasset, R.; Ruiter, N. de [University of Canterbury, Hitlab NZ, Christchurch (New Zealand); Campbell, M. [European Organisation for Nuclear Research, Physics Section, Geneva (Switzerland); Butler, P.H. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand)


    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 {mu}A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 {mu}m isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)

  14. High pressure–low temperature phase diagram of barium: Simplicity versus complexity

    International Nuclear Information System (INIS)

    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations

  15. Radiologic diagnosis of gastro-oesophageal reflux. Comparison of barium and low-density contrast medium

    Energy Technology Data Exchange (ETDEWEB)

    Fransson, S.G.; Soekjer, H.; Johansson, K.E.; Tibbling, L.

    It has been proposed that the high density of ordinary barium suspension may complicate the radiologic diagnosis of gastro-oesophageal reflux. For this reason P-contrast was developed (Ferring AB); a contrast medium with the same density as water (1 g/cm/sup 3/). A comparison of P-contrast and barium (Mixobar Ventrikel 400 mg/ml) was performed in 82 patients. All patients were examined with both contrast media and the findings were compared with those at reflux test at manometry, endoscopy and 24-hour pH monitoring. Another 40 patients and 15 symptom-free controls were examined with two different amounts of barium, 100 ml and 200 ml, to study if the radiologic diagnosis of reflux varied with the volume of contrast medium administered. P-contrast was found to have no advantages over barium for the diagnosis of gastro-oesophageal reflux. The outcome of the radiologic examination was not influenced by the different volumes of barium used.

  16. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    International Nuclear Information System (INIS)

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 μA). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 μm isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)

  17. High pressure–low temperature phase diagram of barium: Simplicity versus complexity

    Energy Technology Data Exchange (ETDEWEB)

    Desgreniers, Serge [Laboratoire de Physique des Solides Denses, Université d' Ottawa, Ottawa, Ontario K1N 6N5 (Canada); Tse, John S., E-mail: [Department of Physics and Engineering Physics, University of Saskatchewan, Saskatoon, Saskatchewan S7N 5B2 (Canada); State Key Laboratory of Superhard Materials, Jilin University, 130012 Changchun (China); Matsuoka, Takahiro [SPring-8/JASRI, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); Department of Electrical, Electronic and Computer Engineering, Gifu University, 1-1 Yanagido, Gifu 501-1193 (Japan); Ohishi, Yasuo [SPring-8/JASRI, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); Li, Quan; Ma, Yanming [State Key Laboratory of Superhard Materials, Jilin University, 130012 Changchun (China)


    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations.

  18. High pressure-low temperature phase diagram of barium: Simplicity versus complexity (United States)

    Desgreniers, Serge; Tse, John S.; Matsuoka, Takahiro; Ohishi, Yasuo; Li, Quan; Ma, Yanming


    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations.

  19. Benefits of Barium Enema in Patients with Incomplete Colonoscopy. Prospective Study of 45 Cases

    International Nuclear Information System (INIS)

    To evaluate the usefulness of barium enema in patients with incomplete colonoscopy. There was carried out a prospective 10-month study of 45 patients with incomplete colonoscopy (27 men and 18 women), who were later examined by means of barium enema (33 conventional, 12 double-contrast) in order to check for additional pathology in portions of the colon not visualized by colonoscopy. Barium enema diagnosed six possible additional lesions (13.3%) in portions of the colon not visualized by incomplete colonoscopy (four neoplasia and two non-neoplasia). Regarding the neoplasia two were true positives and two false positives. Both true positives were adenocarcinomas (one synchronous caecum, and another in splenic angle). The two false positives corresponded to fecal matter stuck to the intestinal wall. Regarding the non-neoplasia, multiple stenosis was detected in a patient with Crohn's disease and an enterocolic fistula was found in a patient with sigmoid colon neoplasia. The diagnostic yield of barium enema in the detection of additional pathology in colon portions not visualized by colonoscopy was of 9%. Barium enema following incomplete colonoscopy permits a complete colon evaluation in most cases, and it offers additional diagnostic information. (Author) 21 refs

  20. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    International Nuclear Information System (INIS)

    Barium can be found in waters up to 1 mg L-1 and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L-1 and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  1. Hydro-MRI with fast sequences in Crohn's disease: Comparison with barium studies

    International Nuclear Information System (INIS)

    Purpose: To compare the value of hydro-MRI with that of barium studies in patients with Crohn's disease. Materials and methods: After an oral bowel opacification using 1000 ml of a 2.5% mannitol solution, axial and coronal breathhold sequences (T2W HASTE±FS, contrast-enhanced T1W FLASH FS) were acquired in 46 patients with Crohn's disease at 1,0 T. The findings of hydro-MRI were compared with those of barium studies. Results: In the stomach and the small bowel, hydro-MRI and barium studies demonstrated similar numbers of Crohn's involvements (39 vs. 36); in the colon, hydro-MRI showed clearly more affections (23 vs. 10). Hydro-MRI showed 12.7 cm of inflamed bowel per patient, on average (barium studies: 10,4 cm; p=0,004). There was a good agreement between the two methods regarding the assessment of the extent of Crohn's disease and the severity of bowel stenoses (r=0.89 and 0.88, respectively). Conclusions: For the assessment of Crohn's disease, hydro-MRI is preferable to the barium study because of the superior imaging quality and the lack of radiation exposure. (orig.)

  2. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    Energy Technology Data Exchange (ETDEWEB)

    Matoso, Erika, E-mail: [Centro Tecnologico da Marinha em Sao Paulo (CEA/CTMS), Ipero, SP (Brazil). Centro Experimental Aramar; Cadore, Solange, E-mail: [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Quimica. Departamento de Quimica Analica


    Barium can be found in waters up to 1 mg L{sup -1} and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L{sup -1} and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)


    International Nuclear Information System (INIS)

    Barium II (Ba) stars are chemically peculiar F-, G-, and K-type objects that show enhanced abundances of s-process elements. Since s-process nucleosynthesis is unlikely to take place in stars prior to the advanced asymptotic giant branch (AGB) stage, the prevailing hypothesis is that each present Ba star was contaminated by an AGB companion which is now a white dwarf (WD). Unless the initial mass ratio of such a binary was fairly close to unity, the receiving star is thus at least as likely to be a dwarf as a giant. So although most known Ba stars appear to be giants, the hypothesis requires that Ba dwarfs be comparably plentiful and moreover that they should all have WD companions. However, despite dedicated searches with the IUE satellite, no WD companions have been directly detected to date among the classical Ba dwarfs, even though some 90% of those stars are spectroscopic binaries, so the contamination hypothesis is therefore presently in some jeopardy. In this paper, we analyze recent deep, near-UV and far-UV Galaxy Evolution Explorer (GALEX) exposures of four of the brightest of the class (HD 2454, 15360, 26367, and 221531), together with archived GALEX data for two newly recognized Ba dwarfs: HD 34654 and HD 114520 (which also prove to be spectroscopic binaries). The GALEX observations of the Ba dwarfs as a group show a significant far-UV excess compared to a control sample of normal F-type dwarfs. We suggest that this ensemble far-UV excess constitutes the first direct evidence that Ba dwarfs have WD companions.

  4. Electrical properties of niobium doped barium bismuth-titanate ceramics

    International Nuclear Information System (INIS)

    Highlights: ► Pure and doped BaBi4Ti4O15 were prepared via the solid-state reaction method. ► The grain size was suppressed in Nb-doped samples. ► The diffuseness of the dielectric peak increased with dopant concentration. ► Niobium affected on relaxor behavior of barium bismuth titanate ceramics. ► The conductivity change was noticed in doped samples. -- Abstract: BaBi4Ti4–5/4xNbxO15 (BBNTx, x = 0, 0.05, 0.15, 0.30) ceramics have been prepared by solid state method. XRD data indicate the formation of single-phase-layered perovskites for all compositions. SEM micrographs suggest that the grain size decreases with Nb doping. The effect of niobium doping on the dielectric and relaxor behavior of BaBi4Ti4O15 ceramics was investigated in a wide range of temperatures (20–777 °C) and frequencies (1.21 kHz to 1 MHz). Nb doping influences Tc decrease as well as the decrease of dielectric permittivity at Curie temperature. At room temperature, undoped BaBi4Ti4O15 exhibits dielectric constant of ∼204 at 100 kHz, that slightly increases with Nb doping. The conductivity of BBNT5 ceramics is found to be lower than that of other investigated compositions. The value of activation energy of σDC was found to be 0.89 eV, 1.01 eV, 0.93 eV and 0.71 eV for BBT, BBNT5, BBNT15 and BBNT30, respectively.

  5. Electrical properties of niobium doped barium bismuth-titanate ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Bobić, J.D., E-mail: [Institute for Multidisciplinary Researches, Belgrade University, Kneza Viseslava 1, Belgrade (Serbia); Vijatović Petrović, M.M. [Institute for Multidisciplinary Researches, Belgrade University, Kneza Viseslava 1, Belgrade (Serbia); Banys, J. [Faculty of Physics, Vilnius University, 9 Sauletekio Str., Vilnius (Lithuania); Stojanović, B.D. [Institute for Multidisciplinary Researches, Belgrade University, Kneza Viseslava 1, Belgrade (Serbia)


    Highlights: ► Pure and doped BaBi{sub 4}Ti{sub 4}O{sub 15} were prepared via the solid-state reaction method. ► The grain size was suppressed in Nb-doped samples. ► The diffuseness of the dielectric peak increased with dopant concentration. ► Niobium affected on relaxor behavior of barium bismuth titanate ceramics. ► The conductivity change was noticed in doped samples. -- Abstract: BaBi{sub 4}Ti{sub 4–5/4x}Nb{sub x}O{sub 15} (BBNTx, x = 0, 0.05, 0.15, 0.30) ceramics have been prepared by solid state method. XRD data indicate the formation of single-phase-layered perovskites for all compositions. SEM micrographs suggest that the grain size decreases with Nb doping. The effect of niobium doping on the dielectric and relaxor behavior of BaBi{sub 4}Ti{sub 4}O{sub 15} ceramics was investigated in a wide range of temperatures (20–777 °C) and frequencies (1.21 kHz to 1 MHz). Nb doping influences T{sub c} decrease as well as the decrease of dielectric permittivity at Curie temperature. At room temperature, undoped BaBi{sub 4}Ti{sub 4}O{sub 15} exhibits dielectric constant of ∼204 at 100 kHz, that slightly increases with Nb doping. The conductivity of BBNT5 ceramics is found to be lower than that of other investigated compositions. The value of activation energy of σ{sub DC} was found to be 0.89 eV, 1.01 eV, 0.93 eV and 0.71 eV for BBT, BBNT5, BBNT15 and BBNT30, respectively.

  6. EPR dosimetric properties of nano-barium sulfate

    International Nuclear Information System (INIS)

    Nano/micro BaSO4 were prepared through the co-precipitation method to measure ionizing radiation doses using electron paramagnetic resonance (EPR). The nano-BaSO4 sample was characterized using X-ray diffraction (XRD), and transmission electron microscopy (TEM) techniques. The dose response and fading properties of nano- and micro-phase BaSO4 were compared in EPR spectra. The prepared nano- and micro-BaSO4 samples have the same hole and electron centers, which may be attributed to SO4− and SO3−, respectively. The dosimetric signals for prepared nano- and micro-BaSO4 have spectroscopic splitting factor (g) with values 2.0025±0.0006 and 2.0027±0.0006, respectively. The nanocrystalline sample has a linear γ-ray dose response over the range 0.4 Gy–1 kGy. The performance parameters which including detection limit and critical level calculated from weighted and unweighted least-squares fitting. The sensitivity of nano-BaSO4 to γ-ray is one and a half times more than alanine. The lifetime and activation energy for nano-BaSO4 were estimated by conducting a thermal stability study, and were 5.7±1.1×104 years and 0.73±0.14 eV, respectively. The combined and expanded uncertainties accompanying measurements were ±3.89% and ±7.78%, respectively. - Highlights: • Preparation of nano-BaSO4 using the co-precipitation method. • Study of the dosimetric properties of nano-barium sulfate using the EPR technique. • Comparison between a new EPR dosimeter using nano-materials and standard alanine. • Calculation of the uncertainty budget for nano-BaSO4

  7. Radiation doses to children during modified barium swallow studies

    Energy Technology Data Exchange (ETDEWEB)

    Weir, Kelly A. [University of Queensland, Discipline of Paediatrics and Child Health, School of Medicine, Herston, Queensland (Australia); McMahon, Sandra M. [SpeechNet Speech Pathology Services, Brisbane (Australia); Long, Gillian; Bunch, Judith A. [Royal Children' s Hospital, Department of Medical Imaging, Herston (Australia); Pandeya, Nirmala [Queensland Institute of Medical Research, Herston (Australia); Coakley, Kerry S. [Biomedical Technology Services, Royal Brisbane and Women' s Hospital, Herston (Australia); Chang, Anne B. [Royal Children' s Hospital, Department of Respiratory Medicine, Herston (Australia)


    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 {+-} 0.0544 mSv, screening time 2.48 {+-} 0.81 min, and DAP 28.79 {+-} 41.72 cGy cm{sup 2}. Significant differences were found across three age groups ({<=}1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P = 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)

  8. Sputtered Modified Barium Titanate for Thin-Film Capacitor Applications

    Directory of Open Access Journals (Sweden)

    Robert Mamazza


    Full Text Available New apparatus and a new process for the sputter deposition of modified barium titanate thin-films were developed. Films were deposited at temperatures up to 900 °C from a Ba0.96Ca0.04Ti0.82Zr0.18O3 (BCZTO target directly onto Si, Ni and Pt surfaces and characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray photoelectron spectroscopy (XPS. Film texture and crystallinity were found to depend on both deposition temperature and substrate: above 600 °C, the as-deposited films consisted of well-facetted crystallites with the cubic perovskite structure. A strongly textured Pt (111 underlayer enhanced the (001 orientation of BCZTO films deposited at 900 °C, 10 mtorr pressure and 10% oxygen in argon. Similar films deposited onto a Pt (111 textured film at 700 °C and directly onto (100 Si wafers showed relatively larger (011 and diminished intensity (00ℓ diffraction peaks. Sputter ambients containing oxygen caused the Ni underlayers to oxidize even at 700 °C: Raising the process temperature produced more diffraction peaks of NiO with increased intensities. Thin-film capacitors were fabricated using ~500 nm thick BCZTO dielectrics and both Pt and Ni top and bottom electrodes. Small signal capacitance measurements were carried out to determine capacitance and parallel resistance at low frequencies and from these data, the relative permittivity (er and resistivity (r of the dielectric films were calculated; values ranged from ~50 to >2,000, and from ~104 to ~1010 Ω∙cm, respectively.

  9. Radiation doses to children during modified barium swallow studies

    International Nuclear Information System (INIS)

    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 ± 0.0544 mSv, screening time 2.48 ± 0.81 min, and DAP 28.79 ± 41.72 cGy cm2. Significant differences were found across three age groups (≤1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)


    International Nuclear Information System (INIS)

    Open clusters are very useful examples to explain the constraint of the nucleosynthesis process with the luminosities of stars because the distances of the clusters are better known than those of field stars. We carried out a detailed spectroscopic analysis to derive the chemical composition of two red giants in the young open cluster NGC 5822, NGC 5822-2, and NGC 5822-201. We obtained abundances of C, N, O, Na, Mg, Al, Ca, Si, Ti, Ni, Cr, Y, Zr, La, Ce, and Nd. The atmospheric parameters of the studied stars and their chemical abundances were determined using high-resolution optical spectroscopy. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. The abundances of the light elements were derived using the spectral synthesis technique. We found that NGC 5822-2 and -201 have, respectively, a mean overabundance of the elements created by the s-process, ''s'', with the notation [s/Fe] of 0.77 ± 0.12 and 0.83 ± 0.05. These values are higher than those for field giants of similar metallicity. We also found that NGC 5822-2 and -201 have, respectively, luminosities of 140 L☉ and 76 L☉, which are much lower than the luminosity of an asymptotic giant branch star. We conclude that NGC 5822-2 and NGC 5822-201 are two new barium stars first identified in the open cluster NGC 5822. The mass transfer hypothesis is the best scenario to explain the observed overabundances

  11. Synthesis and thermionic properties of tungsten–barium titanate composites

    International Nuclear Information System (INIS)

    Highlights: • W–BaTiO3 composites were readily synthesized using standard sintering methods. • Compositions in the range 20–80% by mass were studied. • The microstructure of the composites comprises W, BaTiO3, Ba4Ti12O27 and BaW04. • The Richardson work function was reduced from 4.5 eV for W to as little as 2.67 eV. • Post-emission surfaces were coated in a thin layer of Ba4Ti12O27 and BaW04. - Abstract: The potential of novel tungsten–barium titanate composites as thermionic emitters is explored. Composites ranging from 20% to 80% tungsten by mass were prepared by sintering in an Ar–H2 atmosphere. XRD and SEM studies indicate four major micro-constituents; W, BaTiO3, Ba4(Ti,Fe)12O27 and BaWO4. Richardson work functions (φR) and Richardson constants (AR) were determined using a Schottky diode arrangement at temperatures ranging from 1223 to 1473 K. Work functions ranged from 2.67 eV to 3.32 eV with a shallow minimum at 40% by mass W and were relatively constant (∼2.7–2.8 eV) in the range 30–70% by mass W. The decrease in work function was accompanied by a strong decrease in AR from 39.3 A cm−2 K−2 to 0.02 A cm−2 K−2 over the range 20–70% by mass W. The reduction in both φR and AR was associated with the major conversion of the surface to BaWO4 and Ba4Ti12O27 during the activation treatment before emission testing


    Energy Technology Data Exchange (ETDEWEB)

    Katime Santrich, O. J.; Pereira, C. B.; De Castro, D. B., E-mail:, E-mail:, E-mail: [Observatorio Nacional/MCT, Rua Gen. Jose Cristino, 77, 20921-400 Rio de Janeiro (Brazil)


    Open clusters are very useful examples to explain the constraint of the nucleosynthesis process with the luminosities of stars because the distances of the clusters are better known than those of field stars. We carried out a detailed spectroscopic analysis to derive the chemical composition of two red giants in the young open cluster NGC 5822, NGC 5822-2, and NGC 5822-201. We obtained abundances of C, N, O, Na, Mg, Al, Ca, Si, Ti, Ni, Cr, Y, Zr, La, Ce, and Nd. The atmospheric parameters of the studied stars and their chemical abundances were determined using high-resolution optical spectroscopy. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. The abundances of the light elements were derived using the spectral synthesis technique. We found that NGC 5822-2 and -201 have, respectively, a mean overabundance of the elements created by the s-process, ''s'', with the notation [s/Fe] of 0.77 {+-} 0.12 and 0.83 {+-} 0.05. These values are higher than those for field giants of similar metallicity. We also found that NGC 5822-2 and -201 have, respectively, luminosities of 140 L{sub Sun} and 76 L{sub Sun }, which are much lower than the luminosity of an asymptotic giant branch star. We conclude that NGC 5822-2 and NGC 5822-201 are two new barium stars first identified in the open cluster NGC 5822. The mass transfer hypothesis is the best scenario to explain the observed overabundances.

  13. 9 CFR 151.6 - Statement of owner, agent, or importer as to identity of animals. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Statement of owner, agent, or importer as to identity of animals. 151.6 Section 151.6 Animals and Animal Products ANIMAL AND PLANT HEALTH... identity of animals. The owner, agent, or importer who applies for a certificate of pure breeding for...

  14. 24 CFR 943.151 - What procurement standards apply to a joint venture itself? (United States)


    ... a joint venture itself? 943.151 Section 943.151 Housing and Urban Development Regulations Relating... joint venture itself? (a) When the joint venture as a whole is controlled by the PHA or an identity of interest party of the PHA, the joint venture is subject to the requirements of part 85 of this title....

  15. The Tetraspanin CD151 Is Required for Met-dependent Signaling and Tumor Cell Growth* (United States)

    Franco, Mélanie; Muratori, Claudia; Corso, Simona; Tenaglia, Enrico; Bertotti, Andrea; Capparuccia, Lorena; Trusolino, Livio; Comoglio, Paolo M.; Tamagnone, Luca


    CD151, a transmembrane protein of the tetraspanin family, is implicated in the regulation of cell-substrate adhesion and cell migration through physical and functional interactions with integrin receptors. In contrast, little is known about the potential role of CD151 in controlling cell proliferation and survival. We have previously shown that β4 integrin, a major CD151 partner, not only acts as an adhesive receptor for laminins but also as an intracellular signaling platform promoting cell proliferation and invasive growth upon interaction with Met, the tyrosine kinase receptor for hepatocyte growth factor (HGF). Here we show that RNAi-mediated silencing of CD151 expression in cancer cells impairs HGF-driven proliferation, anchorage-independent growth, protection from anoikis, and tumor progression in xenograft models in vivo. Mechanistically, we found that CD151 is crucially implicated in the formation of signaling complexes between Met and β4 integrin, a known amplifier of HGF-induced tumor cell growth and survival. CD151 depletion hampered HGF-induced phosphorylation of β4 integrin and the ensuing Grb2-Gab1 association, a signaling pathway leading to MAPK stimulation and cell growth. Accordingly, CD151 knockdown reduced HGF-triggered activation of MAPK but not AKT signaling cascade. These results indicate that CD151 controls Met-dependent neoplastic growth by enhancing receptor signaling through β4 integrin-mediated pathways, independent of cell-substrate adhesion. PMID:20937830

  16. 27 CFR 478.151 - Semiautomatic rifles or shotguns for testing or experimentation. (United States)


    ... shotguns for testing or experimentation. 478.151 Section 478.151 Alcohol, Tobacco Products, and Firearms... shotguns for testing or experimentation. (a) The provisions of § 478.39 shall not apply to the assembly of semiautomatic rifles or shotguns for the purpose of testing or experimentation as authorized by the Director....

  17. 33 CFR 151.1518 - Penalties for failure to conduct ballast water management. (United States)


    ... ballast water management. 151.1518 Section 151.1518 Navigation and Navigable Waters COAST GUARD..., GARBAGE, MUNICIPAL OR COMMERCIAL WASTE, AND BALLAST WATER Ballast Water Management for Control of... water management. (a) A person who violates this subpart is liable for a civil penalty in an amount...

  18. 19 CFR 151.23 - Allowance for moisture in raw sugar. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Allowance for moisture in raw sugar. 151.23...; DEPARTMENT OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Sugars, Sirups, and Molasses § 151.23 Allowance for moisture in raw sugar. Inasmuch as the absorption of sea water or...

  19. 40 CFR 141.151 - Purpose and applicability of this subpart. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Purpose and applicability of this subpart. 141.151 Section 141.151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Consumer Confidence Reports §...

  20. 33 CFR 151.67 - Operating requirements: Discharge of plastic prohibited. (United States)


    ... of plastic prohibited. 151.67 Section 151.67 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION VESSELS CARRYING OIL, NOXIOUS LIQUID SUBSTANCES, GARBAGE... Environmental Protection to the Antarctic Treaty as it Pertains to Pollution from Ships Garbage Pollution...

  1. 22 CFR 151.8 - Evidence of insurance for motor vehicles. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Evidence of insurance for motor vehicles. 151.8... LIABILITY INSURANCE FOR DIPLOMATIC MISSIONS AND PERSONNEL § 151.8 Evidence of insurance for motor vehicles... insurance throughout the period of registration on all motor vehicles owned or leased or otherwise...

  2. Study of precipitation processes of strontium and barium nitrates in mixtures of water-with dimethylformamide and dimethylsulfoxide

    International Nuclear Information System (INIS)

    The investigation into phase equilibriums diagrams in the barium (strontium) nitrate-water-dimethylsulfoxide and barium nitrate-water dimethylformamide systems has been pursued at 298, 15 K for the estimation of outlook for use of mixed aqua-organic solvents during the production of mixture form high temperature superconductors by means of coprecipitation or crystallization. 4 refs., 3 figs., 2 tabs

  3. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    CERN Document Server

    Mong, B; Walton, T; Chambers, C; Craycraft, A; Benitez-Medina, C; Hall, K; Fairbank, W; Albert, J B; Auty, D J; Barbeau, P S; Basque, V; Beck, D; Breidenbach, M; Brunner, T; Cao, G F; Cleveland, B; Coon, M; Daniels, T; Daugherty, S J; DeVoe, R; Didberidze, T; Dilling, J; Dolinski, M J; Dunford, M; Fabris, L; Farine, J; Feldmeier, W; Fierlinger, P; Fudenberg, D; Giroux, G; Gornea, R; Graham, K; Gratta, G; Heffner, M; Hughes, M; Jiang, X S; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krucken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Moore, D; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Retiere, F; Rowson, P C; Rozo, M P; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Twelker, K; Vuilleumier, J -L; Walton, J; Weber, M; Wen, L J; Wichoski, U; Yang, L; Yen, Y -R; Zhao, Y B


    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fluorescence quantum efficiency of the principal Ba emission transition are reported. Under current conditions, an image of $\\le10^4$ Ba atoms can be obtained. Prospects for imaging single Ba atoms in solid xenon are discussed.

  4. Synthesis and Characterization of Barium-Vanadium Oxide Nanocomposite Using a Facile thermolysis Approach

    Directory of Open Access Journals (Sweden)

    Niloufar Akbarzadeh-T


    Full Text Available In this investigation, we report synthesis of new cationic-anionic Barium-Vanadium complex with 2, 6- pyridinedicarboxylic acid ligand. This compound [Ba(H2O8][VO2(dipic]2(1 has been characterized using elemental analyses, FT-IR, UV–Vis and Cyclic voltammetry (CV techniques. Also in this study we report facile synthesis of Barium-Vanadium Oxide nanoparticle under thermal decomposition, using precursor complex (1. Characterization of Barium-Vanadium Oxide nanocomposites was carried out by scanning electron microscopy (SEM, energy dispersive X-ray analysis (EDX, X-ray powder diffraction (XRD and Fourier transform infrared (FT-IR spectroscopy. The X-ray diffraction pattern at room temperature revealed that, highly pure and crystallized Ba3(VO42 with rhombohedral structure.

  5. CuO and Ag2O effect on electrical properties of barium vanadate glasses

    International Nuclear Information System (INIS)

    Effect of CuO on barium vanadate glass (BVG) conductivity on direct and alternating currents in the frequency range (102-104)Hz has been studied. Effect of Ag2O has been also studied for comparison, as Ag and Cu have idendical structure of external electron shells (d10, S1). CuO introduction to binary barium vanadate glasses as a modificator results in the conductivity improvement on direct and alternating currents conditioned with reducing activation energy of small radius polaron jump, apparently, owing to exchange (ferromagnetic) interaction between V(IV) and Cu(II). Jump activation energy in barium vanadate glasses with Ag2O increases and conductivity drops due to the distance increase between vanadium atoms

  6. The review of various synthesis methods of barium titanate with the enhanced dielectric properties (United States)

    More, S. P.; Topare, R. J.


    The Barium Titanate is a very well known dielectric ceramic belongs to perovskite structure. It has very wide applications in the field of electronic, electro ceramic, electromechanical and electro-optical applications. Barium Titanate has very high dielectric constant as well as low dielectric loss. Substituted dielectrics are one of the most important technological compounds in modern electro ceramics. Its electrical properties can be tuned flexibly by a simple substitution technique. This has encouraged researchers to select a typical cation to be substituted at cationic sites. In the present paper, the review of various synthesis methods of Barium Titanate compound with the effect of different dopants, the grain size on the dielectric properties at various temperatures is discussed.

  7. Plasma irregularities caused by cycloid bunching of the CRRES G-2 barium release (United States)

    Bernhardt, P. A.; Huba, J. D.; Pongratz, M. B.; Simons, D. J.; Wolcott, J. H.


    The Combined Release and Radiation Effects Satellite (CRRES) spacecraft carried a number of barium thermite canisters for release into the upper atmosphere. The barium release labeled G-2 showed evidence of curved irregularities not aligned with the ambient magnetic field B. The newly discovered curved structures can be explained by a process called cycloid bunching. Cycloid bunching occurs when plasma is created by photoionization of a neutral cloud injected at high velocity perpendicular to B. If the injection velocity is much larger than the expansion speed of the cloud, the ion trail will form a cycloid that has irregularities spaced by the product of the perpendicular injection speed and the ion gyroperiod, Images of the solar-illuminated barium ions are compared with the results of a three-dimensional kinetic simulation. Cycloid bunching is shown to be responsible for the rapid generation of both curved and field-aligned irregularities in the CRRES G-2 experiment.

  8. Highly aligned arrays of high aspect ratio barium titanate nanowires via hydrothermal synthesis

    International Nuclear Information System (INIS)

    We report on the development of a hydrothermal synthesis procedure that results in the growth of highly aligned arrays of high aspect ratio barium titanate nanowires. Using a multiple step, scalable hydrothermal reaction, a textured titanium dioxide film is deposited on titanium foil upon which highly aligned nanowires are grown via homoepitaxy and converted to barium titanate. Scanning electron microscope images clearly illustrate the effect the textured film has on the degree of orientation of the nanowires. The alignment of nanowires is quantified by calculating the Herman's Orientation Factor, which reveals a 58% improvement in orientation as compared to growth in the absence of the textured film. The ferroelectric properties of barium titanate combined with the development of this scalable growth procedure provide a powerful route towards increasing the efficiency and performance of nanowire-based devices in future real-world applications such as sensing and power harvesting

  9. TiO2 ceramic varistor modified with tantalum and barium

    International Nuclear Information System (INIS)

    The non-linear current (I)-voltage (V) characteristics of titanium dioxide doped with small quantities of tantalum and barium (99.9 TiO2 + 0.1 Ta and 99.4 TiO2 + 0.1 Ta + 0.5 Ba, all are in at.%) were investigated. These samples have the non-linear coefficient (α) values of (20-30) with high breakdown voltages (E B ∼ 400-700 V mm-1). The pentavalent tantalum acts as donor and increases the electronic conductivity. The higher electrical conductivity and decrease in the breakdown field strength with barium addition is attributed to higher density. The acceptor like surface states formed by barium ions segregate to grain boundaries due size misfit to thereby modifying the electrical barrier characteristics of grain boundaries

  10. Prompt ionization in the CRIT II barium releases. [Critical Ionization Tests (United States)

    Torbert, R. B.; Kletzing, C. A.; Liou, K.; Rau, D.


    Observations of electron and ion distributions inside a fast neutral barium jet in the ionosphere show significant fluxes within 4 km of release, presumably related to beam plasma instability processes involved in the Critical Ionization Velocity (CIV) effect. Electron fluxes exceeding 5 x 10 exp 12/sq cm-str-sec-keV were responsible for ionizing both the streaming barium and ambient oxygen. Resulting ion fluxes seem to be consistent with 1-2 percent ionization of the fast barium, as reported by optical observations, although the extended spatial distribution of the optically observed ions is difficult to reconcile with the in situ observations. When the perpendicular velocity of the neutrals falls below critical values, these processes shut off. Although these observations resemble the earlier Porcupine experimental results (Haerendel, 1982), theoretical understanding of the differences between these data and that of earlier negative experiments is still lacking.

  11. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    International Nuclear Information System (INIS)

    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  12. Unexpected finding of barium sulphate on the surface of a microspinal catheter

    International Nuclear Information System (INIS)

    During a study with a scanning electron microscope to evaluate the structure of microspinal catheter after its removal from subarachnoid space, we found an unusual case. The observation with the microscope of the tip of a catheter removed at the end of an operation for hip replacement in a old female showed the presence of grounded particles with a crystal shape covering the outer surface. Further analysis of this material with an Energy-Dispersive Spectrometer (EDS) showed that it was barium. The patient performed a large bowel barium enema 8 months earlier for a painful syndrome to the lower abdomen. Authors rule out the contamination from the skin and suggest two possible mechanisms of passage of barium from blood to cerebrospinal fluid (CSF) and so to the surface of the catheter

  13. Barium sulphate preparations for use in double contrast examination of the upper gastrointestinal tract

    International Nuclear Information System (INIS)

    Physical properties relevant to upper gastrointestinal radiology have been compared for five barium sulphate preparations and related to radiographic results. Evaluation of particles (size and stability) and whole suspension (dispersibility and fluidity) resulted in ranking of the preparations generally in accord with that based on radiological experience in double contrast examinations of the stomach. Experiments with extirpated pig stomach revealed a tendency for large particles in a low viscosity barium sulphate suspension to settle in mucosal grooves. This is believed to contribute to good radiographic definition of both the areae gastricae and small lesions. Particle size is therefore important and susceptibility to flocculation, a possible cause of random change in size during use, was assessed by measuring particle electrophoretic mobility under varying conditions; quantitative differences in suspension flow and dispersibility were also demonstrated. Fluidity and dispersibility together with rapid sedimentation of suitably sized particles resistant to flocculation underlie the successful use of low viscosity high density barium sulphate suspensions. (U.K.)

  14. Barium and strontium sulfate solid solution formation in relation to North Sea scaling problems

    International Nuclear Information System (INIS)

    This paper presents the results of laboratory experiments carried out to investigate barium sulphate and strontium sulphate solid solution formation in multi-pressure tapped cores. Two brines, one barium and strontium rich and the other sulphate rich, were mixed in a core plug. Pressure differentials were measured and the changing permeability distribution along the length of the core calculated. The morphology and chemical analysis of scaling crystals are presented based on Scanning electron Microsocpy (SEM) and Energy Dispersive X-ray Analysis (EDAX). The results show the large extent of permeability damage caused by (Ba, SR) SO/sub 4/ solid solution depositing on the rock pore surface. The rock permeability decline and morphology and size of the scaling crystals indicate the influence of the supersaturations of BaSO/sub 4/ and SrSO/sub 4/ as well as the concentration ratio of barium ions to strontium ions

  15. Use of the barium enema in the diagnosis of necrotizing enterocolitis

    Energy Technology Data Exchange (ETDEWEB)

    Uken, P.; Smith, W.; Franken, E.A.; Frey, E.; Sato, Y.; Ellerbroek, C.


    Necrotizing enterocolitis (NEC) is associated with considerable morbidity and mortality in infants. The diagnosis relies heavily upon radiographic and clinical features. Failure to accurately diagnose NEC is associated with a risk of complications and death, however overdiagnosis also causes both morbidity and mortality as well as excessive medical costs. This report documents the use of barium enema to evaluate suspected clinical or radiographic NEC in 31 premature infants with ambiguous clinical and radiographic signs. The enema was normal in 26 infants and no treatment for NEC was given. Only one of these infants developed signs of NEC subsequent to the examination. Five infants had radiographic evidence of colitis including small ulcerations, spasm, intramural extravasation of barium and mucosal irregularity. Two of the five positive cases are pathologically documented. The barium enema can represent a significant improvement in the specificity of the diagnosis of NEC. Its greatest value is in the exclusion of NEC in ambiguous cases.

  16. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    Energy Technology Data Exchange (ETDEWEB)

    Baştürka, Emre; Madakbaş, Seyfullah; Kahraman, Memet Vezir, E-mail: [Department of Chemistry, Marmara University, Istanbul (Turkey)


    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  17. Dicty_cDB: SHB151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available D SHB151 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original sit...ygsqfipivnhtcidptltptpttsttsttfasttsttttsttsnasagttsttsaatt pttsalttstttttsttttittsttlpststttspidsktrniiivtv...ress heart cDNA library Salmo salar cDNA clone hr_004_h06 5' similar to desmin, mRNA sequence. 44 3e-04 3 BX...mNt: 0.00 m3a: 0.00 m3b: 0.00 m_ : 0.00 48.0 %: mitochondrial 20.0 %: Golgi 12.0 ...%: nuclear 8.0 %: endoplasmic reticulum 4.0 %: cytoplasmic 4.0 %: vacuolar 4.0 %: extracellular, including cell wal

  18. Individual-specific transgenerational marking of fish populations based on a barium dual-isotope procedure. (United States)

    Huelga-Suarez, Gonzalo; Moldovan, Mariella; Garcia-Valiente, America; Garcia-Vazquez, Eva; Alonso, J Ignacio Garcia


    The present study focuses on the development and evaluation of an individual-specific transgenerational marking procedure using two enriched barium isotopes, (135)Ba and (137)Ba, mixed at a given and selectable molar ratio. The method is based on the deconvolution of the isotope patterns found in the sample into four molar contribution factors: natural xenon (Xe nat), natural barium (Ba nat), Ba135, and Ba137. The ratio of molar contributions between Ba137 and Ba135 is constant and independent of the contribution of natural barium in the sample. This procedure was tested in brown trout ( Salmo trutta ) kept in captivity. Trout were injected with three different Ba137/Ba135 isotopic signatures ca. 7 months and 7 days before spawning to compare the efficiency of the marking procedure at long and short term, respectively. The barium isotopic profiles were measured in the offspring by means of inductively coupled plasma mass spectrometry. Each of the three different isotopic signatures was unequivocally identified in the offspring in both whole eggs and larvae. For 9 month old offspring, the characteristic barium isotope signatures could also be detected in the otoliths even in the presence of a high and variable amount of barium of natural isotope abundance. In conclusion, it can be stated that the proposed dual-isotope marking is inheritable and can be detected after both long-term and short-term marking. Furthermore, the dual-isotope marking can be made individual-specific, so that it allows identification of offspring from a single individual or a group of individuals within a given fish group. PMID:22103693

  19. Preparation and characterization of ZnSn-substituted barium ferrite thin films

    International Nuclear Information System (INIS)

    The preparation of ZnSn-substituted barium ferrite films by sputtering deposition was studied. The as-sputtered films were amorphous, and annealing at a minimum of 750 oC was required to crystallize the films, based on the X-ray diffraction analysis and the magnetic measurements. Scanning electron microscopy combined with energy-dispersive X-ray spectroscopic microanalysis confirmed that the films were single phase with the composition BaZnxSnxFe12-2xO19, x=0.2-0.3, and their thicknesses were 0.4-1.0 μm when annealed at 750-900 oC. Atomic and magnetic force microscopy studies showed no significant grain growth upon annealing and that the films consisted of single-domain grains forming interaction-cluster-type domains. The natural ferromagnetic resonance frequency was determined at around 4 GHz, together with substantial magnetic losses that make these films promising candidates for microwave absorbers. - Research highlights: → ZnSn-substituted barium ferrite films can be prepared with a sputtering-deposition followed by annealing at 750-900 oC. → The ZnSn-substituted barium ferrite films consist from magnetically coupled single-domain grains. → The ZnSn-substitution in barium ferrite films reduces the ferromagnetic resonance from 48 to 4 GHz. → The ZnSn-substituted barium ferrite films show large magnetic losses at 7-15 GHz. → The ZnSn-substituted barium ferrite films are suitable for microwave absorbers.

  20. Barium hydrogen phosphate/gelatin composites versus gelatin-free barium hydrogen phosphate: synthesis and characterization of properties. (United States)

    Gashti, Mazeyar Parvinzadeh; Burgener, Matthias; Stir, Manuela; Hulliger, Jürg


    Recently, attention has been spent on crystal growth of phosphate compounds in gels for studying the mechanism of in vitro crystallization processes. Here, we present a gel-based approach for the synthesis of barium hydrogen phosphate (BHP) crystals using single and double diffusion techniques in gelatin. The composite crystals were compared with analytical grade BHP powder, single and polycrystalline BHP materials using Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), scanning pyroelectric microscopy (SPEM), optical microscopy (OM), thermal gravimetric analysis (TGA) and X-ray diffraction (XRD). FTIR spectra showed surface adsorption of gelatin molecules by using BHP stacked sheets due to CH2 stretching, CH2 bending and amide I vibrations are found in a gelatin content of about 2% determined by dissolution. SEM shows various crystal morphologies of the BHP/gelatin composites forming bundled micro-flakes to irregular bundled needles and spheres different from gel-free crystals. The variety in morphology depends on the ion concentration, pH of gel as well as the method of crystal growth. SPEM investigation of BHP/gelatin aggregates revealed polar domains showing alteration of the polarization. Moreover, BHP/gelatin composite crystals showed a higher thermal stability in comparison with analytical grade BHP or/and BHP single crystals due to strong interactions between gelatin and BHP. The XRD diffraction analysis demonstrated that the single and double diffusion techniques in gelatin led to the formation of orthorhombic BHP. This study demonstrates that gelatin is a useful high molecular weight biomacromolecule for controlling the crystallization of a composite material by producing a variety of morphological forms. PMID:24996024

  1. Magnetic properties of barium ferrite dispersed within polystyrene-butadiene-styrene block copolymers. (United States)

    Chipara, M; Skomski, R; Ali, N; Hui, D; Sellmyer, D J


    Magnetic properties of nanocomposite materials obtained by dispersing barium ferrite nanoparticles within polystyrene-butadiene-styrene block copolymer, in the temperature range, 300 to 500 K are reported. The temperature dependence of the magnetization at saturation, averaged uniaxial magnetocrystalline anisotropy, and coercive field of thick films are analyzed. A "matrix effect" was noticed within the glass transition range of the hard component (polystyrene) of the polymeric matrix. The reported modifications of the magnetic properties were assigned to the competition between the magnetic and mechanical reorientation of nanoparticles within the polymeric matrix. Such modifications were not observed in barium ferrite dispersed in cement. PMID:19504902

  2. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate

    Indian Academy of Sciences (India)

    P Sarah; S V Suryanarayana


    Piezoelectric 3–0 composite ceramics are prepared from a mixture of barium titanate and lithium ferrite phase constituents. Dielectric properties of composites are affected by a number of parameters that include electrical properties, size, shape and amount of constituent phases. The frequency dependent measurements can provide additional insight into mechanisms controlling electrical response. Frequency dependence of dielectric constant plots of lithium ferrite/barium titanate composites will be given and the relevance of trends seen in them will be discussed. Connectivity in composites developed is studied.

  3. The structural properties of barium cobalt hexaferrite powder prepared by a simple heat treatment method (United States)

    Chauhan, Chetna; Jotania, Rajshree


    The W-type barium hexaferrite was prepared using a simple heat treatment method. The precursor was calcinated at 650°C for 3 hours and then slowly cooled to room temperature in order to obtain barium cobalt hexaferrite powder. The prepared powder was characterised by different experimental techniques like XRD, FTIR and SEM. The X-ray diffractogram of the sample shows W-and M phases. The particle size calculated by Debye Scherrer formula. The FTIR spectra of the sample was taken at room temperature by using KBr pallet method which confirms the formation of hexaferrite phase. The morphological study on the hexaferrite powder was carried out by SEM analysis.

  4. Growth conditions effect on growth strips in barium-strontium niobate crystals

    International Nuclear Information System (INIS)

    The growth bands appeared due to a change of the instantaneous growth rate are studied in the crystals of solid solution of barium and strontium niobates obtained by the method of Chokhral'skii. Instability of thermal conditions in the crystallization front leading to a change of the instantaneous growth rate is caused by several factors: insufficient accuracy in keeping the operating temperature, the presence of convection, displacement of crystallization front in an inhomogeneous thermal field, for instance when crystal rotates. Considered are the ways of diminiching the temperature vibrations in a melt and found are the conditions for obtaining optically homogeneous monocrystals of barium-strontium niobate

  5. Barium meal examination of infants under four months of age presenting with vomiting

    International Nuclear Information System (INIS)

    One hundred barium meal examinations performed on infants of less than 4 months of age are reviewed. All the infants presented with vomiting as a major symptom and the diagnosis remained in doubt following the initial clinical assessment. Fifty seven per cent of the examinations showed an abnormality of which 45% were throught to be significant. Hypertrophic pyloric stenosis was demonstrated in 23 infants. Other abnormalities included hiatus hernia, gastrooesophageal reflux, and duodenal abnormalities. The value of barium meal examinations in this group of infants is emphasised. (orig.)

  6. Barium meal examination of infants under four months of age presenting with vomiting

    Energy Technology Data Exchange (ETDEWEB)

    Arthur, R.J.; Ziervogel, M.A.; Azmy, A.F.


    One hundred barium meal examinations performed on infants of less than 4 months of age are reviewed. All the infants presented with vomiting as a major symptom and the diagnosis remained in doubt following the initial clinical assessment. Fifty seven per cent of the examinations showed an abnormality of which 45% were throught to be significant. Hypertrophic pyloric stenosis was demonstrated in 23 infants. Other abnormalities included hiatus hernia, gastrooesophageal reflux, and duodenal abnormalities. The value of barium meal examinations in this group of infants is emphasised.

  7. Temperature-Dependent Raman Spectra and Microstructure of Barium Metaborate Crystals and Its Melts

    Institute of Scientific and Technical Information of China (English)

    尤静林; 蒋国昌; 侯怀宇; 吴永全; 陈辉; 徐匡迪


    We have measured the Raman spectra of β- and α-barium metaborate in crystal and liquid states from room temperature to 1873K, with a semiconductor laser as the laser source, coupled with a time-resolved detection system to eliminate the dense thermal emission background when temperature was considerably high.Temperature-dependent Raman spectra can clearly indicate that the phase transformation from β- to α-barium metaborate has been completed during 1273 - 1300 K. Variations of different kinds of microstructure units with temperature are identified and discussed.

  8. Calcium barium niobate as a functional material for broadband optical frequency conversion. (United States)

    Sheng, Yan; Chen, Xin; Lukasiewicz, Tadeusz; Swirkowicz, Marek; Koynov, Kaloian; Krolikowski, Wieslaw


    We demonstrate the application of as-grown calcium barium niobate (CBN) crystal with random-sized ferroelectric domains as a broadband frequency converter. The frequency conversion process is similar to broadband harmonic generation in commonly used strontium barium niobate (SBN) crystal, but results in higher conversion efficiency reflecting a larger effective nonlinear coefficient of the CBN crystal. We also analyzed the polarization properties of the emitted radiation and determined the ratio of d32 and d33 components of the second-order susceptibility tensor of the CBN crystal. PMID:24690779

  9. Chemical composition of nanomodified composite binder with nano- and microsized barium silicate

    Directory of Open Access Journals (Sweden)

    KOROLEV Evgenij Valerjevich


    Full Text Available There are several possibilities to improve cement-based binders. In particular, many properties of cement stone can be enhanced by means of micro- and nanoscale modification. In a number of previous works we had shown that application of barium hydrosilicates leads to such improvement. The present article is devoted to the investigation of the chemical composition of the cement stone which is modified by means of addition of barium hydrosilicates. The modification was performed on different scales: micro- and nanoscale; the results of simultaneous multi-scale modification are also presented. The examination was carried out with help of different modern research techniques – FT IR spectroscopy, differential thermal analysis and X-ray phase analysis. Identification of the new phases and comparative quantitative assessment of their content are performed. It is found that the use of nano- and micro-sized barium hydrosilicates as additives leads to reduction of portlandite by 27...28%; by means of multi-scale modification it is possible to reduce the content of portlandite much more (by 83.3%. Due to addition of nano- and micro-sized barium-based modifiers both the amount of calcium hydrosilicates in reaction products is enlarged, and structure of the mentioned hydrosilicates is changed (the formation of a fine-grained structure of hydration products takes place. Micro-sized barium hydrosilicates are chemically active additives and promote the formation of an additional quantity of calcium hydrosilicates of type CSH (I. The use of nanoscale barium hydrosilicates promotes the formation of CSH (I and CSH (II calcium hydrosilicates, and also both riversidite and xonotlite. As a result of simultaneous application of nano- and micro-sized barium hydrosilicates the content of CSH (II increases. This can be confirmed by means of differential thermal and X-ray analysis. The amount of CSH (I, riversidite and various tobermorites is also increases. It is

  10. Effects of oleic acid on the high threshold barium current in seabass Dicentrarchus labrax ventricular myocytes


    Chatelier, Aurelien; Imbert, Nathalie; Zambonino, Jose-luis; McKenzie, David; Bois, P.


    The present study employed a patch clamp technique in isolated seabass ventricular myocytes to investigate the hypothesis that oleic acid (OA), a mono-unsaturated fatty acid, can exert direct effects upon whole-cell barium currents. Acute application of free OA caused a dose-dependent depression of the whole-cell barium current that was evoked by a voltage step to 0 mV from a holding potential of -80 mV. The derived 50% inhibitory concentration (IC50) was 12.49 +/- 0.27 mu mol l(-1). At a con...

  11. Synthesis, characterization and thermostability of barium β-diketonate with tetraethylenepentamine ligand

    Institute of Scientific and Technical Information of China (English)


    The metal-organic chemical vapor deposition (MOCVD) technique is a promising process for high-temperature superconductor YBa2Cu3O7-δ(YBCO) preparation. In this technique, it is a challenge to obtain barium precursors with high volatility. In addition, the purity, evaporation characteristics and thermostability of adopted precursors in the whole process would decide the quality and reproducible results of YBCO film. In the present report, the barium precursor containing 2,2,6,6-tetramethylheptane-3,5-dionate...

  12. The structural and magnetic properties of barium ferrite powders prepared by the sol-gel method

    Institute of Scientific and Technical Information of China (English)

    Li Jie; Zhang Huai-Wu; Li Yuan-Xun; Liu Ying-Li; Ma Yan-Bing


    In this paper,M-type hexagonal barium ferrite powders are synthesized using the sol-gel method.A dried precursor heated in air is analyzed in the temperature range from 50 to 1200 ℃ using thermo-gravimetric analysis and differential scanning calorimetry. The effects of the additives and the cacinating temperature on the magnetic properties are investigated,and the results show that single-phase barium ferrite powders can be formed. After heat-treating at 950 ℃ for 4h with 3 wt% additive,the coercivity and saturation magnetization are found to be 440 Oe and 57.9 emu/g,respectively.

  13. Features of Raman amplification in KGW and barium nitrate crystals at excitation by femtosecond pulses

    International Nuclear Information System (INIS)

    Measurements of Raman amplification in KGd(WO4)2 (KGW) and barium nitrate crystals at femtosecond excitation demonstrate spectral transformation of amplification band with change of pump parameters. The half-height amplification bandwidth of up to 45 nm (650 cm-1) what is 5 times larger than the pumping pulse spectral band 8.5 nm (130 cm-1) was observed for KGW crystal. Implementation of impulsive excitation for the low-frequency vibrations allows estimations of the dephasing times and linewidths for the 87 and 83 cm-1 Raman lines in KGW and barium nitrate

  14. CT-Guided Percutaneous Transthoracic Localization of Pulmonary Nodules Prior to Video-Assisted Thoracoscopic Surgery Using Barium Suspension

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Nyoung Keun; Park, Chang Min; Kang, Chang Hyun; Jeon, Yoon Kyung; Choo, Ji Yung; Lee, Hyun Ju; Goo, Jin Mo [Seoul National University College of Medicine, Seoul (Korea, Republic of)


    To describe our initial experience with CT-guided percutaneous barium marking for the localization of small pulmonary nodules prior to video-assisted thoracoscopic surgery (VATS). From October 2010 to April 2011, 10 consecutive patients (4 men and 6 women; mean age, 60 years) underwent CT-guided percutaneous barium marking for the localization of 10 small pulmonary nodules (mean size, 7.6 mm; range, 3-14 mm): 6 pure ground-glass nodules, 3 part-solid nodules, and 1 solid nodule. A 140% barium sulfate suspension (mean amount, 0.2 mL; range, 0.15-0.25 mL) was injected around the nodules with a 21-gauge needle. The technical details, surgical findings and pathologic features associated with barium localizations were evaluated. All nodules were marked within 3 mm (mean distance, 1.1 mm; range, 0-3 mm) from the barium ball (mean diameter, 9.6 mm; range, 8-16 mm) formed by the injected barium suspension. Pneumothorax occurred in two cases, for which one needed aspiration. However, there were no other complications. All barium balls were palpable during VATS and visible on intraoperative fluoroscopy, and were completely resected. Both the whitish barium balls and target nodules were identifiable in the frozen specimens. Pathology revealed one invasive adenocarcinoma, five adenocarcinoma-in-situ, two atypical adenomatous hyperplasias, and two benign lesions. In all cases, there were acute inflammations around the barium balls which did not hamper the histological diagnosis of the nodules. CT-guided percutaneous barium marking can be an effective, convenient and safe pre-operative localization procedure prior to VATS, enabling accurate resection and diagnosis of small or faint pulmonary nodules.

  15. Growth rate controlled barium partitioning in calcite and aragonite (United States)

    Goetschl, Katja Elisabeth; Mavromatis, Vasileios; Baldermann, Andre; Purgstaller, Bettina; Dietzel, Martin


    The barium (Ba) content and the Ba/Ca molar ratios in biogenic and abiotic carbonates have been widely used from the scientific community as a geochemical proxy especially in marine and early diagenetic settings. The Ba content of carbonate minerals has been earlier associated to changes in oceanic circulation that may have been caused by upwelling, changes in weathering regimes and river-runoff as well as melt water discharge. The physicochemical controls of Ba ion incorporation in the two most abundant CaCO3 polymorphs found in Earth's surface environments, i.e. calcite and aragonite, have adequately been studied only for calcite. These earlier studies (i.e. [1]) suggest that at increasing growth rate, Ba partitioning in calcite is increasing as well. In contrast, to date the effect of growth rate on the partitioning of Ba in aragonite remains questionable, despite the fact that this mineral phase is the predominant carbonate-forming polymorph in shallow marine environments. To shed light on the mechanisms controlling Ba ion uptake in carbonates in this study we performed steady-state Ba co-precipitation experiments with calcite and aragonite at 25°C. The obtained results for the partitioning of Ba in calcite are in good agreement with those reported earlier by [1], whereas those for aragonite indicate a reduction of Ba partitioning at elevated aragonite growth rates, with the partitioning coefficient value between solid and fluid to be approaching the unity. This finding is good agreement with the formation of a solid solution in the aragonite-witherite system, owing to the isostructural crystallography of the two mineral phases. Moreover, our data set provides new insights that are required for reconstructing the evolution of the Ba content of pristine marine versus diagenetically altered carbonate minerals commonly occurring in marine subfloor settings, as the thermodynamically less stable aragonite will transform to calcite enriched in Ba, whilst affecting

  16. 33 CFR 151.3000 - Definition of marine debris for the purposes of the Marine Debris Research, Prevention, and... (United States)


    ... the purposes of the Marine Debris Research, Prevention, and Reduction Act. 151.3000 Section 151.3000... Definition of Marine Debris for the Purposes of the Marine Debris Research, Prevention, and Reduction Act § 151.3000 Definition of marine debris for the purposes of the Marine Debris Research, Prevention,...

  17. 42 CFR 483.151 - State review and approval of nurse aide training and competency evaluation programs. (United States)


    ... and competency evaluation programs. 483.151 Section 483.151 Public Health CENTERS FOR MEDICARE... Agencies: Nurse Aide Training and Competency Evaluation, and Paid Feeding Assistants § 483.151 State review and approval of nurse aide training and competency evaluation programs. (a) State review...

  18. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage. (United States)

    Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J


    Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3). PMID:22233912

  19. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    CERN Document Server

    Anderson, NG; Firsching, M; de Ruiter, N; Schleich, N; Butzer, J S; Cook, N J; Grasset, R; Campbell, M; Scott, N J A; Anderson, N G


    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 A mu A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct f...

  20. The Precipitation Process of Liquid Wastes Containing Contaminant Am withBarium Sulfate

    International Nuclear Information System (INIS)

    The investigated of the reduction volume liquid wastes containing ofAmericium nuclide contaminant has been done. The reduction volume was done byadding barium sulfate coagulant. The experimental procedure that has beendone by adding regent of barium nitrate and natrium sulfate to the wasteswith its preadjusted pH, then by utilizing the jar test equipment was carriedout the fast stirring speed for 5 minutes and the gentle agitation for 30minutes, therefor its floc and supernatant will be formed. The resultedbarium sulfate floc will trap radionuclide in the wastes. The Variableinvestigated were: the concentration of barium sulfate, pH of the wastes, theflash mixing rate, the gentle agitation rate. The investigated barium sulfateconcentration variable was started from 100 ppm up to 800 ppm. Theinvestigated pH variable was started from pH 7 up to pH 13. The investigatedflash mixing rate were 75, 100, 125, 150, 175, 200, 225, 250 rpm. Theinvestigated gentle agitation variable were 20, 30, 40, 50 rpm. The bestresult which was represented by decontaminating factor (DF) was found frombarium sulfate concentration of 300 ppm and pH 11, and the flash mixing rateof 200 rpm and the gentle agitation rate of 20 rpm, with the separationefficiency = 97.2 %. (author)

  1. Barium enema findings (segmental colitis) in four neonates with bloody diarrhea - possible cow's milk allergy

    International Nuclear Information System (INIS)

    Four neonates with sudden onset of bloody diarrhea and barium enema findings suggestive of segmental colitis are reported. The infants were not very ill and in all four, the condition was self-limiting. An exact etiology for the condition was not determined but in all of the infants a possible association with cow's milk intolerance was suggested. (orig.)

  2. Study of structural, ferromagnetic and ferroelectric properties of nanostructured barium doped Bismuth Ferrite

    International Nuclear Information System (INIS)

    Nanostructured multiferroic Bi(1−x)BaxFeO3x=0.0, 0.1, 0.2 were prepared by hydrothermal technique. All samples belonged to the rhombohedrally distorted perovskite structure. The morphology of the particles changed with the doping of barium. Effect of barium doping on the dielectric constant was studied over a wide frequency range of 1000 Hz–1 MHz. The activation energy due to relaxation and due to conduction was measured from the Cole Cole plot and the AC conductivity versus frequency plot respectively. The activation energy estimated from both the studies was close to each other. The activation energy also enhanced with the increase in the barium content. The magnetization at the highest available field (∼1.6 T) increased from 0.05 emu/g for the sample with x=0.0–12 emu/g for the sample with x=0.2. The magnetic measurements show a significant increase in magnetization around 400 °C. Remnant polarization for x=0.0 was negligible and it increased to 0.06 µC/cm2 for x=0.2. - Highlights: • Bismuth Ferrite nanostructures were synthesized by the hydrothermal technique. • Barium was doped in Bismuth site. • Morphology changed with doping. • Ferromagnetic, Ferroelectric and Dielectric properties enhanced with doping. • An unreported magnetic transition due to spin canting was observed near 550 °C


    This document is the final report for the 2004 external peer review of the Proposed Oral Reference Dose (RfD) for Barium and Compounds, prepared by the U.S. Environmental Protection Agency (EPA), National Center for Environmental Assessment (NCEA), for the Integrated Risk Informa...

  4. Magnetic studies of cobalt doped barium hexaferrite nanoparticles prepared by modified sol-gel method (United States)

    Shalini, M. Govindaraj; Sahoo, Subasa C.


    M-type barium hexaferrite (BaFe12O19) and cobalt doped barium hexaferrite (BaFe11CoO19) nanopowders were synthesized by modified sol-gel auto-combustion technique and were annealed at 900°C in air for 4 hours. The annealed powders were studied in the present work and X-ray diffraction studies showed pure phase formation after annealing. The average grain size in the nanopowder sample was decreased after doping. Magnetization value of 60 emu/g was observed at 300K for the barium hexaferrite and was reduced to 54 emu/g after doping. The coercivity of 5586 Oe was observed at 300K for the undoped sample and was found to be decreased in the doped sample. As the measurement temperature was decreased from 300K to 60K, magnetization value was increased in both the samples compared to those at 300K. The coercivity of the undoped sample was found to decrease whereas it was increased for the doped sample at 60K. The observed magnetic properties may be understood on the basis of modified exchange interaction and anisotropy in the doped sample compared to that of pure barium hexaferrite.


    Weak-acid resin in the hydrogen form was found to effectively remove barium, radium, and hardness, without increasing the sodium content of the product water. The maximum capacity of the weak-acid resin was about 2.3 times that of strong-acid resin, and much less spent regenerant...


    This study was conducted to determine how the bioavailability of a low concentration of barium (Ba) in drinking water is affected by anion speciation. Male Sprague Dawley rats weighing 250-300 grams were maintained on a diet of less than 1 mg Ba/kg of food for at least 1 month pr...

  7. Effects of illumination on the dielectric response of barium-strontium niobate ceramics

    International Nuclear Information System (INIS)

    A study of the effects of white light on the low and infra-low frequency relaxation of polarization in the barium-strontium niobate (SBN) ceramics is reported. The light is found considerably decreasing the contribution of space charge at temperatures corresponding to the range of the relaxor phase (it is, around the Tm)

  8. A plasmonic modulator based on metal-insulator-metal waveguide with barium titanate core

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Lavrinenko, Andrei


    We design a plasmonic modulator which can be utilized as a compact active device in photonic integrated circuits. The active material, barium titanate (BaTiO3), is sandwiched between metal plates and changes its refractive index under applied voltage. Some degree of switching of ferroelectric...

  9. Barium responsiveness of the rat aorta and femoral artery during pregnancy. (United States)

    Hart, J L


    The barium responses of isolated aortic strips and femoral arteries from non-pregnant and pregnant rats were investigated. Barium caused concentration-related increases in tension of vessels from both pregnant and non-pregnant rats. The concentration-response curves of femoral arteries from non-pregnant and 3 week pregnant rats were not different; however contractility and slopes of concentration-response lines for thoracic aortas from 1, 2 and 3 week pregnant rats were significantly less than those of aortas from non-pregnant rats. In addition, barium caused rhythmic contractions to develop in both femoral arteries and aortas of 3 week pregnant rats more frequently than vessels from non-pregnant rats. Rhythmic contractions did not develop in aortas from 3 week pregnant rats in calcium-free Krebs. Since the effects of barium on the electrical and mechanical activity of various muscles have been postulated to be similar to and/or dependent on calcium, these results may indicate that changes in calcium sensitivity of vascular smooth muscle occur during pregnancy. Such changes may contribute to the blood flow redistribution and other cardiovascular adaptations of pregnancy. PMID:7054642

  10. Adsorption of Pb(II) present in aqueous solution on calcium, strontium and barium hydroxy apatites

    International Nuclear Information System (INIS)

    Calcium, strontium and barium hydroxy apatites were successfully synthesized by chemical precipitation method, the obtained powders were characterized by the techniques of X-ray diffraction (XRD), scanning electron microscopy (Sem), semi-quantitative elemental analysis (EDS), infrared spectroscopy (IR), and N2 physisorption studies, complementary to these analytical techniques, was determined the surface fractal dimension (Df), and the amount of surface active sites of the materials, in order to know application as ceramic for water remediation. The ability of Pb(II) ion adsorption present in aqueous solution on the hydroxy apatites synthesized by batch type experiments was studied as a function of contact time, concentration of the adsorbate and temperature. The maximum lead adsorption efficiencies obtained were 0.31, 0.32 and 0.26 mg/g for calcium, strontium and barium hydroxy apatites respectively, achieved an equilibrium time of 20 minutes in the three solid-liquid systems studied. Experimental data were adequately adjusted at the adsorption kinetic model pseudo-second order, for the three cases. Moreover, experimental data of the strontium and calcium hydroxy apatites were adjusted to the Langmuir adsorption isotherm, indicating that the adsorption was through a monolayer, whereas barium hydroxyapatite was adjusted to the Freundlich adsorption isotherm, indicating a multilayer adsorption. The thermodynamic parameters obtained during adsorption studies as a function of temperature showed physisorption, exothermic and spontaneous processes respectively. The results showed that the calcium hydroxyapatite, strontium and barium are an alternative for the Pb(II) ion adsorption present in wastewaters. (Author)

  11. Barium versus Nonbarium Stimuli: Differences in Taste Intensity, Chemesthesis, and Swallowing Behavior in Healthy Adult Women (United States)

    Nagy, Ahmed; Steele, Catriona M.; Pelletier, Cathy A.


    Purpose: The authors examined the impact of barium on the perceived taste intensity of 7 different liquid tastant stimuli and the modulatory effect that these differences in perceived taste intensity have on swallowing behaviors. Method: Participants were 80 healthy women, stratified by age group (60) and genetic taste status…

  12. A comparison of radiographer and radiologist reports on radiographer conducted barium enemas

    International Nuclear Information System (INIS)

    Purpose: To compare radiographer and radiologist reports on radiographer conducted barium enemas. Method: Two specially trained, experienced radiographers performed barium enemas and prepared provisional reports without consulting radiologists. Later, formal radiologist reports were issued. The reports of each were compared and correlated with clinical findings derived from case note review. Results:Seven hundred and eighty eight patients had barium enemas. Males numbered 295 (37.5%) and females 493 (62.5%). Patients ages ranged from 17 to 95 years (mean 62). The radiologist reported 244 as normal, 432 as diverticular change, 70 with polyps (31 of which had co-existent diverticular disease), 31 with carcinomas and 12 with colitis (three of which had co-existent diverticular disease). Taking the radiologist reports as gold-standard radiographer reports were concordant in 753 (95.5%). There were 35 (4.5%) discordant radiographer reports of these 19 were false-positive diagnoses of polyps and six false positive diagnoses of diverticular change. There were seven false-negative diagnoses of polyps (only one of these was found to have a polyp at follow-up endoscopy). There was one false-negative diagnosis of colitis and two false-negative reports of diverticular change. On follow up there were no false negative diagnoses of carcinoma by either radiographer or radiologist. There was one concordant false-positive diagnosis of carcinoma. Conclusion:Radiographers with specialized training can report barium enemas to a high standard

  13. The precipitation of radioactive radium-226 from acidic chloride leach liquors with barium chloride

    International Nuclear Information System (INIS)

    The conventional barium chloride (BaClsub(2)) precipitation has been effective in the 99+ percent removal of radium-226 as radium-barium sulphate [RaBa(SOsub(4))sub(2)] sludge, from HCl liquors produced by laboratory and pilot leaches of Canadian uranium ores. Radium-226, due to its low-level radiation characteristics, is removed as it has been identified as an environmental and long-term health problem. The formation of the RaBa(SOsub(4))sub(2) sludge was aided due to adequate sulphate (SOsub(4)) concentrations in the HCl pilot liquors produced. Recyclable Rasup(226) concentrations of about 66 pCi/L, in treated effluents, will cost about 1/10 that of effluents below federal environmental guidelines of 10 pCi Rasup(226)/L. Toxic barium (Ba) will potentially build up in effluents as recyclable Rasup(226) concentrations around 66 pCi/L. Barium, in addition to being added to liquors as BaClsub(2) precipitant, is present in the radioactive ore and HCl leach liquors

  14. Synthesis and characterization of barium titanate, doped with europium and neodymium

    International Nuclear Information System (INIS)

    This work aims at synthesize and characterize mixed oxides in Barium Titanium matrix in doping with Neodymium and Europium analyzing thermogravimetric curves, characteristic bands at infrared region of the polymer complex, which are intermediates to mixed oxides, and identify the formation thereof, and the crystallinity using XRD analysis

  15. Periodate salts as pyrotechnic oxidizers: development of barium- and perchlorate-free incendiary formulations. (United States)

    Moretti, Jared D; Sabatini, Jesse J; Chen, Gary


    In a flash: pyrotechnic incendiary formulations with good stabilities toward various ignition stimuli have been developed without the need for barium or perchlorate oxidizers. KIO(4) and NaIO(4) were introduced as pyrotechnic oxidizers and exhibited excellent pyrotechnic performance. The periodate salts may garner widespread use in military and civilian fireworks because of their low hygroscopicities and high chemical reactivities. PMID:22639415

  16. Structure and properties of hard-magnetic barium, strontium and lead ferrites

    International Nuclear Information System (INIS)

    Structure and properties of compact articles of magnetically hard barium, strontium and lead ferrites produced by self-propagating high-temperature synthesis (SHS) are under study. Ferrites of carious structural defect density and internal microstresses are obtained by varying ferritizing (burning) temperature and comminution time. It is states that powder activity has a favourable effect on electromagnetic and mechanical properties of ferrites

  17. Low temperature phase barium borate: A new optical limiter in continuous wave and nano pulsed regime (United States)

    Babeela, C.; Girisun, T. C. Sabari


    Low temperature phase barium borate was synthesized by hydrothermal method. XRD analysis confirms the formation of γ-BBO or hydrated barium polyborate (Ba3B6O9(OH)6) which crystallizes in monoclinic system in the P2/c space group. The molecular structure analysis shows the presence of dominant BO4 unit and the hydrated nature of material. γ-BBO exhibits sharp absorption edge at 202 nm and highly transparency in the UV-Visible-NIR region. The peak at 347 nm in the emission spectrum is due to the presence of self-trapped exciton. The third order nonlinear optical properties and limiting behavior of low temperature barium borate in both pulsed and continuous wave regime were studied. The effective 2PA absorption coefficient of γ-BBO under ns pulse excitation is estimated to be 0.38 × 10-10 m/W. The nonlinear absorption coefficient, refractive index and optical susceptibility of the material in cw regime were found to be in the order of 10-5 m W-1, 10-12 m2 W-1, 10-6 esu respectively. In both regimes, low temperature phase barium borate exhibits better optical limiting properties than high temperature phase β-BBO.

  18. Barium borosilicate glass as a matrix for the uptake of dyes

    International Nuclear Information System (INIS)

    Barium borosilicate (BBS) and sodium borosilicate (SBS) glass samples, prepared by the conventional melt-quench method, were used for the uptake of Rhodamine 6G dye from aqueous solution. The experimental conditions were optimized to get maximum uptake and was found to be 0.4 mg of dye per gram of BBS glass sample. For the same network former to modifier ratio, barium borosilicate glasses are found to have improved extent of uptake for the dye molecules from aqueous solutions compared to sodium borosilicate glasses. Based on 29Si MAS NMR studies on these glasses, it is inferred that significantly higher number of non-bridging oxygen atoms present in barium borosilicate glasses compared to sodium borosilicate glasses is responsible for its improved uptake of Rhodamine 6G dye. 11B MAS NMR studies have confirmed the simultaneous existence of boron in BO3 and BO4 configurations in both barium borosilicate and sodium borosilicate glasses. The luminescence studies have established that the dye molecule is incorporated into the glass matrix through ion exchange mechanism by replacing the exchangeable ions like Na+/Ba2+ attached with the non-bridging oxygen atoms present in the glass.

  19. Esophageal Transit Scintigraphy, Manometry, and Barium Swallow in Assessment of Response to Balloon Dilatation in Achalasia

    Directory of Open Access Journals (Sweden)

    M.J. Ehsani Ardakani


    Full Text Available Background/Objective: Achalasia is a motility disorder of unknown etiology, characterized by absent esophageal peristalsis and loss of lower esophageal sphincter relaxation. Balloon dilatation is the most effective non-surgical treatment for patients with achalasia. Manometry, scintigraphy and radiology are three techniques that provide an objective measure of success after balloon dilatation. The objective of this study was to determine the best predictor of success after balloon dilatation in patients with achalasia. Patients and Methods: 17 patients with achalasia of cardia who referred to Taleghani Hospital in 2003, were evaluated, both symptomatically and objectively (esophageal manometry, timed barium esophagogram, and scintigraphic emptying index, before and after treating with pneumatic dilatation of esophagus. The degree of patient symptom improvements after treat-ment was recorded and correlated with improvement in some indices derived by the above-mentioned three methods. Results: 12 (70.6% of 17 patients had score improvements of ≥80%. All the pre-treatment diagnostic indices were significantly (P<0.05 different from those after therapy. There was no significant difference between the two groups in terms of improvement in symptoms according to the indices of barium swallow or scintigraphy. No association between the patient symptom scores and improvement in either the barium height or emptying index was found. Conclusion: In evaluation of efficacy of pneumatic dilatation of esophagus for treatment of achalasia, we should not only rely on transit or barium study.

  20. Physical and biological dosimetry at the barium sulphate-culture medium interface

    International Nuclear Information System (INIS)

    The present study suggests that a thin layer of Barium sulphate suspension forms an interface with tissues which results in high dose regions on both sides of the BSS-tissue interface when irradiated with 250 kVp X rays. The magnitude of dose increase depends on the density of the BSS. (U.K.)

  1. Assessment of barium sulphate formation and inhibition at surfaces with synchrotron X-ray diffraction (SXRD)

    International Nuclear Information System (INIS)

    The precipitation of barium sulphate from aqueous supersaturated solutions is a well-known problem in the oil industry often referred to as 'scaling'. The formation and growth of barite on surfaces during the oil extraction process can result in malfunctions within the oil facilities and serious damage to the equipment. The formation of barium sulphate at surfaces remains an important topic of research with the focus being on understanding the mechanisms of formation and means of control. In situ synchrotron X-ray diffraction (SXRD) was used to investigate the formation of barium sulphate on a stainless steel surface. The effect of Poly-phosphinocarboxylic acid (PPCA) and Diethylenetriamine-penta-methylenephosphonic acid (DETPMP) which are two commercial inhibitors for barium sulphate was examined. The in situ SXRD measurements allowed the identification of the crystal faces of the deposited barite in the absence and presence of the two inhibitors. The preferential effect of the inhibitors on some crystal planes is reported and the practical significance discussed.

  2. Performance of cement solidification with barium for high activity liquid waste including sulphate

    International Nuclear Information System (INIS)

    The target liquid waste to be solidified is generated from PWR primary loop spent resin treatment with sulphate acid, so, its main constituent is sodium sulphate and the activity of this liquid is relatively high. Waste form of this liquid waste is considered to be a candidate for the subsurface disposal. The disposed waste including sulphate is anticipated to rise a concentration of sulphate ion in the ground water around the disposal facility and it may cause degradation of materials such as cement and bentonite layer and comprise the disposal facility. There could be two approaches to avoid this problem, the strong design of the disposal facility and the minimization of sulphaste ion migration from the solidified waste. In this study, the latter approach was examined. In order to keep the low concentration of sulphate ion in the ground water, it is effective to make barium sulphate by adding barium compound into the liquid waste in solidification. However, adding equivalent amount of barium compound with sulphate ion causes difficulty of mixing, because production of barium sulphate causes high viscosity. In this study, mixing condition after and before adding cement into the liquid waste was estimated. The mixing condition was set with consideration to keep anion concentration low in the ground water and of mixing easily enough in practical operation. Long term leaching behavior of the simulated solidified waste was also analyzed by PHREEQC. And the concentration of the constitution affected to the disposal facility was estimated be low enough in the ground water. (author)

  3. Possible discovery of the r-process characteristics in the abundances of metal-rich barium stars

    CERN Document Server

    Cui, W Y; Shi, J R; Zhao, G; Wang, W J; Niu, P


    We study the abundance distributions of a sample of metal-rich barium stars provided by Pereira et al. (2011) to investigate the s- and r-process nucleosynthesis in the metal-rich environment. We compared the theoretical results predicted by a parametric model with the observed abundances of the metal-rich barium stars. We found that six barium stars have a significant r-process characteristic, and we divided the barium stars into two groups: the r-rich barium stars ($C_r>5.0$, [La/Nd]\\,$<0$) and normal barium stars. The behavior of the r-rich barium stars seems more like that of the metal-poor r-rich and CEMP-r/s stars. We suggest that the most possible formation mechanism for these stars is the s-process pollution, although their abundance patterns can be fitted very well when the pre-enrichment hypothesis is included. The fact that we can not explain them well using the s-process nucleosynthesis alone may be due to our incomplete knowledge on the production of Nd, Eu, and other relevant elements by the ...

  4. Fabrication and electrical characterization of 15% yttrium-doped barium zirconate-nitrate freeze drying method combined with vacuum heating

    International Nuclear Information System (INIS)

    Research highlights: → Very fine 15% yttrium-doped barium zirconate powder of particle size about 30 nm was obtained by synthesizing at 500 deg. C in vacuum from powder mixed by the nitrate freeze-drying method. → Large and homogeneous grains of 15% yttrium-doped barium zirconate were easily obtained using the synthesized powder. → Grain boundary resistance was not inversely proportional to the grain size as theoretically expected. → Specific grain boundary conductivity varies with samples because impurities and/or evaporation loss of barium oxide might affect the grain-boundary resistance in 15% yttrium-doped barium zirconate. - Abstract: We applied a nitrate freeze-drying method to obtain a fine synthesized powder of 15% yttrium-doped barium zirconate. Fine 15% yttrium-doped barium zirconate powder of particle size about 30 nm was obtained by synthesizing at 500 deg. C in vacuum from a powder mixed by the nitrate freeze-drying method. However, we could not obtain such fine powder by synthesizing in air. Using the powder synthesized in vacuum, large and homogeneous grains of 15% yttrium-doped barium zirconate were easily obtained after sintering. Then, the bulk and grain boundary resistance were evaluated by AC 2-terminal measurement of sample in the form of bar and pellet and DC 4-terminal measurement of bar-shape sample. The grain boundary resistance was not inversely proportional to the grain size as theoretically expected. We concluded that specific grain boundary conductivity varies with samples. Some impurities, evaporation loss of barium oxide and/or other unexpected reasons might affect the grain boundary resistance in 15% yttrium-doped barium zirconate.

  5. A study of the microchemistry of nanocrystalline barium titanate with tetragonal and pseudocubic room temperature symmetries (United States)

    Lacey, Robert A.

    The investigation of possible effects of undesired surface species on barium titanate, one of the most utilized ferroelectric ceramics, constitutes the focus of this work. Six commercial barium titanate powders from three manufacturers representing two different synthesis processes, with average particle sizes from 40 nm to 470 nm, were analyzed in this study. Four of the nanopowders exhibited pseudocubic room temperature symmetry. Diffuse Reflectance Infrared Fourier Transform (DRIFT) spectroscopic analysis of the nanopowders was conducted in ambient atmosphere at room temperature. High temperature DRIFT followed incorporating four avenues of analysis: moisture adsorption studies, deuterium oxide exchange studies, carbon dioxide adsorption studies, and high temperature analysis under dry air and UHP nitrogen atmospheres. At the highest temperature used in this study, 1173K, moisture and the accompanying incorporated protonic impurities were still present. The powders readily readsorbed moisture during rapid cooling, 170K/minute, to room temperature. The smallest powder, as received, formed spherical agglomerates up to 10 mum diameter. These sintered as separate units attaining diameters up to 60 mum during intermediate stage sintering. X-ray photoelectron spectroscopy indicated a surface contamination layer of 10 A to 18 A; 50--70% of which was barium carbonate, the balance being atmospheric adsorbed species. Samples cooled at 3K/minute after an 1173K calcine retained cubic symmetry as indicated with high temperature X-ray diffraction. However, spectral evidence was obtained indicating that upon the rapid cooling from the 1173K calcine, a reorientation to the room temperature tetragonal symmetry was observed. Further, SEM and TEM supported this finding with visual evidence of interfacial rearrangement including corroborating electron diffraction analysis. This data, therefore, substantiated the hypothesis that the cause of the room temperature pseudocubic

  6. Influence of barium substitution on bioactivity, thermal and physico-mechanical properties of bioactive glass

    Energy Technology Data Exchange (ETDEWEB)

    Arepalli, Sampath Kumar, E-mail:; Tripathi, Himanshu; Vyas, Vikash Kumar; Jain, Shubham; Suman, Shyam Kumar; Pyare, Ram; Singh, S.P., E-mail:


    Barium with low concentration in the glasses acts as a muscle stimulant and is found in human teeth. We have made a primary study by substituting barium in the bioactive glass. The chemical composition containing (46.1 − X) SiO{sub 2−}–24.3 Na{sub 2}O–26.9 CaO–2.6 P{sub 2}O{sub 5}, where X = 0, 0.4, 0.8, 1.2 and 1.6 mol% of BaO was chosen and melted in an electric furnace at 1400 ± 5 °C. The glasses were characterized to determine their use in biomedical applications. The nucleation and crystallization regimes were determined by DTA and the controlled crystallization was carried out by suitable heat treatment. The crystalline phase formed was identified by using XRD technique. Bioactivity of these glasses was assessed by immersion in simulated body fluid (SBF) for various time periods. The formation of hydroxy carbonate apatite (HCA) layer was identified by FTIR spectrometry, scanning electron microscope (SEM) and XRD which showed the presence of HCA as the main phase in all tested bioactive glass samples. Flexural strength and densities of bioactive glasses have been measured and found to increase with increasing the barium content. The human blood compatibility of the samples was evaluated and found to be pertinent. - Highlights: • In vitro bioactivity of soda-lime–baria-phospho-silicate glass was investigated. • HCA formed on surface of glasses was confirmed by XRD, SEM and FTIR spectrometry. • Mechanical properties of glasses were found to increase with barium addition. • Hemolysis showed that 1.2 mol% BaO bioactive glass exhibited better biocompatibility. • Barium substituted bioactive glasses can be used as bone implants.

  7. Influence of barium substitution on bioactivity, thermal and physico-mechanical properties of bioactive glass

    International Nuclear Information System (INIS)

    Barium with low concentration in the glasses acts as a muscle stimulant and is found in human teeth. We have made a primary study by substituting barium in the bioactive glass. The chemical composition containing (46.1 − X) SiO2−–24.3 Na2O–26.9 CaO–2.6 P2O5, where X = 0, 0.4, 0.8, 1.2 and 1.6 mol% of BaO was chosen and melted in an electric furnace at 1400 ± 5 °C. The glasses were characterized to determine their use in biomedical applications. The nucleation and crystallization regimes were determined by DTA and the controlled crystallization was carried out by suitable heat treatment. The crystalline phase formed was identified by using XRD technique. Bioactivity of these glasses was assessed by immersion in simulated body fluid (SBF) for various time periods. The formation of hydroxy carbonate apatite (HCA) layer was identified by FTIR spectrometry, scanning electron microscope (SEM) and XRD which showed the presence of HCA as the main phase in all tested bioactive glass samples. Flexural strength and densities of bioactive glasses have been measured and found to increase with increasing the barium content. The human blood compatibility of the samples was evaluated and found to be pertinent. - Highlights: • In vitro bioactivity of soda-lime–baria-phospho-silicate glass was investigated. • HCA formed on surface of glasses was confirmed by XRD, SEM and FTIR spectrometry. • Mechanical properties of glasses were found to increase with barium addition. • Hemolysis showed that 1.2 mol% BaO bioactive glass exhibited better biocompatibility. • Barium substituted bioactive glasses can be used as bone implants

  8. AFM studies of swift heavy ion and electron irradiated mixed barium strontium borate nonlinear optical crystal

    International Nuclear Information System (INIS)

    Single crystals of novel nonlinear optical material of mixed barium strontium borate is grown in our laboratory by employing the low-temperature solution technique. Equal proportion (1:1 molar ratio) of AR grade barium borate and strontium borate are mixed together in double distilled water to prepare a supersaturated solution. The solution is allowed to evaporate at constant temperature (30 deg. C) in a Petri dish for about a week which resulted in the formation of seed crystals. These seed crystals are used to grow larger crystals by suspending them using fine silk thread in the supersaturated mother solution. The solution is allowed to evaporate at constant temperature. This resulted in the growth of good transparent crystals of dimension 15 mmx10 mmx1 mm after about one month. These crystals show good second harmonic generation (SHG) efficiency. The mixed barium strontium borate crystal is found to be a promising nonlinear optical crystal, which possibly can be used for fabrication of photonic devices. The single crystals of mixed barium strontium borate are irradiated by 120 MeV Ag+13 swift heavy ions (SHI) of fluence 5x1011 ions/cm2 at Nuclear Science Centre, New Delhi and also by electrons of 8 MeV energy with a fluence 5.7x109/cm2 using Microtron accelerator at Mangalore University. Surface morphology studies of these crystals are carried out using atomic force microscope. The AFM topographical images of these SHI/electron irradiated single crystals of mixed barium strontium borate are obtained from different frames of the sample taken at different magnifications using atomic force microscope. An attempt is made to explain the surface damage caused due to SHI/electron irradiation using the observed AFM images

  9. Lattice dynamic studies from {sup 151}Eu-Moessbauer spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Katada, Motomi [Tokyo Metropolitan Univ., Hachioji (Japan). Faculty of Science


    New complexes {l_brace}(Eu(napy){sub 2}(H{sub 2}O){sub 3})(Fe(CN){sub 6})4H{sub 2}O{r_brace}{sub x}, bpy({l_brace}(Eu(bpy)(H{sub 2}O){sub 4})(Fe(CN){sub 6})1.5bpy4H{sub 2}O{r_brace}{sub x}) and ({l_brace}(Eu(phen){sub 2}(H{sub 2}O){sub 2})(Fe(CN){sub 6})2phen{r_brace}{sub x}) etc were synthesized using phenanthroline and bipyridine. Lattice dynamic behaviors of Eu and Fe atom in the complexes were investigated by Moessbauer spectroscopy. By {sup 151}Eu-Moessbauer spectrum and parameters of new complexes, bpy complex showed the largest quadrupole splitting value, indicating bad symmetry of Eu ligand in the environment. Molecular structure of napy, bpy and phen complex were shown. These complexes are consisted of Eu atom coordinated with ligand and water molecule, of which (Fe(CN){sub 6}){sup 3-} ion formed one dimentional polymer chain and naphthyridines formed stacking structure. New complexes were observed by {sup 57}Fe-Moessbauer spectroscopy, too. The quadrupole splitting values were very different each other, indicating change of symmetry of Fe atom in the environment and three valence low spin state of Fe in the complex. (S.Y.)

  10. CD151 gene delivery increases eNOS activity and induces ECV304 migration, proliferation and tube formation

    Institute of Scientific and Technical Information of China (English)

    Zhen-zhong ZHENO; Zheng-xiang LIU


    Aim: To investigate the effects of CD151 on the activity of endothelial NO syn-thase (eNOS), and ECV304 migration, proliferation and tube formation. Methods:pAAV-CD151 and pAAV-anti-CD151 were constructed and used to transiently transfect ECV304 mediated with Lipofectamine 2000. After transfection, the ex-pression of CD151 was measured by Western blotting. Cell migration assay was performed using Boyden transwell; proliferation assay was evaluated using the 3-[4,5-dimethylthiazol-2-yl]-2,5, diphenyltetrazolium bromide (MTT) method, and tube formation test was examined on matrigel, eNOS activity was assayed by L-[3H]citrulline production from L-[3H]arginine. The involvement of eNOS was ex-plored using an eNOS inhibitor (L-NAME) and the effects in the process were observed. Results: CD151 promotes cell migration, proliferation and tube formation.In addition, CD151 increases eNOS activity. Moreover, cell migration, prolifera-tion and tube formation induced by CD151 are inhibited when L-NAME is used,which indicates that there is an involvement of eNOS in CD151-induced cell migration, cell proliferation and tube formation. Conclusion: CD151 promotes ECV304 migration, proliferation and tube formation. The mechanism is that CD151 increases eNOS activity. This result also suggests that eNOS is involved in the angiogenic effects of CD151.

  11. CT colonography: optimisation, diagnostic performance and patient acceptability of reduced-laxative regimens using barium-based faecal tagging


    Stuart A Taylor; Slater, Andrew; Burling, David N.; Tam, Emily; Greenhalgh, Rebecca; Gartner, Louise; Scarth, Julia; Pearce, Robert; Bassett, Paul; Halligan, Steve


    To establish the optimum barium-based reduced-laxative tagging regimen prior to CT colonography (CTC). Ninety-five subjects underwent reduced-laxative (13 g senna/18 g magnesium citrate) CTC prior to same-day colonoscopy and were randomised to one of four tagging regimens using 20 ml 40%w/v barium sulphate: regimen A: four doses, B: three doses, C: three doses plus 220 ml 2.1% barium sulphate, or D: three doses plus 15 ml diatriazoate megluamine. Patient experience was assessed immediately af...

  12. CD151 promotes proliferation of and eNOS expression in human umbilical endothelial cell%CD151蛋白促内皮细胞增殖和eNOS蛋白表达

    Institute of Scientific and Technical Information of China (English)

    彭丹; 左后娟; 秦瑾; 刘正湘; 汪道文


    目的 研究CD151及其突变体CD151-ARSA245-248对人脐静脉内皮细胞(HUVEC)增殖及eNOS 表达的影响,探讨CD151促血管生成的机制.方法 构建pAAV-CD151及其突变体CD151-ARSA245-248(囊泡运输缺陷突变体),并转染HUVEC.CCK-8法测定HUVEC增殖的能力,Western Blot检测CD151及eNOS蛋白的表达.结果 pAAV-CD151组及pAAV- CD151-ARSA245-248组CD151蛋白表达均增加,显著高于正常对照组和pAAV-GFP组(P<0.05),但pAAV-CD151组及pAAV- CD151-ARSA245-248组之间CD151蛋白表达没有统计学意义(P>0.05).CCK-8法测定HUVEC增殖能力亦无统计学意义(P>0.05).正常对照组,pAAV-GFP组,pAAV-CD151组及pAAV-CD151-ARSA245-248突变体组的OD值分别为1.393±1.68、1.498±1.746、2.346±2.52和1.71±1.863,pAAV-CD151组较pAAV-GFP组和正常对照组细胞增殖能力明显增强(P<0.01),pAAV-CD151 -ARSA245-248组较pAAV-CD151组细胞增殖能力减弱(P<0.05).此外,pAAV-CD151组eNOS蛋白表达较pAAV-GFP组和正常对照组明显增加(P<0.01),pAAV-CD151 -ARSA245-248组较pAAV-CD151组eNOS蛋白表达降低(P<0.05).结论 CD151是促细胞增殖的重要蛋白质,CD151影响eNOS信号通路的激活.上述机制可能为CD151促血管生成的重要机制之一.%Objective To investigate the effect of CD151 and CD151- ARSA245-248 mutant on the proliferation of human umbilical vein endothelial cells (HUVEC) and eNOS phosphorylation. Methods We constructed pAAV-CD151 and pAAV-CD151 pAAV_CD151_ARSA245-248 mutant, and transfected HUVECs mediated with Fugene HD. After transfection, the expressions of CD 151 , eNOS and phospho-eNOS were measured by western blot. Proliferation of HUVECs was measured by Cell Counting Kit-8 assay. Results The expression of CD151 protein in pAAV-CD151, pAAV_CD151_ARSAp245-248 groups were significantly higher than in the control group and pAAV-GFP group (P<0. 05). The OD values in control, pAAV-GFP, pAAV-CD151, pAAV-CD151-ARSA245-248 groups were 1. 393 ±1. 685 , 1. 498

  13. Project W-151 Tank 101-AZ Waste Retrieval System Year 2000 Compliance Assessment Project Plan

    International Nuclear Information System (INIS)

    This document contains a limited assessment of Year 2000 compliance for Project W-151. Additional information is provided as a road map to project documents and other references that may be used to verify Year 2000 compliance

  14. Refined exposure assessment for Brilliant Black BN (E 151

    Directory of Open Access Journals (Sweden)

    European Food Safety Authority


    Full Text Available The European Food Safety Authority (EFSA carried out an exposure assessment of Brilliant Black BN (E 151, taking into account new information on its use as a food additive in foods. In 2010, the EFSA Panel on Food Additives and Nutrient Sources added to Food (ANS adopted a scientific opinion on the re-evaluation of Brilliant Black BN and concluded that dietary exposure in 1- to 10-year-old children at the high level may exceed the Acceptable Daily Intake (ADI for Brilliant Black BN of 5 mg/kg body weight (bw/day at the upper end of the range. Following this conclusion, the European Commission requested that EFSA performs a refined exposure assessment for this food colour. Data on the presence of Brilliant Black BN in foods were requested from relevant stakeholders through a call for usage and concentration data. Usage levels were provided to EFSA for 11 out of 37 food categories in which Brilliant Black is authorised. In addition, 4 337 analytical results were also reported to EFSA, with the majority of values being below the limit of detection (LOD or limit of quantification (LOQ. Exposure assessment was performed using the EFSA Comprehensive Food Consumption Database. Three scenarios were considered: (1 exposure estimates based on Maximum Permitted Levels (MPLs, (2 a refined brand-loyal exposure scenario, and (3 a refined non-brand-loyal exposure scenario. Considering the first scenario, high exposure levels (95th percentile exceeded the ADI for toddlers and children in four dietary surveys. In comparison with the previous assessment, for both children and adults, the current mean exposure estimates are of the same order of magnitude, whereas the 95th percentile exposure is lower, particularly in adults. The mean and high-level exposure estimates of Brilliant Black BN are below the ADI for all population groups when considering the refined scenarios (brand-loyal and non-brand-loyal.

  15. Revaluation on detection of metastatic cancer of the colorectum with barium enema. Comparison with computed tomography and colonoscopy

    International Nuclear Information System (INIS)

    The findings with barium enema were analyzed and compared to those with computed tomography and colonoscopy in 15 patients with metastatic cancer of the colorectum, which were from 8 gastric, 2 colonic, 2 ovarian, 1 pancreatic, 1 prostatic carcinomas and 1 unknown origin. Primary cancers of intra-abdominal cavity origin tended to make multiple colorectal metastases (91.7%). With barium enema colonic and rectal involvement was mostly expressed as the tethered type and the diffuse type by Ishikawa's classification, respectively. Computed tomography detected direct tumor invasion to the colorectum in 4 cases. Of the other 11 cases, 8 patients (72.3%) showed abnormally thickened colorectal wall. Colonoscopy detected only 3 (37.5%) out of 8 lesions seen in 4 patients who had undergone colonoscopy before barium enema. Many of the lesions missed were the tethered type involvement. Barium enema is the most sensitive method to detect metastatic cancer of the colorectum. (author)

  16. Spherical barium ferrite nanoparticles and hexaferrite single crystals for information data storage and RF devices (United States)

    Jalli, Jeevan Prasad

    Since their discovery in the early 1950's hexagonal ferrites or hexaferrites have been studied for a long time because of their technological applications, such as microwave devices and high density magnetic recording media. In this dissertation efforts have been made to address these two applications by developing nanosized spherical barium ferrite particles for advanced magnetic recording media, and hexaferrite single crystals for low loss RF devices. Accordingly, this dissertation consists of two parts; part one spherical barium ferrite nanoparticles for information data storage media, and part two hexaferrite single crystals for RF devices. Part I. Spherical Barium Ferrite Nanoparticles Hexagonal barium ferrite (H-BaFe) nanoparticles are good candidates for particulate recording media due to their high uniaxial magnetocrystalline anisotropy, excellent chemical stability, and narrow switching field distribution. One major disadvantage of using H-BaFe particles for particulate recording media is their poor dispersion and a high degree of stacking that deteriorate the recording capability by creating large media noise and surface roughness. One way to solve and improve the recording performance of H-BaFe media is employing substantially nanosized spherical barium ferrite (S­BaFe) particles. Spherical shaped particles have low aspect ratio and only form a point-to-point contact, unlike the H-BaFe particles. Therefore, using S-BaFe particles not only decrease the degree of magnetic interaction between the particles but also can substantially increases the recording performance by improving the dispersion and SNR of the particles in the magnetic media. In this dissertation, two different approaches were employed successfully to synthesize S-BaFe nanoparticles in the range of 20-45 nm. Part II. Hexaferrite Single Crystals As wireless communication systems are flourishing, and the operating frequencies are increasing, there is a great demand for RF devices such as

  17. Enhanced sintering and conductivity study of cobalt or nickel doped solid solution of barium cerate and zirconate

    DEFF Research Database (Denmark)

    Ricote, Sandrine; Bonanos, Nikolaos

    atmospheres and compared to the undoped compounds. The ionic and p-type conductivities have been determined, as well as the activation energy in wet reducing atmospheres, in which protonic conduction is dominant. A decrease of the ionic conductivity is noticeable for the cobalt or nickel doped barium...... zirconate (x = 0), while not for cobalt or nickel solid solution of barium cerate and zirconate (x = 0.2)....

  18. Intra-individual comparison of patient acceptability of multidetector-row CT colonography and double-contrast barium enema

    International Nuclear Information System (INIS)

    AIMS: To compare the subjective acceptability of CT colonography in comparison with barium enema in older symptomatic patients, and to ascertain preferences for future colonic investigation. MATERIALS AND METHODS: The study population comprised 78 persons aged 60 years or over with symptoms suggestive of colorectal neoplasia, who underwent CT colonography followed the same day by barium enema. A 25-point questionnaire was administered after each procedure and an additional follow-up questionnaire a week later. Responses were compared using Wilcoxon matched pairs testing, Mann-Whitney test statistics and binomial exact testing. RESULTS: Participants suffered less physical discomfort during CT colonography (p=0.03) and overall satisfaction was greater compared with barium enema (p=0.03). On follow-up, respondents reported significantly better tolerance of CT colonography (p=0.002), and were less prepared to undergo barium enema again (p<0.001). Of 52 subjects expressing an opinion, all preferred CT to barium enema. CONCLUSION: Patient satisfaction was higher with CT colonography than barium enema. CT colonography caused significantly less physical discomfort and was overwhelmingly preferred by patients

  19. Site-selective spectroscopy of the solid-state defect chemistry in erbium-doped barium titanate. (United States)

    Bak, John D; Wright, John C


    Erbium-doped barium titanate crystals were studied by laser-induced fluorescence spectroscopy. Thirteen spectroscopically distinct erbium ion sites were found. The relative concentrations of the different sites changed as a function of the crystal and its preparation and treatment. One major site was present in all crystals. The site distribution was changed either by growing codoped crystals with donor (La3+) and acceptor (Sc3+) ions or by changing the temperature and partial pressure of the oxygen in the annealing atmosphere. Equilibrium calculations were done to simulate the defect distributions that result from the charge compensation of the erbium ions. Comparison with the observed dependence of the site spectral intensities indicated that the erbium enters the lattice on barium sites. We assigned the dominant site to an erbium ion on a barium site that is locally compensated by a barium vacancy, whereas the other lower-intensity sites corresponded to erbium ions that are locally compensated by an electron and a more complex center of an erbium, a barium vacancy, and a hole. The spectra of one sample showed that its defects were different and were characteristic of a sample that had not equilibrated. The new sites in this sample were assigned to erbium entering the lattice on a titanium site, which was then locally compensated by an oxygen vacancy or a hole. Heating equilibrated the sample and changed the erbium to a barium site. PMID:16853368

  20. Single-step synthesis of well-crystallized and pure barium titanate nanoparticles in supercritical fluids (United States)

    Reverón, Helen; Aymonier, Cyril; Loppinet-Serani, Anne; Elissalde, Catherine; Maglione, Mario; Cansell, François


    Single-step synthesis of ultra-fine barium titanate powder with a crystallinity as high as 90% and without barium carbonate contamination has been successfully performed under supercritical conditions using a continuous-flow reactor in the temperature range 150-380 °C at 16 MPa. To synthesize this bimetallic oxide, alkoxides, ethanol and water were used. The influence of the synthesis parameters on the BaTiO3 powder characteristics was investigated. The results show that the water to alkoxide precursor ratio, the reactor temperature and the Ba:Ti molar ratio of alkoxide precursor play a major role in the crystallization of pure and well-crystallized BaTiO3 nanoparticles. The continuous mode of operation without post-treatments for powder washing, drying or crystallization increase the industrial interest.

  1. Barium hexaferrite/graphene oxide: controlled synthesis and characterization and investigation of its magnetic properties (United States)

    Maddahfar, Mahnaz; Ramezani, Majid; Mostafa Hosseinpour-Mashkani, S.


    In the present study, barium hexaferrite nanocrystals (BaFe12O19) were successfully synthesized through the two-step sol-gel method in an aqueous solution in the presence of barium nitrate and iron (III) nitrate. Besides, the effect of the molar ratio of graphene oxide on the particle size and magnetic properties of final product was investigated. In this research, glucose plays a role as capping and chelating agent in the synthesis of BaFe12O19/graphene oxide. Moreover, it was found that the size, morphology, and magnetic properties of the final products could be greatly influenced by the molar ratio of graphene oxide. BaFe12O19/graphene oxide was characterized by using X-ray diffraction, scanning electron microscope, Fourier transform infrared spectroscopy, vibrating sample magnetometer, and energy-dispersive spectrometry.

  2. The evaporation residue in the fission state of Barium nuclei within relativistic mean-field theory

    CERN Document Server

    Bhuyan, M; Gupta, Raj K


    The evaporation residue of Barium isotopes are investigated in a microscopic study using relativistic mean field theory. The investigation includes the isotopes of Barium from the valley of stability to exotic proton-rich region. The ground as well as neck configurations for these nuclei are generated from their total nucleonic density distributions of the corresponding state. We have estimated the constituents (number of nucleons) in the elongated neck region of the fission state. We found the $\\alpha$-particle as the constituent of neck of Ba-isotopes, referred to as the evaporated residue in heavy-ion reaction studies. A strong correlation between the neutron and proton is observed throughout the isotopic chain.

  3. Ammonia synthesis with barium-promoted iron–cobalt alloys supported on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus; Chorkendorff, Ib; Jacobsen, Claus J.H.; Teunissen, Herman T.


    Iron–cobalt alloys supported on carbon were investigated as ammonia synthesis catalysts. Barium was found to have a promoting effect for Fe with an optimum atomic ratio Ba/Fe of 0.35. At this Ba loading, a local maximum for the NH3 synthesis activity was found at 4 wt% Co by varying the Fe/Co ratio....... Samples containing only Co and no Fe, however, yielded by far the most active catalysts (7.0 μmol (NH3) g−1 s−1, 673 K, 10 bar). Barium was a very efficient promoter for Co, increasing the NH3 synthesis activity by more than two orders of magnitude compared to the unpromoted Co samples, while it was not...

  4. Effect of Mg–Zr substitution and microwave processing on magnetic properties of barium hexaferrite

    International Nuclear Information System (INIS)

    The effect of substitution of Mg–Zr for Fe in M-type barium hexaferrite (BHF) and of processing technique on the magnetic properties and microstructure has been reported in the present paper. Significant changes in magnetic properties have been observed on substituting Fe ions by Mg and Zr ions in M-type barium hexaferrite, i.e. BaFe12O19 as well as by single mode microwave processing. The single mode microwave processing of the undoped sample reduced the coercivity to nearly 25% of the value for the sintered sample along with the enhancement in magnetization, thereby making it suitable for memory devices. The improvement in magnetic properties is explained on the basis of microstructure. The addition of substituents, though assisted in the formation of single phase, it, however, degraded the magnetization besides decreasing the coercivity, possibly due to substitution at the octahedral sites

  5. Study on the preparation and formation mechanism of barium sulphate nanoparticles modified by different organic acids

    Indian Academy of Sciences (India)

    Yuhua Shen; Chuanhao Li; Xuemei Zhu; Anjian Xie; Lingguang Qiu; Jinmiao Zhu


    This paper reports a simple method to prepare barium sulphate nanoparticles by use of tetradecanoic acid, hexadecanoic acid and stearic acid as modifier. The barium sulphate nanoparticles obtained are characterized by using Fourier transform infra-red spectroscopy (FT-IR), powder X-ray diffraction (XRD), transmission electron microscopy (TEM), dynamic laser light scatter (DLLS) and thermogravimetric analysis (TGA), respectively. The results show that the BaSO4 particles are all spherical and in the nano-scale. Our method has a better dispersion and controllable diameter dependent on the length of the chain of organic acid and the pH value of the system. A possible mechanism is also discussed.

  6. The CAMEO barium release - E/parallel/ fields over the polar cap (United States)

    Heppner, J. P.; Miller, M. L.; Pongratz, M. B.; Smith, G. M.; Smith, L. L.; Mende, S. B.; Nath, N. R.


    Four successive thermite barium releases at an altitude of 965 km over polar cap invariant latitudes 84 to 76 deg near magnetic midnight were conducted from the orbiting second stage of the vehicle that launched Nimbus 7; the releases were made as part of the CAMEO (Chemically Active Material Ejected in Orbit) program. This was the first opportunity to observe the behavior of conventional barium release when conducted at orbital velocity in the near-earth magnetic field. The principal unexpected characteristic in the release dynamics was the high, 1.4 to 2.6 km/s, initial Ba(+) expansion velocity relative to an expected velocity of 0.9 km/s. Attention is also given to neutral cloud expansion, initial ion cloud expansion, convective motion, and the characteristics of field-aligned motion. The possibility of measuring parallel electric fields over the polar cap by observing perturbations in the motion of the visible ions is assessed.

  7. Removal of hexavalent chromium from aqueous solution by barium ion cross-linked alginate beads

    Directory of Open Access Journals (Sweden)

    Uzaşçı Sesil


    Full Text Available Barium ion cross-linked alginate beads have shown great affinity to toxic hexavalent chromium ions in aqueous solution, contrary to the traditional calcium alginate beads. The adsorption experiments were carried out by the batch contact method. The optimal pH for removal was found to be pH 4. The equilibrium was established in 4 h and the removal efficiency of chromium (VI was found as 95%. The adsorption data fit well with Langmuir and Freundlich isotherms. The maximum chromium (VI adsorption capacity determined from Langmuir isotherm was 36.5 mg/g dry alginate beads. Our study suggests that barium alginate beads can be used as cost-effective and efficient adsorbents for the removal of chromium (VI from contaminated waters.

  8. Barium enema carried out by digital luminescent radiography (DLR) and conventional screen-film system combinations

    International Nuclear Information System (INIS)

    120 double-contrast barium enemas were obtained by both digital luminescent radiography (DLR) and conventional screen-film systems, the digital exposure dose being 50% of the conventional one. In DLR two differently post processed images were obtained from one X-ray exposure: a display with low spatial frequency enhancement was processed to look like a conventional radiograph and was complemented by a display with high spatial frequency enhancement. Analysing the results statistically DLR proved to be diagnostically equivalent to conventional radiography despite the reduction in exposure dose and a slightly diminished image quality. High spatial frequency enhancement did not provide further diagnostic information and is therefore superfluous in barium enemas. (orig.)

  9. Elastic properties investigation of gamma-radiated barium lead borosilicate glass using ultrasonic technique

    International Nuclear Information System (INIS)

    Highlights: → Change in acoustical parameter due to composition effect and irradiation effect. → Changes in the structure of the glass (BO3 → BO4) due to the effect of radiation. → Structural changes in the BO3 to BO4 have a more compactness structure. - Abstract: The ultrasonic velocities were measured in barium lead borosilicate glass samples of different compositions before and after irradiation with γ-rays. Measurements were carried out at room temperature and 4 MHz frequency using ultrasonic technique. The ultrasonic velocities data of glass samples have been used to find the elastic modulus and micro-hardness. Densities of glass samples were measured by Archimedes's principle using n-hexane as immersion liquid. It was found that ultrasonic velocity, elastic modulus and micro-hardness increase with increasing barium oxide content and increasing γ-radiation dose.

  10. Scaled-energy spectroscopy of a |M|=1 Rydberg barium atom in an electric field

    Institute of Scientific and Technical Information of China (English)

    Wang Lei; Quan Wei; Shen Li; Yang Hai-Feng; Shi Ting-Yun; Liu Xiao-Jun; Liu Hong-Ping; Zhan Ming-Sheng


    We observe strong energy-dependent quantum defects in the scaled-energy Stark spectra for |M|=1 Rydberg states of barium atoms at three scaled energies: ε= -2.000, ε= -2.500 and ε=-3.000. In an attempt to explain the observations, theoretical calculations of closed orbit theory based on a model potential including core effect are performed for non-hydrogenic atoms. While such a potential has been uniformly successful for alkali atoms with a single valence electron, it fails to match experimental results for barium atoms in the 6snp Rydberg states with two valence electrons. Our study points out that this discrepancy is due to the strong perturbation from the 5d8p state, which voids the simple approximation for constant quantum defects of principle quantum number n.

  11. Nanocrystalline barium zirconate titanate synthesized at low temperature by an aqueous co-precipitation technique

    International Nuclear Information System (INIS)

    Single-phase nanocrystalline powder of barium zirconium titanate, Ba(Zr xTi1-x)O3 (BZT), x = 0.10, 0.20 and 0.30, was synthesized at low-temperature using an aqueous co-precipitation technique. X-ray diffraction (XRD) of the as-precipitated powder showed single-phase BZT formation. The decrease in precipitant concentration resulted in impurity barium carbonate phase formation. Transmission electron microscopy studies of as-prepared powders showed an average particle size of 30 nm and the crystallite size from XRD was estimated to be 13 nm. The microstructural studies of sintered bodies showed an average grain size of 4 μm and the dielectric and ferroelectric behaviour of BZT with 10 mol.% Zr is reported

  12. The Static and Molecular Structure of Barium Dibromide: A Theoretical Study

    International Nuclear Information System (INIS)

    The geometry of barium dibromide was first determined by electron diffraction by Akishin and Spiridov. That study concluded that the molecule is linear, but recent modern electron diffraction and quantum chemical studies of BaBr2 indicated that its equilibrium geometry is bent. The geometrical parameters, namely, bond lengths and bond angles of barium dibromide were calculated from different levels of computation and experimentally. In this work we have calculated the molecular structure of the BaCl2 using the Interionic Force model. On the other hand, we have calculated the interionic potentials with two different rigid ion model potentials (RIM) which one is the Vashista-Rahman (VR) semi-empirical potential and second one is the RIM potential with parametrization of Tatlipinar. These two model potential are compared with each other by reproducing the experimental static structure. The structure calculations have been performed by solving numerically the hypernetted chain approximate of liquids

  13. Correlated Strontium and Barium Isotopic Compositions of Acid-Cleaned Single Silicon Carbides from Murchison

    CERN Document Server

    Liu, Nan; Gallino, Roberto; Davis, Andrew M; Bisterzo, Sara; Gyngard, Frank; Kaeppeler, Franz; Cristallo, Sergio; Dauphas, Nicolas; Pellin, Michael J; Dillmann, Iris


    We present strontium, barium, carbon, and silicon isotopic compositions of 61 acid-cleaned presolar SiC grains from Murchison. Comparison with previous data shows that acid washing is highly effective in removing both strontium and barium contamination. For the first time, by using correlated $^{88}Sr$/$^{86}Sr$ and $^{138}Ba$/$^{136}Ba$ ratios in mainstream SiC grains, we are able to resolve the effect of $^{13}C$ concentration from that of $^{13}C$-pocket mass on s-process nucleosynthesis, which points towards the existence of large $^{13}C$-pockets with low $^{13}C$ concentration in AGB stars. The presence of such large $^{13}$R-pockets with a variety of relatively low $^{13}C$ concentrations seems to require multiple mixing processes in parent AGB stars of mainstream SiC grains.

  14. Laser plasma channel formation in barium vapor based on superelastic heating of electrons

    International Nuclear Information System (INIS)

    Computational study of plasma channel formation kinetics in optically dense barium vapor irradiated by pulsed laser light tuned to the Ba I resonance transition at λ = 553.5 nm has been performed. Seed electrons are produced due to the mechanism of atoms associative ionization, which then gain energy in superelastic collisions and initiate the avalanche ionization of atoms by electron impact. We have studied the influence of radiative transfer effects in cylindrically symmetric gas volume on the excitation kinetics of multilevel barium atoms, dynamics of absorption of laser radiation, and the plasma channel expansion in the form of a halo in condition of competition between the ionizing and quenching electron collisions with excited atoms. (paper)

  15. Examination of colon with diluted barium contrast medium by the irrigoscopic (irrigographic) method

    International Nuclear Information System (INIS)

    By analogy with the work of C.Tavernier et al. (1974), who examined the eosophagus, stomach and duodenum with diluted 23% barium sulphate solution, the authors examined 58 patients by irrigoscopy (irrigography) with 20% barium sulphate solution. The rationality and the advantages of the method over the standard one were demonstrated. Early lesions measuring 3 or 4 mm were detected; the mucosal relief was very well presented. The injurious effect of tannic acid on the liver parenchyma was avoided by the use of low 0.15% tannin solution. In comparison with the method of Fischer (with double contrast) the examination time was shortened and the radiation load to the patients and attending personal reduced. The method is technically easy to perform. (author)

  16. Isolation and characterisation of barium sulphate and titanium oxides in monument crusts

    International Nuclear Information System (INIS)

    Black crusts from historical ornamental materials contain Ba and Ti. These elements are in low proportion, making their determination difficult and especially the characterisation of the phases in which they are present. For this reason, works on the mineralogical composition of the two elements in black crusts is scarce. Thus the isolation, previous to their characterisation, is important for the study of the surface layer in altered monuments. An acid attack for the isolation of barium sulphate and titanium oxides in black crusts from polluted areas has been used. The acid employed is a mixture of HF, HNO3 and HClO4. The residue isolated by acid attack was analysed by energy dispersive X-ray fluorescence and X-ray diffraction. It was characterised, and the percentages of barite (barium sulphate), anatase (titanium oxide), and rutile (titanium oxide) phases present in the surface layers were calculated

  17. The removal of radiostrontium by means of barium sulphate precipitation, ch. 4

    International Nuclear Information System (INIS)

    The barium sulphate precipitation method which is less-commonly used for the purification of radioactive wastewater is examined. In batch experiments, source variables influencing the process are studied. Results are tested in continuous processes. It was shown that the addition of stoichiometric amounts of precipitants at the same time rendered no more than 60% removal of radiostrontium; the addition of excess sulphate ions resulted in 99.7% removal. This can also be achieved by slow addition of a stoichiometric amount of barium ions to a solution containing sulphate ions and the radioisotope. The binding process is multilayer occlusion, but when more than the stoichiometric amount is added the continuing process is normal adsorption. The process is pH-independent; there is little interference of foreign ions. The method was also tested for the removal of ruthenium-106 and cobalt-60 and was successfully applied in the case of ruthenium

  18. Effects of barium sulfate as a contrast medium to enterocutaneous fistulas

    International Nuclear Information System (INIS)

    Fistulation following thoracic and epigastric interventions are conservatively treated, as a rule, because of the high rate of complications expected from reoperation. With properly functioning anastomotic transit, insufficiencies usually undergo spontaneous healing, within four to six weeks. Enterocutaneous fistulae developed in 29 of 271 patients with intrathoracic oesophagastric or oesophagojejunal anastomosis. Syringeal ramification into pleural or abdominal cavities were eliminated by means of an absorbable contrast medium, before barium sulphate was orally administered to all patients. Thoracic fistulae were closed after 21.8 days on average, while 20.3 days was the average period required for closure of epigastric fistulae. Barium sulphate was found to stimulate fistular tissue granulation, so that obliteration of the fistular system occurred much sooner, as compared to conservative treatment. The patient's quality of life can thus be improved, and hospitalisation can be shortened. Neither locally delimited nor systemic complications were observed in any of the cases described. (author)

  19. Characterization of individual barium titanate nanorods and their assessment as building blocks of new circuit architectures

    International Nuclear Information System (INIS)

    In this work, we report on the integration of individual BaTiO3 nanorods into simple circuit architectures. Polycrystalline BaTiO3 nanorods were synthesized by electrophoretic deposition (EPD) of barium titanate sol into aluminium oxide (AAO) templates and subsequent annealing. Transmission electron microscopy (TEM) observations revealed the presence of slabs of hexagonal polymorphs intergrown within cubic grains, resulting from the local reducing atmosphere during the thermal treatment. Electrical measurements performed on individual BaTiO3 nanorods revealed resistivity values between 10 and 100 Ω cm, which is in good agreement with typical values reported in the past for oxygen-deficient barium titanate films. Consequently the presence of oxygen vacancies in their structure was indirectly validated. Some of these nanorods were tested as proof-of-concept humidity sensors. They showed reproducible responses towards different moisture concentrations, demonstrating that individual BaTiO3 nanorods may be integrated in complex circuit architectures with functional capacities.

  20. Characterization of individual barium titanate nanorods and their assessment as building blocks of new circuit architectures (United States)

    Žagar, Kristina; Hernandez-Ramirez, Francisco; Prades, Joan Daniel; Morante, Joan Ramon; Rečnik, Aleksander; Čeh, Miran


    In this work, we report on the integration of individual BaTiO3 nanorods into simple circuit architectures. Polycrystalline BaTiO3 nanorods were synthesized by electrophoretic deposition (EPD) of barium titanate sol into aluminium oxide (AAO) templates and subsequent annealing. Transmission electron microscopy (TEM) observations revealed the presence of slabs of hexagonal polymorphs intergrown within cubic grains, resulting from the local reducing atmosphere during the thermal treatment. Electrical measurements performed on individual BaTiO3 nanorods revealed resistivity values between 10 and 100 Ω cm, which is in good agreement with typical values reported in the past for oxygen-deficient barium titanate films. Consequently the presence of oxygen vacancies in their structure was indirectly validated. Some of these nanorods were tested as proof-of-concept humidity sensors. They showed reproducible responses towards different moisture concentrations, demonstrating that individual BaTiO3 nanorods may be integrated in complex circuit architectures with functional capacities.