
Sample records for barium 138 target

  1. Preparation of barium and uranium targets on thick backings

    International Nuclear Information System (INIS)

    Sletten, G.


    Targets of 135 Ba and 235 U have been prepared by the technique of heavy ion sputtering. Rolled foils of 208 Pb and 197 Au were used to support 250-500 μg/cm 2 layers of barium. Uranium films have been prepared by sputtering UO 2 onto 1 mg/cm 2 titanium foils. Uranium deposit thicknesses of 300 to 1800 μg/cm 2 have been prepared. (orig.)

  2. miR-138 inhibits proliferation by targeting 3-phosphoinositide-dependent protein kinase-1 in non-small cell lung cancer cells. (United States)

    Ye, Xian-wei; Yu, Hong; Jin, Yan-kun; Jing, Xiao-ting; Xu, Mei; Wan, Zi-fen; Zhang, Xiang-yan


    Underlying mechanisms of non-small cell lung cancer (NSCLC) development remain poorly understood. miR-138 and 3-phosphoinositide-dependent protein kinase-1 (PDK1) have been reported to be involved in the genesis of NSCLC. The aim of this study was to investigate the role and mechanisms of miR-138 and PDK1 in human NSCLC cells. The effect of miR-138 on proliferation of A549 lung cancer cells was first examined using 3-[4,5-dimethylthiazol-2-yl]-2,5 diphenyl tetrazolium bromide assay. The expression of PDK1 in A549 lung cancer cells was assessed by real-time polymerase chain reaction further. A luciferase reporter activity assay was conducted to confirm target association between miR-138 and 3' untranslated region (3'-UTR) of PDK1. Finally, the role of PDK1 on proliferation of A549 cells was evaluated by transefection of PDK1 small interfering RNA (siRNA). Proliferation of A549 lung cancer cells was suppressed by miR-138 in a concentration-dependent manner. Furthermore, miR-138 can bind to the 3'-UTR of PDK1 and downregulate expression of PDK1 at both mRNA and protein levels. Knockdown of PDK1 by siRNA significantly inhibits the proliferation of A549 lung cancer cells. These findings suggest that miR-138 as a potential tumor suppressor could inhibit cell proliferation by targeting PDK1 in NSCLC cells, which could be employed as a potential therapeutic target for miRNA-based NSCLC therapy. © 2014 John Wiley & Sons Ltd.

  3. The K2 Ecliptic Plane Input Catalog (EPIC) and Stellar Classifications of 138,600 Targets in Campaigns 1-8 (United States)

    Huber, Daniel; Bryson, Stephen T.; Haas, Michael R.; Barclay, Thomas; Barentsen, Geert; Howell, Steve B.; Sharma, Sanjib; Stello, Dennis; Thompson, Susan E.


    The K2 Mission uses the Kepler spacecraft to obtain high-precision photometry over ≈80 day campaigns in the ecliptic plane. The Ecliptic Plane Input Catalog (EPIC) provides coordinates, photometry, and kinematics based on a federation of all-sky catalogs to support target selection and target management for the K2 mission. We describe the construction of the EPIC, as well as modifications and shortcomings of the catalog. Kepler magnitudes (Kp) are shown to be accurate to ≈0.1 mag for the Kepler field, and the EPIC is typically complete to Kp ≈ 17 (Kp ≈ 19 for campaigns covered by Sloan Digital Sky Survey). We furthermore classify 138,600 targets in Campaigns 1-8 (≈88% of the full target sample) using colors, proper motions, spectroscopy, parallaxes, and galactic population synthesis models, with typical uncertainties for G-type stars of ≈3% in {T}{{eff}}, ≈0.3 dex in {log} g, ≈40% in radius, ≈10% in mass, and ≈40% in distance. Our results show that stars targeted by K2 are dominated by K-M dwarfs (≈41% of all selected targets), F-G dwarfs (≈36%), and K giants (≈21%), consistent with key K2 science programs to search for transiting exoplanets and galactic archeology studies using oscillating red giants. However, we find significant variation of the fraction of cool dwarfs with galactic latitude, indicating a target selection bias due to interstellar reddening and increased contamination by giant stars near the galactic plane. We discuss possible systematic errors in the derived stellar properties, and differences with published classifications for K2 exoplanet host stars. The EPIC is hosted at the Mikulski Archive for Space Telescopes (MAST):

  4. Barium Sulfate (United States)

    ... uses a computer to put together x-ray images to create cross-sectional or three dimensional pictures of the inside of the body). Barium sulfate is in a class of medications called radiopaque contrast media. It works by coating the esophagus, stomach, or ...

  5. Barite (Barium) (United States)

    Johnson, Craig A.; Piatak, Nadine M.; Miller, M. Michael; Schulz, Klaus J.; DeYoung,, John H.; Seal, Robert R.; Bradley, Dwight C.


    Barite (barium sulfate, BaSO4) is vital to the oil and gas industry because it is a key constituent of the mud used to drill oil and gas wells. Elemental barium is an additive in optical glass, ceramic glazes, and other products. Within the United States, barite is produced mainly from mines in Nevada. Imports in 2011 (the latest year for which complete data were available) accounted for 78 percent of domestic consumption and came mostly from China.Barite deposits can be divided into the following four main types: bedded-sedimentary; bedded-volcanic; vein, cavity-fill, and metasomatic; and residual. Bedded-sedimentary deposits, which are found in sedimentary rocks with characteristics of high biological productivity during sediment accumulation, are the major sources of barite production and account for the majority of reserves, both in the United States and worldwide. In 2013, China and India were the leading producers of barite, and they have large identified resources that position them to be significant producers for the foreseeable future. The potential for undiscovered barite resources in the United States and in many other countries is considerable, however. The expected tight supply and rising costs in the coming years will likely be met by increased production from such countries as Kazakhstan, Mexico, Morocco, and Vietnam.Barium has limited mobility in the environment and exposed barium in the vicinity of barite mines poses minimal risk to human or ecosystem health. Of greater concern is the potential for acidic metal-bearing drainage at sites where the barite ores or waste rocks contain abundant sulfide minerals. This risk is lessened naturally if the host rocks at the site are acid-neutralizing, and the risk can also be lessened by engineering measures.

  6. Targeting of human GGT in a renal cell carcinoma mouse model with 99mTc-HYNIC-mAb 138H11

    International Nuclear Information System (INIS)

    Kuenstler, J.U.; Seifert, S.; Zimmermann, J.; Fischer, P.; Invancevic, V.; Johannsen, B.


    The study shows that the specific tumor uptake of 99m Tc-HYNIC-mAb 138H11 in GGT positive tumours was 2 to 5 times as high as in the controls. A high unspecific background activity was observed in the blood and in all organs well supplied with blood. (orig.)


    Blanco, R.E.


    A method of separating barium from nuclear fission products is described. In accordance with the invention, barium may be recovered from an acidic solution of neutron-irradiated fissionable material by carrying ihe barium cut of solution as a sulfate with lead as a carrier and then dissolving the barium-containing precipitate in an aqueous solution of an aliphatic diamine chelating reagent. The barium values together with certain other metallic values present in the diamine solution are then absorbed onto a cation exchange resin and the barium is selectively eluted from the resin bed with concentrated nitric acid.

  8. Barium enema (image) (United States)

    A barium enema is performed to examine the walls of the colon. During the procedure, a well lubricated enema tube is inserted gently into the rectum. The barium, a radiopaque (shows up on X-ray) contrast ...

  9. Esophagram (Barium Swallow Study) (United States)

    ... drink 1 to 2 cups of barium. The barium is a contrast material that makes liquids show up on the ... MRI Intravenous Contrast Information MRI with or without Contrast Small Bowel Follow Through (SBFT) Tailored Barium Swallow Study The Upper GI Study (GI Series) ...

  10. A compact, quasi-monochromatic laser-plasma EUV source based on a double-stream gas-puff target at 13.8 nm wavelength

    Czech Academy of Sciences Publication Activity Database

    Wachulak, P.W.; Bartnik, A.; Fiedorowicz, H.; Feigl, T.; Jarocki, R.; Kostecki, J.; Rudawski, P.; Sawicka, Magdalena; Szczurek, M.; Szczurek, A.; Zawadzki, Z.


    Roč. 100, č. 3 (2010), 461-469 ISSN 0946-2171 Institutional research plan: CEZ:AV0Z10100523 Keywords : laser-plasma * EUV source * gas puff target * elliptical multi- layer * mirror * table-top setup Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.239, year: 2010

  11. Renal targeting of captopril selectively enhances the intrarenal over the systemic effects of ACE inhibition in rats (Retracted Article. See vol 138, pg 531, 2003)

    NARCIS (Netherlands)

    Haverdings, RFG; Haas, M; Navis, G; van Loenen-Weemaes, AM; Meijer, DKF; de Zeeuw, D; Moolenaar, F

    1 In previous studies on the renal targeting of the ACE inhibitor captopril, we demonstrated that a 6 fold increased concentration of this drug could be obtained in the kidney after conjugation to the low-molecular-weight protein lysozyme. In this study, we investigated in unrestrained rats whether

  12. Tailored Barium Swallow Study (United States)

    ... Different textures of food are often given. The barium is a contrast material that makes the food and liquid show ... MRI Intravenous Contrast Information MRI with or without Contrast Small Bowel Follow Through (SBFT) Tailored Barium Swallow Study The Upper GI Study (GI Series) ...

  13. Aspiration of Barium Contrast


    Fuentes Santos, Cristina; Steen, Bárbara


    The aspiration of barium contrast is a rare complication that may occur during studies of the digestive tract. Barium is an inert material that can cause anywhere from an asymptomatic mechanical obstruction to serious symptoms of respiratory distress that can result in patient death. We present the case of a 79-year-old male patient in whom we observed the presence of contrast medium residue in the lung parenchyma as an incidental finding during hospitalization. When the patient’s medical fil...

  14. Modeling and minimization of barium sulfate scale (United States)

    Alan W. Rudie; Peter W. Hart


    The majority of the barium present in the pulping process exits the digester as barium carbonate. Barium carbonate dissolves in the bleach plant when the pH drops below 7 and, if barium and sulfate concentrations are too high, begins to precipitate as barium sulfate. Barium is difficult to control because a mill cannot avoid this carbonate-to-sulfate transition using...

  15. Barium isotopes in Allende meteorite - Evidence against an extinct superheavy element (United States)

    Lewis, R. S.; Anders, E.; Shimamura, T.; Lugmair, G. W.


    Carbon and chromite fractions from the Allende meteorite that contain isotopically anomalous xenon-131 to xenon-136 (carbonaceous chondrite fission or CCF xenon) at up to 5 x 10 to the 11th atoms per gram show no detectable isotopic anomalies in barium-130 to barium-138. This rules out the possibility that the CCF xenon was formed by in situ fission of an extinct superheavy element. Apparently the CCF xenon and its carbonaceous carrier are relics from stellar nucleosynthesis.

  16. Observed Barium Emission Rates (United States)

    Stenbaek-Nielsen, H. C.; Wescott, E. M.; Hallinan, T. J.


    The barium releases from the CRRES satellite have provided an opportunity for verifying theoretically calculated barium ion and neutral emission rates. Spectra of the five Caribbean releases in the summer of 1991 were taken with a spectrograph on board a U.S. Air Force jet aircraft. Because the line of sight release densities are not known, only relative rates could be obtained. The observed relative rates agree well with the theoretically calculated rates and, together with other observations, confirm the earlier detailed theoretical emission rates. The calculated emission rates can thus with good accuracy be used with photometric observations. It has been postulated that charge exchange between neutral barium and oxygen ions represents a significant source for ionization. If so. it should be associated with emissions at 4957.15 A and 5013.00 A, but these emissions were not detected.

  17. Aspiration of Barium Contrast

    Directory of Open Access Journals (Sweden)

    Cristina Fuentes Santos


    Full Text Available The aspiration of barium contrast is a rare complication that may occur during studies of the digestive tract. Barium is an inert material that can cause anywhere from an asymptomatic mechanical obstruction to serious symptoms of respiratory distress that can result in patient death. We present the case of a 79-year-old male patient in whom we observed the presence of contrast medium residue in the lung parenchyma as an incidental finding during hospitalization. When the patient’s medical file was reviewed, images were found of a barium swallow study that the patient had undergone months earlier, and we were able to observe the exact moment of the aspiration of the contrast material. The patient had been asymptomatic since the test.

  18. Lower GI Series (Barium Enema) (United States)

    ... single-contrast lower GI series, which uses only barium a double-contrast or air-contrast lower GI series, which uses ... to evenly coat the large intestine with the barium. If you are having a double-contrast lower GI series, the radiologist will inject air ...

  19. 22 CFR 138.210 - Reporting. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Reporting. 138.210 Section 138.210 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 138.210 Reporting. No reporting is required with respect to payments of reasonable compensation made to...

  20. 21 CFR 133.138 - Edam cheese. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Edam cheese. 133.138 Section 133.138 Food and... CONSUMPTION CHEESES AND RELATED CHEESE PRODUCTS Requirements for Specific Standardized Cheese and Related Products § 133.138 Edam cheese. (a) Description. (1) Edam cheese is the food prepared by the procedure set...

  1. Barium toxicosis in a dog. (United States)

    Adam, Fiona H; Noble, Peter J M; Swift, Simon T; Higgins, Brent M; Sieniawska, Christine E


    A 2-year-old 14.9-kg (32.8-lb) neutered female Shetland Sheepdog was admitted to the University of Liverpool Small Animal Teaching Hospital for evaluation of acute collapse. At admission, the dog was tachypneic and had reduced limb reflexes and muscle tone in all limbs consistent with diffuse lower motor neuron dysfunction. The dog was severely hypokalemic (1.7 mEq/L; reference range, 3.5 to 5.8 mEq/L). Clinical status of the dog deteriorated; there was muscle twitching, flaccid paralysis, and respiratory failure, which was considered a result of respiratory muscle weakness. Ventricular arrhythmias and severe acidemia (pH, 7.18; reference range, 7.35 to 7.45) developed. Intoxication was suspected, and plasma and urine samples submitted for barium analysis had barium concentrations comparable with those reported in humans with barium toxicosis. Analysis of barium concentrations in 5 control dogs supported the diagnosis of barium toxicosis in the dog. Fluids and potassium supplementation were administered IV. The dog recovered rapidly. Electrolyte concentrations measured after recovery were consistently unremarkable. Quantification of plasma barium concentration 56 days after the presumed episode of intoxication revealed a large decrease; however, the plasma barium concentration remained elevated, compared with that in control dogs. To our knowledge, this case represented the first description of barium toxicosis in the veterinary literature. Barium toxicosis can cause life-threatening hypokalemia; however, prompt supportive treatment can yield excellent outcomes. Barium toxicosis is a rare but important differential diagnosis in animals with hypokalemia and appropriate clinical signs.

  2. On barium oxide solubility in barium-containing chloride melts

    Energy Technology Data Exchange (ETDEWEB)

    Nikolaeva, Elena V.; Zakiryanova, Irina D.; Bovet, Andrey L.; Korzun, Iraida V. [Ural Federal Univ., Yekaterinburg (Russian Federation). Inst. of High Temperature Electrochemistry


    Oxide solubility in chloride melts depends on temperature and composition of molten solvent. The solubility of barium oxide in the solvents with barium chloride content is essentially higher than that in molten alkali chlorides. Spectral data demonstrate the existence of oxychloride ionic groupings in such melts. This work presents the results of the BaO solubility in two molten BaCl{sub 2}-NaCl systems with different barium chloride content. The received data together with earlier published results revealed the main regularities of BaO solubility in molten BaO-BaCl{sub 2}-MCl systems.

  3. MR Colonography with fecal tagging: Barium vs. barium ferumoxsil

    DEFF Research Database (Denmark)

    Achiam, M.P.; Chabanova, E.; Logager, V.B.


    and Methods. Twenty patients referred to CC underwent dark lumen MRC prior to the colonoscopy. Two groups of patients received two different oral contrast agents (barium sulfate and barium sulfate/ferumoxsil) as a laxative-free fecal tagging prior to the MRC. After MRC, the contrast agent was rated...... qualitatively (with the standard method using contrast-to-wall ratio) and subjectively (using a visual analog scale [VAS]) by three different blinded observers. Results. Evaluated both qualitatively and subjectively, the tagging efficiency of barium sulfate/ferumoxsil was significantly better (P ... barium sulfate alone. The VAS method for evaluating the tagging efficiency of contrast agents showed a high correlation (observer 11, r = 0.91) to the standard method using contrast-to-wall ratio and also a high interclass correlation (observer 11 and III = 0.89/0.85). MRC found I of 22 (5%) polyps

  4. Statistical properties of barium stars

    International Nuclear Information System (INIS)

    Hakkila, J.E.


    Barium stars are G- and K-giant stars with atmospheric excesses of s-process elements, and a broadband spectral depression in the blue portion of the spectrum. The strength of the λ4554 Ball line is used as a classification parameter known as the Barium Intensity. They have a mean absolute magnitude of 1.0 and a dispersion of 1.2 magnitudes (assuming a Gaussian distribution in absolute magnitude) as measured from secular and statistical parallaxes. These stars apparently belong to a young-disk population from analyses of both the solar reflex motion and their residual velocity distribution, which implies that they have an upper mass limit of around three solar masses. There is no apparent correlation of barium intensity with either luminosity or kinematic properties. The barium stars appear to be preferentially distributed in the direction of the local spiral arm, but show no preference to associate with or avoid the direction of the galactic center. They do not appear related to either the carbon or S-stars because of these tendencies and because of the stellar population to which each type of star belongs. The distribution in absolute magnitude combined with star count analyses implies that these stars are slightly less numerous than previously believed. Barium stars show infrared excesses that correlate with their barium intensities

  5. Barium light source method and apparatus (United States)

    Curry, John J. (Inventor); MacDonagh-Dumler, Jeffrey (Inventor); Anderson, Heidi M. (Inventor); Lawler, James E. (Inventor)


    Visible light emission is obtained from a plasma containing elemental barium including neutral barium atoms and barium ion species. Neutral barium provides a strong green light emission in the center of the visible spectrum with a highly efficient conversion of electrical energy into visible light. By the selective excitation of barium ionic species, emission of visible light at longer and shorter wavelengths can be obtained simultaneously with the green emission from neutral barium, effectively providing light that is visually perceived as white. A discharge vessel contains the elemental barium and a buffer gas fill therein, and a discharge inducer is utilized to induce a desired discharge temperature and barium vapor pressure therein to produce from the barium vapor a visible light emission. The discharge can be induced utilizing a glow discharge between electrodes in the discharge vessel as well as by inductively or capacitively coupling RF energy into the plasma within the discharge vessel.

  6. Identification and characterization of HLA-A24-specific XBP1, CD138 (Syndecan-1) and CS1 (SLAMF7) peptides inducing antigens-specific memory cytotoxic T lymphocytes targeting multiple myeloma. (United States)

    Bae, J; Hideshima, T; Zhang, G L; Zhou, J; Keskin, D B; Munshi, N C; Anderson, K C


    X-box binding protein 1 (XBP1), CD138 (Syndecan-1) and CS1 (SLAMF7) are highly expressed antigens in cancers including multiple myeloma (MM). Here, we identify and characterize immunogenic HLA-A24 peptides derived from these antigens for potential vaccination therapy of HLA-A24+ patients with MM. The identified immunogenic HLA-A24-specific XBP1 unspliced (UN) 185-193 (I S P W I L A V L), XBP1 spliced (SP) 223-231 (V Y P E G P S S L), CD138 265-273 (I F A V C L V G F) and CS1 240-248 (L F V L G L F L W) peptides induced antigen-specific CTL with anti-MM activity in an HLA-A24 restricted manner. Furthermore, a cocktail containing the four HLA-A24 peptides evoked MM-specific CTL with distinct phenotypic profiles (CD28, CD40L, 41BB, CD38, CD69) and anti-tumor activities, evidenced by perforin upregulation, CD107a degranulation (cytotoxicity) and Th1-type cytokines (IFN-γ/IL-2/TNF-α) production in response to HLA-A24 + MM cells. The multipeptide-specific CTL included antigen-specific memory CD8 + T cells expressing both T-cell activation (CD38, CD69) and immune checkpoints antigens (CTLA, PD-1, LAG-3, TIM-3). These results provide the framework for a multipeptide vaccination therapy to induce tumor-specific CTL in HLA-A24-positive patients with myeloma and other cancers expressing these antigens.

  7. 75 FR 19657 - Barium Chloride From China (United States)


    ... No: 2010-8568] INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-149 (Third Review)] Barium... determination to conduct a full five-year review concerning the antidumping duty order on barium chloride from... antidumping duty order on barium chloride from China would be likely to lead to continuation or recurrence of...

  8. 75 FR 33824 - Barium Chloride From China (United States)


    ... COMMISSION Barium Chloride From China Determination On the basis of the record\\1\\ developed in the subject... order on barium chloride from China would be likely to lead to continuation or recurrence of material... Barium Chloride from China: Investigation No. 731-TA-149 (Third Review). By order of the Commission...

  9. RNF138 joins the HR team

    DEFF Research Database (Denmark)

    Bekker-Jensen, Simon; Mailand, Niels


    Two studies show that the E3 ubiquitin ligase RNF138 is recruited to DNA double-strand break sites, where it ubiquitylates key repair factors to promote DNA-end resection and homologous recombination. These findings add insights into the multilayered regulatory mechanisms underlying DNA double-st...

  10. 33 CFR 138.20 - Definitions. (United States)


    ... financial responsibility referred to in § 138.10(a): claim, claimant, damages, discharge, exclusive economic... POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION FINANCIAL RESPONSIBILITY FOR WATER POLLUTION (VESSELS) AND OPA 90 LIMITS OF LIABILITY (VESSELS AND DEEPWATER PORTS) Financial Responsibility for Water...

  11. Barium aspiration and alveolarisation of barium in an infant: A case report and review of management

    Directory of Open Access Journals (Sweden)

    Alan F. Isles


    Full Text Available We describe a case of bilateral inhalation and alveolarisation of barium in an infant following a barium swallow for investigation of dusky spells associated with feeds. A bronchoscopy subsequently revealed the presence of a mid-tracheal tracheo-oesophageal cleft. We review the literature on barium aspiration, its consequences and make recommendations for management.

  12. Egr2-dependent microRNA-138 is dispensable for peripheral nerve myelination. (United States)

    Lin, Hsin-Pin; Oksuz, Idil; Svaren, John; Awatramani, Rajeshwar


    Recent studies have elucidated the crucial role for microRNAs in peripheral nerve myelination by ablating components of the microRNA synthesis machinery. Few studies have focused on the role of individual microRNAs. To fill this gap, we focused this study on miR-138, which was shown to be drastically reduced in Dicer1 and Dgcr8 knockout mice with hypomyelinating phenotypes and to potentially target the negative regulators of Schwann cell differentiation. Here, we show that of two miR-138 encoding loci, mir-138-1 is the predominant locus transcribed in Schwann cells. mir-138-1 is transcriptionally upregulated during myelination and downregulated upon nerve injury. EGR2 is required for mir-138-1 transcription during development, and both SOX10 and EGR2 bind to an active enhancer near the mir-138-1 locus. Based on expression analyses, we hypothesized that miR-138 facilitates the transition between undifferentiated Schwann cells and myelinating Schwann cells. However, in conditional knockouts, we could not detect significant changes in Schwann cell proliferation, cell cycle exit, or myelination. Overall, our results demonstrate that miR-138 is an Egr2-dependent microRNA but is dispensable for Schwann cell myelination.

  13. Barium Depletion in Hollow Cathode Emitters (United States)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira


    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the ow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  14. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  15. Laser cooling and trapping of barium

    NARCIS (Netherlands)

    De, Subhadeep


    Laser cooling and trapping of heavy alkaline-earth element barium have been demonstrated for the first time ever. For any possible cycling transition in barium that could provide strong cooling forces, the excited state has a very large branching probability to metastable states. Additional lasers

  16. MiR-138 Inhibits Tumor Growth Through Repression of EZH2 in Non-Small Cell Lung Cancer

    Directory of Open Access Journals (Sweden)

    Huijun Zhang


    Full Text Available Background/Aims: MicroRNAs (miRNAs play important roles in tumorigenesis. We investigated the roles and mechanisms of miR-138 in human non-small cell lung cancer (NSCLC. Methods: The expression of miR-138 was first examined in NSCLC cell lines and tumourtissues by real-time PCR The in vitro and in vivo functional effect of miR-138 was examined further. A luciferase reporter assay was conducted to confirm target association between miR-138 and the enhancer of zeste homolog 2 (EZH2. Results: miR-138 was frequently downregulated in NSCLC cells and tissues. Overexpression of miR-138 inhibited proliferation of NSCLC cells in vitro and tumor growth in vivo. The EZH2 oncogene, which is often overexpressed in various human cancers and acts as an important regulator of cell growth and tumor invasion, was identified as a novel target of miR-138. miR-138 can bind to the 3′ untranslated region (3′ UTR of EZH2 and suppress the expression of EZH2 at both mRNA and protein levels. Furthermore, knockdown of EZH2 phenocopied the tumor suppressive effects of miR-138 in cell models, whereas ectopic expression of EZH2 rescued the suppressive effects of miR-138. Conclusion: These findings define a tumor suppressor function for miR-138 in NSCLC and further suggest that miR-138 may represent a potential therapeutic target for NSCLC patients.

  17. Barium as a potential indicator of phosphorus in agricultural runoff. (United States)

    Ahlgren, Joakim; Djodjic, Faruk; Wallin, Mats


    In many catchments, anthropogenic input of contaminants, and in particular phosphorus (P), into surface water is a mixture of agricultural and sewage runoff. Knowledge about the relative contribution from each of these sources is vital for mitigation of major environmental problems such as eutrophication. In this study, we investigated whether the distribution of trace elements in surface waters can be used to trace the contamination source. Water from three groups of streams was investigated: streams influenced only by agricultural runoff, streams influenced mainly by sewage runoff, and reference streams. Samples were collected at different flow regimes and times of year and analyzed for 62 elements using ICP-MS. Our results show that there are significant differences between the anthropogenic sources affecting the streams in terms of total element composition and individual elements, indicating that the method has the potential to trace anthropogenic impact on surface waters. The elements that show significant differences between sources are strontium (p barium (p barium shows the greatest potential as a tracer for an individual source of anthropogenic input to surface waters. We observed a strong relationship between barium and total P in the investigated samples (R(2) = 0.78), which could potentially be used to apportion anthropogenic sources of P and thereby facilitate targeting of mitigation practices. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  18. A new double contrast barium enema

    International Nuclear Information System (INIS)

    Park, Jun Sang; Cho, Won Sik; Lee, Sung Woo; Lee, Mun Gyu; Jeon, Jeong Dong; Jaun, Woo Ki; Han, Chung Yul


    A new technic of the barium enema was proposed for the better colonic double contrast study with the average 204ml of 50w/v% barium, applied to 109 serial patients. The barium was introduced to sigmoid colon, and then pushed to a mid transverse colon by the air insufflation through an enema syringe, a new device. An advance to cecum is accomplished by the air insufflation and/or the position change of the patient. The barium transfer method was developed for the best spot film exposure, through colon, by the position change of the patient, the tilting of the x-ray table and the air insufflation with the enema syringe. The mean angle of the x-ray table tilted was -10 .deg. at the beginning the barium enema till the barium sent past the splenic flexure, -15 . deg. for the best lateral view of rectum and -18 .deg. for the bet prone PA view of rectosigmoid colon. This was a simple, better and economic double contrast barium enema for the cooperative patients

  19. Double contrast barium meal and acetylcysteine

    International Nuclear Information System (INIS)

    Kinnunen, J.; Pietilae, J.; Ahovuo, J.; Mankinen, P.; Tervahartiala, P.


    In a prospective double blind study, acetylcysteine, a local and systemic respiratory tract mucolytic agent, or a placebo, were given to 100 patients prior to a double contrast barium meal to decrease the gastric mucus viscosity and to make the mucus layer thinner, in order to permit barium to outline the furrows surrounding the areae gastricae instead of the overlying thick mucus. However, acetylcysteine failed to improve either visualization of the areae gastricae or the general quality of the double contrast barium meal. (orig.)

  20. New neutron-deficient isotopes of barium and rare-earth elements

    CERN Document Server

    Bogdanov, D D; Karnaukhov, V A; Petrov, L A; Plochocki, A; Subbotin, V G; Voboril, J


    The authors present an investigation of the short-lived neutron- deficient isotopes of barium and rare-earth elements. By using the BEMS-2 isotope separator on a heavy ion beam, 19 new isotopes were produced with mass numbers ranging from 117 to 138. Five of these (/sup 117/Ba, /sup 129,131/Nd and /sup 133,135/Sm) turned out to be delayed proton emitters. The beta -decay probabilities for the new isotopes have been analyzed in terms of the beta -strength function. An analysis of the proton spectrum shape has been performed using the statistical model for delayed proton emission.

  1. 22 CFR Appendix A to Part 138 - Certification Regarding Lobbying (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Certification Regarding Lobbying A Appendix A to Part 138 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Pt. 138, App. A Appendix A to Part 138—Certification Regarding Lobbying Certification for Contracts, Grants...

  2. 7 CFR 800.138 - Conflict of interest. (United States)


    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Conflict of interest. 800.138 Section 800.138 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... Inspection Services § 800.138 Conflict of interest. Official personnel cannot perform or participate in...

  3. 32 CFR 935.138 - Motor bus operation. (United States)


    ... 32 National Defense 6 2010-07-01 2010-07-01 false Motor bus operation. 935.138 Section 935.138 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND INSULAR REGULATIONS WAKE ISLAND CODE Motor Vehicle Code § 935.138 Motor bus operation. Each person operating a motor...

  4. Time requirement for barium reduction in intussusception

    International Nuclear Information System (INIS)

    Hwang, Hye Eun; Kim, Seung Ho; Kang, In Young; Park, Byoung Lan; Kim, Byoung Geun


    During the period between January 1985 and December 1987, barium reduction was performed in 146 cases of intussusception who were admitted to Kwangju Christian Hospital. The results were as follows: 1. Success rate to the symptom duration is relatively constant. 2. The success rate in infants with severe dehydration was 50% but it was gradually increased in infants with moderate dehydration and in infants with mild dehydration, 83.3% and 100% respectively. 3. The success rate of 12 cases in severely dehydrated infants with positive dissection sign was 16.7%. 4. The success rate of 15 cases in moderately dehydrated infants with positive dissection sign was 66.7%. 5. The average time requirement for barium reduction was 58.3 minutes. No serious complications were noted during barium reduction, except mild vomiting. 6. With above results, it is desirable that barium reduction should be performed according to the patient's physical status and radiologic findings.

  5. Barium Isotopes in Single Presolar Grains (United States)

    Pellin, M. J.; Davis, A. M.; Savina, M. R.; Kashiv, Y.; Clayton, R. N.; Lewis, R. S.; Amari, S.


    Barium isotopic compositions of single presolar grains were measured by laser ablation laser resonant ionization mass spectrometry and the implications of the data for stellar processes are discussed. Additional information is contained in the original extended abstract.

  6. Barium appendicitis after upper gastrointestinal imaging. (United States)

    Novotny, Nathan M; Lillemoe, Keith D; Falimirski, Mark E


    Barium appendicitis (BA) is a rarely seen entity with fewer than 30 reports in the literature. However, it is a known complication of barium imaging. To report a case of BA in a patient whose computed tomography (CT) scan was initially read as foreign body ingestion. An 18-year-old man presented with right lower quadrant pain after upper gastrointestinal imaging 2 weeks prior. A CT scan was obtained of his abdomen and pelvis that revealed a finding that was interpreted as a foreign body at the area of the terminal ileum. A plain X-ray study of the abdomen revealed radiopaque appendicoliths. Pathology confirmed the diagnosis of barium appendicitis. BA is a rare entity and the pathogenesis is unclear. Shorter intervals between barium study and presentation with appendicitis usually correlate with fewer complications. Copyright (c) 2010 Elsevier Inc. All rights reserved.

  7. An experimental study on barium peritonitis in rats

    International Nuclear Information System (INIS)

    Kang, Heung Sik; Han, Man Chung; Kim, Chu Wan


    Barium sulfate is universally used contrast media in gastrointestinal roentgenology, and spillage of barium into peritoneal cavity can occur. The references on effect of barium sulfate in the peritoneal cavity have been scattered and the results are varied. In 80 rats, body weight of 130 gm to 150 gm, sterile pure barium, sterile commercial barium, intestinal content, and mixed pure barium and intestinal content were experimentally injected into the peritoneal cavity. Consecutive weekly laparotomy and microscopic examination were done for 4 weeks. The results are as followings: 1. Mind inflammatory reaction and mild adhesion after sterile pure barium injection. 2. Mild inflammatory reaction and moderate adhesion after sterile commercial barium injection. 3. Acute peritonitis and abscess formation after intestinal content injection. 4. High mortality due to severe acute peritonitis, and severe adhesion in survivors after injection of both pure barium and intestinal content.

  8. Bacterial Reduction Of Barium Sulphate By Sulphate-Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Luptáková Alena


    Full Text Available Acid mine drainage (AMD is a worldwide problem leading to contamination of water sources. AMD are characterized by low pH and high content of heavy metals and sulphates. The barium salts application presents one of the methods for the sulphates removing from AMD. Barium chloride, barium hydroxide and barium sulphide are used for the sulphates precipitation in the form of barium sulphate. Because of high investment costs of barium salts, barium sulphide is recycled from barium sulphate precipitates. It can be recycled by thermic or bacterial reduction of barium sulphate. The aim of our study was to verify experimentally the possibility of the bacterial transformation of BaSO4 to BaS by sulphate-reducing bacteria. Applied BaSO4 came from experiments of sulphates removal from Smolnik AMD using BaCl2.

  9. Sulphate removal from sodium sulphate-rich brine and recovery of barium as a barium salt mixture. (United States)

    Vadapalli, Viswanath R K; Zvimba, John N; Mulopo, Jean; Motaung, Solly


    Sulphate removal from sodium sulphate-rich brine using barium hydroxide and recovery of the barium salts has been investigated. The sodium sulphate-rich brine treated with different dosages of barium hydroxide to precipitate barium sulphate showed sulphate removal from 13.5 g/L to less than 400 mg/L over 60 min using a barium to sulphate molar ratio of 1.1. The thermal conversion of precipitated barium sulphate to barium sulphide achieved a conversion yield of 85% using coal as both a reducing agent and an energy source. The recovery of a pure mixture of barium salts from barium sulphide, which involved dissolution of barium sulphide and reaction with ammonium hydroxide resulted in recovery of a mixture of barium carbonate (62%) and barium hydroxide (38%), which is a critical input raw material for barium salts based acid mine drainage (AMD) desalination technologies. Under alkaline conditions of this barium salt mixture recovery process, ammonia gas is given off, while hydrogen sulfide is retained in solution as bisulfide species, and this provides basis for ammonium hydroxide separation and recovery for reuse, with hydrogen sulfide also recoverable for further industrial applications such as sulfur production by subsequent stripping.

  10. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    Energy Technology Data Exchange (ETDEWEB)

    Baştürka, Emre; Madakbaş, Seyfullah; Kahraman, Memet Vezir, E-mail: [Department of Chemistry, Marmara University, Istanbul (Turkey)


    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  11. Barium nucleosynthesis in the disk

    Energy Technology Data Exchange (ETDEWEB)

    Twarog, B.A.


    The history of Ba production in the disk is discussed, particularly with regard to the apparent constancy of the production rate of Ba relative to Fe over the lifetime of the disk. An infall model of the chemical evolution of Ba/Fe within the disk is constructed under the assumption that the mass function and star formation rate are independent of time and Ba is produced as purely a secondary element. The model not only satisfies the present constraints for the disk, but produces a (Ba/H)-(Fe/H) relation which is consistent with the available observational data. It is shown that the apparent constancy of the Ba/Fe ratio is an artifact of (1) an inadequate and insufficiently accurated data sample, and (2) secondary production of Ba within the disk which is 20 to 80 times less efficient relative to Fe than the production ratio for the halo. The model predicts that stars formed during the transition period between halo and disk should show a Ba/Fe excess relative to the Sun of about a factor of 2. It is concluded that the possible sources of the Ba/Fe overproduction in the halo relative to the disk are incompatible with present theoretical limits on the mass ranges for iron and barium production by stars.

  12. Warming barium sulfate improves esophageal leak detection in pig model. (United States)

    Raman, Vignesh; MacGlaflin, Caitlyn E; Moodie, Karen L; Kaiser, Larry R; Erkmen, Cherie P


    Barium esophagograms have poor sensitivity in detecting leaks. We hypothesized that heating barium would decrease viscosity, facilitate extravasation, and enhance its sensitivity in detecting esophageal leaks. We characterized the viscosity of barium at increasing temperatures. We measured the radiopacity of barium at 25°C and 50°C. We determined the smallest diameter defect in esophagus that barium can detect by perforating a porcine esophageal segment with angiocatheters of various diameters, injecting barium at 25°C, and observing extravasation of contrast. We repeated this with barium heated to 30°C, 40°C, 50°C, and 70°C. To determine the ability of barium to detect a staple line leak, we perforated a stapled esophageal segment by air insufflation, injected barium at different temperatures, and monitored extravasation. We used Visipaque, a water-soluble contrast agent, for comparison in all experiments. The viscosity of barium decreased with increasing temperature. The radiopacity of barium did not change with increasing temperature and was higher than that of Visipaque (P detectable leak decreased from 2.1 mm with barium at 25°C to 1.3 mm at 40°C and 1.1 mm with Visipaque (P leak detection increased from 0% for barium at 25°C to 80% (P = 0.02) with barium at 40°C. There was no significant difference in sensitivity between barium at 40°C and Visipaque. Barium warmed to 40°C offers the best sensitivity of esophageal leak detection without compromising radiopacity. Barium at 40°C may be the optimum choice for swallow study to detect esophageal leaks. Copyright © 2015 Elsevier Inc. All rights reserved.

  13. Barium ferrite nanoparticles prepared by self-propagating low ...

    Indian Academy of Sciences (India)


    temperature combustion method using ... talline barium ferrite. Keywords. Barium ferrite; self-propagating combustion method; magnetic property; X-ray diffraction; morphology. 1. Introduction .... known that γ-Fe2O3 is a cubic spinel, whose chemical.

  14. miR-138 protects cardiomyocytes from hypoxia-induced apoptosis via MLK3/JNK/c-jun pathway

    Energy Technology Data Exchange (ETDEWEB)

    He, Siyi; Liu, Peng; Jian, Zhao; Li, Jingwei; Zhu, Yun; Feng, Zezhou; Xiao, Yingbin, E-mail:


    Highlights: •First time to find miR-138 is up-regulated in hypoxic cardiomyocytes. •First time to find miR-138 targets MLK3 and regulates JNK/c-jun pathway. •Rare myocardial biopsy of patients with CHD were collected. •Both silence and overexpression of miR-138 were implemented. •Various methods were used to detect cell function. -- Abstract: Cardiomyocytes experience a series of complex endogenous regulatory mechanisms against apoptosis induced by chronic hypoxia. MicroRNAs are a class of endogenous small non-coding RNAs that regulate cellular pathophysiological processes. Recently, microRNA-138 (miR-138) has been found related to hypoxia, and beneficial for cell proliferation. Therefore, we intend to study the role of miR-138 in hypoxic cardiomyocytes and the main mechanism. Myocardial samples of patients with congenital heart disease (CHD) were collected to test miR-138 expression. Agomir or antagomir of miR-138 was transfected into H9C2 cells to investigate its effect on cell apoptosis. Higher miR-138 expression was observed in patients with cyanotic CHD, and its expression gradually increased with prolonged hypoxia time in H9C2 cells. Using MTT and LDH assays, cell growth was significantly greater in the agomir group than in the negative control (NC) group, while antagomir decreased cell survival. Dual luciferase reporter gene and Western-blot results confirmed MLK3 was a direct target of miR-138. It was found that miR-138 attenuated hypoxia-induced apoptosis using TUNEL, Hoechst staining and Annexin V-PE/7-AAD flow cytometry analysis. We further detected expression of apoptosis-related proteins. In the agomir group, the level of pro-apoptotic proteins such as cleaved-caspase-3, cleaved-PARP and Bad significantly reduced, while Bcl-2 and Bcl-2/Bax ratio increased. Opposite changes were observed in the antagomir group. Downstream targets of MLK3, JNK and c-jun, were also suppressed by miR-138. Our study demonstrates that up-regulation of miR-138 plays

  15. Statistical nuclear properties and synthesis of 138La

    Directory of Open Access Journals (Sweden)

    Kheswa B. V.


    Full Text Available The synthesis of the neutron deficient 138La nucleus has been a puzzle for a long time. It has not been clear whether it is produced through photodisintegration processes or neutrino induced reactions due to unavailability of experimental data for nuclear level densities and γ strength functions of 138,139La nuclei. In the present work these nuclear properties have been measured and are used to investigate the synthesis of 138La. The results support the neutrino interactions as a dominant production process for 138La.

  16. 40 CFR 721.10011 - Barium calcium manganese strontium oxide. (United States)


    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium calcium...

  17. Synthesis of nanosized barium titanate/epoxy resin composites and ...

    Indian Academy of Sciences (India)

    Barium titanate/epoxy resin composites have been synthesized and tested for microwave absorption/ transmission. Nanocrystalline barium titanate (BaTiO3 or BT) ... Anechoic chamber; barium titanate; electromagnetic interference and compatibility; epoxy resin ..... electromagnetic waves, the two port calibrations have been.

  18. Effect of sodium bicarbonate pretreatment on barium coating of mucosa during double contrast barium meal

    International Nuclear Information System (INIS)

    Kinnunen, J.; Toetterman, S.; Kaila, R.; Pietilae, J.; Linden, H.; Tervahartiala, P.


    The radiographic pattern of the areae gastricae is produced by barium lying in the intersecting furrows of the gastric mucosal surface. However, if the mucus layer on the gastric mucosa is thick, it interferes with the barium coating of the areae gastricae during double contrast barium meal. As sodium bicarbonate decreases the viscosity of mucus and thus may make the gastric mucus layer thinner, it was evaluated as a pretreatment agent in a routine double contrast upper-gastrointestinal study to improve the visualization of the areae gastricae. In a single blind study, 53 of 106 patients took sodium bicarbonate water mixtures at bedtime the day before and on the morning of the examination. According to the results of the present study mucolysis induced by the used doses of sodium bicarbonate does not significantly affect micromucosal visualization during double-contrast barium meal. (orig.) [de

  19. 7 CFR 457.138 - Grape crop insurance provisions. (United States)


    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Grape crop insurance provisions. 457.138 Section 457... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.138 Grape crop insurance provisions. The grape crop insurance provisions for the 2010 and succeeding crop years are as follows: United...

  20. 29 CFR 780.138 - Application of the general principles. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Application of the general principles. 780.138 Section 780.138 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR... principles. Some examples will serve to illustrate the above principles. Employees of a fruit grower who dry...

  1. 22 CFR 138.500 - Secretary of Defense. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Secretary of Defense. 138.500 Section 138.500... Secretary of Defense. (a) The Secretary of Defense may exempt, on a case-by-case basis, a covered Federal... immediately after making such a determination. (b) The Department of Defense may issue supplemental...

  2. 32 CFR 644.138 - Family housing leasing program. (United States)


    ... 32 National Defense 4 2010-07-01 2010-07-01 true Family housing leasing program. 644.138 Section... PROPERTY REAL ESTATE HANDBOOK Acquisition Acquisition by Leasing § 644.138 Family housing leasing program... of Engineers. (a) Leasing requests. The Departments of the Army and Air Force direct their requests...

  3. 34 CFR 300.138 - Equitable services provided. (United States)


    ... 34 Education 2 2010-07-01 2010-07-01 false Equitable services provided. 300.138 Section 300.138 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF...

  4. Work Function Calculation For Hafnium- Barium System

    Directory of Open Access Journals (Sweden)

    K.A. Tursunmetov


    Full Text Available The adsorption process of barium atoms on hafnium is considered. A structural model of the system is presented and on the basis of calculation of interaction between ions dipole system the dependence of the work function on the coating.

  5. High temperature impedance spectroscopy of barium stannate ...

    Indian Academy of Sciences (India)

    High temperature impedance spectroscopy of barium stannate, BaSnO3. SHAIL UPADHYAY. Department of Physics, Institute of Technology, Banaras Hindu University, Varanasi 221 005, India. MS received 29 May 2012; revised 14 July 2012. Abstract. Polycrystalline powder of BaSnO3 was prepared at 1300 ◦C using a ...

  6. Impurities in barium titanate posistor ceramics

    Czech Academy of Sciences Publication Activity Database

    Korniyenko, S. M.; Bykov, I. P.; Glinchuk, M. J.; Laguta, V. V.; Belous, A. G.; Jastrabík, Lubomír


    Roč. 239, - (2000), s. 1209-1218 ISSN 0015-0193 Institutional research plan: CEZ:AV0Z1010914 Keywords : barium titanate phase transition * ESR * positive temperature coefficient of resistivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.547, year: 2000

  7. Magneto-optical trapping of barium

    NARCIS (Netherlands)

    De, S.; Dammalapati, U.; Jungmann, K.; Willmann, L.

    Laser cooling and trapping of the heavy alkaline-earth-metal element barium has been achieved based on the strong 6s(2) (1)S(0)-6s6p (1)P(1) transition. The excited state decays to a large fraction into metastable D states. Two schemes were implemented where three additional laser-driven transitions

  8. Scattering lengths of calcium and barium isotopes

    NARCIS (Netherlands)

    Dammalapati, U.; Willmann, L.; Knoop, S.


    We have calculated the s-wave scattering length of all the even isotopes of calcium (Ca) and barium (Ba) in order to investigate the prospect of Bose-Einstein condensation (BEC). For Ca we have used an accurate molecular potential based on detailed spectroscopic data. Our calculations show that Ca

  9. 75 FR 20625 - Barium Chloride From China (United States)


    ... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Revised schedule for the subject review. DATES: Effective Date: April 9, 2010. FOR FURTHER INFORMATION CONTACT: Amy...

  10. Barium Transport Process in Impregnated Dispenser Cathodes. (United States)


    Coupon Indicating Initial Discontinuity in Bariumn Coverage 17 ...... .... aru apo Hae Cuo ......... GsLie ifuso ..4... Fig. 5. SAI! Barium ’tap of a...monitoring. Electronics Research Laboratory: Microelectronics. GaAs low-noise and pover devices, semiconductor lasers. electromagnetic and optical propagation...phenomena, quantum electronics, laser comunications, lidar, and electro-optics; communication sciences, applied electronics, semiconductor crystal

  11. Electrical characterization of zirconium substituted barium titanate ...

    Indian Academy of Sciences (India)

    Nyquist (Cole–Cole) plots show both inter and intra grain boundary ... Ferroelectrics; barium zirconate titanate; complex impedance spectroscopy. ... The impedance plots in the complex plane appear in the form of succe- ssion of semicircles representing electrical phenomena due to the bulk material, grain boundary effect ...

  12. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    International Nuclear Information System (INIS)

    Fernandes, J.P.; Duarte, G.W.; Caldart, C.; Kniess, C.T.; Montedo, O.R.K.; Rocha, M.R.; Riella, H.G.; Fiori, M.A.


    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound

  13. 47 CFR 90.138 - Applications for itinerant frequencies. (United States)


    ... SERVICES PRIVATE LAND MOBILE RADIO SERVICES Applications and Authorizations § 90.138 Applications for.../Business Pool must be restricted to use of itinerant frequencies or other frequencies not designated for...

  14. Specific features of the ferroelectric state in two-layer barium strontium titanate-based heterostructures (United States)

    Stryukov, D. V.; Mukhortov, V. M.; Golovko, Yu. I.; Biryukov, S. V.


    The structural properties of one- and two-layer heterostructures based on the barium-strontium titanate of various compositions deposited by the Frank-Van der Merve on a magnesium oxide substrate have been studied. The heterostructures have been prepared by the rf sputtering of the stoichiometric ceramic targets in a Plazma 50 SE deposition system. The principal difference of this method of deposition from known analogs is that the growth of single-crystal films occurs from a disperse oxide phase formed in the plasma of a high-current rf discharge during the ceramic target sputtering at the cluster level. The peculiarities of the manifestation of the ferroelectric state in the two-layer heterostructures when changing the sequence order of the films with various compositions of barium-strontium titanate.

  15. Absolute densities in exoplanetary systems. Photodynamical modelling of Kepler-138. (United States)

    Almenara, J. M.; Díaz, R. F.; Dorn, C.; Bonfils, X.; Udry, S.


    In favourable conditions, the density of transiting planets in multiple systems can be determined from photometry data alone. Dynamical information can be extracted from light curves, providing modelling is done self-consistently, i.e. using a photodynamical model, which simulates the individual photometric observations instead of the more generally used transit times. We apply this methodology to the Kepler-138 planetary system. The derived planetary bulk densities are a factor of two more precise than previous determinations, and we find a discrepancy in the stellar bulk density with respect to a previous study. This leads, in turn, to a discrepancy in the determination of masses and radii of the star and the planets. In particular, we find that interior planet, Kepler-138 b, has a size in between Mars and the Earth. Given our mass and density estimates, we characterize the planetary interiors using a generalized Bayesian inference model. This model allows us to quantify for interior degeneracy and calculate confidence regions of interior parameters such as thicknesses of the core, the mantle, and ocean and gas layers. We find that Kepler-138 b and Kepler-138 d have significantly thick volatile layers, and that the gas layer of Kepler-138 b is likely enriched. On the other hand, Kepler-138 c can be purely rocky.

  16. Nanoparticles of barium induce apoptosis in human phagocytes. (United States)

    Mores, Luana; França, Eduardo Luzia; Silva, Núbia Andrade; Suchara, Eliane Aparecida; Honorio-França, Adenilda Cristina


    Nutrients and immunological factors of breast milk are essential for newborn growth and the development of their immune system, but this secretion can contain organic and inorganic toxins such as barium. Colostrum contamination with barium is an important issue to investigate because this naturally occurring element is also associated with human activity and industrial pollution. The study evaluated the administration of barium nanoparticles to colostrum, assessing the viability and functional activity of colostral mononuclear phagocytes. Colostrum was collected from 24 clinically healthy women (aged 18-35 years). Cell viability, superoxide release, intracellular Ca(2+) release, and phagocyte apoptosis were analyzed in the samples. Treatment with barium lowered mononuclear phagocyte viability, increased superoxide release, and reduced intracellular calcium release. In addition, barium increased cell death by apoptosis. These data suggest that nanoparticles of barium in colostrum are toxic to cells, showing the importance of avoiding exposure to this element.

  17. Deflocculants for Tape Casting Barium Titanate. (United States)


    are discussed in detail by Mitchell and Smith (2). The measurement of free and bound water was performed by titration to an electrometric end point by...the dead- stop ( biamperometric ) technique using a Fisher Model 391 aquametry apparatus. The fundamental theory behind this technique is reviewed p in... Titrations were performed at 25 ± 10C. "i 9 For insoluble materials, such as the barium titanate powder, the solid was added to the pyridine solvent

  18. Barium hexaferrite nanoparticles: Synthesis and magnetic properties

    International Nuclear Information System (INIS)

    Martirosyan, K.S.; Galstyan, E.; Hossain, S.M.; Wang Yiju; Litvinov, D.


    Carbon combustion synthesis is applied to rapid and energy efficient fabrication of crystalline barium hexaferrite nanoparticles with the average particle size of 50-100 nm. In this method, the exothermic oxidation of carbon nanoparticles with an average size of 5 nm with a surface area of 80 m 2 /g generates a self-propagating thermal wave with maximum temperatures of up to 1000 deg. C. The thermal front rapidly propagates through the mixture of solid reactants converting it to the hexagonal barium ferrite. Carbon is not incorporated in the product and is emitted from the reaction zone as a gaseous CO 2 . The activation energy for carbon combustion synthesis of BaFe 12 O 19 was estimated to be 98 kJ/mol. A complete conversion to hexagonal barium ferrite is obtained for carbon concentration exceeding 11 wt.%. The magnetic properties H c ∼3000 Oe and M s ∼50.3 emu/g of the compact sintered ferrites compare well with those produced by other synthesis methods.


    Denenholz, Edward J.; Feher, George. S.


    Barium enema reduction was used as the initial routine treatment in 29 infants with intussusception. In 22 of them the intussusception was reduced by this means. In three of eight patients operated upon the intussusception was found to be reduced. Four of the remaining five patients had clinical or x-ray evidence of complications before reduction by barium enema was attempted. Twenty-one of the patients, all of whom were observed in private practice, were treated without admission to the hospital. After reduction, these patients were observed closely by the clinician. None of these patients showed clinical or x-ray signs of complications before reduction. Certain clinical and roentgen criteria must be satisfied before it can be concluded that reduction by barium enema is complete. If there are clinical signs of complications with x-ray evidence of small bowel obstruction, only a very cautious attempt at hydrostatic reduction should be made. As the time factor is generally a reliable clinical guide to reducibility, the late cases should be viewed with greater caution. Long duration of symptoms, however, is not per se a contraindication to an attempt at hydrostatic reduction. PMID:13230908

  20. Effects of Barium Concentration on Oropharyngeal Swallow Timing Measures


    Stokely, Shauna L.; Molfenter, Sonja M.; Steele, Catriona M.


    Videofluoroscopy is commonly used for evaluating oropharyngeal swallowing but requires radiopaque contrast (typically barium). Prior studies suggest that some aspects of swallowing, including timing measures of oral and pharyngeal bolus transit, vary depending on barium concentration. The aim of our study was to identify timing differences in healthy swallowing between “thin” (40 % w/v concentration) and “ultrathin” (22 % w/v concentration) barium solutions. Twenty healthy adults (Ten women; ...

  1. Contrast characteristics of barium preparations and the timing of exposure


    渋谷, 光一; 中桐, 義忠; 東, 義晴; 杉田, 勝彦; 小橋, 高郎; 大倉, 保彦; 丹谷, 延義; 三上, 泰隆; 平木, 祥夫


    We studied the relationship between the contrast characteristics of barium suspension and timing of exposure. We poured several kinds of barium preparations on the phantom manufactured by ourselves, and took X-ray pictures continuously by a DSA system. We analyzed each of the characteris-tics of the contrast. The time which was reguired for the contrast to reach the peak (Contrast Peak Time ; CPT) was unrelated with the kind of barium preparations used. It depended on the viscosity of the con...

  2. Barium peritonitis following upper gastrointestinal series: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Su Jin; Hwang, Ji Young; Kim, Yong Jin; Hong, Seong Sook [Soonchunhyang University College of Medicine, Seoul Hospital, Seoul (Korea, Republic of)


    We report a rare case of barium peritonitis following an upper gastrointestinal (GI) series and its imaging findings in a 74-year-old female. Barium peritonitis is a rare but life-threatening complication of GI contrast investigation. Therefore, clinical awareness of barium peritonitis as a complication of GI tract contrast investigation would help to prevent such a complication and manage the patients properly.

  3. Effects of barium concentration on oropharyngeal swallow timing measures. (United States)

    Stokely, Shauna L; Molfenter, Sonja M; Steele, Catriona M


    Videofluoroscopy is commonly used for evaluating oropharyngeal swallowing but requires radiopaque contrast (typically barium). Prior studies suggest that some aspects of swallowing, including timing measures of oral and pharyngeal bolus transit, vary depending on barium concentration. The aim of our study was to identify timing differences in healthy swallowing between "thin" (40 % w/v concentration) and "ultrathin" (22 % w/v concentration) barium solutions. Twenty healthy adults (Ten women; mean age = 31 years) each performed a series of three noncued 5-ml swallows each of ultrathin and thin liquid barium solutions in videofluoroscopy. Timing measures were compared between barium concentrations using a mixed-model ANOVA. The measures of interest were stage transition duration, pharyngeal transit time, and duration of upper esophageal sphincter opening. Significant differences were observed in the timing measures of swallowing with respect to barium concentration. In all cases, longer durations were seen with the higher barium concentration. Barium concentration influences timing parameters in healthy swallowing, even between ultrathin and thin concentrations. Clinicians need to understand and control for the impact of different barium stimuli on swallowing physiology.

  4. History and challenges of barium titanate: Part II

    Directory of Open Access Journals (Sweden)

    Vijatović M.M.


    Full Text Available Barium titanate is the first ferroelectric ceramics and a good candidate for a variety of applications due to its excellent dielectric, ferroelectric and piezoelectric properties. Barium titanate is a member of a large family of compounds with the general formula ABO3 which is called perovskite. Barium titanate can be prepared using different methods. The synthesis method depends on the desired characteristics for the end application and the method used has a significant influence on the structure and properties of barium titanate materials. In this review paper, in Part II the properties of obtained materials and their application are presented.

  5. History and challenges of barium titanate: Part I

    Directory of Open Access Journals (Sweden)

    Vijatović M.M.


    Full Text Available Barium titanate is the first ferroelectric ceramics and a good candidate for a variety of applications due to its excellent dielectric, ferroelectric and piezoelectric properties. Barium titanate is a member of a large family of compounds with the general formula ABO3 called perovskites. Barium titanate can be prepared using different methods. The synthesis method depends on the desired characteristics for the end application. The used method has a significant influence on the structure and properties of barium titanate materials. In this review paper, Part I contains a study of the BaTiO3 structure and frequently used synthesis methods.

  6. Impact of the barium enema examination on patient management

    International Nuclear Information System (INIS)

    Chen, Y.M.; Ott, D.J.; Munitz, H.A.; Gelfand, D.W.


    The records of 214 patients who underwent barium enema examinations were reviewed. Indications for the examination, radiographic efficacy, and patient outcome were correlated to determine the impact of barium enema examination on patient management. The most frequent indications were rectal bleeding (33%), abdominal pain (31%), and anemia (17%). Diverticulosis (30%), polyps (10%), and malignancies (12%) were the most common abnormalities detected. The sensitivity of barium enema examination for detecting neoplasms was 89%. The effects on patient management were as follows: serious pathology was excluded (64%); a diagnosis was made that changed therapy (24%); existing therapy was continued (10%); additional studies were ordered (2%). No serious lesion was missed on barium enema examination

  7. Lanthanide doped strontium-barium cesium halide scintillators (United States)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew


    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  8. Electrooptic modulation in thin film barium titanate plasmonic interferometers. (United States)

    Dicken, Matthew J; Sweatlock, Luke A; Pacifici, Domenico; Lezec, Henri J; Bhattacharya, Kaushik; Atwater, Harry A


    We demonstrate control of the surface plasmon polariton wavevector in an active metal-dielectric plasmonic interferometer by utilizing electrooptic barium titanate as the dielectric layer. Arrays of subwavelength interferometers were fabricated from pairs of parallel slits milled in silver on barium titanate thin films. Plasmon-mediated transmission of incident light through the subwavelength slits is modulated by an external voltage applied across the barium titanate thin film. Transmitted light modulation is ascribed to two effects, electrically induced domain switching and electrooptic modulation of the barium titanate index.

  9. Binding and leakage of barium in alginate microbeads. (United States)

    Mørch, Yrr A; Qi, Meirigeng; Gundersen, Per Ole M; Formo, Kjetil; Lacik, Igor; Skjåk-Braek, Gudmund; Oberholzer, Jose; Strand, Berit L


    Microbeads of alginate crosslinked with Ca(2+) and/or Ba(2+) are popular matrices in cell-based therapy. The aim of this study was to quantify the binding of barium in alginate microbeads and its leakage under in vitro and accumulation under in vivo conditions. Low concentrations of barium (1 mM) in combination with calcium (50 mM) and high concentrations of barium (20 mM) in gelling solutions were used for preparation of microbeads made of high-G and high-M alginates. High-G microbeads accumulated barium from gelling solution and contained higher concentrations of divalent ions for both low- and high-Ba exposure compared with high-G microbeads exposed to calcium solely and to high-M microbeads for all gelling conditions. Although most of the unbound divalent ions were removed during the wash and culture steps, leakage of barium was still detected during storage. Barium accumulation in blood and femur bone of mice implanted with high-G beads was found to be dose-dependent. Estimated barium leakage relevant to transplantation to diabetic patients with islets in alginate microbeads showed that the leakage was 2.5 times lower than the tolerable intake value given by WHO for high-G microbeads made using low barium concentration. The similar estimate gave 1.5 times higher than is the tolerable intake value for the high-G microbeads made using high barium concentration. To reduce the risk of barium accumulation that may be of safety concern, the microbeads made of high-G alginate gelled with a combination of calcium and low concentration of barium ions is recommended for islet transplantation. Copyright © 2012 Wiley Periodicals, Inc.

  10. Gluten content of barium sulfate suspensions used for barium swallows in patients with celiac disease. (United States)

    Chiu, Jennifer G; Shin, Yoona; Patel, Priti N; Mangione, Robert A


    To determine the availability and accuracy of information provided by hospitals, imaging centers, and manufacturers regarding gluten in barium sulfate suspensions. A total of 105 facilities were contacted via telephone to determine the gluten content of the contrast media used in those facilities. Manufacturers were contacted and their Web sites reviewed to determine the gluten content of their barium products. Thirty-nine percent of the hospitals and 52% of the imaging centers were not aware of the gluten content of the contrast media they used. Twenty-nine-and-a-half percent of the respondents provided the correct gluten content. The manufacturers noted that 5 products were tested and confirmed gluten free, 1 product was not tested but described as gluten free, 1 product's gluten content depended upon its flavor, and 1 product was reported to contain gluten. Clinicians caring for patients with celiac disease or patients who choose to restrict their gluten consumption must ensure that the barium sulfate suspension ingested is gluten free. It can be difficult to determine the gluten content of barium sulfate, as a majority of radiology departments and imaging centers did not know whether the product they use is gluten free. Educating staff members and improving product labeling would benefit the quality of care provided to patients with celiac disease.

  11. Comparison of barium and gastrograffin swallow for radiation ...

    African Journals Online (AJOL)

    using radio-opaque contrast is a standard step in treatment planning prior to delivering radiation therapy. Various contrast mediums such as barium, gastrograffin and hexabrix have been used for simulation at different centres. Objective. The purpose of the study was to compare barium and gastrograffin as a useful and ...

  12. Study on the preparation and formation mechanism of barium ...

    Indian Academy of Sciences (India)

    This paper reports a simple method to prepare barium sulphate nanoparticles by use of tetradecanoic acid, hexadecanoic acid and stearic acid as modifier. The barium sulphate nanoparticles obtained are characterized by using Fourier transform infra-red spectroscopy (FT-IR), powder X-ray diffraction (XRD), transmission ...

  13. Outcome of barium enema in patients with colorectal symptoms ...

    African Journals Online (AJOL)

    Background: For many years, double contrast barium enema has been an effective way to evaluate the large bowel. With the development of the colonoscope, the role of barium enema has been questioned. However it is still useful in investigating patients with colorectal symptoms especially in the developing world where ...

  14. Application of magnesium hydroxide and barium hydroxide for the ...

    African Journals Online (AJOL)

    Application of magnesium hydroxide and barium hydroxide for the removal of metals and sulphate from mine water. ... equivalent to the Ba(OH)2 dosage. During CO2-dosing, CaCO3 is precipitated to the saturation level of CaCO3. Keywords: Magnesium hydroxide; barium hydroxide; sulphate removal; water treatment ...

  15. Barium enema findings of milk allergy in infants

    International Nuclear Information System (INIS)

    Kim, Gyoung Ju; Kim, Mi Jeong; Lee, Hee Jung


    We wanted to evaluate the barium enema findings of milk allergy in infants. Retrospective evaluation of the plain abdominal radiography and barium enema findings was performed in fifteen young infants suffering with milk allergy. The presence of gaseous distension, rectal gas, paralytic ileus and mechanical obstruction was evaluated on the plain radiography. The presence of spasm, a transitional zone, a reversed rectosigmoid index and mucosal irregularity was analyzed on the barium enema; the presence of barium retention was also evaluated on 24-hour-delayed plain radiography. Paralytic ileus was the most common finding on the plain radiography (93%). On the barium enema, continuous spasm of the colon, ranging from the rectum to the descending colon, was revealed in ten infants (67%). A transitional zone was observed in one infant and a reversed rectosigmoid index was revealed in four. Mucosal irregularity was observed in two infants. Barium retention was demonstrated in 11 of fifteen cases: throughout the entire colon (n = 3), from the rectum to the descending colon (n = 7), and up to the transverse colon (n = 1). The most common barium enema finding of milk allergy in infants was spasm of the distal colon. The other findings were a transitional zone, a reversed rectosigmoid index, mucosal irregularity and barium retention

  16. Short-cavity squeezing in barium (United States)

    Hope, D. M.; Bachor, H-A.; Manson, P. J.; Mcclelland, D. E.


    Broadband phase sensitive noise and squeezing were experimentally observed in a system of barium atoms interacting with a single mode of a short optical cavity. Squeezing of 13 +/- 3 percent was observed. A maximum possible squeezing of 45 +/- 8 percent could be inferred for out experimental conditions, after correction for measured loss factors. Noise reductions below the quantum limit were found over a range of detection frequencies 60-170 MHz and were best for high cavity transmission and large optical depths. The amount of squeezing observed is consistent with theoretical predictions from a full quantum statistical model of the system.

  17. Dielectric properties of barium titanate supramolecular nanocomposites. (United States)

    Lee, Keun Hyung; Kao, Joseph; Parizi, Saman Salemizadeh; Caruntu, Gabriel; Xu, Ting


    Nanostructured dielectric composites can be obtained by dispersing high permittivity fillers, barium titanate (BTO) nanocubes, within a supramolecular framework. Thin films of BTO supramolecular nanocomposites exhibit a dielectric permittivity (εr) as high as 15 and a relatively low dielectric loss of ∼0.1 at 1 kHz. These results demonstrate a new route to control the dispersion of high permittivity fillers toward high permittivity dielectric nanocomposites with low loss. Furthermore, the present study shows that the size distribution of nanofillers plays a key role in their spatial distribution and local ordering and alignment within supramolecular nanostructures.

  18. Structural and Dynamical Properties of Barium Stannate (United States)

    Phelan, D.; Krogstad, M. J.; Lopez-Bezanilla, A.; Parshall, D.; Gim, Y.; Cooper, S. L.; Zheng, H.

    Barium stannate based perovskites have recently drawn attention due to their potential as transparent conducting oxides and reports of high carrier mobility in La-doped single crystals. Published DFT calculations and experimental results have suggested phonon instabilities at high symmetry zone boundary positions and local octahedral rotations, respectively, for BaSnO3. Here, we discuss recent structural measurements of BaSnO3, in which we have searched for such distortions by employing a combination of single crystal neutron diffraction and total scattering analysis of powder neutron diffraction. Moreover, we discuss lattice dynamical measurements, comparing phonon dispersion measurements to DFT calculations.

  19. Short-cavity squeezing in barium

    International Nuclear Information System (INIS)

    Hope, D.M.; Bachor, H-A.; Manson, P.J.; Mcclelland, D.E.


    Broadband phase sensitive noise and squeezing were experimentally observed in a system of barium atoms interacting with a single mode of a short optical cavity. Squeezing of 13 +/- 3 percent was observed. A maximum possible squeezing of 45 +/- 8 percent could be inferred for out experimental conditions, after correction for measured loss factors. Noise reductions below the quantum limit were found over a range of detection frequencies 60-170 MHz and were best for high cavity transmission and large optical depths. The amount of squeezing observed is consistent with theoretical predictions from a full quantum statistical model of the system

  20. Barium and radium migration in unconsolidated Canadian geological materials

    International Nuclear Information System (INIS)

    Gillham, R.W.; Sharma, H.D.; Reddy, M.R.; Cooper, E.L.; Cherry, J.A.


    This report describes the results of laboratory studies on the distribution coefficients of radium and barium in samples of unconsolidated geologic materials. Graphs of Ksub(d) versus solution concentration for the respective elements showed constant Ksub(d) values in the low concentration range suggesting that, at low concentrations, a distribution coefficient is a valid means of representing the geochemical reactions of both barium and radium. The Ksub(d) values for barium range between 60 and 3500 ml/g. The values appear to be influenced by the amount of barium occurring naturally in the soil materials and thus there is little possiblility of using barium as an analog of radium in laboratory experiments. The Ksub(d) values of radium vary from 50 to 1000 ml/g indicating that a wide range of geological materials have a substantial capacity to retard the migration of radium

  1. Barium sulfate aspiration: Severe chemical pneumonia induced by a massive reflux of contrast medium during small bowel barium enema. (United States)

    Zhang, Lin; Yang, Yi; Zhang, Ji; Zhou, Xiaowei; Dong, Hongmei; Zhou, Yiwu


    Barium contrast radiography is a conventional procedure aimed at revealing lesions of the alimentary tract using barium sulfate on X-ray irradiation. Although it is widely used in clinics, adverse effects and complications are observed, such as anaphylaxis, granuloma, fecalithes, abdomen-leaking, embolism, bacterial contamination, and aspiration. We report a case of death due to a massive barium sulfate aspiration resulted from an air-barium double contrast enema radiography. A 25-year-old female patient was hospitalized with symptoms of abdominal distention, nausea, vomiting and diarrhea for three days. A progressive respiratory distress presented only 1h after a small bowel air-barium double contrast enema. The patient died 11h later. The result of autopsy revealed the cause of death to be severe chemical pneumonitis induced by gastric fluid which was aspirated into her lungs. Barium sulfate is generally recognized to be chemically inert for the respiratory system, but a mixture of barium sulfate with gastric contents is fatal. Here we intend to suggest that, when determining the potential cause of death, medical examiners should consider a patient's status quo as well as the possible adverse effects and complications caused by the barium sulfate preparation during gastrointestinal radiography. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  2. 33 CFR 138.90 - Individual and Fleet Certificates. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Individual and Fleet Certificates... for Water Pollution (Vessels) § 138.90 Individual and Fleet Certificates. (a) The Director, NPFC... provided and appropriate fees have been paid, except where a Fleet Certificate is issued under this section...

  3. 40 CFR 86.138-96 - Hot soak test. (United States)


    ....138-96 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... preparation for the hot soak test. (2) Gaseous-fueled vehicles. Since gaseous-fueled vehicles are not required.... (iii) Fresh impingers shall be installed in the methanol sample collection system immediately prior to...

  4. 22 CFR 138.300 - Professional and technical services. (United States)


    ... Activities by Other Than Own Employees § 138.300 Professional and technical services. (a) The prohibition on... to a person, other than an officer or employee of a person requesting or receiving a covered Federal..., submission, or negotiation of any bid, proposal, or application for that Federal contract, grant, loan, or...

  5. MicroRNA-138 enhances TRAIL-induced apoptosis through interferon-stimulated gene 15 downregulation in hepatocellular carcinoma cells. (United States)

    Zuo, Chaohui; Sheng, Xinyi; Liu, Zhuo; Ma, Min; Xiong, Shuhan; Deng, Hongyu; Li, Sha; Yang, Darong; Wang, Xiaohong; Xiao, Hua; Quan, Hu; Xia, Man


    Hepatocellular carcinoma is a leading cause of cancer-related mortality worldwide. TRAIL (tumor necrosis factor-related apoptosis-inducing ligand) is a potential target for cancer therapy. However, many cancer cells are resistant to TRAIL-induced apoptosis and its mechanism is not well understood. In this study, to identify potential therapeutic targets for TRAIL-resistant cancer cells, we compared the expression levels of interferon-stimulated gene 15 in TRAIL-sensitive and TRAIL-resistant hepatocellular carcinoma cell lines. Western blot analysis showed that interferon-stimulated gene 15 expression levels were significantly higher in resistant HLCZ01and Huh7 cells than in sensitive LH86 and SMMC-7721 cells. Interferon-stimulated gene 15 knockdown in resistance cells led to TRAIL sensitivity. Conversely, interferon-stimulated gene 15 overexpression in sensitive cells resulted in TRAIL resistance. Our bioinformatics search detected a putative target sequence for microRNA miR-138 in the 3' untranslated region of the interferon-stimulated gene 15. Real-time quantitative polymerase chain reaction analysis demonstrated that miR-138 was significantly downregulated in TRAIL-resistant cells compared to TRAIL-sensitive cells. Forced expression of miR-138 in resistant cells decreased both messenger RNA and protein levels of interferon-stimulated gene 15, and when exposed to TRAIL, activated poly(adenosine diphosphate-ribose) polymerase, indicating sensitization to TRAIL. The results suggested that miR-138 regulates the interferon-stimulated gene 15 expression by directly targeting the 3' untranslated region of interferon-stimulated gene 15 and modulates the sensitivity to TRAIL-induced apoptosis. MiR-138 may be a target for therapeutic intervention in TRAIL-based drug treatments of resistant hepatocellular carcinoma or could be a biomarker to select patients who may benefit from the treatment.


    Directory of Open Access Journals (Sweden)

    GRISHINA Anna Nikolaevna


    Full Text Available Cement concretes are the most used materials in modern civil engineering. Due to that such materials draw great attention both in the Russian Federation and abroad. The possibility to enhance the manufacturability and operational properties of concretes results in significant reduction of overall operating costs. Many enhancement methods have been elaborated. Among them there is one based on introduction of calcium hydrosilicates into construction composition. The authors set up a hypothesis that similarity between properties and structures of different hydrosilicates (for example, alkaline earth metals and metals of the second group will provide similar increased operational characteristics. The specialists of Research and Educational Center «Nanotechnology» are developing cement composites nanomodification methods which include introduction of nanodimensional barium hydrosilicates particles. The synthesis of barium hydrosilicates particles can be done with the use of many technologies, different by energy consumption or performing complexity. Taking into account both these factors, one can assume that low-temperature sol-gel synthesis from diluted water solutions is the proper technology. The present paper shows that this assumption is correct. The selection of certain technology is made by the means of multiobjective optimization, which is in turn is performed by the means of linear scalarization. This method, while not always giving the Pareto optimal solutions, can be easily implemented. The particle size distribution is taken into consideration during selection of objectives and weights. It is shown that selected technology allows manufacturing nanoparticles with median size about 30 nm.

  7. The Novel Formation of Barium Titanate Nanodendrites

    Directory of Open Access Journals (Sweden)

    Chien-Jung Huang


    Full Text Available The barium titanate (BaTiO3 nanoparticles with novel dendrite-like structures have been successfully fabricated via a simple coprecipitation method, the so-called BaTiO3 nanodendrites (BTNDs. This method was remarkable, fast, simple, and scalable. The growth solution is prepared by barium chloride (BaCl2, titanium tetrachloride (TiCl4, and oxalic acid. The shape and size of BaTiO3 depend on the amount of added BaCl2 solvent. To investigate the influence of amount of BaCl2 on BTNDs, the amount of BaCl2 was varied in the range from 3 to 6 mL. The role of BaCl2 is found to have remarkable influence on the morphology, crystallite size, and formation of dendrite-like structures. The thickness and length of the central stem of BTND were ~300 nm and ~20 μm, respectively. The branchings were found to occur at irregular intervals along the main stem. Besides, the formation mechanism of BTND is proposed and discussed.

  8. Three barium diphosphonates with 3-D structures (United States)

    Tuikka, Matti; Haukka, Matti; Ahlgrén, Markku


    The gel crystallization method was exploited in this work in order to study the 3-D solid state structures of barium diphosphonates. This technique proved to be an effective tool for the growth of single crystals of diphosphonates for structure analysis. By using this approach, three barium diphosphonates, Ba[HO 3P(CH 2) 2PO 3H] ( 1), Ba 2[O 3P(CH 2) 3PO 3]·3H 2O ( 2) and Ba[HO 3P(CH 2) 4PO 3H] ( 3), with different three dimensional structures, were synthesized and characterized. The structures of compounds 1 and 2 were determined by single crystal X-ray diffraction and the structure of 3 by the powder diffraction method. In the structure of 1, the diphosphonate ligand is completely surrounded by the Ba atoms, which is an unusual arrangement in a diphosphonate system. The structures of 2 and 3 are more conventional. They are organized in typical pillared layers in which the separation of the layers can be adjusted by varying the length of the hydrocarbon chain.

  9. Radiation doses to patients undergoing barium meal and barium enema examinations

    International Nuclear Information System (INIS)

    Delichas, M. G.; Hatziioannou, K.; Papanastassiou, E.; Albanopoulou, P.; Chatzi, E.; Sioundas, A.; Psarrakos, K.


    The radiation doses received by patients during 41 barium meal (BM) and 42 barium enema (BE) examinations in two Greek hospitals are presented. Radiation dose was measured in terms of the dose area product (DAP). The effective dose and doses to certain organs were estimated using the ODS-60 software. Mean total DAP values were found to be 25 ± 11 Gy cm 2 for BM and 60 ± 35 Gy cm 2 for BE examinations, whereas the estimated mean values of effective dose were 8.6 ± 4.0 and 24 ± 16 mSv respectively. DAP to effective dose conversion coefficients were estimated to be 0.34 mSv per Gy cm 2 for BM and 0.41 mSv per Gy cm 2 for BE. (authors)

  10. Large Flexoelectric Anisotropy in Paraelectric Barium Titanate. (United States)

    Narvaez, Jackeline; Saremi, Sahar; Hong, Jiawang; Stengel, Massimiliano; Catalan, Gustau


    The bending-induced polarization of barium titanate single crystals has been measured with an aim to elucidate the origin of the large difference between theoretically predicted and experimentally measured flexoelectricity in this material. The results indicate that part of the difference is due to polar regions (short-range order) that exist above T(C) and up to T*≈200-225 °C. Above T*, however, the flexovoltage coefficient still shows an unexpectedly large anisotropy for a cubic material, with (001)-oriented crystals displaying 10 times more flexoelectricity than (111)-oriented crystals. Theoretical analysis shows that this anisotropy cannot be a bulk property, and we therefore interpret it as indirect evidence for the theoretically predicted but experimentally elusive contribution of surface piezoelectricity to macroscopic bending-induced polarization.

  11. Large Flexoelectric Anisotropy in Paraelectric Barium Titanate (United States)

    Narvaez, Jackeline; Saremi, Sahar; Hong, Jiawang; Stengel, Massimiliano; Catalan, Gustau


    The bending-induced polarization of barium titanate single crystals has been measured with an aim to elucidate the origin of the large difference between theoretically predicted and experimentally measured flexoelectricity in this material. The results indicate that part of the difference is due to polar regions (short-range order) that exist above TC and up to T*≈2 00 - 2 2 5 °C . Above T* , however, the flexovoltage coefficient still shows an unexpectedly large anisotropy for a cubic material, with (001)-oriented crystals displaying 10 times more flexoelectricity than (111)-oriented crystals. Theoretical analysis shows that this anisotropy cannot be a bulk property, and we therefore interpret it as indirect evidence for the theoretically predicted but experimentally elusive contribution of surface piezoelectricity to macroscopic bending-induced polarization.

  12. Thermal decomposition of barium valerate in argon

    DEFF Research Database (Denmark)

    Torres, P.; Norby, Poul; Grivel, Jean-Claude


    degrees C and evidence was found for the solidification of the melt at 380-440 degrees C, i.e. simultaneously with the onset of decomposition. Between 400 degrees C and 520 degrees C (Ba(C4H9CO2)(2) decomposes in two main steps, first into BaCO3 with release of C4H9COC4H9 (5-nonanone), whereas final......The thermal decomposition of barium valerate (Ba(C4H9CO2)(2)/Ba-pentanoate) was studied in argon by means of thermogravimetry, differential thermal analysis, IR-spectroscopy, X-ray diffraction and hot-stage optical microscopy. Melting takes place in two different steps, at 200 degrees C and 280...

  13. Solar Twins and the Barium Puzzle

    Energy Technology Data Exchange (ETDEWEB)

    Reddy, Arumalla B. S.; Lambert, David L., E-mail: [W.J. McDonald Observatory and Department of Astronomy, The University of Texas at Austin, Austin, TX 78712-1205 (United States)


    Several abundance analyses of Galactic open clusters (OCs) have shown a tendency for Ba but not for other heavy elements (La−Sm) to increase sharply with decreasing age such that Ba was claimed to reach [Ba/Fe] ≃ +0.6 in the youngest clusters (ages < 100 Myr) rising from [Ba/Fe] = 0.00 dex in solar-age clusters. Within the formulation of the s -process, the difficulty to replicate higher Ba abundance and normal La−Sm abundances in young clusters is known as the barium puzzle. Here, we investigate the barium puzzle using extremely high-resolution and high signal-to-noise spectra of 24 solar twins and measured the heavy elements Ba, La, Ce, Nd, and Sm with a precision of 0.03 dex. We demonstrate that the enhanced Ba ii relative to La−Sm seen among solar twins, stellar associations, and OCs at young ages (<100 Myr) is unrelated to aspects of stellar nucleosynthesis but has resulted from overestimation of Ba by standard methods of LTE abundance analysis in which the microturbulence derived from the Fe lines formed deep in the photosphere is insufficient to represent the true line broadening imposed on Ba ii lines by the upper photospheric layers from where the Ba ii lines emerge. Because the young stars have relatively active photospheres, Ba overabundances most likely result from the adoption of a too low value of microturbulence in the spectrum synthesis of the strong Ba ii lines but the change of microturbulence in the upper photosphere has only a minor affect on La−Sm abundances measured from the weak lines.

  14. Study of the photovoltaic effect in thin film barium titanate (United States)

    Grannemann, W. W.; Dharmadhikari, V. S.


    The feasibility of making non-volatile digital memory devices of barium titanate, BaTiO3, that are integrated onto a silicon substrate with the required ferroelectric film produced by processing, compatible with silicon technology was examined.

  15. The Overview of The Electrical Properties of Barium Titanate


    Burcu Ertuğ


    The perovskite family includes many titanates used in various electroceramic applications, for example, electronic, electro-optical, and electromechanical applications of ceramics. Barium titanate, perovskite structure, is a common ferroelectric material with a high dielectric constant, widely utilized to manufacture electronic components such as mutilayer capacitors (MLCs), PTC thermistors, piezoelectric transducers, and a variety of electro-optic devices. Pure barium titanate is an insulato...

  16. Cost-effectiveness of barium enemas performed by radiographers

    International Nuclear Information System (INIS)

    Brown, Lorraine; Desai, Sharad


    AIM: To assess the cost-effectiveness of barium enemas performed by radiographers compared to those performed by consultant radiologists. METHOD: Prospective study of 200 barium enemas carried out by a senior radiographer and a consultant radiologist. The sample was a consecutive sample of adult out-patients over a 3-month period, with no exclusion. The length of time of the enema and the numbers and grades of staff involved in the procedure were recorded. This was translated into staffing costs using the appropriate pay scales. RESULTS: The barium enemas performed by the superintendent radiographer were more cost-effective than those performed by the consultant radiologist (1406 pounds for 100 radiographer-performed barium enemas compared to 1787 pounds for 100 carried out by the consultant radiologist). CONCLUSION: In terms of staffing costs, radiographers performing barium enemas not only liberates radiologist time, it is also a cost-effective method of providing an out-patient barium enema service. Brown, L. and Desai, S. (2002)

  17. Anastomotic stenosis of the descending colon caused by barium granuloma formation following barium peritonitis: report of a case. (United States)

    Kitajima, Toshihiro; Tomizawa, Kenji; Hanaoka, Yutaka; Toda, Shigeo; Matoba, Shuichiro; Kuroyanagi, Hiroya; Oota, Yasunori


    Anastomotic stricture reportedly often recurs following barium peritonitis, regardless of whether the anastomotic diameter is initially sufficient. However, the causes of repetitive stricture have not been clarified. We report a case that suggests the pathophysiology of recurrent anastomotic strictures following barium peritonitis. The patient was a 39-year-old Japanese man with idiopathic perforation of the descending colon after undergoing an upper gastrointestinal barium contrast study. After emergency peritoneal lavage and diverting colostomy, created using the perforated region, the patient recovered uneventfully and 3 months later, the colostomy was closed and the perforated colon was resected. However, 7 months after colostomy closure, abdominal distention gradually developed, and colonoscopy revealed an anastomotic stricture. The patient was referred to our hospital where he underwent resection of the anastomotic stricture. The surgical specimen exhibited barium granulomas not only in the subserosa of the entire specimen, but also in the submucosa and lamina propria localized in the anastomotic site. These findings suggest that barium was embedded in the submucosa and lamina propria with manipulation of the stapled anastomosis and that the barium trapped in the anastomotic site caused persistent inflammation, resulting in an anastomotic stricture.

  18. The efficacy of steroids for postoperative persistent inflammatory reaction in a patient with barium peritonitis: A case report

    Directory of Open Access Journals (Sweden)

    Hirofumi Kojima


    Conclusion: Residual barium in the intraperitoneal cavity causes persistent inflammatory reaction in patients with barium peritonitis. The use of steroids is effective for postoperative persistent inflammation due to the residual barium.

  19. Biokinetics and effects of barium sulfate nanoparticles. (United States)

    Konduru, Nagarjun; Keller, Jana; Ma-Hock, Lan; Gröters, Sibylle; Landsiedel, Robert; Donaghey, Thomas C; Brain, Joseph D; Wohlleben, Wendel; Molina, Ramon M


    Nanoparticulate barium sulfate has potential novel applications and wide use in the polymer and paint industries. A short-term inhalation study on barium sulfate nanoparticles (BaSO₄ NPs) was previously published [Part Fibre Toxicol 11:16, 2014]. We performed comprehensive biokinetic studies of ¹³¹BaSO₄ NPs administered via different routes and of acute and subchronic pulmonary responses to instilled or inhaled BaSO₄ in rats. We compared the tissue distribution of ¹³¹Ba over 28 days after intratracheal (IT) instillation, and over 7 days after gavage and intravenous (IV) injection of ¹³¹BaSO₄. Rats were exposed to 50 mg/m³ BaSO₄ aerosol for 4 or 13 weeks (6 h/day, 5 consecutive days/week), and then gross and histopathologic, blood and bronchoalveolar lavage (BAL) fluid analyses were performed. BAL fluid from instilled rats was also analyzed. Inhaled BaSO₄ NPs showed no toxicity after 4-week exposure, but a slight neutrophil increase in BAL after 13-week exposure was observed. Lung burden of inhaled BaSO₄ NPs after 4-week exposure (0.84 ± 0.18 mg/lung) decreased by 95% over 34 days. Instilled BaSO₄ NPs caused dose-dependent inflammatory responses in the lungs. Instilled BaSO₄ NPs (0.28 mg/lung) was cleared with a half-life of ≈ 9.6 days. Translocated ¹³¹Ba from the lungs was predominantly found in the bone (29%). Only 0.15% of gavaged dose was detected in all organs at 7 days. IV-injected ¹³¹BaSO₄ NPs were predominantly localized in the liver, spleen, lungs and bone at 2 hours, but redistributed from the liver to bone over time. Fecal excretion was the dominant elimination pathway for all three routes of exposure. Pulmonary exposure to instilled BaSO₄ NPs caused dose-dependent lung injury and inflammation. Four-week and 13-week inhalation exposures to a high concentration (50 mg/m³) of BaSO₄ NPs elicited minimal pulmonary response and no systemic effects. Instilled and inhaled BaSO₄ NPs were cleared quickly yet

  20. Design of portable electrocardiogram device using DSO138 (United States)

    Abuzairi, Tomy; Matondang, Josef Stevanus; Purnamaningsih, Retno Wigajatri; Basari, Ratnasari, Anita


    Cardiovascular disease has been one of the leading causes of sudden cardiac deaths in many countries, covering Indonesia. Electrocardiogram (ECG) is a medical test to detect cardiac abnormalities by measuring the electrical activity generated by the heart, as the heart contracts. By using ECG, we can observe anomaly at the time of heart abnormalities. In this paper, design of portable ECG device is presented. The portable ECG device was designed to easily use in the village clinic or houses, due to the small size device and other benefits. The device was designed by using four units: (1) ECG electrode; (2) ECG analog front-end; (3) DSO138; and (4) battery. To create a simple electrode system in the portable ECG, 1-lead ECG with two electrodes were applied. The analog front-end circuitry consists of three integrated circuits, an instrumentation amplifier AD820AN, a low noise operational amplifier OPA134, and a low offset operational amplifier TL082. Digital ECG data were transformed to graphical data on DSO138. The results show that the portable ECG is successfully read the signal from 1-lead ECG system.

  1. Effectiveness of therapeutic barium enema for diverticular hemorrhage. (United States)

    Matsuura, Mizue; Inamori, Masahiko; Nakajima, Atsushi; Komiya, Yasuhiko; Inoh, Yumi; Kawasima, Keigo; Naitoh, Mai; Fujita, Yuji; Eduka, Akiko; Kanazawa, Noriyoshi; Uchiyama, Shiori; Tani, Rie; Kawana, Kennichi; Ohtani, Setsuya; Nagase, Hajime


    To evaluate the effectiveness of barium impaction therapy for patients with colonic diverticular bleeding. We reviewed the clinical charts of patients in whom therapeutic barium enema was performed for the control of diverticular bleeding between August 2010 and March 2012 at Yokohama Rosai Hospital. Twenty patients were included in the review, consisting of 14 men and 6 women. The median age of the patients was 73.5 years. The duration of the follow-up period ranged from 1 to 19 mo (median: 9.8 mo). Among the 20 patients were 11 patients who required the procedure for re-bleeding during hospitalization, 6 patients who required it for re-bleeding that developed after the patient left the hospital, and 3 patients who required the procedure for the prevention of re-bleeding. Barium (concentration: 150 w%/v%) was administered per the rectum, and the leading edge of the contrast medium was followed up to the cecum by fluoroscopy. After confirmation that the ascending colon and cecum were filled with barium, the enema tube was withdrawn, and the patient's position was changed every 20 min for 3 h. Twelve patients remained free of re-bleeding during the follow-up period (range: 1-19 mo) after the therapeutic barium enema, including 9 men and 3 women with a median age of 72.0 years. Re-bleeding occurred in 8 patients including 5 men and 3 women with a median age of 68.5 years: 4 developed early re-bleeding, defined as re-bleeding that occurs within one week after the procedure, and the remaining 4 developed late re-bleeding. The DFI (disease-free interval) decreased 0.4 for 12 mo. Only one patient developed a complication from therapeutic barium enema (colonic perforation). Therapeutic barium enema is effective for the control of diverticular hemorrhage in cases where the active bleeding site cannot be identified by colonoscopy.

  2. Manufacture of barium hexaferrite (BaO3.98Fe2O3) from iron oxide waste of grinding process by using calcination process (United States)

    Idayanti, N.; Dedi; Kristiantoro, T.; Mulyadi, D.; Sudrajat, N.; Alam, G. F. N.


    The utilization of iron oxide waste of grinding process as raw materials for making barium hexaferrite has been completed by powder metallurgy method. The iron oxide waste was purified by roasting at 800 °C temperature for 3 hours. The method used varying calcination temperature at 1000, 1100, 1200, and 1250 °C for 3 hours. The starting iron oxide waste (Fe2O3) and barium carbonate (BaCO3) were prepared by mol ratio of Fe2O3:BaCO3 from the formula BaO3.98Fe2O3. Some additives such as calcium oxide (CaO), silicon dioxide (SiO2), and polyvinyl alcohol (PVA) were added after calcination process. The samples were formed at the pressure of 2 ton/cm2 and sintered at the temperature of 1250 °C for 1 hour. The formation of barium hexaferrite compounds after calcination is determined by X-Ray diffraction. The magnetic properties were observed by Permagraph-Magnet Physik with the optimum characteristic at calcination temperature of 1250 °C with the induction of remanence (Br) = 1.38 kG, coercivity (HcJ) = 4.533 kOe, product energy maximum (BHmax) = 1.086 MGOe, and density = 4.33 g/cm3.

  3. 31 CFR 363.138 - How do I purchase a certificate of indebtedness? (United States)


    ... indebtedness? 363.138 Section 363.138 Money and Finance: Treasury Regulations Relating to Money and Finance... SECURITIES HELD IN TREASURYDIRECT Certificate of Indebtedness § 363.138 How do I purchase a certificate of indebtedness? You may purchase your certificate of indebtedness through one or more of the following four...

  4. 33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...

  5. Air (CO2) double-contrast barium enteroclysis. (United States)

    Maglinte, Dean D T; Kohli, Marc D; Romano, Stefania; Lappas, John C


    In the 1980s and 1990s in North America and Europe, air (CO(2)) double-contrast barium enteroclysis took a back seat to biphasic methylcellulose double-contrast enteroclysis in the investigation of small-bowel diseases. The widespread application of capsule endoscopy in the 21st century has identified a number of limitations of radiologic examinations in the investigation of mucosal diseases of the small intestine. Evidence-based studies comparing barium, computed tomographic (CT), and magnetic resonance (MR) enteroclysis have shown that in spite of improvements in small-bowel examination methods using CT and MR, barium examinations remain superior in the depiction of mucosal abnormalities, particularly the apthoid lesions of early Crohn disease. Barium small-bowel examinations have been recommended in the patient with a negative CT or MR enteroclysis study where the pretest probability of Crohn disease is high. A recent prospective comparison of methylcellulose double-contrast barium enteroclysis to capsule endoscopy with review of the literature has shown that air enteroclysis depicts mucosal details better than does methylcellulose double-contrast enteroclysis because of the "washout" effect of methylcellulose on superficial mucosal features. Recent articles have shown that air enteroclysis compares favorably with wireless capsule endoscopy and double-balloon endoscopy in the diagnosis of mucosal abnormalities of the small bowel. This article describes the authors' technique of performing air double-contrast enteroclysis, its clinical indications, and its pitfalls.

  6. Creating unstable velocity-space distributions with barium injections

    International Nuclear Information System (INIS)

    Pongratz, M.B.


    Large Debye lengths relative to detector dimensions and the absence of confining walls makes space an attractive laboratory for studying fundamental theories of plasma instabilities. However, natural space plasmas are rarely found displaced from equilibrium enough to permit isolation and diagnosis of the controlling parameters and driving conditions. Furthermore, any plasma or field response to the departure from equilibrium can be masked by noise in the natural system. Active experiments provide a technique for addressing the chicken or egg dilemma. Early thermite barium releases were generally conducted at low altitudes from sounding rockets to trace electric fields passively or to study configuration-space instabilities. One can also study velocity-space instabilities with barium releases. Neutral barium vapor releases wherein a typical speed greatly exceeds the thermal speed can be used to produce barium ion velocity-space distributions that should be subject to a number of microinstabilities. We examine the ion velocity-space distributions resulting from barium injections from orbiting spacecraft and shaped-charges

  7. Preparation of barium hexaferrite powders using oxidized steel scales waste (United States)

    Septiani, Ardita; Idayanti, Novrita; Kristiantoro, Tony


    Research on preparation of barium hexaferrite powders has been done using Hot Strip Mill scales as raw materials. Hot Strip Mill scales are oxidized steel scales waste from steel industrial process. The method used for preparing the barium hexaferrite powders was solid state reaction method. Oxidized steel scales were milled using ball mill for 10 hours, then screened through a 250 mesh sieve to obtain powders with maximum size of 63 µm. Powders were roasted at 600°C temperature for 4 hours to obtain hematite (Fe2O3) phase. Roasted powders were then mixed with barium carbonate, and were subsequently milled for 16 hours. After mixing, powders were calcined with an increasing rate of 10°C/min and maintained at 1100°C for 3 hours. Calcination process was performed to acquire barium hexaferrite phase. X-ray Diffraction (XRD) characterization in conjunction with RIR analysis showed that 85 wt. % of barium hexaferrite is formed. The magnetic properties of powders were characterized using Permagraph. It is found the value of remanent induction is 1.09 kG, coercivity of 2.043 kOe, and the maximum energy product of 0.25 MGOe.

  8. Barium Depletion in the NSTAR Discharge Cathode After 30,000 Hours of Operation (United States)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira


    Dispenser hollow cathodes rely on a consumable supply of barium released by impregnant materials in the pores of a tungsten matrix to maintain a low work function surface. Examinations of cathode inserts from long duration ion engine tests show deposits of tungsten at the downstream end that appear to block the flow of barium from the interior. In addition, a numerical model of barium transport in the insert plasma indicates that the barium partial pressure in the insert may exceed the equilibrium vapor pressure of the dominant barium-producing reaction, and it was postulated previously that this would suppress barium loss in the upstream part of the insert. New measurements of the depth of barium depletion from a cathode insert operated for 30,352 hours reveal that barium loss is confined to a narrow region near the downstream end, confirming this hypothesis.

  9. Centrifugal Jet Spinning for Highly Efficient and Large-scale Fabrication of Barium Titanate Nanofibers


    Ren, Liyun; Kotha, Shiva P.


    The centrifugal jet spinning (CJS) method has been developed to enable large-scale synthesis of barium titanate nanofibers. Barium titanate nanofibers with fiber diameters down to 50 nm and grain sizes around 25 nm were prepared with CJS by spinning a sol-gel solution of barium titanate and poly(vinylpyrrolidone) with subsequent heat treatment at 850 °C. XRD and FTIR analysis demonstrated high purity and tetragonal perovskite structured barium titanate nanofibers. SEM and TEM images confirm t...

  10. Occupational doses in pediatric barium meal procedures

    International Nuclear Information System (INIS)

    Filipov, D.; Schelin, H.R.; Denyak, V.; Legnani, A.; Ledesma, J.A.; Paschuk, S.A.; Sauzen, J.; Yagui, A.; Hoff, G.; Khoury, H.J.


    Ionizing radiation has become an indispensable tool when it comes to diagnosis and therapy. However, its use should happen in a rational manner, taking into account the risks to which the staff is being exposed. Barium meal (BM), or upper gastrointestinal (GI) studies, using fluoroscopy, are widely used for gastroesophageal reflux disease diagnostic in children and professionals are required to stay inside the examination room to position and immobilize pediatric patients during the procedure. Therefore, it is very important that proffessionals strictly follow the technical standards of radiation protection. According to the ICRP and the NCRP recommendations, the annual limit equivalent doses for eyes, thyroid and hands are, espectively, 20 mSv, 150 mSv and 500 mSv. Based on those data, the aim of the current study is to estimate the annual equivalent dose for eyes, thyroid and hands of professionals who perform BM procedures in children. This was done using properly package LiF:Mg,Cu,P thermoluminescent dosimeters in 37 procedures; 2 pairs were positioned near each staff´s eye, 2 pairs on each professional´s neck (on and under the lead protector) and 2 pairs on both staff´s hands. The range of the estimative annual equivalent doses, for eyes, thyroid and hands, are, respectively: 14 – 36 mSv, 7 – 22 mSv and 14 – 58 mSv. Only the closest staff to the patient exceeded the annual equivalent doses in the eyes (around 80% higher than the limit set by ICRP). However, the results from this study, for hands and thyroid, compared to similar studies, show higher values. Therefore, the optimization implementation is necessary, so that the radiation levels can be reduced. (authors)

  11. Selectivity in biomineralization of barium and strontium. (United States)

    Krejci, Minna R; Wasserman, Brian; Finney, Lydia; McNulty, Ian; Legnini, Daniel; Vogt, Stefan; Joester, Derk


    The desmid green alga Closterium moniliferum belongs to a small number of organisms that form barite (BaSO(4)) or celestite (SrSO(4)) biominerals. The ability to sequester Sr in the presence of an excess of Ca is of considerable interest for the remediation of (90)Sr from the environment and nuclear waste. While most cells dynamically regulate the concentration of the second messenger Ca(2+) in the cytosol and various organelles, transport proteins rarely discriminate strongly between Ca, Sr, and Ba. Herein, we investigate how these ions are trafficked in C. moniliferum and how precipitation of (Ba,Sr)SO(4) crystals occurs in the terminal vacuoles. Towards this goal, we simultaneously visualize intracellular dynamics of multiple elements using X-ray fluorescence microscopy (XFM) of cryo-fixed/freeze-dried samples. We correlate the resulting elemental maps with ultrastructural information gleaned from freeze-fracture cryo-SEM of frozen-hydrated cells and use micro X-ray absorption near edge structure (micro-XANES) to determine sulfur speciation. We find that the kinetics of Sr uptake and efflux depend on external Ca concentrations, and Sr, Ba, and Ca show similar intracellular localization. A highly ion-selective cross-membrane transport step is not evident. Based on elevated levels of sulfate detected in the terminal vacuoles, we propose a "sulfate trap" model, where the presence of dissolved barium leads to preferential precipitation of (Ba,Sr)SO(4) due to its low solubility relative to SrSO(4) and CaSO(4). Engineering the sulfate concentration in the vacuole may thus be the most direct way to increase the Sr sequestered per cell, an important consideration in using desmids for phytoremediation of (90)Sr. Copyright © 2011 Elsevier Inc. All rights reserved.

  12. Sputtered Modified Barium Titanate for Thin-Film Capacitor Applications. (United States)

    Reynolds, Glyn J; Kratzer, Martin; Dubs, Martin; Felzer, Heinz; Mamazza, Robert


    New apparatus and a new process for the sputter deposition of modified barium titanate thin-films were developed. Films were deposited at temperatures up to 900 °C from a Ba₀ .96 Ca 0. 04 Ti 0. 82 Zr 0. 18 O₃ (BCZTO) target directly onto Si, Ni and Pt surfaces and characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and X-ray photoelectron spectroscopy (XPS). Film texture and crystallinity were found to depend on both deposition temperature and substrate: above 600 °C, the as-deposited films consisted of well-facetted crystallites with the cubic perovskite structure. A strongly textured Pt (111) underlayer enhanced the (001) orientation of BCZTO films deposited at 900 °C, 10 mtorr pressure and 10% oxygen in argon. Similar films deposited onto a Pt (111) textured film at 700 °C and directly onto (100) Si wafers showed relatively larger (011) and diminished intensity (00ℓ) diffraction peaks. Sputter ambients containing oxygen caused the Ni underlayers to oxidize even at 700 °C: Raising the process temperature produced more diffraction peaks of NiO with increased intensities. Thin-film capacitors were fabricated using ~500 nm thick BCZTO dielectrics and both Pt and Ni top and bottom electrodes. Small signal capacitance measurements were carried out to determine capacitance and parallel resistance at low frequencies and from these data, the relative permittivity (e r ) and resistivity (r) of the dielectric films were calculated; values ranged from ~50 to >2,000, and from ~10⁴ to ~10 10 Ω∙cm, respectively.

  13. Sputtered Modified Barium Titanate for Thin-Film Capacitor Applications

    Directory of Open Access Journals (Sweden)

    Robert Mamazza


    Full Text Available New apparatus and a new process for the sputter deposition of modified barium titanate thin-films were developed. Films were deposited at temperatures up to 900 °C from a Ba0.96Ca0.04Ti0.82Zr0.18O3 (BCZTO target directly onto Si, Ni and Pt surfaces and characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray photoelectron spectroscopy (XPS. Film texture and crystallinity were found to depend on both deposition temperature and substrate: above 600 °C, the as-deposited films consisted of well-facetted crystallites with the cubic perovskite structure. A strongly textured Pt (111 underlayer enhanced the (001 orientation of BCZTO films deposited at 900 °C, 10 mtorr pressure and 10% oxygen in argon. Similar films deposited onto a Pt (111 textured film at 700 °C and directly onto (100 Si wafers showed relatively larger (011 and diminished intensity (00ℓ diffraction peaks. Sputter ambients containing oxygen caused the Ni underlayers to oxidize even at 700 °C: Raising the process temperature produced more diffraction peaks of NiO with increased intensities. Thin-film capacitors were fabricated using ~500 nm thick BCZTO dielectrics and both Pt and Ni top and bottom electrodes. Small signal capacitance measurements were carried out to determine capacitance and parallel resistance at low frequencies and from these data, the relative permittivity (er and resistivity (r of the dielectric films were calculated; values ranged from ~50 to >2,000, and from ~104 to ~1010 Ω∙cm, respectively.

  14. Gastrointestinal tract wall visualization and distention during abdominal and pelvic multidetector CT with a neutral barium sulphate suspension: comparison with positive barium sulphate suspension and with water. (United States)

    Oliva, M R; Erturk, S M; Ichikawa, T; Rocha, T; Ros, P R; Silverman, S G; Mortele, K J


    When examining patients with contrast-enhanced multidetector-row CT, we determined if the stomach and small bowel were visualized and distended better with a neutral barium sulphate suspension than with positive barium sulphate suspension or water. After obtaining approval from our institutional review board, 156 patients (women: 84; mean age: 54 yrs) with no history of gastrointestinal tract disease were randomized prospectively to receive orally either 900 ml of neutral (0.1% w/v) barium sulphate suspension (n = 53), 900 ml of positive (2.1% w/v) barium sulphate suspension (n = 53), or 900 ml of water (n = 50), prior to undergoing contrast-enhanced abdominal and pelvic multidetector-row CT. Two independent radiologists evaluated the stomach, and small bowel, for luminal distension and wall visualization, using a five point scale. Results were compared using Kruskal-Wallis and Mann-Whitney U tests. The walls of the stomach, and small bowel were visualized better in patients who were administered neutral barium sulphate suspension than those who were administered either positive barium sulphate suspension (p barium sulphate suspension, the stomach and small bowel were distended better compared to patients administered water (p barium sulphate suspension (p contrast-enhanced abdominal and pelvic multidetector-row CT, orally administered neutral barium sulphate suspension allows the gastrointestinal tract to be visualized and distended better than either positive barium sulphate suspension, or water.

  15. Barium titanate thick films prepared by screen printing technique

    Directory of Open Access Journals (Sweden)

    Mirjana M. Vijatović


    Full Text Available The barium titanate (BaTiO3 thick films were prepared by screen printing technique using powders obtained by soft chemical route, modified Pechini process. Three different barium titanate powders were prepared: i pure, ii doped with lanthanum and iii doped with antimony. Pastes for screen printing were prepared using previously obtained powders. The thick films were deposited onto Al2O3 substrates and fired at 850°C together with electrode material (silver/palladium in the moving belt furnace in the air atmosphere. Measurements of thickness and roughness of barium titanate thick films were performed. The electrical properties of thick films such as dielectric constant, dielectric losses, Curie temperature, hysteresis loop were reported. The influence of different factors on electrical properties values was analyzed.

  16. Diagnostic role of barium enema in carcinoma rectum

    International Nuclear Information System (INIS)

    Asghar, M.


    Objective: The main aim of this barium enema study was to evaluate its role in patients suspected to have rectal pathologies with complaints of change in bowel habit, anorexia/weight loss, bleeding per rectum and acute/sub-acute colonic obstruction. Results: barium enema study as screening test for colo-rectal carcinoma was undertaken. Contrast outlined the colonic growth in 35 cases, out of which the cases of carcinoma colon were 24 including 13 patients suffering from carcinoma rectum. The percentage of carcinoma colon to total colonic growth was 68% while, carcinoma rectum to total carcinoma colon was 54%. Conclusion: On the basis of these investigations, it is concluded that patient's compliance is important factor in the early detection of colonic neoplasia. Though results of colonoscopy are more reliable but in practice, barium enema (double contrast) is performed initially to outline the lesion and then colonoscopy for biopsy purpose. (author)

  17. 49 CFR 173.182 - Barium azide-50 percent or more water wet. (United States)


    ... 49 Transportation 2 2010-10-01 2010-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or more...

  18. 75 FR 36629 - Barium Chloride From the People's Republic of China: Continuation of Antidumping Duty Order (United States)


    ... International Trade Administration Barium Chloride From the People's Republic of China: Continuation of... the antidumping duty order on barium chloride from the People's Republic of China (``PRC'') would... of initiation of the third sunset review of the antidumping duty order on barium chloride from the...

  19. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3). (United States)


    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN P-00...

  20. The diagnosis of gastro-esophageal reflux disease cannot be made with barium esophagograms

    NARCIS (Netherlands)

    Saleh, C. M. G.; Smout, A. J. P. M.; Bredenoord, A. J.


    For over 50 years, barium studies have been used to diagnose gastro-esophageal reflux disease (GERD), but the value of this test is controversial. Our study aimed to determine if barium esophagograms can be used to diagnose GERD. Barium esophagograms and pH-impedance measurement were performed in 20

  1. Measurement of Elastic Modulus of Alumina and Barium Strontium Titanate Wafers Produced by Tape Casting Method (United States)


    DATES COVERED (From – To) 4. TITLE AND SUBTITLE MEASUREMENT OF ELASTIC MODULUS OF ALUMINA AND BARIUM STRONTIUM TITANATE WAFERS PRODUCED BY...configuration testing method. Samples of barium strontium titanate (BST) were made using a regular powder pressing, sintering, pelletizing, and...fabricated using thin wafers of barium strontium titanate (BST) and aluminum oxide (alumina) ceramic during launch of a system. Sandia National

  2. Diagnosis of anastomotic leak: electrolyte detection versus barium fluoroscopy. (United States)

    DeArmond, Daniel T; Carswell, Aimee; Louden, Christopher L; Simmons, Jeremy D; Bayer, Johanna; Das, Nitin A; Johnson, Scott B


    We recently described a new method of diagnosing anastomotic leak using the detection of electrical changes induced by electrolyte extravasation from a surgically created gastric leak site in experimental rats. We sought to compare the sensitivity and specificity of anastomotic leak detection for this method to that of upper gastrointestinal (GI) barium fluoroscopy. Experimental rats with a surgically created gastric leak site and controls were interrogated as to the presence of leak using either the electrolyte-gated leak detection method or upper GI barium fluoroscopy. The sensitivity and specificity of leak detection for the two methods were compared. The sensitivity and specificity of electrolyte-gated leak detection were both 100% (95% confidence interval 69-100%). Barium upper GI fluoroscopy misidentified one leak as a control and one control as a leak, for a sensitivity and specificity of 80% each (95% confidence interval 37-97%). No statistically significant difference was seen between electrolyte-gated leak detection and barium upper GI fluoroscopy in terms of the sensitivity and specificity of anastomotic leak detection. Electrolyte-gated leak detection was similarly sensitive and specific for anastomotic leak detection as upper GI barium fluoroscopy, the current standard. The electrolyte-gated method has the advantages of an inert contrast agent (normal saline) and the possibility of performing leak interrogation at the bedside. Electrolyte-gated leak detection might represent a plausible alternative to upper GI barium fluoroscopy for routine postoperative anastomotic leak surveillance after esophagectomy or other foregut surgery. Copyright © 2013 Elsevier Inc. All rights reserved.

  3. Compact pulse forming line using barium titanate ceramic material. (United States)

    Kumar Sharma, Surender; Deb, P; Shukla, R; Prabaharan, T; Shyam, A


    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO(3)) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber. © 2011 American Institute of Physics

  4. Reaction sintering of a zirconia-containing barium feldspar ceramic

    International Nuclear Information System (INIS)

    Nordmann, A.; Cheng, Y-B.; Muddle, B. C.


    Zircon (ZrSiO 4 ) is a natural mineral resource known to react with certain oxides to produce a dispersion of zirconia particles within ceramic or glass-ceramic matrices. Barium aluminosilicates, particularly the celsian polymorphs of BaO- Al 2 O 3 2SiO 2 display oxidation resistance and refractory characteristics commensurate with the properties required of high temperature materials. Such properties, coupled with the high melting point of ZrO 2 (2680 deg C), suggest that barium aluminosilicates and zirconia are an ideal combination from which to fabricate high temperature materials. A recent study has indicated that a barium aluminosilicate containing up to 40mol% ZrO 2 can be prepared via a sol-gel process. However, the desire to utilise a natural resource in the form of zircon in the present work has led to the choice of reaction sintering as an alternative processing route. The current work was undertaken to investigate the possibility of forming a zirconia-containing barium feldspar composite material using the reaction sintering of zircon and assuming the following stoichiometric reaction: 2ZrSiO 4 + BaCO 3 + Al 2 O 3 → 2ZrO 2 + BaO-Al 2 O 3 -2SiO 2 + CO 2 ↑. The reaction sintering of zircon with alumina and barium carbonate produces a composite material comprising distributed ZrO 2 in a continous barium feldspar matrix. Yttria added during processing allows a significant fraction of the ZrO 2 to be retained as tetragonal phase to room temperature and thus the potential for a measure of transformation toughening

  5. Esophageal intramural pseudodiverticulosis characterized by barium esophagography: a case report

    LENUS (Irish Health Repository)

    O'Connor, Owen J


    Abstract Introduction Esophageal intramural pseudodiverticulosis is a rare condition characterized by the dilatation of the submucosal glands. Case presentation We present a case of esophageal intramural pseudodiverticulosis in a 72-year-old Caucasian man who presented with dysphagia and with a background history of alcohol abuse. An upper gastrointestinal endoscopy of our patient showed an esophageal stricture with abnormal mucosal appearances, but no malignant cells were seen at biopsy. Appearances on a barium esophagram were pathognomonic for esophageal intramural pseudodiverticulosis. Conclusion We demonstrate the enduring usefulness of barium esophagography in the characterization of abnormal mucosal appearances at endoscopy.

  6. Comparison of endoscopy and barium swallow with marshmallow in dysphagia. (United States)

    Somers, S; Stevenson, G W; Thompson, G


    Forty-four patients with dysphagia were examined both by endoscopy and by barium swallow with a marshmallow bolus. In these patients 36 stenoses were found: 34 by radiology and 30 by endoscopy. The radiologic criteria for stenosis included arrest of the marshmallow in a manner to support a column of barium and reproduction of the patient's symptoms at the time this occurred. Radiologic false negative findings were partly due to an inability by patients to swallow an adequate marshmallow bolus; endoscopic failures were associated with small endoscopes and mild stenoses.

  7. The Kerr nonlinearity of the beta-barium borate crystal

    DEFF Research Database (Denmark)

    Bache, Morten; Guo, Hairun; Zhou, Binbin


    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond experime......A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond...

  8. Methods for producing monodispersed particles of barium titanate (United States)

    Hu, Zhong-Cheng


    The present invention is a low-temperature controlled method for producing high-quality, ultrafine monodispersed nanocrystalline microsphere powders of barium titanate and other pure or composite oxide materials having particles ranging from nanosized to micronsized particles. The method of the subject invention comprises a two-stage process. The first stage produces high quality monodispersed hydrous titania microsphere particles prepared by homogeneous precipitation via dielectric tuning in alcohol-water mixed solutions of inorganic salts. Titanium tetrachloride is used as an inorganic salt precursor material. The second stage converts the pure hydrous titania microsphere particles into crystalline barium titanate microsphere powders via low-temperature, hydrothermal reactions.

  9. Preparation, structure and dielectric property of barium stannate titanate ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Wei Xiaoyong [Electronic Materials Research Laboratory, Key Laboratory of the Ministry of Education, Xi' an Jiaotong Univesity, Xi' an 710049 (China)]. E-mail:; Yao Xi [Electronic Materials Research Laboratory, Key Laboratory of the Ministry of Education, Xi' an Jiaotong Univesity, Xi' an 710049 (China)


    The processing route of barium stannate titanate ceramics were optimized to prepare full composition range solid solution sample. The phase structure, microscopic morphology and dielectric properties of barium stannate titanate ceramics were studied. X-ray diffraction patterns indicated that the samples are of single perovskite structure. Linear empirical relationship between crystal lattice and tin content was proposed. This relationship is valid covering the full composition range, which suggests that this solid solution system is ultimate mutual soluble. The phase transition behavior was studied and a phase diagram was obtained based on the dielectric measurements.

  10. An Overview of NCRP Report No. 138 on Terrorist Activities (United States)

    Poston, John, Sr.


    In late 1998, the National Council on Radiation Protection and Measurements (NCRP) convened Scientific Committee 46-14 to prepare a report on the radiological safety aspects of terrorist activities involving radioactivity. The work of this committee was funded through a contract with the Planning and Preparedness Division of the Office of Emergency Management of the Department of Energy. The committee was composed of a diverse group of individuals with expertise in many areas in addition to radiation safety and emergency response. These areas included law (both federal and state), public communications, and psychosocial aspects of such incidents. The statement of work focused the work of the committee, and the resulting report did not necessarily address all issues of such activities. One of the charges of the committee was to provide guidance as to necessary research and make recommendations regarding the present infrastructure with the responsibility for responding to such incidents. This presentation will provide an overview of NCRP Report No. 138 and focus on some of the critical issues raised in the report. These issues include recognition of the event, the interface between federal, state, and local authorities, exposure limits for the first-responders, clean-up criteria, training and resources, the psychosocial aspects of such events, and communications with the media and the public. This report represented the ``beginning'' of such considerations. It pointed the way for additional studies and research in this very important area.

  11. Ruled and holographic experiment (AO 138-5) (United States)

    Bonnemason, Francis


    The AO 138-5 experiment was designed, via the FRECOPA (FRench COoperative PAyload) experiment with the aim to study the optical behavior of different diffraction gratings submitted to space vacuum long exposure and solar irradiation. Samples were ruled and holographic gratings, masters or replica, and some additional control mirrors with various coatings. The experiment was located on the B3, trailing edge of the LDEF and was protected against Atomic Oxygen flux. The experienced thermal cycling was evaluated from -23 C to 66 C during the flight, 34,000 orbits. The samples (two batches of four pieces) were located on a dedicated plate, by a pair of equivalent gratings or mirrors; optical faces were located on the external side. The plate was inside a canister, which had been opened in space for ten months. When the satellite returned to Kennedy Space Center, the remaining vacuum in the canister was still correct. The analysis focused on the triple point characterization including light efficiency, wavefront flatness quality and stray light level. Tests were conducted on control mirrors and gratings (rules and holographic master or replica) loaded but not exposed to cosmic dust or direct solar irradiations. They did not show any significant variations. Solar exposure had damaged the coating (aluminum and platinum) reflectivity in the Ultra-Violet region; the degradation is higher with the gratings, in terms of efficiency. However, wavefront flatness quality and stray light level tests revealed no additional changes.

  12. Characterisation of lead barium zirconate thin films for utilisation of the electrocaloric effect

    Energy Technology Data Exchange (ETDEWEB)

    Shaw, C.P., E-mail: [Surface Engineering and Nanotechnology Institute, Manufacturing and Materials Department, Cranfield University, Cranfield, Bedfordshire MK43 0AL (United Kingdom); Zhang, Qi, E-mail: [Surface Engineering and Nanotechnology Institute, Manufacturing and Materials Department, Cranfield University, Cranfield, Bedfordshire MK43 0AL (United Kingdom); Correia, T.M., E-mail: [Knowledge Transfer Network (United Kingdom); Weaver, P.M., E-mail: [InotekUK (United Kingdom)


    Characterisation of a composition of Lead Barium Zirconate thin films deposited by a spin coating sol-gel process onto platinised silicon substrates has been undertaken to investigate a potential application utilising the reported electrocaloric properties of the material. Xray diffraction studies revealed that above 700 °C the presence of pyrochlore phase was replaced by ferroelectric phase but the identification of antiferroelectric phases previously reported could not be identified. Wet etching of the films produced an insoluble residue containing only evidence of zirconium out of the original three metals, which resembled a skeletal structure similar to the original rosette morphology of the annealed films. Elemental analysis of the annealed films using EDX indicated a non-target Pb:Ba:Zr ratio, which suggested a reduced Zr content of the films. “Solution-like” rather than “sol-like” nature of the spin coated sol and phase boundary proximity are proposed for reported observations, and a mechanism is proposed to account for the unusual observed trend in dielectric constant. - Highlights: • Characterisation of sol-gel deposited Lead barium zirconnate films. • Absence of previously reported antiferroelectric phase. • Identification of proposed non-PBZ phase. • Anomalous increase in film capacitance with thickness interpreted.


    NARCIS (Netherlands)

    van Leeuwen, R.; Ubachs, W.M.G.; Hogervorst, W.


    The autoionizing 5dng J = 1-5 states in barium for n=5-8 were investigated in a two-step pulsed laser atomic beam experiment. The wavefunctions of the 5dng configuration can be well described in a (jl)K-coupled basis. Each 5d(j)ng[K] fine structure state autoionizes into a single 6sepsilonl

  14. Ionic conductivity and diffusion coefficient of barium-chloride-based ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 40; Issue 4. Ionic conductivity and diffusion coefficient of barium-chloride-based polymer electrolyte with poly(vinyl alcohol)–poly(4-styrenesulphonic acid) polymer complex. MAYANK PANDEY GIRISH M JOSHI NARENDRA NATH GHOSH. Volume 40 Issue 4 August ...

  15. ORIGINAL ARTICLE ORIG ORIG Comparison of barium and ...

    African Journals Online (AJOL)

    Background. Simulation of patients with carcinoma of the oesophagus using radio-opaque contrast is a standard step in treatment planning prior to delivering radiation therapy. Various contrast mediums such as barium, gastrograffin and hexabrix have been used for simulation at different centres. Objective. The purpose of ...

  16. Barium Ferrite Films Grown By Pulsed Laser Ablation

    NARCIS (Netherlands)

    Lisfi, A.; Lodder, J.C.; de Haan, P.; Roesthuis, F.J.G.


    Abstract available only. It is known that barium ferrite (BaFe12019) can grow with perpendicular anisotropy on A1203 a single crystal substrate,' but also on an amorphous substrate by using a ZnO buffer.2 Because of its large magnetic anisotropy which can easily overcome the shape anisotropy of the

  17. Synthesis of nanosized barium titanate/epoxy resin composites and ...

    Indian Academy of Sciences (India)

    Anechoic chamber; barium titanate; electromagnetic interference and compatibility; epoxy resin composites; microwave absorbers; radio frequency absorbers. ... The reflection loss (RL) and transmission loss (TL) of the composite materials were measured by the reflection/transmission method using a vector network ...

  18. Thermal expansion behaviour of barium and strontium zirconium ...

    Indian Academy of Sciences (India)


    Thermal expansion behaviour of barium and strontium zirconium phosphates. P SRIKARI TANTRI, K GEETHA†, A M UMARJI† and SHEELA K RAMASESHA*. Materials Science Division, National Aerospace Laboratories, Bangalore 560 017, India. †Materials Research Centre, Indian Institute of Science, Bangalore 560 ...

  19. Phase developments and dielectric responses of barium substituted ...

    Indian Academy of Sciences (India)

    Phase developments and dielectric responses of barium substituted four-layer CaBi4Ti4O15 Aurivillius. HUILING DU. ∗. , XIANG SHI and HUILU LI. College of Materials Science and Engineering, Xi'an University of Science and Technology, Xi'an 710054, China. MS received 26 December 2010; revised 8 February 2011.

  20. Experimental study of yttrium barium copper oxide superconducting ...

    Indian Academy of Sciences (India)

    667–676. Experimental study of yttrium barium copper oxide ... In the present study, torsional strain dependence of the critical current of the coated conductor is investigated experimentally for different current ramp rates. Again, the .... An empirical formula was proposed and established using a curve fit expressed in eq. (1).

  1. Dose-area product measurements during Barium enema radiograph ...

    African Journals Online (AJOL)

    The aim of this study was to obtain a direct measurement of the typical dose delivered to an average adult patient during a barium enema examination. Measurement was done on a sample of 50 patients at three departments, using a dose-area product (DAP) meter. The comparison of the results with UK median levels ...

  2. peroxo-oxalate preparation of doped barium titanate

    NARCIS (Netherlands)

    van der Gijp, S.; Winnubst, Aloysius J.A.; Verweij, H.


    The peroxo-oxalate complexation method is a method that can be used for the preparation of doped barium titanate. In this paper we focus on BaTi0.91Zr0.09O3, which can be used for discharge capacitors in lamp starters. The preparation method described here is based on the complexation and subsequent

  3. Thermal expansion behaviour of barium and strontium zirconium ...

    Indian Academy of Sciences (India)


    small substitution of barium changes its sign. X = 1⋅0 and 1⋅25 samples have almost constant CTE over the entire temperature range. The low thermal expansion of these samples can be attributed to the ordering of the ions in the crystal structure of these materials. Keywords. Coefficient of thermal expansion; low thermal ...


    Tompkins, E.R.


    The separation of radioactive barium values from a uranyl nitrate solution of neutron-irradiated uranium is described. The 10 to 20% uranyl nitrate solution is passed through a flrst column of a cation exchange resin under conditions favoring the adsorption of barium and certain other cations. The loaded resin is first washed with dilute sulfuric acid to remove a portion of the other cations, and then wash with a citric acid solution at pH of 5 to 7 to recover the barium along with a lesser amount of the other cations. The PH of the resulting eluate is adjusted to about 2.3 to 3.5 and diluted prior to passing through a smaller second column of exchange resin. The loaded resin is first washed with a citric acid solution at a pH of 3 to elute undesired cations and then with citric acid solution at a pH of 6 to eluts the barium, which is substantially free of undesired cations.

  5. Heat stress attenuates new cell generation in the hypothalamus: a role for miR-138. (United States)

    Kisliouk, T; Cramer, T; Meiri, N


    The anterior hypothalamus (Ant Hyp) of the brain serves as the main regulator of numerous homeostatic functions, among them body temperature. Fine-tuning of the thermal-response set point during the critical postnatal sensory-developmental period involves neuronal network remodeling which might also be accompanied by alterations in hypothalamic cell populations. Here we demonstrate that heat stress during the critical period of thermal-control establishment interferes with generation of new cells in the chick hypothalamus. Whereas conditioning of the 3-day-old chicks under high ambient temperatures for 24h diminished the number of newborn cells in anterior hypothalamic structures 1 week after the treatment, mild heat stress did not influence the amount of new cells. Phenotypic analysis of these newborn cells indicated a predominant decrease in non-neuronal cell precursors, i.e. cells that do not express doublecortin (DCX). Furthermore, heat challenge of 10-day-old previously high-temperature-conditioned chicks abolished hypothalamic neurogenesis and significantly decreased the number of cells of non-neural origin. As a potential regulatory mechanism for the underlying generation of new cells in the hypothalamus, we investigated the role of the microRNA (miRNA) miR-138, previously reported by us to promote hypothalamic cell migration in vitro and whose levels are reduced during heat stress. Intracranial injection into the third ventricle of miR-138 led to an increase in the number of newborn cells in the Ant Hyp, an effect which might be partially mediated by inhibition of its direct target reelin. These data demonstrate the role of ambient temperature on the generation of new cells in the hypothalamus during the critical period of thermal-control establishment and highlight the long-term effect of severe heat stress on hypothalamic cell population. Moreover, miRNAs, miR-138 in particular, can regulate new cell generation in the hypothalamus. Copyright © 2014 IBRO

  6. Dicty_cDB: VHA138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR034434 |CR034434....1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...4 CR103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engine...ering clone MHPP142o16. 50 0.17 1 CR044130 |CR044130.1 Forward strand read from ins

  7. Dicty_cDB: SHC138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 5...neering clone MHPP142o16. 50 0.13 1 CR034434 |CR034434.1... clone MHPP186g09. 50 0.13 1 CR103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engi

  8. 22 CFR Appendix B to Part 138 - Disclosure Form To Report Lobbying (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Disclosure Form To Report Lobbying B Appendix B to Part 138 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Pt. 138, App. B Appendix B to Part 138—Disclosure Form To Report Lobbying EC06OC91.000 EC06OC91.001 EC06OC91...

  9. Long non-coding RNA TUG1 promotes cervical cancer progression by regulating the miR-138-5p-SIRT1 axis. (United States)

    Zhu, Jie; Shi, Huirong; Liu, Huina; Wang, Xiaojuan; Li, Fengmei


    Increasing evidences showed that long non-coding RNAs (lncRNAs) play vital roles in tumor progression. Recent studies indicated that lncRNA TUG1 was upregulated and promoted tumor processes in several cancers. However, the expression and underlying mechanism of TUG1 in cervical cancer remain unclear. In the present study, we found that TUG1 expression was upregulated in cervical cancer tissues and correlated with advanced clinical features and poor overall survival. TUG1 knockdown suppressed cervical cancer cell growth and metastasis in vitro and tumor growth in vivo . In addition, our results indicated that TUG1 could act as an endogenous sponge by directly binding to miR-138-5p and suppressed miR-138-5p expression. Furthermore, we found that TUG1 could reverse the inhibitory effect of miR-138-5p on cervical cancer cells processes, which might be involved in the activation of SIRT1, a target gene of miR-138-5p, and activation of Wnt/β-catenin signaling pathway. Taken together, we elucidated that TUG1 might promote cervical cancer malignant progression via miR-138-5p-SIRT1-Wnt/β-catenin signaling pathway axis.

  10. Effects of chemesthetic stimuli mixtures with barium on swallowing apnea duration. (United States)

    Todd, J Tee; Butler, Susan G; Plonk, Drew P; Grace-Martin, Karen; Pelletier, Cathy A


    This study tested the hypotheses that swallowing apnea duration (SAD) will increase given barium versus water, chemesthetic stimuli (i.e., water barium, age (older > younger), and genetic taste differences (supertasters > nontasters). Prospective group design. University Medical Center. Eighty healthy women were identified as nontasters and supertasters, equally comprising two age groups: 18 to 35 years and 60+ years. The KayPentax Swallowing Signals Lab was used to acquire SAD via nasal cannula during individually randomized swallows of 5 mL barium, 2.7% w/v citric acid with barium, carbonation with barium, and 50:50 diluted ethanol with barium. Data were analyzed using path analysis, with the mediator of chemesthetic perception, adjusted for repeated measures. Significant main effects of age (P = .012) and chemesthetic stimuli (P = .014) were found, as well as a significant interaction between chemesthetic stimuli and age (P = .028). Older women had a significantly longer SAD than younger women. Post hoc analyses revealed that barium mixed with ethanol elicited a significantly longer SAD than other bolus conditions, regardless of age group. There were no significant differences in SAD between barium and water conditions, and no significant effect of chemesthetic perception (P > .05). Ethanol added to barium elicited longer SAD compared to plain barium, but not the other chemesthetic conditions. Older women had a longer SAD than younger women in all conditions. These findings may influence design of future studies examining effects of various stimuli on SAD. Copyright © 2012 The American Laryngological, Rhinological, and Otological Society, Inc.

  11. Exposure to low-dose barium by drinking water causes hearing loss in mice. (United States)

    Ohgami, Nobutaka; Hori, Sohjiro; Ohgami, Kyoko; Tamura, Haruka; Tsuzuki, Toyonori; Ohnuma, Shoko; Kato, Masashi


    We continuously ingest barium as a general element by drinking water and foods in our daily life. Exposure to high-dose barium (>100mg/kg/day) has been shown to cause physiological impairments. Direct administration of barium to inner ears by vascular perfusion has been shown to cause physiological impairments in inner ears. However, the toxic influence of oral exposure to low-dose barium on hearing levels has not been clarified in vivo. We analyzed the toxic influence of oral exposure to low-dose barium on hearing levels and inner ears in mice. We orally administered barium at low doses of 0.14 and 1.4 mg/kg/day to wild-type ICR mice by drinking water. The doses are equivalent to and 10-fold higher than the limit level (0.7 mg/l) of WHO health-based guidelines for drinking water, respectively. After 2-week exposure, hearing levels were measured by auditory brain stem responses and inner ears were morphologically analyzed. After 2-month exposure, tissue distribution of barium was measured by inductively coupled plasma mass spectrometry. Low-dose barium in drinking water caused severe hearing loss in mice. Inner ears including inner and outer hair cells, stria vascularis and spiral ganglion neurons showed severe degeneration. The Barium-administered group showed significantly higher levels of barium in inner ears than those in the control group, while barium levels in bone did not show a significant difference between the two groups. Barium levels in other tissues including the cerebrum, cerebellum, heart, liver and kidney were undetectably low in both groups. Our results demonstrate for the first time that low-dose barium administered by drinking water specifically distributes to inner ears resulting in severe ototoxicity with degeneration of inner ears in mice. Copyright © 2012 Elsevier Inc. All rights reserved.

  12. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage

    CSIR Research Space (South Africa)

    Mulopo, J


    Full Text Available Batch regeneration of barium carbonate (BaCO3) from barium sulphide (BaS) slurries by passing CO2 gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO3 recovery in the Alkali...

  13. Gas thermodesorption study of barium and strontium cerates

    International Nuclear Information System (INIS)

    Aksenova, T.I.; Khromushin, I.V.; Zhotabaev, Zh.R.; Bukenov, K.D.; Medvedeva, Z.V.; Berdauletov, A.K.


    Kinetic of water, oxygen, hydrogen and carbon dioxide molecules release from doped and undoped samples of barium cerates and doped strontium cerates during vacuum heating was studied. The samples were prepared by inductive melting method. The following two kinds of preliminary samples treatments were used: annealing in air (650-750 deg. C) and wet nitrogen atmosphere (625 deg.C). Main results of thermodesorption studies of barium and strontium cerates are represented in the table. The samples of doped LaSrMnO were investigated also. It was found that the initial doped samples (without preliminary annealing) did not show any gas release in temperature range of 20-1100 deg. C. This fact indicates on high stability of compositions and strong bond of 'host' oxygen in their lattice. A significant amount of water and oxygen molecules were released from BaCe 0.9 Nd 0.1 O 3 samples whereas water and hydrogen molecules desorption from SrCe 0.95 Y 0.05 O 3 samples took place. Hydrogen molecules desorption was found for strontium cerates samples; no hydrogen molecules release was observed for doped and pure barium cerate samples.Intensive water molecules release from doped samples confirms the necessity of oxygen vacancies creation in these compounds to get properties of proton conductivity, since it was not found any water molecules release from annealed undoped samples of BaCeO 3 It is necessary to notice that oxygen molecules release from these samples took place at ∼1000 deg. C that is significantly higher then from BaCeNdO samples. Forms of high temperatures part of oxygen and low temperature part of water spectra indicate that phase transformations are responsible for oxygen and water molecules desorption in this cases. These results are in good agreement with literature data. Desorption of water molecules from barium and strontium cerates took place. Oxygen desorption took place only from barium cerates. It can be explained as the following: doped barium cerates have

  14. Barium determination in gastric contents, blood and urine by inductively coupled plasma mass spectrometry in the case of oral barium chloride poisoning. (United States)

    Łukasik-Głębocka, Magdalena; Sommerfeld, Karina; Hanć, Anetta; Grzegorowski, Adam; Barałkiewicz, Danuta; Gaca, Michał; Zielińska-Psuja, Barbara


    A serious case of barium intoxication from suicidal ingestion is reported. Oral barium chloride poisoning with hypokalemia, neuromuscular and cardiac toxicity, treated with intravenous potassium supplementation and hemodialysis, was confirmed by the determination of barium concentrations in gastric contents, blood, serum and urine using the inductively coupled plasma mass spectrometry method. Barium concentrations in the analyzed specimens were 20.45 µg/L in serum, 150 µg/L in blood, 10,500 µg/L in urine and 63,500 µg/L in gastric contents. Results were compared with barium levels obtained from a non-intoxicated person. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email:

  15. X-shooter spectroscopy of young stellar objects in Lupus. Lithium, iron, and barium elemental abundances (United States)

    Biazzo, K.; Frasca, A.; Alcalá, J. M.; Zusi, M.; Covino, E.; Randich, S.; Esposito, M.; Manara, C. F.; Antoniucci, S.; Nisini, B.; Rigliaco, E.; Getman, F.


    Aims: With the purpose of performing a homogeneous determination of elemental abundances for members of the Lupus T association, we analyzed three chemical elements: lithium, iron, and barium. The aims were: 1) to derive the lithium abundance for the almost complete sample ( 90%) of known class II stars in the Lupus I, II, III, and IV clouds; 2) to perform chemical tagging of a region where few iron abundance measurements have been obtained in the past, and no determination of the barium content has been done up to now. We also investigated possible barium enhancement at the very young age of the region, as this element has become increasingly interesting in the last few years following the evidence of barium over-abundance in young clusters, the origin of which is still unknown. Methods: Using the X-shooter spectrograph mounted on the Unit 2 (UT2) at the Very Large Telescope (VLT), we analyzed the spectra of 89 cluster members, both class II (82) and class III (7) stars. We measured the strength of the lithium line at λ6707.8 Å and derived the abundance of this element through equivalent width measurements and curves of growth. For six class II stars we also derived the iron and barium abundances using the spectral synthesis method and the code MOOG. The veiling contribution was taken into account in the abundance analysis for all three elements. Results: We find a dispersion in the strength of the lithium line at low effective temperatures and identify three targets with severe Li depletion. The nuclear age inferred for these highly lithium-depleted stars is around 15 Myr, which exceeds by an order of magnitude the isochronal one. We derive a nearly solar metallicity for the members whose spectra could be analyzed. We find that Ba is over-abundant by 0.7 dex with respect to the Sun. Since current theoretical models cannot reproduce this abundance pattern, we investigated whether this unusually large Ba content might be related to effects due to stellar

  16. 9 CFR 3.138 - Primary conveyances (motor vehicle, rail, air, and marine). (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Primary conveyances (motor vehicle, rail, air, and marine). 3.138 Section 3.138 Animals and Animal Products ANIMAL AND PLANT HEALTH... (motor vehicle, rail, air, and marine). (a) The animal cargo space of primary conveyances used in...

  17. Galvanic interactions of HE15 /MDN138 & HE15 /MDN250 alloys in natural seawater (United States)

    Parthiban, G. T.; Subramanian, G.; Muthuraman, K.; Ramakrishna Rao, P.


    HE15 is a heat treatable high strength alloy with excellent machinability find wide applications in aerospace and defence industries. In view of their excellent mechanical properties, workability, machinability, heat treatment characteristics and good resistance to general and stress corrosion cracking, MDN138 & MDN250 have been widely used in petrochemical, nuclear and aerospace industries. The galvanic corrosion behaviour of the metal combinations HE15 /MDN138 and HE15 /MDN250, with 1:1 area ratio, has been studied in natural seawater using the open well facility of CECRI's Offshore Platform at Tuticorin for a year. The open circuit potentials of MDN138, MDN250 and HE15 of the individual metal, the galvanic potential and galvanic current of the couples HE15 /MDN138 and HE15 /MDN250 were periodically monitored throughout the study period. The calcareous deposits on MDN138 and MDN250 in galvanic contact with HE15 were analyzed using XRD. The electrochemical behaviors of MDN138, MDN250 and HE15 in seawater have been studied using an electrochemical work station. The surface characteristics of MDN138 and MDN250 in galvanic contact with HE15 have been examined with scanning electron microscope. The results of the study reveal that HE15 offered required amount of protection to MDN138 & MDN250.

  18. 7 CFR 58.138 - Quality testing of milk from new producers. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Quality testing of milk from new producers. 58.138... Service 1 Quality Specifications for Raw Milk § 58.138 Quality testing of milk from new producers. A quality examination and tests shall be made on the first shipment of milk from a producer shipping milk to...

  19. 33 CFR 138.240 - Procedure for calculating limit of liability adjustments for inflation. (United States)


    ... of liability adjustments for inflation. 138.240 Section 138.240 Navigation and Navigable Waters COAST... calculating limit of liability adjustments for inflation. (a) Formula for calculating a cumulative percent... every three years from the year the limits of liability were last adjusted for inflation, the Director...

  20. 11 CFR 100.138 - Sale of food and beverages by vendor. (United States)


    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Sale of food and beverages by vendor. 100.138...) Exceptions to Expenditures § 100.138 Sale of food and beverages by vendor. The sale of any food or beverage..., is not an expenditure, provided that the charge is at least equal to the cost of such food or...

  1. An evaluation of a radiographer-led barium enema service in the diagnosis of colorectal cancer

    International Nuclear Information System (INIS)

    Law, R.L.; Slack, N.F.; Harvey, R.F.


    Purpose: This study was undertaken to assess the sensitivity and efficacy of a radiographer-led double contrast barium enema (DCBE) service in the diagnosis of colorectal cancer (CRC). Methods: All patients on the CRC database from its inception in 1997 until the end of 2004 were cross-referenced with the radiology database. Details were recorded of any patient who had undergone a DCBE examination at any time prior to histological confirmation of colorectal cancer. All the DCBE in this review were performed and reported by radiographers as part of a protocol of double reporting with a consultant radiologist. The radiographers and radiologists reports were reviewed for each patient. Notes and X-rays were also reviewed when necessary. Reporting sensitivity was compared with the Royal College of Radiologists (RCR) barium enema examination targets for the diagnosis of colorectal carcinoma. Results: 362 of the 1005 patients on the CRC database had undergone a DCBE. Combined radiographer and radiologist reporting demonstrated a diagnostic sensitivity of 98% for CRC and were cancer specific in 93% of cases. These results compared favourably with the referenced RCR sensitivity targets for colorectal cancer. Reporting discord only occurred with the terminology of reporting 13 equivocal polyps. None of these polyps were neoplastic and thus did not affect CRC sensitivity. Conclusion: Radiographer reporting compares favourably with published CRC sensitivity data of more expensive techniques such as CT colonography. A protocol of radiographer/radiographer double reporting is now used at this hospital with radiological second opinion being acquired for more complex abnormal DCBE examination appearances. This service is a safe, cost-effective option that should not be overlooked with the increasing demand for CRC screening

  2. Perforated colorectal neoplasms: Correlation of clinical, barium, and CT examinations

    International Nuclear Information System (INIS)

    Hulnick, D.H.; Megibow, A.J.; Gordon, R.; Balthazar, E.J.


    Findings on clinical, barium enema, and CT examinations in 24 patients with perforated colorectal neoplasms were retrospectively reviewed. In 12 patients with fever and leukocytosis, the clinical diagnoses were diverticulitis (n=8), appendicitis (n=2), pelvic inflammatory disease (n=2), and perforation of a known carcinoma (n=1). In 12 nontoxic patients, the clinical diagnoses were malignancy (n=8), obstruction (n=3) and an abdominal mass (n=1). In 18 barium enema examinations, the radiologic impression was uncomplicated carcinoma (n=9), perforated carcinoma (n=6), and diverticulitis (n=3). Twenty-two CT examinations revealed pericolic inflammation in all cases and macroperforation in 12. The primary tumor was evident in 14 patients, liver metastases were found in six, and ascites was present in three. CT findings influenced the management of patients initially suspected of having inflammatory conditions

  3. Electromagnetic properties of photodefinable barium ferrite polymer composites

    Directory of Open Access Journals (Sweden)

    Olusegun Sholiyi


    Full Text Available This article reports the magnetic and microwave properties of a Barium ferrite powder suspended in a polymer matrix. The sizes for Barium hexaferrite powder are 3–6 μm for coarse and 0.8–1.0 μm for the fine powder. Ratios 1:1 and 3:1 (by mass of ferrite to SU8 samples were characterized and analyzed for predicting the necessary combinations of these powders with SU8 2000 Negative photoresist. The magnetization properties of these materials were equally determined and were analyzed using Vibrating Sample Magnetometer (VSM. The Thru, Reflect, Line (TRL calibration technique was employed in determining complex relative permittivity and permeability of the powders and composites with SU8 between 26.5 and 40 GHz.

  4. Influence of Magnetron Effect on Barium Hexaferrite Thin Layers

    International Nuclear Information System (INIS)

    Hassane, H.; Chatelon, J.P.; Rousseau, J.J; Siblini, A.; Kriga, A.


    In this paper, we study the effects of a magnet, located in the cathode, on barium hexaferrite thin films deposited by RF magnetron sputtering technique. During the process, these effects can modify thickness, roughness and stress of coatings. The characteristics of the deposited layers depend on the substrate position that is located opposite of magnetron cathode. In the m agnetron area , one can observe that the high stress can produce cracks or detachment of layers and the increasing of both depositing rate and surface roughness. After sputtering elaboration, barium hexaferrite films are in a compressive stress mode. But, after the post-deposition heat treatment these films are in a tensile stress mode. To improve the quality of BaM films, the subsrtate has to be set outside the magnetron area. (author)

  5. Synthesis of Barium Titanate Piezoelectric Ceramics for Multilayer Actuators (MLAs

    Directory of Open Access Journals (Sweden)

    Biglar Mojtaba


    Full Text Available In this paper the characteristics of BaTiO3 ceramics synthesized by solid state method is presented. In order to receive the monophase ceramics the double activation and calcination were applied. A spray drier was used to granulate the powder of BaTiO3. Isostatic and uniaxial pressing were applied to manufacture the barium titanate pellets. The properties of fabricated BaTiO3 ceramics were determined at different stages of production. After the sintering phase, the hardness, the bending strength, the fracture toughness, and the coefficient of thermal expansion of barium titanate sinter were estimated. The BaTiO3 powder is characterized by spherical grains and the average size of 0.5 μm. The small value of the specific surface area of granulate ensured good properties of material mouldability and finally allowed to receive sinters of high density.

  6. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine. (United States)

    Genchi, Giada Graziana; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni


    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these 'smart' nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation.

  7. Attainment of barium hexaferrite nanoparticles by a Pechini Method

    International Nuclear Information System (INIS)

    Galvao, S.B.; Timoteo, Jr.J.F.; Melo, G.M.; Souto, K.K.O.; Florioto, N.T.; Paskocimas, C.A.


    The barium hexaferrites (BaFe 12 O 19 ) are used as a compound of materials applied in electronic devices, as medical devices, satellites, dada servers systems, wireless systems and others. The general properties are strongly related to the microstructure and morphology, and the particles size decrease results in advantages to the majority applications, mainly the high-tech thumbnail devices. These magnetic ceramic materials, with perovskite structure, are traditionally prepared my conventional oxide mixture synthesis. In this work was studied the nanoparticle synthesis of BaFe 12 O 19 by the precursors polymeric method (Pechini), using as precursors the barium carbonate and the iron nitrate, under different thermal treatment conditions. The samples were characterized by XRD, SEM, BET, DTA and TGA. The results presented the attainment of a monophasic powder with particles size around 100 nm. (author)

  8. Barium fluoride surface preparation, analysis and UV reflective coatings at Lawrence Livermore National Laboratory

    International Nuclear Information System (INIS)

    Wuest, C.R.


    Lawrence Livermore National Laboratory (LLNL) has begun a program of study on barium fluoride scintillating crystals for the Barium Fluoride Electromagnetic Calorimeter Collaboration. This program has resulted in a number of significant improvements in the mechanical processing, polishing and coating of barium fluoride crystals. Techniques have been developed using diamond-loaded pitch lapping that can produce 15 angstrom RMS surface finishes over large areas. These lapped surfaces have been shown to be crystalline using Rutherford Back-scattering (RBS). Also, special polishing fixtures have been designed based on mounting technology developed for the 1.1 m diameter optics used in LLNL's Nova Laser. These fixtures allow as many as five 25--50 cm long barium fluoride crystals to be polished and lapped at a time with the necessary tolerances for the 16,000 crystal Barium Fluoride Calorimeter. In addition, results will be presented on coating barium fluoride with UV reflective layers of magnesium fluoride and aluminum

  9. Vanadium doped barium germanate microrods and photocatalytic properties under solar light (United States)

    Pei, L. Z.; Wang, S.; Liu, H. D.; Lin, N.; Yu, H. Y.


    Vanadium doped barium germanate microrods have been prepared by a facile hydrothermal process. The obtained vanadium doped barium germanate microrods are proved to be hexagonal BaGe4O9 and orthorhombic Ba2V2O7 phases by X-ray diffraction. Scanning electron microscopy shows that the vanadium doped barium germanate products consist of microrods with the diameter of microscale size. The diameter of the mirorods decreases from 800 nm to 150 nm with the vanadium doping mass percentage increasing from 1% to 10%. Solid UV-vis diffuse reflectance spectra show that the band gap of the vanadium doped barium germanate is smaller than that of the undoped barium germanate. The photocatalytic activity has been greatly enhanced by the vanadium doping. The vanadium doped barium germanate microrods exhibit great application potential for the photocatalytic degradation of methylene blue under solar light irradiation.

  10. Clinical efficacy of a new barium sulfate for abdominal CT

    International Nuclear Information System (INIS)

    Yamada, Tatuya; Kohno, Mitio; Uematsu, Sadao; Nisitani, Hiromu; Tanaka, Takao.


    Computed Tomography of the abdomen requires that the intestines are filled with contrast medium so that the gut is not misinterpreted as a pathologic process. Besides, normal structures may be difficult to delimit in patients with scanty intra-abdominal fat. In Japan, up to date, only a single contrast medium has been available for this purpose, Gastrografin and thus identical with the intravasculaly used Urografin or Angiografin. A new Barium Sulfate suspention (Fusimi Seiyaku, Kagawa) for computed tomographic use has been dilute solution (4.77 %) and with suspending agents that prevent a rapid sedimentation of the Barium Sulfate. The aim of this investigation was to compare Gastrografin with a new barium regarding patients tolerance, side effects and diagnostic information. The investigation comprised 146 patients who were reffered for abdominal CT and was carried out by 5 facilities; National Cancer Center, Kobe University, Chiba University, Kyushu University and Juntendo University. Diagnostic information was judged with respect to the filling of the stomach and intestines, the presence of imaging artifacts and finally clinical estimation. Patients tolerance was investigated as regards taste and side effects. Good filling of the stomach and intestines was obtained in this investigation. However, imaging artifacts occured in only a few cases. The imaging artifacts appeared almost exclusively to arise in the boundary layer between the bowel gas and contrast medium, and were most common in the stomach. However, the contrasting effect of this medium did not in itself appear to cause any imaging artifacts. Fushimi's new barium seems to be preffered because of its lesser tendency to arise artifacts and better tendency to make good filling of the stomach and intestines. Moreover, this investigation did not have any side effects. (J.P.N.)

  11. Optical and luminescent properties of the lead and barium molybdates

    Energy Technology Data Exchange (ETDEWEB)

    Spassky, D.A. E-mail:; Ivanov, S.N.; Kolobanov, V.N.; Mikhailin, V.V.; Zemskov, V.N.; Zadneprovski, B.I.; Potkin, L.I


    Time-resolved luminescence as well as excitation and reflectivity spectra of the oriented lead and barium molybdate single crystals were studied using synchrotron radiation. Features in reflectivity spectra in the fundamental absorption region were analyzed. The contribution of electronic states of lead cation to the formation of the bandgap in PbMoO{sub 4} is supposed. The role of lead states in the intrinsic luminescence of PbMoO{sub 4} is discussed.

  12. Sulphate removal from industrial effluents through barium sulphate precipitation

    CSIR Research Space (South Africa)

    Swanepoel, H


    Full Text Available surface wetland g Gas HiPRO Hi recovery Precipitating Reverse Osmosis l Liquid MBO Magnesium Barium Oxide ORP Oxidation-reduction potential RO Reverse osmosis s Solid SANAS South African National Accreditation System SANS... South African National Standards SEM Scanning electron microscopy SF wetland Subsurface flow wetland SPARRO Slurry precipitation and recycle reverse osmosis SRO Seeded reverse osmosis TDS Total Dissolved Solids WHO World Health...

  13. Structure and multiferroic properties of barium hexaferrite ceramics

    International Nuclear Information System (INIS)

    Tan, Guolong; Chen, Xiuna


    Simultaneous occurrence of large ferroelectricity and strong ferromagnetism have been observed in barium hexaferrite ceramics. Barium hexaferrite (BaFe 12 O 19 ) powders with hexagonal crystal structure were successfully synthesized in a polymer precursor method using barium acetate and ferric acetylacetonate as the precursors. The powders were pressed into pellets which were sintered into ceramics at 1200 °C and 1300 °C for 1 h. The structure and morphology of the ceramics were examined using X-ray diffraction and field emission scanning electron microscopy. Large spontaneous polarization was observed in the BaFe 12 O 19 ceramics at room temperature, revealing a clear ferroelectric hysteresis loop. The maximum remanent polarization of the BaFe 12 O 19 ceramic was estimated approximately 11.8 μC cm −2 . The FeO 6 octahedron in its perovskite-like hexagonal unit cell and the shift of Fe 3+ off the center of octahedron are suggested to be the origin of the polarization in BaFe 12 O 19 . The BaFe 12 O 19 ceramics also showed strong ferromagnetism at room temperature. - Graphical abstract: Ferroelectric hysteresis loops of BaFe 12 O 19 ceramics measured at a frequency of 120 Hz, which shows that the ceramics sintered at 1200 °C is ferroelectric with P r ∼11.8 μC/cm 2 . Highlights: ► Large ferroelectricity and strong ferromagnetism were observed in barium hexaferrite ceramics. ► The maximum remanent polarization of the BaFe 12 O 19 ceramic was estimated to be 11.8 μC cm −2 . ► The FeO 6 octahedron and off-center shift of Fe 3+ are suggested to be the origin of the polarization.

  14. Microwave-hydrothermal synthesis of barium strontium titanate nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Simoes, A.Z., E-mail: [Universidade Federal de Itajuba- Unifei - Campus Itabira, Rua Sao Paulo, 377, Bairro, Amazonas, CEP 35900-37, Itabira, MG (Brazil); Universidade Estadual Paulista- Unesp - Faculdade de Engenharia de Guaratingueta, Av. Dr. Ariberto Pereira da Cunha, 333, Bairro Pedregulho, CEP 12516-410 Guaratingueta, SP (Brazil); Moura, F.; Onofre, T.B. [Universidade Federal de Itajuba- Unifei - Campus Itabira, Rua Sao Paulo, 377, Bairro, Amazonas, CEP 35900-37, Itabira, MG (Brazil); Ramirez, M.A.; Varela, J.A.; Longo, E. [Laboratorio Interdisciplinar em Ceramica (LIEC), Departamento de Fisico-Quimica, Instituto de Quimica, UNESP, CEP 14800-900, Araraquara, SP (Brazil)


    Research highlights: {yields} Barium strontium titanate nanoparticles were obtained by the Hydrothemal microwave technique (HTMW) {yields} This is a genuine technique to obtain nanoparticles at low temperature and short times {yields} Barium strontium titanate free of carbonates with tetragonal structure was grown at 130 {sup o}C. - Abstract: Hydrothermal-microwave method (HTMW) was used to synthesize crystalline barium strontium titanate (Ba{sub 0.8}Sr{sub 0.2}TiO{sub 3}) nanoparticles (BST) in the temperature range of 100-130 {sup o}C. The crystallization of BST with tetragonal structure was reached at all the synthesis temperatures along with the formation of BaCO{sub 3} as a minor impurity at lower syntheses temperatures. Typical FT-IR spectra for tetragonal (BST) nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH- groups, commonly found in materials obtained by HTMW process. FE/SEM revealed that lower syntheses temperatures led to a morphology that consisted of uniform grains while higher syntheses temperature consisted of big grains isolated and embedded in a matrix of small grains. TEM has shown BST nanoparticles with diameters between 40 and 80 nm. These results show that the HTMW synthesis route is rapid, cost effective, and could serve as an alternative to obtain BST nanoparticles.

  15. Early colon cancer : findings on double contrast barium enema

    International Nuclear Information System (INIS)

    Kim, Seung Kwon; Lim, Jae Hoon; Lee, Soon Jin; Lim, Hyo Keun


    The purpose of this study is to describe the radiologic findings of early colon cancer on double-contrast barium enema. We retrospectively reviewed the double-contrast barium enemas of eight patients (M:F = 6:2; mean age : 67 yrs; range : 48-77 yrs) who were pathologically proven to be early colon cancer. The location, size and gross morphology of lesions was evaluated using double-contrast barium enema, while depth of invasion, degree of differentiation, precancerous lesions and lymph node metastasis were evaluated histopathologically. Early colon cancer was found in the rectum (n=4), sigmoid colon (n=3) and ascending colon (n=1). The size of mass ranged from 2.3 ∼ 8.3 (mean, 4.6) cm. And the polypoid type was most common (n=7); this was subdivided into sessile (Is, n=5), semipedunculated (Isp, n=1) and pedunculated type (Ip, n=1). Another mass was a sessile polypoid combined with a flat depressed lesion. In eight cases, four cancers were confined to the mucosa, while the remaining four had infiltrated the submucosa. Most cancers arose from villous and villotubular adenoma. All cases were well-differentiated adenocarcinoma and no metastasis to lymph nodes had occurred. In early colon cancer, lesions were mainly polypoid and large. Most arose from villous and villotubular adenoma. (author). 19 refs., 1 tab., 3 figs

  16. Aspiration of barium contrast medium in an elderly man with disordered swallowing


    Bağcı Ceyhan, B.; Çelikel, T.; Koç, M.; Ahıskalı, R.; Biren, T.; Ataizi Çelikel, Ç.


    The aspiration of contrast medium during the investigation of gastrointestinal diseases is a well recognized hazard, particularly in patients with swallowing disorders. A case is reported in which accidental aspiration of contrast barium occurred owing to disordered swallowing in an elderly man. The infiltration on chest x-ray persisted 2 years after barium contrast aspiration. Inflammatory reaction and retractile, granular material observed in lung biopsy specimens suggested barium-induced p...

  17. Strontium-90 sorption from fresh waters in the process of barium manganite modification

    International Nuclear Information System (INIS)

    Ryzhen'kov, A.P.; Egorov, Yu.V.


    Strontium-90 extraction by barium manganite from fresh water (natural non-salty water in open ponds) may be increased adding to the solution the sulfate anion containing reagents that modify a sorbent and chemically bind a sorbate. Heterogeneous anion-exchanging reaction of barium manganite transformation into barium sulfate-manganese dioxide and simultaneous coprecipitation of strontium sulfate (microelement) occur as a result of it. 9 refs., 4 figs., 1 tab

  18. Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, Weitang; Zhang, Zhiyong; Liu, Jinbo; Li, Zhen; Song, Junmin; Wu, Changcai [Department of Colorectal Surgery, The First Affiliated Hospital and Institute of Clinical Medicine, Zhengzhou University, 450052 Zhengzhou (China); Wang, Guixian, E-mail: [Department of Colorectal Surgery, The First Affiliated Hospital and Institute of Clinical Medicine, Zhengzhou University, 450052 Zhengzhou (China)


    Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation.

  19. Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium

    International Nuclear Information System (INIS)

    Yuan, Weitang; Zhang, Zhiyong; Liu, Jinbo; Li, Zhen; Song, Junmin; Wu, Changcai; Wang, Guixian


    Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation

  20. Effects of powdered versus liquid barium on the viscosity of fluids used in modified swallow studies

    Energy Technology Data Exchange (ETDEWEB)

    Baron, J.; Alexander, T. [Univ. of Alberta, Dept. of Radiology, Edmonton, Alberta (Canada)


    To determine if the viscosity of thickened juice mixtures used in modified barium swallow studies significantly changes with the addition of powdered barium. We also describe a test formulation created using liquid barium, which has a negligible effect on juice viscosity. The viscosities of water and standardized honey- and nectar-consistency juices mixed with different amounts of powdered barium were measured by timing the laminar flow of a given initial hydrostatic head of fluid under gravity though an orifice of fixed diameter. Standardized juices were then mixed with a liquid formulation of barium and with measured quantities of water to produce viscosities that more closely equated with those of the standardized juices. With the addition of powdered barium, viscosity increased in all fluids, most markedly with the nectar-consistency juice. Liquid barium formulations maintained the viscosities of the original thickened juices. Rendering juices radio-opaque with barium powder results in dramatic increases in the viscosity of the resulting mixture and compromises diagnostic accuracy. Liquid barium preparations have the advantage that they can be rapidly and accurately dispensed by syringe, and their use does not significantly increase the viscosity of the preparation. (author)

  1. Results of a cooperative study for the evaluation of the barium meal Falibaryt HD

    International Nuclear Information System (INIS)

    Reisinger, W.; Liess, G.; Beckmann, D.; Block, H.G.; Dietze, R.; Grosche, N.; Hall, E.; Lasch, G.; Knoth, H.J.; Kroeger, W.


    The diagnostic capabilities of radiologic investigations of the stomach in double contrast can be significantly improved with high-density low-viscosity barium meals. In the GDR the barium meal Falibaryt HD with a barium sulfate content of 215 g per 100 ml suspension has been developed. In nearly 1,000 radiologic investigations of the stomach (81% in relaxation with spasmolytics, 66% without hypotony) all fine structures were well imaged and the preparation therefore is comparable with the best barium meals presently on the market. (author)

  2. Barium titanate coated with magnesium titanate via fused salt method and its dielectric property

    International Nuclear Information System (INIS)

    Chen Renzheng; Cui Aili; Wang Xiaohui; Li Longtu


    Barium titanate fine particles were coated homogeneously with magnesium titanate via the fused salt method. The thickness of the magnesium titanate film is 20 nm, as verified by TEM and XRD. The mechanism of the coating is that: when magnesium chloride is liquated in 800 deg. C, magnesium will replace barium in barium titanate, and form magnesium titanate film on the surface of barium titanate particles. Ceramics sintered from the coated particles show improved high frequency ability. The dielectric constant is about 130 at the frequency from 1 to 800 MHz

  3. High Resolution Computed Tomography Appearences of late sequelae of Barium Aspiration in an asymptomatic young child

    International Nuclear Information System (INIS)

    Venkatraman, Bhat; Rahman, Hatim A.; Abdul-Wahab, Atiqa


    Barium aspiration is a well-known complication of upper gastro-intestinal studies. Consequences of aspiration are generally insignificant and leave no permanent changes in the lung parenchyma. However, large quantities of high density barium, if aspirated, lead to silent interstitial changes and fibrosis. High-resolution computed tomography HRCT appearances of lung changes have been demonstrated in adults; few such reports are available in the pediatric literature. We report a case of a child who aspirated barium 3 months before this presentation. The HRCT appearances of barium aspiration are presented with a review of the literature. (author)

  4. Hydrothermal synthesis of barium germanate microrods and photocatalytic degradation performance for methyl blue

    Energy Technology Data Exchange (ETDEWEB)

    Pei, L.Z., E-mail: [Key Lab of Materials Science and Processing of Anhui Province, School of Materials Science and Engineering, Anhui University of Technology, Ma’anshan, Anhui 243002 (China); Wang, S.; Xie, Y.K.; Yu, H.Y. [Key Lab of Materials Science and Processing of Anhui Province, School of Materials Science and Engineering, Anhui University of Technology, Ma’anshan, Anhui 243002 (China); Guo, Y.H. [Department of Materials Science, Fudan University, Shanghai 200433 (China)


    Highlights: • Barium germanate microrods have been synthesized by a simple hydrothermal process. • The size of the barium germanate microrods can be controlled by growth conditions. • Barium germanate microrods exhibit good photocatalytic activities for methyl blue. -- Abstract: Barium germanate microrods were prepared by a facile hydrothermal process without any surfactants. X-ray diffraction (XRD), scanning electron microscopy (SEM), Fourier transform infrared (FTIR) and photoluminescence spectra were used to characterize the structure, morphology, size and optical properties of the barium germanate microrods. XRD and SEM observations show that the microrods with hexagonal BaGe{sub 4}O{sub 9} phase have the diameter of 500 nm to 1.5 μm. The size of the barium germanate microrods can be tuned by controlling the hydrothermal temperature, reaction time and surfactants. The influence factors including the irradiation time, content of the barium germanate microrods and MB concentration on the photocatalytic degradation of methylene blue (MB) have been analyzed. The barium germanate microrods show a MB degradation ratio of 83.49% after the irradiation time for 30 min using 1.25 mg/ml barium germanate microrods in 10 mgL{sup −1} MB solution.

  5. Radiation losses in microwave K{sub u} region by conducting pyrrole/barium titanate and barium hexaferrite based nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Talwinder [Department of Physics, Lovely Professional University, Phagwara 144411 (India); Kumar, Sachin [Department of Chemistry, Guru Nanak Dev University, Amritsar 143005 (India); Narang, S.B. [Department of Electronics Technology, Guru Nanak Dev University, Amritsar 143005 (India); Srivastava, A.K., E-mail: [Department of Physics, Lovely Professional University, Phagwara 144411 (India)


    Nanocomposites of substituted barium hexaferrite and barium titanate embedded in a polymer were synthesized via emulsion polymerization. The study was performed by using X-ray diffraction, Fourier transform infrared spectroscopy, transmission electron microscopy, electron spin resonance spectroscopy, a vibrating sample magnetometer and a vector network analyzer. It is found that maximum radiation loss occur at 16.09 GHz (−14.23 dB) frequency owing to the combined effect of conducting polymer, suitable dielectric and magnetic material. This suggests that prepared material is suitable for radiation losses. Micro structural study reveals the presence of all the phases of the compounds comprises composite. Benzene ring absorption band (at 1183 cm{sup −1}) in FT-IR spectra illustrates the presence of polymer. Surface morphology reveals the presence of array of particles encapsulated by the polymer. - Highlights: • Composites having polymer, barium titanate and hexaferrite have been successfully prepared. • Effective radiation absorption and losses have been achieved. • Magnetic properties have made an impact on shielding effectiveness.

  6. Adsorption behaviors of surface active reagents on barium ferrite magnetic fine particles; Barium ferrite jisei biryushi eno hymen shorizai kyuchaku

    Energy Technology Data Exchange (ETDEWEB)

    Kudo, M.; Otani, T.; Masuko, T. [Yamagata University, Yamagata (Japan). Faculty of Engineering


    The adsorption mode of lecithin (dioleoylphosphatidylcholine) or [3-(methacryloyloxy)propyl] trimethoxysilane (MPS) onto barium ferrite magnetic particles has been investigated by measurements of changes in solution concentration of the surfactant. Both adsortion isotherms of the surface active reagents on barium ferrite particles indicated to be of the Langmuir type. The occupied areas per one molecule on the surface of barium ferrite particles were estimated to be about 70 angstrom{sup 2}/molecule for lecithin and 22 angstrom{sup 2}/molecule for MPS at their saturated adsorption. In X-ray photoelectron spectroscopy (XPS) measurements for the adsorbed lecithin layer, the peak position in the binding energy distribution for the P (2p) photoelectron was observed to shift into slightly higher values with increasing amount of adsorbed lecithin. This implies that dipole-dipole interactions among the lecithin molecules become stronger because of increased high molecular packing in the adsorption layers. However, the peak position for the Si (2p) photoelectron remains almost unchanged due to slight interaction among the adsorbing functional groups onto the particles. 16 refs., 16 figs., 3 tabs.

  7. Basis for early and preferential selection of the E138K mutation in HIV-1 reverse transcriptase. (United States)

    McCallum, Matthew; Oliveira, Maureen; Ibanescu, Ruxandra-Ilinca; Kramer, Victor G; Moisi, Daniela; Asahchop, Eugene L; Brenner, Bluma G; Harrigan, P Richard; Xu, Hongtao; Wainberg, Mark A


    E138K, a G→A mutation in HIV-1 reverse transcriptase (RT), is preferentially selected by etravirine (ETR) and rilpivirine over other substitutions at position E138 that offer greater drug resistance. We hypothesized that there was a mutational bias for the E138K substitution and designed an allele-specific PCR to monitor the emergence of E138A/G/K/Q/R/V during ETR selection experiments. We also performed competition experiments using mutated viruses and quantified the prevalence of E138 minority species in drug-naive patients. E138K, as well as E138G, consistently emerged first during ETR selection experiments, followed by E138A and E138Q; E138R was never selected. Surprisingly, E138K was identified as a tiny minority in 23% of drug-naive subtype B patients, a result confirmed by ultradeep sequencing (UDS). This result could reflect a low fitness cost of E138K; however, E138K was one of the least fit substitutions at codon E138, even after taking into account the deoxynucleoside triphosphate pools of the cells used in competition experiments. Further UDS analysis revealed other minority species in a pattern consistent with the mutational bias of HIV RT. There was no evidence of APOBEC3-hypermutation in these selection experiments or in patients. Our results confirm the mutational bias of HIV-1 in patients and highlight the importance of G→A mutations in HIV-1 drug resistance evolution.

  8. Rilpivirine resistance mutation E138K in HIV-1 reverse transcriptase predisposed by prevalent polymorphic mutations. (United States)

    Hayashida, Tsunefusa; Hachiya, Atsuko; Ode, Hirotaka; Nishijima, Takeshi; Tsuchiya, Kiyoto; Sugiura, Wataru; Takiguchi, Masafumi; Oka, Shinichi; Gatanaga, Hiroyuki


    Rilpivirine is listed as a recommended or alternative key drug in the current ART guidelines. E138K in HIV-1 reverse transcriptase (RT) is a primary mutation in resistance to rilpivirine, although in vitro experiments showed it confers only E138K. The objective of this study was to reveal the mechanism amplifying rilpivirine resistance conferred by E138K. HIV-1 RT sequences were compared in patients who failed rilpivirine-containing ART virologically. The effects of mutations commonly identified with E138K on rilpivirine susceptibility were analysed by using recombinant HIV-1 variants. Rilpivirine-containing ART was introduced in 162 HIV-1-infected patients at the outpatient clinic of the AIDS Clinical Center (National Center for Global Health and Medicine, Tokyo, Japan) between May 2012 and June 2015. Virological treatment failure occurred in six of these patients. E138K emerged in three patients while other rilpivirine resistance mutations emerged in the other three patients. I135T/L were identified in only three patients with E138K and existed before the introduction of rilpivirine-containing ART. Analysis of recombinant HIV-1 variants indicated that E138K conferred low-level rilpivirine resistance and that coexistence of I135T/L with E138K amplified the resistance. I135T/L, escape mutations from HLA-B*51/52-restricted cytotoxic T lymphocytes, which are prevalent in Japan, may predispose HIV-1 to harbour E138K upon failure of rilpivirine-containing ART. The mutation patterns of drug resistance may vary due to baseline polymorphic mutations. © The Author 2016. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please e-mail:

  9. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    DEFF Research Database (Denmark)

    Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan


    Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators......-regulated during osteoblast differentiation of hMSCs. Overexpression of miR-138 inhibited osteoblast differentiation of hMSCs in vitro, whereas inhibition of miR-138 function by antimiR-138 promoted expression of osteoblast-specific genes, alkaline phosphatase (ALP) activity, and matrix mineralization. Furthermore...

  10. A review of the health impacts of barium from natural and anthropogenic exposure. (United States)

    Kravchenko, Julia; Darrah, Thomas H; Miller, Richard K; Lyerly, H Kim; Vengosh, Avner


    There is an increasing public awareness of the relatively new and expanded industrial barium uses which are potential sources of human exposure (e.g., a shale gas development that causes an increased awareness of environmental exposures to barium). However, absorption of barium in exposed humans and a full spectrum of its health effects, especially among chronically exposed to moderate and low doses of barium populations, remain unclear. We suggest a systematic literature review (from 1875 to 2014) on environmental distribution of barium, its bioaccumulation, and potential and proven health impacts (in animal models and humans) to provide the information that can be used for optimization of future experimental and epidemiological studies and developing of mitigative and preventive strategies to minimize negative health effects in exposed populations. The potential health effects of barium exposure are largely based on animal studies, while epidemiological data for humans, specifically for chronic low-level exposures, are sparse. The reported health effects include cardiovascular and kidney diseases, metabolic, neurological, and mental disorders. Age, race, dietary patterns, behavioral risks (e.g., smoking), use of medications (those that interfere with absorbed barium in human organism), and specific physiological status (e.g., pregnancy) can modify barium effects on human health. Identifying, evaluating, and predicting the health effects of chronic low-level and moderate-level barium exposures in humans is challenging: Future research is needed to develop an understanding of barium bioaccumulation in order to mitigate its potential health impacts in various exposured populations. Further, while occupationally exposed at-risk populations exist, it is also important to identify potentially vulnerable subgroups among non-occupationally exposed populations (e.g., elderly, pregnant women, children) who are at higher risk of barium exposure from drinking water and food.

  11. The diagnosis of gastro-esophageal reflux disease cannot be made with barium esophagograms. (United States)

    Saleh, C M G; Smout, A J P M; Bredenoord, A J


    For over 50 years, barium studies have been used to diagnose gastro-esophageal reflux disease (GERD), but the value of this test is controversial. Our study aimed to determine if barium esophagograms can be used to diagnose GERD. Barium esophagograms and pH-impedance measurement were performed in 20 subjects with reflux symptoms. pH-impedance measurements were used as gold standard for the diagnosis of GERD. Gastro-esophageal reflux measured with the barium study was defined as a positive outcome. 50% of patients presented gastro-esophageal reflux on the barium esophagogram. No significant differences were observed in acid exposure time between subjects with (median: 7.4%; interquartile range, IQR: 8.4%) or without reflux at barium esophagography (median: 5.95%; IQR: 13.05%; p > 0.05). Nor did we find differences in median proximal extent of reflux measured with impedance monitoring between patients with a positive (median: 6.7%; IQR: 1.95%) and negative barium study (median: 7.1%; IQR: 0.68%; p > 0.05). Patients with reflux on barium esophagogram did not have a positive symptom association probability more often than those who did not have reflux at barium esophagography. Lastly, there were no differences in numbers of acid, weakly acidic or total reflux episodes between those with positive or negative barium esophagogram (p > 0.05). No correlations were found between the maximum proximal extent of gastro-esophageal reflux during esophagography and pH-impedance parameters. Presence or absence of gastro-esophageal reflux during barium esophagography does not correlate with incidence or extent of reflux observed during 24-h pH-impedance monitoring and is not of value for the diagnosis of GERD. © 2014 John Wiley & Sons Ltd.

  12. Down-regulation of human cytomegalovirus UL138, a novel latency ...

    Indian Academy of Sciences (India)


    Jul 12, 2013 ... and HindIII and inserted into the multiple cloning regions of a luciferase reporter vector pMIR (Ambion, Beijing, China) to construct pMIR-UL138UTR, The sequence containing the. UL138 open reading frame (ORF) and 3′UTR was also am- plified from mRNA-derived cDNA using both sense (5′-.

  13. Anion and cation diffusion in barium titanate and strontium titanate

    International Nuclear Information System (INIS)

    Kessel, Markus Franz


    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO 3 single crystals has been studied by means of 18 O 2 / 16 O 2 isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial pressure and temperature. The

  14. Acute respiratory failure caused by aspiration of high density barium: A case report

    International Nuclear Information System (INIS)

    Park, Ki Soon; Jung, Eun A; Yang, Ik; Lee, Yul; Chung, Soo Young


    Accidental aspiration of barium contrast medium during the upper gastrointestinal study can occur in patients with swallowing disorder, especially in the elderly patients. We experienced a case of respiratory failure followed by death within a few hours in 85 year-old patient after barium aspiration

  15. Integrated treatment of acid mine drainage using cryptocrystalline magnesite and barium chloride

    CSIR Research Space (South Africa)

    Masindi, Vhahangwele


    Full Text Available the formation of barium sulphate. Batch experimental approach was adopted and the documented optimum conditions for both cryptocrystalline magnesite and barium salts were used. This was 60 mins for pre-treatment and 60 mins for polishing the residual sulphate...

  16. Effect of barium doping on the physical properties of zinc oxide ...

    Indian Academy of Sciences (India)


    Jun 9, 2016 ... Abstract. The aim of this work is to study the effect of barium (Ba) doping on the optical, morphological and structural properties of ZnO nanoparticles. Undoped and Ba-doped ZnO have been successfully synthesized via sonochemical method using zinc nitrate, hexamethylenetetramine (HMT) and barium ...

  17. The effect of barium on perceptions of taste intensity and palatability (United States)

    Dietsch, Angela M.; Solomon, Nancy Pearl; Steele, Catriona M.; Pelletier, Cathy A.


    Purpose Barium may affect the perception of taste intensity and palatability. Such differences are important considerations in the selection of dysphagia assessment strategies and interpretation of results. Methods Eighty healthy women grouped by age (younger, older) and genetic taste status (supertaster, non-taster) rated intensity and palatability for seven tastants prepared in deionized water with and without 40% w/v barium: non-carbonated and carbonated water, diluted ethanol, and high concentrations of citric acid (sour), sodium chloride (salty), caffeine (bitter) and sucrose (sweet). Mixed model analyses explored the effects of barium, taster status, and age on perceived taste intensity and acceptability of stimuli. Results Barium was associated with lower taste intensity ratings for sweet, salty, and bitter tastants, higher taste intensity in carbonated water, and lower palatability in water, sweet, sour, and carbonated water. Older subjects reported lower palatability (all barium samples, sour) and higher taste intensity scores (ethanol, sweet, sour) compared to younger subjects. Supertasters reported higher taste intensity (ethanol, sweet, sour, salty, bitter) and lower palatability (ethanol, salty, bitter) than non-tasters. Refusal rates were highest for younger subjects and supertasters, and for barium (regardless of tastant), bitter, and ethanol. Conclusions Barium suppressed the perceived intensity of some tastes and reduced palatability. These effects are more pronounced in older subjects and supertasters, but younger supertasters are least likely to tolerate trials of barium and strong tastant solutions. PMID:24037100

  18. New efficient catalyst for ammonia synthesis: barium-promoted cobalt on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus


    Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia......Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia...

  19. Thermal evolution of exchange interactions in lightly doped barium hexaferrites

    Energy Technology Data Exchange (ETDEWEB)

    Trukhanov, S.V., E-mail: [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Trukhanov, A.V. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Kostishyn, V.G.; Panina, L.V. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); Turchenko, V.A. [Joint Institute for Nuclear Research, Joliot-Curie Str., 141980 Dubna (Russian Federation); Donetsk Institute of Physics and Technology named after A.A. Galkin of the NAS of Ukraine, 72 R.Luxemburg Str., 83114 Donetsk (Ukraine); Kazakevich, I.S. [SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Trukhanov, An.V. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Trukhanova, E.L.; Natarov, V.O. [SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Balagurov, A.M. [Joint Institute for Nuclear Research, Joliot-Curie Str., 141980 Dubna (Russian Federation)


    The lightly doped BaFe{sub 12−x}D{sub x}O{sub 19} (D=Al{sup 3+}, In{sup 3+}; x=0.1 and 0.3) polycrystalline hexaferrite samples have been investigated by powder neutron diffractometry as well as by vibration sample magnetometry in a wide temperature range from 4 K up to 740 K and in magnetic field up to 14 T to establish the nature of Fe{sup 3+}(Al{sup 3+}, In{sup 3+}) – O{sup 2-} - Fe{sup 3+}(Al{sup 3+}, In{sup 3+}) indirect exchange interactions. The crystal structure features such as the ionic coordinates and lattice parameters have been defined and Rietveld refined. The Invar effect has been observed in low temperature range below 150 K. It was explained by the thermal oscillation anharmonicity of ions. It is established that the ferrimagnet-paramagnet phase transition is a standard second-order one. From the macroscopic magnetization measurement the Curie temperature and ordered magnetic moment per nominal iron ion are obtained. From the microscopic diffraction measurement the magnetic moments at all the nonequivalent ionic positions and total magnetic moment per iron ion have been obtained at different temperatures down to 4 K. The light diamagnetic doping mechanism and magnetic structure model are proposed. The effect of light diamagnetic doping on nature of Fe{sup 3+}(Al{sup 3+}, In{sup 3+}) – O{sup 2-} - Fe{sup 3+}(Al{sup 3+}, In{sup 3+}) indirect exchange interactions with temperature increase is discussed. - Highlights: • Crystal structure for lightly doped barium hexaferrites was investigated. • Atomic coordinates and lattice parameters were Rietveld refined. • Magnetic properties for lightly doped barium hexaferrites was investigated. • Magnetic structure for lightly doped barium hexaferrites was investigated. • Magnetic moments at different position and total moment per iron ion were defined.

  20. Evidence against Barium in the Mushroom Trogia venenata as a Cause of Sudden Unexpected Deaths in Yunnan, China


    Zhang, Ying; Li, Yanchun; Wu, Gang; Feng, Bang; Yoell, Shanze; Yu, Zefen; Zhang, Keqin; Xu, Jianping


    This study examined barium concentrations in the mushroom Trogia venenata, the leading culprit for sudden unexpected deaths in Yunnan, southwest China. We found that barium concentrations in T. venenata from Yunnan were low and comparable to other foods, inconsistent with barium concentrations in this mushroom as a significant contributor to these deaths.

  1. Evidence against barium in the mushroom Trogia venenata as a cause of sudden unexpected deaths in Yunnan, China. (United States)

    Zhang, Ying; Li, Yanchun; Wu, Gang; Feng, Bang; Yoell, Shanze; Yu, Zefen; Zhang, Keqin; Xu, Jianping


    This study examined barium concentrations in the mushroom Trogia venenata, the leading culprit for sudden unexpected deaths in Yunnan, southwest China. We found that barium concentrations in T. venenata from Yunnan were low and comparable to other foods, inconsistent with barium concentrations in this mushroom as a significant contributor to these deaths.

  2. Room-temperature biosynthesis of ferroelectric barium titanate nanoparticles. (United States)

    Bansal, Vipul; Poddar, Pankaj; Ahmad, Absar; Sastry, Murali


    The syntheses of inorganic materials by biological systems is characterized by processes that occur close to ambient temperatures, pressures, and neutral pH, as is exemplified by biosilicification and biomineralization processes in nature. Conversely, laboratory-based syntheses of oxide materials often require extremes of temperature and pressure. We have shown here the extracellular, room-temperature biosynthesis of 4-5 nm ternary oxide nanoparticles such as barium titanate (BT) using a fungus-mediated approach. The tetragonality as well as a lowered Curie transition temperature in sub-10 nm particles was established, and the ferroelectricity in these particles was shown using Kelvin probe microscopy.

  3. Barium strontium titanate powders prepared by spray pyrolysis

    International Nuclear Information System (INIS)

    Brankovic, G.; Brankovic, Z.; Goes, M.S.; Paiva-Santos, C.O.; Cilense, M.; Varela, J.A.; Longo, E.


    Ultasonic spray pyrolysis (SP) has been investigated for the production of the barium strontium titanate (BST) powders from the polymeric precursors. The processing parameters, such as flux of aerosol and temperature profile inside the furnace, were optimized to obtain single phase BST. The powders were characterized by the methods of X-ray diffraction analysis, SEM, EDS and TEM. The obtained powders were submicronic, consisting of spherical, polycrystalline particles, with internal nanocrystalline structure. Crystallite size of 10 nm, calculated using Rietveld refinement, is in a good agreement with results of HRTEM

  4. Radium and barium in the Amazon River system

    International Nuclear Information System (INIS)

    Moore, W.S.; Edmond, J.M.


    Data for 226 Ra and 228 Ra in the Amazon River system show that the activity of each radium isotope is strongly correlated with barium concentrations. Two trends are apparent, one for rivers which drain shield areas and another for all other rivers. These data suggest that there has been extensive fractionation of U, Th, and Ba during weathering in the Amazon basin. The 226 Ra data fit a flux model for the major ions indicating that 226 Ra behaves conservatively along the main channel of the Amazon River

  5. Enhanced flexoelectricity through residual ferroelectricity in barium strontium titanate

    International Nuclear Information System (INIS)

    Garten, Lauren M.; Trolier-McKinstry, Susan


    Residual ferroelectricity is observed in barium strontium titanate ceramics over 30 °C above the global phase transition temperature, in the same temperature range in which anomalously large flexoelectric coefficients are reported. The application of a strain gradient leads to strain gradient-induced poling or flexoelectric poling. This was observed by the development of a remanent polarization in flexoelectric measurements, an induced d 33 piezoelectric response even after the strain gradient was removed, and the production of an internal bias of 9 kV m −1 . It is concluded that residual ferroelectric response considerably enhances the observed flexoelectric response

  6. Enhanced flexoelectricity through residual ferroelectricity in barium strontium titanate

    Energy Technology Data Exchange (ETDEWEB)

    Garten, Lauren M., E-mail:; Trolier-McKinstry, Susan [Department of Materials Science and Engineering and Materials Research Institute, The Pennsylvania State University, University Park, Pennsylvania 16802 (United States)


    Residual ferroelectricity is observed in barium strontium titanate ceramics over 30 °C above the global phase transition temperature, in the same temperature range in which anomalously large flexoelectric coefficients are reported. The application of a strain gradient leads to strain gradient-induced poling or flexoelectric poling. This was observed by the development of a remanent polarization in flexoelectric measurements, an induced d{sub 33} piezoelectric response even after the strain gradient was removed, and the production of an internal bias of 9 kV m{sup −1}. It is concluded that residual ferroelectric response considerably enhances the observed flexoelectric response.

  7. Enhanced flexoelectricity through residual ferroelectricity in barium strontium titanate (United States)

    Garten, Lauren M.; Trolier-McKinstry, Susan


    Residual ferroelectricity is observed in barium strontium titanate ceramics over 30 °C above the global phase transition temperature, in the same temperature range in which anomalously large flexoelectric coefficients are reported. The application of a strain gradient leads to strain gradient-induced poling or flexoelectric poling. This was observed by the development of a remanent polarization in flexoelectric measurements, an induced d33 piezoelectric response even after the strain gradient was removed, and the production of an internal bias of 9 kV m-1. It is concluded that residual ferroelectric response considerably enhances the observed flexoelectric response.

  8. Barium sulfate suspension as a negative oral contrast agent for MR imaging

    International Nuclear Information System (INIS)

    Li, K.C.P.; Tart, R.P.; Fitzsimmons, J.R.; Storm, B.; Mao, J.


    Proton spectroscopy with linewidth measurements and MR imaging were performed on various commercially available barium sulfate suspensions as well as inorganic sulfates and barium salts. Approximately 500 mL of 20%, 40%, 60%, and 70% wt/wt single-contrast oral barium sulfate suspensions were administered to four normal volunteers, and MR imaging was performed with both a 1.5-T and a 0.15-T MR imager. As much as 80% of the small bowel and the entire colon were well visualized with the 60% or 70% wt/wt single-contrast barium sulfate suspensions. The authors conclude that barium sulfate suspensions are useful as oral MR contrast agents

  9. Characterization of barium titanate powder doped with sodium and potassium ions by using Rietveld refining

    International Nuclear Information System (INIS)

    Andrade, M.C.; Assis, J.T.; Pereira, F.R.


    A solid-reaction synthesis of doped barium titanate was done by employing barium carbonates, sodium, potassium and titanium oxides with classic procedures. Rietveld refining of X ray diffraction data of perovskite samples with tetragonal symmetry was applying and show good agreement. Besides, the treatment performed from 600 deg C produces nanocrystals of barium titanate with average size of 33 nm. The presence of endothermic peaks related to BaTiO 3 formation at relatively low temperatures was determined by thermal analysis. A pseudo-Voigt Thompson-Cox-Hastings function was used to fit the standard samples of barium titanate. The Rietveld method has showed be efficient to detect the influences of temperature and doping on barium titanate microstructures. (author)

  10. Centrifugal Jet Spinning for Highly Efficient and Large-scale Fabrication of Barium Titanate Nanofibers. (United States)

    Ren, Liyun; Kotha, Shiva P


    The centrifugal jet spinning (CJS) method has been developed to enable large-scale synthesis of barium titanate nanofibers. Barium titanate nanofibers with fiber diameters down to 50 nm and grain sizes around 25 nm were prepared with CJS by spinning a sol-gel solution of barium titanate and poly(vinylpyrrolidone) with subsequent heat treatment at 850 °C. XRD and FTIR analysis demonstrated high purity and tetragonal perovskite structured barium titanate nanofibers. SEM and TEM images confirm the continuous high aspect ratio structure of barium titanate nanofibers after heat treatment. It is demonstrated that the CJS technique offers a highly efficient method for large-scale fabrication of ceramic nanofibers at production rates of up to 0.3 gram/minute.

  11. Prospective comparison of double contrast barium enema plus flexible sigmoidoscopy v colonoscopy in rectal bleeding: barium enema v colonoscopy in rectal bleeding.


    Irvine, E J; O'Connor, J; Frost, R A; Shorvon, P; Somers, S; Stevenson, G W; Hunt, R H


    Rectal bleeding often heralds serious colonic disease. The literature suggests that colonoscopy is superior to barium enema plus sigmoidoscopy, although no good comparative studies exist. Seventy one patients with overt rectal bleeding had prospectively flexible sigmoidoscopy, double contrast barium enema and colonoscopy completed independently. Against the gold standard, the sensitivity and specificity of colonoscopy were 0.69 and 0.78 respectively for a spectrum of colonic lesions, while fo...

  12. Evaluation of gastrointestinal tract transit times using barium-impregnated polyethylene spheres and barium sulfate suspension in a domestic pigeon (Columba livia) model. (United States)

    Bloch, Rebecca A; Cronin, Kimberly; Hoover, John P; Pechman, Robert D; Payton, Mark E


    Barium impregnated polyethylene spheres (BIPS) are used in small animal medicine as an alternative to barium sulfate for radiographic studies of the gastrointestinal tract. To determine the usefulness of BIPS as an alternative to barium suspension in measuring gastrointestinal (GI) transit time for avian species, ventrodorsal radiographs were used to follow the passage of BIPS and 30% barium sulfate suspension through the GI tracts of domestic pigeons (Columba livia). Gastrointestinal transit times of thirty 1.5-mm BIPS administered in moistened gelatin capsules and 30% barium sulfate suspension gavaged into the crop were compared in 6 pigeons. Although the barium suspension passed out of the GI tract of all pigeons within 24 hours, the 1.5-mm BIPS remained in the ventriculus for 368.0 +/- 176.8 hours and did not clear the GI tract for 424.0 +/- 204.6 hours. Although the times for passage of BIPS and 30% barium sulfate suspension from the crop into the ventriculus were not significantly different (P = .14), the times for passage of BIPS from the ventriculus into the large intestine-cloaca and for clearance from the GI tract of the pigeons were significantly longer (P barium sulfate suspension. From the results of this study, we conclude that BIPS are not useful for radiographically evaluating GI transit times in pigeons and are unlikely to be useful in other avian species that have a muscular ventriculus. BIPS may or may not be useful for evaluating GI transit times in species that lack a muscular ventriculus.

  13. Anion and cation diffusion in barium titanate and strontium titanate; Anionen- und Kationendiffusion in Barium- und Strontiumtitanat

    Energy Technology Data Exchange (ETDEWEB)

    Kessel, Markus Franz


    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO{sub 3} single crystals has been studied by means of {sup 18}O{sub 2}/{sup 16}O{sub 2} isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial

  14. Barium titanate core--gold shell nanoparticles for hyperthermia treatments. (United States)

    FarrokhTakin, Elmira; Ciofani, Gianni; Puleo, Gian Luigi; de Vito, Giuseppe; Filippeschi, Carlo; Mazzolai, Barbara; Piazza, Vincenzo; Mattoli, Virgilio


    The development of new tools and devices to aid in treating cancer is a hot topic in biomedical research. The practice of using heat (hyperthermia) to treat cancerous lesions has a long history dating back to ancient Greece. With deeper knowledge of the factors that cause cancer and the transmissive window of cells and tissues in the near-infrared region of the electromagnetic spectrum, hyperthermia applications have been able to incorporate the use of lasers. Photothermal therapy has been introduced as a selective and noninvasive treatment for cancer, in which exogenous photothermal agents are exploited to achieve the selective destruction of cancer cells. In this manuscript, we propose applications of barium titanate core-gold shell nanoparticles for hyperthermia treatment against cancer cells. We explored the effect of increasing concentrations of these nanoshells (0-100 μg/mL) on human neuroblastoma SH-SY5Y cells, testing the internalization and intrinsic toxicity and validating the hyperthermic functionality of the particles through near infrared (NIR) laser-induced thermoablation experiments. No significant changes were observed in cell viability up to nanoparticle concentrations of 50 μg/mL. Experiments upon stimulation with an NIR laser revealed the ability of the nanoshells to destroy human neuroblastoma cells. On the basis of these findings, barium titanate core-gold shell nanoparticles resulted in being suitable for hyperthermia treatment, and our results represent a promising first step for subsequent investigations on their applicability in clinical practice.

  15. Synthesis of Barium Titanate Using Deep Eutectic Solvents. (United States)

    Boston, Rebecca; Foeller, Philip Y; Sinclair, Derek C; Reaney, Ian M


    Novel synthetic routes to prepare functional oxides at lower temperatures are an increasingly important area of research. Many of these synthetic routes, however, use water as the solvent and rely on dissolution of the precursors, precluding their use with, for example, titanates. Here we present a low-cost solvent system as a means to rapidly create phase-pure ferroelectric barium titanate using a choline chloride-malonic acid deep eutectic solvent. This solvent is compatible with alkoxide precursors and allows for the rapid synthesis of nanoscale barium titanate powders at 950 °C. The phase and morphology were determined, along with investigation of the synthetic pathway, with the reaction proceeding via BaCl 2 and TiO 2 intermediates. The powders were also used to create sintered ceramics, which exhibit a permittivity maximum corresponding to a tetragonal-cubic transition at 112 °C, as opposed to the more conventional temperature of ∼120 °C. The lower-than-expected value for the ferro- to para-electric phase transition is likely due to undetectable levels of contaminants.

  16. Studies on Nano Barium Strontium Titanate/Cellulose Derivatives Composites

    Directory of Open Access Journals (Sweden)

    Y. Hamzeh


    Full Text Available Studies were carried out on the preparation and properties of the composites made from cellulose acetate butyrate and cellulose acetate propionate with various amounts of barium strontium titanate nano-particle. The nano-particles of barium strontium titanate (BST with formulation of Ba0.77Sr0.23TiO3 were made by sol-gel method and their purity and particle size were analyzed by X-ray diffraction (XRD. The composites were prepared with BST nano-particle loading of 10 to 50 vol%, and their distribution in the composites studied using SEM imaging. The dielectric constant of the composites was measured at 1 kHz and 100 kHz at room temperature. It was found that the adopted procedure produced dense and uniform composites. The dielectric constant of the composites increased with the solid contentof BST and followed the modified Lichtenecker equation. The increasing rate of dielectric constant with increased BST content was more pronounced for the BST/CAP composite. The dielectric constant of the composites decreased withincreasing the frequency which was more obvious at higher loading of BST nano-particle

  17. Barium titanate core – gold shell nanoparticles for hyperthermia treatments (United States)

    FarrokhTakin, Elmira; Ciofani, Gianni; Puleo, Gian Luigi; de Vito, Giuseppe; Filippeschi, Carlo; Mazzolai, Barbara; Piazza, Vincenzo; Mattoli, Virgilio


    The development of new tools and devices to aid in treating cancer is a hot topic in biomedical research. The practice of using heat (hyperthermia) to treat cancerous lesions has a long history dating back to ancient Greece. With deeper knowledge of the factors that cause cancer and the transmissive window of cells and tissues in the near-infrared region of the electromagnetic spectrum, hyperthermia applications have been able to incorporate the use of lasers. Photothermal therapy has been introduced as a selective and noninvasive treatment for cancer, in which exogenous photothermal agents are exploited to achieve the selective destruction of cancer cells. In this manuscript, we propose applications of barium titanate core–gold shell nanoparticles for hyperthermia treatment against cancer cells. We explored the effect of increasing concentrations of these nanoshells (0–100 μg/mL) on human neuroblastoma SH-SY5Y cells, testing the internalization and intrinsic toxicity and validating the hyperthermic functionality of the particles through near infrared (NIR) laser-induced thermoablation experiments. No significant changes were observed in cell viability up to nanoparticle concentrations of 50 μg/mL. Experiments upon stimulation with an NIR laser revealed the ability of the nanoshells to destroy human neuroblastoma cells. On the basis of these findings, barium titanate core–gold shell nanoparticles resulted in being suitable for hyperthermia treatment, and our results represent a promising first step for subsequent investigations on their applicability in clinical practice. PMID:23847415

  18. Materials Synthesis Of Barium Hexa ferrite Used Local Natural Resources

    International Nuclear Information System (INIS)

    Ridwan; Sulungbudi, Grace Tj.; Mujamilah


    The magnetic materials of barium hexa ferrites, Ba O.6Fe 2 O 3 successfully synthesized by powder metallurgy method used local natural resources from materials waste of steel fabrication (HSM, CRM), waste of polymer fabrication (LK) as well as iron sands (PBA). These waste as well as iron sands were the main resources of iron oxide, Fe 2 O 3 . The barium oxide used in this experiments are from BaCO 3 product of Merck, and BaCO 4 which is commercially available in the market as barite. Phase identification by x-ray diffraction technique show the synthesized magnetic materials are agreed with the available commercial product, (SUMI). The energy product maximum (BH) max measured by vibrating sample magnetometer (VSM) for the samples used HSM-, CRM- and BaCO 3 as basic materials are 1.141 MGOe and 1.136 MGOe while SUMI is 1.142 MGOe. However for the samples made from LK-, PBA- used of BaCO 3 or CRM- with barite, the energy product maximum (BH) max are relatively lower than commercial product

  19. Prospects for the ORNL/TAMU Barium Fluoride Array (United States)

    Townsend, Austin; McIntosh, Alan; Youngs, Mike; Mosby, Shea; Varner, Robert


    Understanding the symmetry energy in the nuclear equation of state is essential to understanding properties such as the structure of a neutron star or its gravitational collapse, leading to supernovae. It has been suggested that to better constrain the symmetry energy one can use the bremmstrahlung gamma rays emitted from the hot, dense nuclear matter in the early stages of heavy ion collisions. These gamma rays have the potential to provide a cleaner probe than the more traditional hadronic probes. To measure these bremmstrahlung photons, barium fluoride scintillation crystals were chosen for their ability to detect photons across a large energy range and for their inherent pulse shape discrimination properties. This summer, the detectors of the TAMU/ORNL barium fluoride array were tested in preparation for such an experiment. Signals from each detector were recorded individually for cosmic rays and radioactive source events. The full waveforms were digitized with flash ADCs. A selected set of detectors was assembled and tested with beam from the K500 cyclotron. With this in-beam data, waveform integration parameters may be optimized. Results from the testing of these detectors with flash digitizers will be presented. Department of Energy, National Science Foundation, Cyclotron Institute.

  20. Synthesis of barium titanate crystalline nanoparticles using hydrothermal microwave method

    International Nuclear Information System (INIS)

    Souza, A.E.; Silva, R.A.; Teixeira, S.R.; Moreira, M.L.; Volanti, D.P.; Longo, E.


    The hydrothermal microwave method (HTMW) was used in the synthesis of barium titanate (BaTiO 3 ) nanoparticles. The solution was prepared in deionized water by using titanium (IV) isopropoxide (C 12 H 28 O 4 Ti), barium chloride (BaCl 2 .2H 2 O) and potassium hydroxide (KOH). Afterwards it was heated in an adapted conventional microwave oven. The system is composed of a temperature controller with thermocouple, a hermetic camera of reaction made of teflon, a manometer and a safety valve. The solution was heated to 140 deg C, at a 140 deg C/min heating rate, and maintained at this temperature for 40 minutes. The obtained ceramic powder was characterized by using X-ray diffraction (XRD) and field emission scanning electron microscopy (FE-SEM). The XRD data confirms the formation of a high crystalline ceramic material with perovskite structure. The FE-SEM images reveal morphologies with dimensions varying from 27 to 54 nm. (author)

  1. Green Synthesis of Barium Sulfate Particles Using Plant Extracts

    Directory of Open Access Journals (Sweden)

    Chen Long


    Full Text Available The biological molecules in the extracts of four fruits or vegetables: kiwifruit, oranges, tomato and carrot, were used as templates to synthesize barium sulfate (BaSO4 particles. The products were characterized by scanning electron microscopy, Fourier transform infrared spectroscopy and X-ray power diffractometry. The results showed that, leaf-shaped barite BaSO4 crystals with toothed edge were obtained with kiwifruit extracts; thorn spherical barium sulfate crystals with diameter of 2-4 micrometers were produced with tomato extracts; rod-like or quasi-spherical BaSO4 crystals with size of several hundred nanometers to several micrometers were gained with orange extracts; while quasi-spherical BaSO4 nano-crystals were obtained with carrot extracts. The formation mechanism of BaSO4 is also discussed, showing that the proteins, carbohydrates, vitamins and organic acids in above four kinds of fruits or vegetables may provide nucleation sites, controlling the growth of BaSO4 crystals with different morphologies.

  2. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.


    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  3. Fabrication and characterization of cerium-doped barium titanate inverse opal by sol-gel method

    International Nuclear Information System (INIS)

    Jin Yi; Zhu Yihua; Yang Xiaoling; Li Chunzhong; Zhou Jinghong


    Cerium-doped barium titanate inverted opal was synthesized from barium acetate contained cerous acetate and tetrabutyl titanate in the interstitial spaces of a polystyrene (PS) opal. This procedure involves infiltration of precursors into the interstices of the PS opal template followed by hydrolytic polycondensation of the precursors to amorphous barium titanate and removal of the PS opal by calcination. The morphologies of opal and inverse opal were characterized by scanning electron microscope (SEM). The pores were characterized by mercury intrusion porosimetry (MIP). X-ray photoelectron spectroscopy (XPS) investigation showed the doping structure of cerium, barium and titanium. And powder X-ray diffraction allows one to observe the influence of doping degree on the grain size. The lattice parameters, crystal size and lattice strain were calculated by the Rietveld refinement method. The synthesis of cerium-doped barium titanate inverted opals provides an opportunity to electrically and optically engineer the photonic band structure and the possibility of developing tunable three-dimensional photonic crystal devices. - Graphical abstract: Cerium-doped barium titanate inverted opal was synthesized from barium acetate acid contained cerous acetate and tetrabutyl titanate in the interstitial spaces of a PS opal, which involves infiltration of precursors into the interstices of the PS opal template and removal of the PS opal by calcination

  4. A138

    Directory of Open Access Journals (Sweden)

    K. Yurchenko


    Thus, results suggest that vascular disruption in the NDV-treated group indicates the virus ability to directly or indirectly affect tumor angiogenesis and regulate tissue trophism in that way. Understanding how and in which step this effect occurs may provide capacity to use oncolytic NDV strains for therapeutic benefit.

  5. Wideband and enhanced microwave absorption performance of doped barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Pingyuan; Xiong, Kun [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Ju, Kui [Guizhou Institute of Metallurgy and Chemical Engineering, Guiyang 550002 (China); Li, Shengnan [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Xu, Guangliang, E-mail: [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China)


    To achieve stronger microwave attenuation and larger bandwidth in electromagnetic absorber, the nickel ions (Ni{sup 2+}) and manganese ions (Mn{sup 2+}) were employed to partially replace the cobalt ions (Co{sup 2+}) in BaCoTiFe{sub 10}O{sub 19}, and the doped barium hexaferrite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19}) powders were synthesized via the sol–gel combustion method. Subsequently, the microwave absorbing composites were prepared by mixing the ferrite powders with the paraffin. The X-ray diffraction (XRD) patterns of the doped ferrites confirmed the formation of the M-type barium ferrite, and no other types of barium ferrite could be found. Based on the electromagnetic parameters measured by the vector net-analyzer, it was found that the composite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19}) possessed a minimum reflection loss of −52.8 dB at 13.4 GHz with a matching thickness of 1.8 mm and the bandwidth below −15 dB was 5.8 GHz. Moreover, the maximum attenuation of Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could reach −69 dB when its thickness was 1.8 mm, and also the bandwidth less than −20 dB was ranging from 13.2 GHz to 18 GHz. Thus, Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could be the good microwave absorbers, which have great potentials to be applied in the high frequency fields of the microwave absorbing materials. - Highlights: • The Co was first time substituted by Mn–Ni in ferrites. • The substituted ferrites had good microwave absorption. • The doped ferrites had broad bandwidth and low reflection loss.

  6. Microstructure of doped barium titanate prepared from polymeric precursors

    Directory of Open Access Journals (Sweden)

    Stojanovic, B. D.


    Full Text Available Barium titanate is used extensively as a dielectric in ceramic capacitors, particularly due to its high dielectric constant and low dielectric loss characteristics. It can be made semiconducting by addition of certain dopants and by proper modification of grains and grain boundary properties obtaining very interesting characteristics for various applications. The synthesis method and sintering regime have a strong influence on properties of obtained barium titanate ceramics. Doped barium titanate was prepared with Nb+5 and Y+3 ions as donor dopants, and with Mn+2 ions as acceptor dopant by polymeric precursors method. By this procedure nanosized powders were obtained after calcination. Sintering was performed in the temperature range of 1290ºC to 1380ºC. The microstructure of doped BaTiO3 was performed using scanning electron microscopy. The influence of dopants and sintering temperature on grain size was analysed.

    El titanato de bario se usa extensamente como dieléctrico en condensadores cerámicos, debido principalmente a su elevada constante dieléctrica y a sus bajas pérdidas dieléctricas. Puede hacerse semiconductor mediante la adición de ciertos dopantes y a través de modificaciones adecuadas de las propiedades de los granos y los bordes de grano se obtienen características muy interesantes para muchas aplicaciones. El método de síntesis y el régimen de sinterización tienen una fuerte influencia sobre las propiedades del titanato de bario cerámico. El titanato de bario dopado con Nb5+ y Y3+ como dopantes donores y con Mn2+ como dopante aceptor se preparó mediante el método de precursores poliméricos. Mediante este procedimiento se obtuvieron polvos nanométricos después de la etapa de calcinación. La sinterización se realizó en el intervalo de temperaturas entre 1290ºC y 1380ºC. La microestructura del BaTiO3 dopado se estudió usando microscopía electrónica de barrido. Se analizó la influencia de los

  7. In vitro experiments for the development of a high density (HD) barium sulfate contrast medium

    International Nuclear Information System (INIS)

    Klein, J.


    In vitro experiments with the high-density (HD) barium meal Falibaryt HD are described. Several charges of BaSO 4 were tested together with certain additives influencing dispersion, stability of the suspension, flowability, surface tension etc. Particle size spectra were measured by the manufacturer, VEB Fahlberg-List. With a simple PVC test plate containing several grooves simulating small details (areae gastricae) the diagnostic capabilities of the HD contrast medium were evaluated in an in vitro test. The developed barium meal Falibaryt HD is in its physical and chemical parameters comparable with Prontobario-HD, one of the best HD barium meals. (author)

  8. Addition of methyl cellulose enema to double-contrast barium imaging of sigmoid diverticulosis

    International Nuclear Information System (INIS)

    Olsson, R.; Adnerhill, I.; Bjoerkdahl, P.; Ekberg, O.; Fork, F.T.


    Double-contrast barium enema has a reduced sensitivity in patients with severe sigmoid diverticulosis. Therefore a carboxy methyl cellulose enema was employed after the conventional double-contrast examination in 15 patients with sigmoid diverticulosis. A significant increase in lumen diameter and a superior removal of barium residue from the diverticulas facilitated the interpretation of the sigmoid loops. Conclusion: The addition of methyl cellulose enema to double-contrast barium imaging improves diagnostic imaging in diverticulosis by expanding the lumen and emptying the diverticulas. (orig.)

  9. Addition of methyl cellulose enema to double-contrast barium imaging of sigmoid diverticulosis

    Energy Technology Data Exchange (ETDEWEB)

    Olsson, R. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Adnerhill, I. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Bjoerkdahl, P. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Ekberg, O. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Fork, F.T. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology


    Double-contrast barium enema has a reduced sensitivity in patients with severe sigmoid diverticulosis. Therefore a carboxy methyl cellulose enema was employed after the conventional double-contrast examination in 15 patients with sigmoid diverticulosis. A significant increase in lumen diameter and a superior removal of barium residue from the diverticulas facilitated the interpretation of the sigmoid loops. Conclusion: The addition of methyl cellulose enema to double-contrast barium imaging improves diagnostic imaging in diverticulosis by expanding the lumen and emptying the diverticulas. (orig.).

  10. A Comparative Study on Magnetostructural Properties of Barium Hexaferrite Powders Prepared by Polyethylene Glycol

    Directory of Open Access Journals (Sweden)

    Zehra Durmus


    Full Text Available Nanocrystalline particles of barium hexaferrite were synthesized by a sol-gel combustion route using nitrate-citrate gels prepared from metal nitrates and citric acid solutions with Fe/Ba molar ratio 12. The present paper aims to study the effect of addition of polyethylene glycol (PEG solutions with different molecular weights (MW: 400, 2000, and 10.000 g/mol on magnetostructural properties of barium hexaferrite. The formation of the barium hexaferrite was inspected using X-ray diffraction (XRD analysis, Fourier transform infrared (FT-IR analysis, thermogravimetric (TGA analysis, scanning electron microscopy (SEM analysis and vibrating sample magnetometer (VSM analysis for magnetic measurements.

  11. Photoexcited-carrier transport in barium strontium titanate/strontium titanate heterostructures (United States)

    Yan, H.; Wang, J. Y.; Zhang, Z. T.; Yang, B.; Chen, C. L.; Jin, K. X.


    Photoexcited-carrier transport properties at the surface and the interface of barium strontium titanate/strontium titanate heterostructures are reported. Under a 365 nm light irradiation, the surfaces of barium strontium titanate films exhibit a metal-to-insulator transition, while the interfaces favor the metallic conduction with increasing temperatures. By analyzing, we consider that these results might be attributed to the intrinsic features of strontium titanate and the polarization state of barium strontium titanate films under the irradiation. Our results would contribute to further understanding of the photocarrier effect at the interface and demonstrate great potential applications in optoelectronic devices of all-oxide heterostructures.

  12. Soluble CD138/Syndecan-1 Increases in the Sera of Patients with Moderately Differentiated Bladder Cancer. (United States)

    Sanaee, Mohammad Nabi; Malekzadeh, Mahyar; Khezri, Abdolaziz; Ghaderi, Abbas; Doroudchi, Mehrnoosh


    CD138/Syndecan-1 (Sdc-1) is expressed on the tumor and stromal cells of invasive bladder carcinoma. CD138/Sdc-1 shedding from the cell surface is associated with the invasive phenotype in lung and breast cancers. Soluble CD138/Sdc-1 was measured in the sera of 86 bladder cancer patients and 57 healthy individuals by a commercial ELISA assay. Soluble Sdc-1 was increased in the sera of patients with bladder cancer (138.42 ± 81.85 vs. 86.48 ± 82.58 ng/ml, p = 0.0003). Patients aged over 70 years had higher levels of CD138/Sdc-1 in their sera (159.7 ± 15.77 vs. 124.5 ± 9.99 ng/ml, p = 0.025), and soluble Sdc-1 levels were higher in the sera of patients with moderately differentiated tumors compared to poorly differentiated ones (170.47 ± 85.06 vs. 101.79 ± 68.24 ng/ml, p = 0.01). The soluble Sdc-1 level was higher in muscle-invasive (154.45 ± 83.60 vs. 89.9 ± 55.02 ng/ml) but not lymphatic-invasive (106.25 ± 52.10 vs. 123.43 ± 63.76 ng/ml) tumors (p = 0.027 and 0.45, respectively). A non-significant trend of soluble Sdc-1 increase in the sera of male patients compared to female patients was observed (145.38 ± 85.47 vs. 110.20 ± 59.04 ng/ml, p = 0.054). The elevated levels of soluble CD138/Sdc-1 in older bladder cancer patients and those with muscular invasion sheds some light on the mechanisms of the disease invasion. © 2015 S. Karger AG, Basel.

  13. Radioluminescence and photoluminescence characterization of Eu and Tb doped barium stannate phosphor ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Ayvacıklı, M. [Celal Bayar University, Faculty of Arts and Sciences, Department of Physics, 45010 Muradiye, Manisa (Turkey); Canimoglu, A., E-mail: [Niğde University, Faculty of Arts and Sciences, Department of Physics, Niğde (Turkey); Karabulut, Y. [Celal Bayar University, Faculty of Arts and Sciences, Department of Physics, 45010 Muradiye, Manisa (Turkey); Kotan, Z. [Ege University, Institute of Nuclear Sciences, 35100 Bornova, İzmir (Turkey); Herval, L.K.S.; Godoy, M.P.F. de; Galvão Gobato, Y. [Departmento de Física, UniversidadeFederal de São Carlos, 13565-905 São Carlos, SP (Brazil); Henini, M. [School of Physics and Astronomy, Nottingham Nanotechnology and Nanoscience Center, University of Nottingham, Nottingham NG7 2RD (United Kingdom); Can, N., E-mail: [Celal Bayar University, Faculty of Arts and Sciences, Department of Physics, 45010 Muradiye, Manisa (Turkey)


    In this paper, we report on structural and optical properties of terbium and europium doped barium stannate phosphors (BaSnO{sub 3}) synthesised by conventional solid state reaction method. We have studied those materials by using X-ray diffraction (XRD), radioluminescence (RL) and photoluminescence (PL) techniques. XRD patterns confirm that the BaSnO{sub 3} sintered at 1400 °C exhibit orthorhombic structure and that the Tb{sup 3+} and Eu{sup 3+} substitution of Ba{sup 2+} does not change the structure of the BaSnO{sub 3} host. The optical emission spectrum is characterized a broad band centered at 897 nm (1.38 eV), with a high-energy tail approximately 750 nm from the host lattice. Other emission signals that are characteristic of the 3 + oxidation state of rare earth elements were generated by Eu and Tb doping. Luminescence measurements show that the series of emission states {sup 5}D{sub 4} → {sup 7}F{sub 6}, {sup 5}D{sub 4} → {sup 7}F{sub 5}, {sup 5}D{sub 4} → {sup 7}F{sub 4} and {sup 5}D{sub 4} → {sup 7}F{sub 3} corresponding to the typical 4f → 4f infra-configuration forbidden transitions of Tb{sup 3+} are appeared and the major emission peak at 540 nm is due to {sup 5}D{sub 4} → {sup 7}F{sub 5} transitions of Tb{sup 3+}. On the other hand, the emission spectrum of Eu doped BaSnO{sub 3} phosphor exhibits a series of emission bands, which are attributed to the {sup 5}D{sub 0} → {sup 7}F{sub j} (j = 0–4) transitions of Eu{sup 3+} ions. The dominant emission of Eu{sup 3+} corresponding to the electric dipole transition {sup 5}D{sub 0} → {sup 7}F{sub 2} is located at 613 nm. The sharp emission properties exhibited demonstrate that the BaSnO{sub 3} is a suitable host for rare-earth ion doped phosphor material. This work clearly confirms the unusual near infrared (NIR) PL discovered by H. Mizoguchi et al. in BaSnO{sub 3} at room temperature.

  14. Analysis of barium hydroxide and calcium hydroxide slurry carbonation reactors

    International Nuclear Information System (INIS)

    Patch, K.D.; Hart, R.P.; Schumacher, W.A.


    The removal of CO 2 from air was investigated by using a continuous-agitated-slurry carbonation reactor containing either barium hydroxide [Ba(OH) 2 ] or calcium hydroxide [Ca(OH) 2 ]. Such a process would be applied to scrub 14 CO 2 from stack gases at nuclear-fuel reprocessing plants. Decontamination factors were characterized for reactor conditions which could alter hydrodynamic behavior. An attempt was made to characterize reactor performance with models assuming both plug flow and various degrees of backmixing in the gas phase. The Ba(OH) 2 slurry enabled increased conversion, but apparently the process was controlled under some conditions by phenomena differing from those observed for carbonation by Ca(OH) 2 . Overall reaction mechanisms are postulated

  15. Bronchography in dogs. Comparative study with two barium sulphate solutions

    International Nuclear Information System (INIS)

    Thibaut, J.; Gallardo, P.; Vargas, L.; Deppe, R.; Born, R.


    Two solutions of barium sulphate, 60 and 30% w/v, were compared with the ''overflow'' Bronchographic method. Two groups of eight healthy adult does of both sexes, weighing 7 to 18 kg were used for the study. The dogs were anaesthetised with thiopentone sodium 2% (20 mg/kg iv). After intubation, each dog received contrast medium by a catheter connected to a syringe, in a 9 mi dose. Two series of two x-rays plates were taken in left lateral recumbent, 3 and 6 min after administering the contrast medium and in ventrodorsal projection, 30 sec. later. The x-ray plates obtained were analysed and compared intra and inter group considering the advance speed of the contrast medium, the radiographic density and outlines. Adverse reactions were controlled

  16. Assessment of patient exposure for barium enema examinations

    International Nuclear Information System (INIS)

    Bednarek, D.R.; Rudin, S.; Wong, R.


    Methods are described for the assessment of patient exposure during clinical fluoroscopic procedures. Values of the roentgen-area-product (RAP) and their distribution throughout the examination are presented for both single-contrast and double-contrast barium enema studies. The double-contrast procedure was measured to give 50% more radiation to the patient than the single-contrast procedure when the same size optical aperture is used between the intensifier and TV pick-up tube. However, it was possible to decrease the fluoroscopic RAP value by over a factor of two for the double-contrast procedure without an adverse clinical effect by increasing the area of the aperture diaphragm

  17. Polarization switching kinetics in ultrathin ferroelectric barium titanate film

    Energy Technology Data Exchange (ETDEWEB)

    Gaynutdinov, R., E-mail: [Institute of Crystallography, Russian Academy of Sciences, Moscow 119333 (Russian Federation); Minnekaev, M., E-mail: [NRNU Moscow Engineering Physics Institute, Moscow 115409 (Russian Federation); Mitko, S., E-mail: [NT-MDT Co., Moscow 124482 (Russian Federation); Tolstikhina, A., E-mail: [Institute of Crystallography, Russian Academy of Sciences, Moscow 119333 (Russian Federation); Zenkevich, A., E-mail: [NRNU Moscow Engineering Physics Institute, Moscow 115409 (Russian Federation); NRC Kurchatov Institute, Moscow 123182 (Russian Federation); Ducharme, S., E-mail: [Department of Physics and Astronomy and Nebraska Center for Materials and Nanoscience, University of Nebraska-Lincoln, NE 68588-0299 (United States); Fridkin, V., E-mail: [Institute of Crystallography, Russian Academy of Sciences, Moscow 119333 (Russian Federation)


    The investigation of polarization switching kinetics in an ultrathin barium titanate film reveals true threshold switching at a large coercive electric field, evidence that switching is of intrinsic thermodynamic nature, rather than of extrinsic nature initiated by thermal nucleation, which has no true threshold field. The switching speed of a 7 nm thick epitaxial film exhibits a critical slowing as the threshold is approached from above, a key characteristic of intrinsic switching. In contrast, a bulk crystal exhibits nucleation-initiated switching, which has no threshold, and proceeds even at fields well below the nominal coercive field, which was determined independently from the polarization-electric field hysteresis loop. Previously, this phenomenon was only reported for ultrathin ferroelectric polymer Langmuir–Blodgett films. Since both the thermodynamic coercive field and the intrinsic switching kinetics are derived from the mean field theory of ferroelectricity, we expect that these phenomena will be found in other ferroelectric films at the nanoscale.

  18. X-ray and Moessbauer investigations of isotropic barium ferrites

    International Nuclear Information System (INIS)

    Kirichok, P.P.; Pashchenko, V.A.; Dem'yaniv, T.O.; Ryabova, G.N.; Lisovskij, A.M.


    Using the methods of X-ray and γ-resonance spectroscopy the crystal chemical and magnetic structure of isotropic barium hexaferrites is studied. compacting pressure the lattice parameter c of ferrite of the BaOx5.7Fe 2 O 3 is decreased and the diffraction line width on its X-ray p attern is increased. Due to increasing the isoststical compacting pressure quadrupole splitting of the γ-resonance absorption spectrum of 57 Fe nuclei in tetrahedral positions 4f 1 and in positions 2a decreases. The sintering temperature growth leads to increasing the lattice parameter c and diffraction line widths and decreasing the effeutive field values and isomeric s hifts on 57 Fe nuclei. Isostatical compacting pressure does not affect the electron configuration of iron ions

  19. Structural and functional characterization of barium zirconium titanate / epoxy composites

    Directory of Open Access Journals (Sweden)

    Filiberto González Garcia


    Full Text Available The dielectric behavior of composite materials (barium zirconium titanate / epoxy system was analyzed as a function of ceramic concentration. Structure and morphologic behavior of the composites was investigated by X-ray Diffraction (XRD, Fourier transformed infrared spectroscopy (FT-IR, Raman spectroscopy, field emission scanning electron microscopy (FE-SEM and transmission electron microscopy (TEM analyses. Composites were prepared by mixing the components and pouring them into suitable moulds. It was demonstrated that the amount of inorganic phase affects the morphology of the presented composites. XRD revealed the presence of a single phase while Raman scattering confirmed structural transitions as a function of ceramic concentration. Changes in the ceramic concentration affected Raman modes and the distribution of particles along into in epoxy matrix. Dielectric permittivity and dielectric losses were influenced by filler concentration.

  20. High Pressure X-ray Diffraction Studies on Barium. (United States)

    Barnett, J D; Bennion, R B; Hall, H T


    Simultaneous x-ray diffraction and electrical resistance measurements on barium establish, with certainty, that Bridgman's 78-kb resistance transition is identical with his 59-kb volumetransition. During this transition, the bodycentered cubic structure changes to hexagonalclose packed. Lattice parameters for the latter structure at 62 kb (volume scale) are: a = 3.90 A, c = 6.15 A, and c/a = 1.58. Compression (AV/Vo) at 62 kb is 0.359 + 0.005 compared to 0.345 previously reported by Bridgman. Below the transition, at 49 kb, compression is 0.300 +/- 0.005 compared to Bridgman's 0.288. Bridgman's 17-kb volume transition was not detected by x-ray diffraction.

  1. Effect of Nb on barium titanate prepared from citrate solutions

    Directory of Open Access Journals (Sweden)

    Stojanović Biljana D.


    Full Text Available The influence of the addition of dopants on the microstructure development and electrical properties of BaTiO3 doped with 0.2, 0.4, 0.6, 0.8 mol% of Nb and 0.01 mol% of Mn based compounds was studied. Doped barium titanate was prepared using the polymeric precursor method from citrate solutions. The powders calcined at 700°C for 4 hours were analysed by infrared (IR spectroscopy to verify the presence of carbonates, and by X-ray diffraction (XRD for phase formation. The phase composition, microstructure and dielectric properties show a strong dependence on the amount of added niobium.

  2. Conoscopic study of strontium-barium niobate single crystals (United States)

    Kolesnikov, Aleksandr; Grechishkin, Rostislav; Malyshkina, Olga; Malyshkin, Yury; Dec, Jan; Łukasiewicz, Tadeusz; Ivanova, Aleksandra


    Optically transparent single crystals of strontium-barium niobate, SrxBa1-xNb2O6, of different compositions (x = 0.26...0.7) were examined with the aid of conoscopic light interference figures. A regular change of the isochrome concentric ring number and diameters consistent with the temperature variation of the value of birefringence is demonstrated by direct observations of polar cuts of optically uniaxial samples. Anomalous violations of the conventional (uniaxial) interference patterns occur occasionaly in some samples being indicative of the existence of biaxial trait in their behaviour even though no voltage is applied. These features may depend on annealing treatments at elevated temperatures. The results of the study show that conoscopic images may serve as a sensitive indicator of the structural state of SBN crystals related to the effects of stress-induced change of optical anisotropy and temperature dependent birefringence parameters.

  3. Laser irradiation in Nd3+ doped strontium barium niobate glass

    International Nuclear Information System (INIS)

    Haro-Gonzalez, P.; Martin, I. R.; Arbelo-Jorge, E.; Gonzalez-Perez, S.; Caceres, J. M.; Nunez, P.


    A local nanocrystalline formation in a neodymium doped strontium barium niobate (SBN) glass has been obtained under argon laser irradiation. The intense emission around 880 nm, originated from the 4 F 3/2 ( 4 F 5/2 ) thermalized level when the glass structure changes to a glass ceramic structure due to the irradiation of the laser beam, has been studied. The intensities and lifetimes change from this level inside and outside the irradiated area made by the laser excitation. They have been analyzed and demonstrated that the desvitrification process has been successfully achieved. These results confirm that nanocrystals of SBN have been created by the laser action confirming that the transition from glass to glass ceramic has been completed. These results are in agreement with the emission properties of nanocrystals of the bulk glass ceramic sample. The present study also suggests that the SBN nanocrystal has a potential application as temperature detector

  4. Ultrasonic de-agglomeration of barium titanate powder. (United States)

    Marković, S; Mitrić, M; Starcević, G; Uskoković, D


    BaTiO3 (BT) powder, with average particle size of 1.4 microm, was synthesized by solid-state reaction. A high-intensity ultrasound irradiation (ultrasonication) was used to de-agglomerate micro-sized powder to nano-sized one. The crystal structure, crystallite size, morphology, particle size, particle size distribution, and specific surface area of the BT powder de-agglomerated for different ultrasonication times (0, 10, 60, and 180 min) were determined. It was found that the particles size of the BT powder was influenced by ultrasonic treatment, while its tetragonal structure was maintained. Therefore, ultrasonic irradiation can be proposed as an environmental-friendly, economical, and effective tool for the de-agglomeration of barium titanate powders.

  5. Microscopic theory of the phonon frequencies in BCC barium

    International Nuclear Information System (INIS)

    Oli, B.A.


    The phonon dispersion frequencies are calculated from first principles for bbc barium using a resonance pseudopotential model which incorporates the effect of s-d hybridization. It was also possible using this scheme to account for the anomalous feature of the Ba dispersion curve observed experimentally in the (ξ,0,0) direction where the frequencies of the transverse branch are higher than the frequencies of the longitudinal branch. The frequencies obtained were also used to calculate the phonon density of states by the linear-analytic tetrahedra method of zone integration. The results of these calculations are qualitatively in good agreement with experimental data, and provide further support to the interpretation of the anomalous behaviour in the (ξ,0,0) direction as arising from s-d hybridization. (author). 27 refs, 4 figs, 3 tabs

  6. Barium titanate nanocomposite capacitor FY09 year end report.

    Energy Technology Data Exchange (ETDEWEB)

    Stevens, Tyler E.; DiAntonio, Christopher Brian; Yang, Pin; Chavez, Tom P.; Winter, Michael R.; Monson, Todd C.; Roesler, Alexander William; Fellows, Benjamin D.


    This late start RTBF project started the development of barium titanate (BTO)/glass nanocomposite capacitors for future and emerging energy storage applications. The long term goal of this work is to decrease the size, weight, and cost of ceramic capacitors while increasing their reliability. Ceramic-based nanocomposites have the potential to yield materials with enhanced permittivity, breakdown strength (BDS), and reduced strain, which can increase the energy density of capacitors and increase their shot life. Composites of BTO in glass will limit grain growth during device fabrication (preserving nanoparticle grain size and enhanced properties), resulting in devices with improved density, permittivity, BDS, and shot life. BTO will eliminate the issues associated with Pb toxicity and volatility as well as the variation in energy storage vs. temperature of PZT based devices. During the last six months of FY09 this work focused on developing syntheses for BTO nanoparticles and firing profiles for sintering BTO/glass composite capacitors.

  7. Study on a flexoelectric microphone using barium strontium titanate

    International Nuclear Information System (INIS)

    Kwon, S R; Huang, W B; Yuan, F G; Jiang, X N; Zhang, S J


    In this study, a flexoelectric microphone was, for the first time, designed and fabricated in a bridge structure using barium strontium titanate (Ba 0.65 Sr 0.35 TiO 3 ) ceramic and tested afterwards. The prototyped flexoelectric microphone consists of a 1.5 mm  ×  768 μm  ×  50 μm BST bridge structure and a silicon substrate with a cavity. The sensitivity and resonance frequency were designed to be 0.92 pC/Pa and 98.67 kHz, respectively. The signal to noise ratio was measured to be 74 dB. The results demonstrate that the flexoelectric microphone possesses high sensitivity and a wide working frequency range simultaneously, suggesting that flexoelectricity could be an excellent alternative sensing mechanism for microphone applications. (paper)

  8. Study on a flexoelectric microphone using barium strontium titanate (United States)

    Kwon, S. R.; Huang, W. B.; Zhang, S. J.; Yuan, F. G.; Jiang, X. N.


    In this study, a flexoelectric microphone was, for the first time, designed and fabricated in a bridge structure using barium strontium titanate (Ba0.65Sr0.35TiO3) ceramic and tested afterwards. The prototyped flexoelectric microphone consists of a 1.5 mm  ×  768 μm  ×  50 μm BST bridge structure and a silicon substrate with a cavity. The sensitivity and resonance frequency were designed to be 0.92 pC/Pa and 98.67 kHz, respectively. The signal to noise ratio was measured to be 74 dB. The results demonstrate that the flexoelectric microphone possesses high sensitivity and a wide working frequency range simultaneously, suggesting that flexoelectricity could be an excellent alternative sensing mechanism for microphone applications.

  9. The Performance of Barium Sulfate Nanoparticles/polypropylene Hybrid Multifilament (United States)

    Li, Ying; Wang, Xuanjun; Mu, Xiaoxi; Zhang, Shujuan


    Nanosize barium sulfate (BaSO4) particles prepared with dodecyl benzene sulfonic acid (DBSA) in ethanol-water reaction system are used to prepare BaSO4/polypropylene (PP) nanocomposites by melt mixing method. It is then made into hybrid fibers by melt spinning and subsequent drawing with different ratios. The hybrid fibers are characterized by rheology, morphology, thermal stability and mechanical properties, respectively. The results indicate that the DBSA-modified BaSO4 can improve the spinnability of BaSO4/PP hybrid multifilament even at high BaSO4 nanoparticles concentration. DBSA can be used as compatibilizer to enhance the interface interaction of BaSO4/PP nanocomposites, because DBSA contains both hydrophobicity long alkyl chain and hydrophilic sulfonic group. Therefore, it can improve the performances of BaSO4/PP hybrid multifilament.

  10. Association between esophageal dysmotility and gastroesophaeal reflux on barium studies

    International Nuclear Information System (INIS)

    Campbell, Craig; Levine, Marc S.; Rubesin, Stephen E.; Laufer, Igor; Redfern, Gina; Katzka, David A.


    Objective: To determine whether there is an association between abnormal primary peristalsis in the esophagus and gastroesophageal reflux (GER) on barium studies. Methods: A computerized search of radiologic reports revealed 151 patients with esophageal dysmotility (characterized by intermittently decreased or absent peristalsis in the esophagus on upper gastrointestinal tract examinations) who fulfilled our study's entry criteria. These 151 patients were stratified into two groups depending on whether this dysmotility was associated with nonperistaltic contractions (NPCs): 92 patients had no NPCs (Dysmotility and No NPCs Group) and 59 had NPCs (Dysmotility and NPCs Group). An age-matched control group of 92 patients with normal motility was also generated from the radiologic reports. The reports were also reviewed for the presence and degree of GER and other complications of GER. The frequency and degree of GER were tabulated for each group, and the data were analyzed using a Pearson chi square test to determine if significant differences were present in the frequency and degree of GER or other findings among the groups. Results: The frequency of GER was significantly higher in patients with abnormal peristalsis and no NPCs than in controls (p = 0.02). When GER was stratified based on the degree of reflux, the frequency of moderate-to-marked GER was significantly higher in patients with abnormal peristalsis and no NPCs than in patients with abnormal peristalsis and NPCs (p = 0.01) or in controls (p = 0.0031). The frequency of reflux esophagitis also was significantly higher in patients with abnormal peristalsis and no NPCs than in controls (p = 0.04). Conclusion: Our findings suggest that patients with esophageal dysmotility characterized by intermittently decreased or absent peristalsis without NPCs have a significantly higher frequency and degree of GER than patients with normal motility. The presence of this specific form of esophageal dysmotility on barium

  11. Association between esophageal dysmotility and gastroesophaeal reflux on barium studies

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, Craig [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Levine, Marc S. [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States)]. E-mail:; Rubesin, Stephen E. [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Laufer, Igor [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Redfern, Gina [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Katzka, David A. [Department of Medicine, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States)


    Objective: To determine whether there is an association between abnormal primary peristalsis in the esophagus and gastroesophageal reflux (GER) on barium studies. Methods: A computerized search of radiologic reports revealed 151 patients with esophageal dysmotility (characterized by intermittently decreased or absent peristalsis in the esophagus on upper gastrointestinal tract examinations) who fulfilled our study's entry criteria. These 151 patients were stratified into two groups depending on whether this dysmotility was associated with nonperistaltic contractions (NPCs): 92 patients had no NPCs (Dysmotility and No NPCs Group) and 59 had NPCs (Dysmotility and NPCs Group). An age-matched control group of 92 patients with normal motility was also generated from the radiologic reports. The reports were also reviewed for the presence and degree of GER and other complications of GER. The frequency and degree of GER were tabulated for each group, and the data were analyzed using a Pearson chi square test to determine if significant differences were present in the frequency and degree of GER or other findings among the groups. Results: The frequency of GER was significantly higher in patients with abnormal peristalsis and no NPCs than in controls (p = 0.02). When GER was stratified based on the degree of reflux, the frequency of moderate-to-marked GER was significantly higher in patients with abnormal peristalsis and no NPCs than in patients with abnormal peristalsis and NPCs (p = 0.01) or in controls (p = 0.0031). The frequency of reflux esophagitis also was significantly higher in patients with abnormal peristalsis and no NPCs than in controls (p = 0.04). Conclusion: Our findings suggest that patients with esophageal dysmotility characterized by intermittently decreased or absent peristalsis without NPCs have a significantly higher frequency and degree of GER than patients with normal motility. The presence of this specific form of esophageal dysmotility on

  12. Qualitative analysis of barium particles coated in small intestinal mucosa of rabbit by using scanning electron microscopy

    International Nuclear Information System (INIS)

    Lee, Yong Suk; Ha, Hyun Kwon; Lee, Yang Seob; Kim, Jae Kyun; Yoon, Seong Eon; Kim, Jung Hoon; Chung, Dong Jin; Auh, Yong Ho


    To qualitatively analysed barium coating status in the intestinal mucosa, we used scanning electron microscopy to observe barium particles coated in the small intestinal mucosa of rabbit, and we attempted to assess the relationship between electron microscopic findings and radiographic densities. Six different combination of barium and methylcellulose suspensions were infused into the resected small intestines of 15 rabbits. Barium powders were mixed with water to make 40% and 70% w/v barium solutions, and also mixed with 0.5% methylcellulose solutions were used as a double contrast agent. After the infusion of barium suspensions, a mammography unit was used to obtain radiographs of the small intestine, and their optical densities were measured by a densitometer. Thereafter, photographs of barium-coated small intestinal mucosa were obtained using a scanning electron microscope (x 8,000), and the number of barium particles in the unit area were measured. To compare the relationship between the electron microscopic findings and optical densities, statistical analysis using Spearman correlation was performed. This study shows that by using scanning electron microscopy, barium particles coated on the small intestinal mucosa can be qualitatively analysed. It also shows that the number of small barium particles measured by scanning electron microscopy is related to optical densities. (author). 14 refs., 2 figs

  13. Sensitivity of single contrast barium enema with regard to colorectal disease as diagnosed by colonoscopy

    International Nuclear Information System (INIS)

    Kaude, J.V.; Harty, R.F.


    The results of single contrast barium enema were retrospectively correlated with colonoscopically diagnosed colorectal disease in 54 patients (75 lesions). Altogether 66 lesions (88%) were correctly diagnosed. The sensitivity of barium enema for polyps was 81% (26/32). There were three perceptive errors and three polyps 5 mm or less in size were not demonstrated by barium enema. Twenty-nine cases of inflammatory disorders were all correctly diagnosed. One of 12 malignancies was missed by perceptive error. In two cases with vascular malformations the barium enema was normal. 4/9 (44%) of missed lesions were perceptive errors and could have been probably avoided by a second independent reading of films. (orig.)

  14. Severe acute cholangitis after endoscopic sphincterotomy induced by barium examination: A case report. (United States)

    Zhang, Zhen-Hai; Wu, Ya-Guang; Qin, Cheng-Kun; Su, Zhong-Xue; Xu, Jian; Xian, Guo-Zhe; Wu, Shuo-Dong


    Endoscopic sphincterotomy (EST) is considered as a possible etiological factor for severe cholangitis. We herein report a case of severe cholangitis after endoscopic sphincterotomy induced by barium examination. An adult male patient presented with epigastric pain was diagnosed as having choledocholithiasis by ultrasonography. EST was performed and the stone was completely cleaned. Barium examination was done 3 d after EST and severe cholangitis appeared 4 h later. The patient was recovered after treated with tienam for 4 d. Barium examination may induce severe cholangitis in patients after EST, although rare, barium examination should be chosen cautiously. Cautions should be also used when EST is performed in patients younger than 50 years to avoid the damage to the sphincter of Oddi.

  15. Barium borate β-BaB2O4 as a material for nonlinear optics

    International Nuclear Information System (INIS)

    Fedorov, Pavel P; Kokh, Aleksandr E; Kononova, Nadezhda G


    Data on the structure, polymorphism, phase equilibria, growth techniques, properties and applications of single crystals of the low-temperature modification of barium borate are analysed. The bibliography includes 201 references.

  16. 21 CFR 201.304 - Tannic acid and barium enema preparations. (United States)


    ... number of deaths associated with the addition of tannic acid to barium enemas. There is a lack of...(f) of the Federal Food, Drug, and Cosmetic Act unless the label and the labeling bear conspicuously...

  17. Significant decrease in yield under future climate conditions: Stability and production of 138 spring barley accessions

    DEFF Research Database (Denmark)

    Ingvordsen, Cathrine Heinz; Backes, Gunter; Lyngkjær, Michael Foged


    The response in production parameters to projected future levels of temperature, atmospheric carbondioxide ([CO2]), and ozone ([O3]) was investigated in 138 spring barley accessions. The comprehensive setof landraces, cultivars, and breeder-lines, were during their entire life cycle exposed...

  18. Abundances of La 138 and Ta 180 Through ν-Nucleosynthesis in ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 1. Abundances of La138 and Ta180 Through ν-Nucleosynthesis in 20 M ⊙ Type II Supernova Progenitor, Guided by Stellar Models for Seeds. N. Lahkar S. Kalita H. L. Duorah K. Duorah. Research Article Volume 38 Issue 1 March 2017 Article ID 8 ...

  19. 28 CFR 0.138 - Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco... (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco, Firearms, and Explosives, Bureau of Prisons, Federal... Administrative Matters § 0.138 Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of...

  20. Complete genome sequence of an attenuated Sparfloxacin-resistant Streptococcus agalactiae strain 138spar (United States)

    The complete genome of a sparfloxacin-resistant Streptococcus agalactiae vaccine strain 138spar is 1,838,126 bp in size. The genome has 1892 coding sequences and 82 RNAs. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipeline. The publishing of this genome will allo...

  1. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough


    Nin, Carlos Shuler; Marchiori, Edson; Irion, Klaus Loureiro; Paludo, Artur de Oliveira; Alves, Giordano Rafael Tronco; Hochhegger, Daniela Reis; Hochhegger, Bruno


    OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks) were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological...

  2. Comparison of Calcium and Barium Microcapsules as Scaffolds in the Development of Artificial Dermal Papillae


    Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu


    This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and c...

  3. Calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid

    International Nuclear Information System (INIS)

    Kurbanov, A.R.; Sharipov, D.Sh.


    Present article is devoted to calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid. The calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid was carried out in order to determine the thermal effects of reactions. The results of interaction of Ba(OH) 4 ·8H 2 O with 5, 10, and 20% solution of hydrofluoric acid were considered.

  4. Role of Barium Swallow in Diagnosing Clinically Significant Anastomotic Leak following Esophagectomy

    Directory of Open Access Journals (Sweden)

    Simon Roh


    Full Text Available Background: Barium swallow is performed following esophagectomy to evaluate the anastomosis for detection of leaks and to assess the emptying of the gastric conduit. The aim of this study was to evaluate the reliability of the barium swallow study in diagnosing anastomotic leaks following esophagectomy. Methods: Patients who underwent esophagectomy from January 2000 to December 2013 at our institution were investigated. Barium swallow was routinely done between days 5–7 to detect a leak. These results were compared to clinically determined leaks (defined by neck wound infection requiring jejunal feeds and or parenteral nutrition during the postoperative period. The sensitivity and specificity of barium swallow in diagnosing clinically significant anastomotic leaks was determined. Results: A total of 395 esophagectomies were performed (mean age, 62.2 years. The indications for the esophagectomy were as follows: malignancy (n=320, high-grade dysplasia (n=14, perforation (n=27, benign stricture (n=7, achalasia (n=16, and other (n=11. A variety of techniques were used including transhiatal (n=351, McKeown (n=35, and Ivor Lewis (n=9 esophagectomies. Operative mortality was 2.8% (n=11. Three hundred and sixty-eight patients (93% underwent barium swallow study after esophagectomy. Clinically significant anastomotic leak was identified in 36 patients (9.8%. Barium swallow was able to detect only 13/36 clinically significant leaks. The sensitivity of the swallow in diagnosing a leak was 36% and specificity was 97%. The positive and negative predictive values of barium swallow study in detecting leaks were 59% and 93%, respectively. Conclusion: Barium swallow is an insensitive but specific test for detecting leaks at the cervical anastomotic site after esophagectomy.

  5. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO ...

    Indian Academy of Sciences (India)


    Abstract. Cubic barium titanate (BaTiO3) powder was synthesized by heating barium titanyl oxalate hydrate,. BaTiO(C2O4)2⋅4H2O (BTO) precursor in microwave heating system in air at 500°C. Heating BTO in micro- wave above 600°C yielded tetragonal form of BaTiO3. Experiments repeated in silicon carbide furnace ...

  6. Calculations of energy levels and lifetimes of low-lying states of barium and radium

    International Nuclear Information System (INIS)

    Dzuba, V. A.; Ginges, J. S. M.


    We use the configuration-interaction method and many-body perturbation theory to perform accurate calculations of energy levels, transition amplitudes, and lifetimes of low-lying states of barium and radium. Calculations for radium are needed for the planning of measurements of parity- and time-invariance-violating effects which are strongly enhanced in this atom. Calculations for barium are used to control the accuracy of the calculations

  7. Preparation of barium titanate nanoparticle sphere arrays and their dielectric properties. (United States)

    Wada, Satoshi; Yazawa, Aki; Hoshina, Takuya; Kameshima, Yoshikazu; Kakemoto, Hirofumi; Tsurumi, Takaaki; Kuroiwa, Yoshihiro


    Barium titanate (BaTiO(3)) nanoparticles from 27 to 192 nm were prepared by the 2-step thermal decomposition method from barium titanyl oxalate nanoparticles. These particles were dispersed well into 1-propanol, and dense BaTiO(3); nanoparticle sphere arrays without stress-field were prepared by the meniscus method. Temperature dependence of dielectric properties was successfully measured using these dense nanoparticle sphere arrays, and size effect on dielectric properties was discussed.

  8. Gamma radiation shielding properties of poly (ethylene glycol) - barium oxide composite

    International Nuclear Information System (INIS)

    Hussain, R.; Haq, Z.U.; Mohammad, D.


    Shielding properties of the composites of poly (ethylene glycol) and barium oxide were studied using a cobalt-60 gamma radiation source. The constituents of the composites were physically mixed in a number and discs prepared on hydraulic press at room temperature. The results reveal that PEG-BaO composites containing 20% or more of barium oxide have better radiation attenuation properties than poly (ethylene glycol). author

  9. Screening of plant species for phytoremediation of uranium, thorium, barium, nickel, strontium and lead contaminated soils from a uranium mill tailings repository in South China. (United States)

    Li, Guang-yue; Hu, Nan; Ding, De-xin; Zheng, Ji-fang; Liu, Yu-long; Wang, Yong-dong; Nie, Xiao-qin


    The concentrations of uranium, thorium, barium, nickel, strontium and lead in the samples of the tailings and plant species collected from a uranium mill tailings repository in South China were analyzed. Then, the removal capability of a plant for a target element was assessed. It was found that Phragmites australis had the greatest removal capabilities for uranium (820 μg), thorium (103 μg) and lead (1,870 μg). Miscanthus floridulus had the greatest removal capabilities for barium (3,730 μg) and nickel (667 μg), and Parthenocissus quinquefolia had the greatest removal capability for strontium (3,920 μg). In this study, a novel coefficient, termed as phytoremediation factor (PF), was proposed, for the first time, to assess the potential of a plant to be used in phytoremediation of a target element contaminated soil. Phragmites australis has the highest PFs for uranium (16.6), thorium (8.68), barium (10.0) and lead (10.5). Miscanthus floridulus has the highest PF for Ni (25.0). Broussonetia papyrifera and Parthenocissus quinquefolia have the relatively high PFs for strontium (28.1 and 25.4, respectively). On the basis of the definition for a hyperaccumulator, only Cyperus iria and Parthenocissus quinquefolia satisfied the criteria for hyperaccumulator of uranium (36.4 μg/g) and strontium (190 μg/g), and could be the candidates for phytoremediation of uranium and strontium contaminated soils. The results show that the PF has advantage over the hyperaccumulator in reflecting the removal capabilities of a plant for a target element, and is more adequate for assessing the potential of a plant to be used in phytoremediation than conventional method.

  10. Semaphorin 4C Protects against Allergic Inflammation: Requirement of Regulatory CD138+ Plasma Cells. (United States)

    Xue, Di; Kaufman, Gabriel N; Dembele, Marieme; Beland, Marianne; Massoud, Amir H; Mindt, Barbara C; Fiter, Ryan; Fixman, Elizabeth D; Martin, James G; Friedel, Roland H; Divangahi, Maziar; Fritz, Jörg H; Mazer, Bruce D


    The regulatory properties of B cells have been studied in autoimmune diseases; however, their role in allergic diseases is poorly understood. We demonstrate that Semaphorin 4C (Sema4C), an axonal guidance molecule, plays a crucial role in B cell regulatory function. Mice deficient in Sema4C exhibited increased airway inflammation after allergen exposure, with massive eosinophilic lung infiltrates and increased Th2 cytokines. This phenotype was reproduced by mixed bone marrow chimeric mice with Sema4C deficient only in B cells, indicating that B lymphocytes were the key cells affected by the absence of Sema4C expression in allergic inflammation. We determined that Sema4C-deficient CD19 + CD138 + cells exhibited decreased IL-10 and increased IL-4 expression in vivo and in vitro. Adoptive transfer of Sema4c -/- CD19 + CD138 + cells induced marked pulmonary inflammation, eosinophilia, and increased bronchoalveolar lavage fluid IL-4 and IL-5, whereas adoptive transfer of wild-type CD19 + CD138 + IL-10 + cells dramatically decreased allergic airway inflammation in wild-type and Sema4c -/- mice. This study identifies a novel pathway by which Th2-mediated immune responses are regulated. It highlights the importance of plasma cells as regulatory cells in allergic inflammation and suggests that CD138 + B cells contribute to cytokine balance and are important for maintenance of immune homeostasis in allergic airways disease. Furthermore, we demonstrate that Sema4C is critical for optimal regulatory cytokine production in CD138 + B cells. Copyright © 2016 by The American Association of Immunologists, Inc.

  11. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough. (United States)

    Nin, Carlos Shuler; Marchiori, Edson; Irion, Klaus Loureiro; Paludo, Artur de Oliveira; Alves, Giordano Rafael Tronco; Hochhegger, Daniela Reis; Hochhegger, Bruno


    To assess the routine use of barium swallow study in patients with chronic cough. Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks) were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons. The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6%) of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6%) of the patients, whereas the treatment was ineffective in 1 (8.4%). We observed no complications related to barium swallow, such as contrast aspiration. Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.

  12. Virtual colonoscopy with electron beam CT: correlation with barium enema, colonoscopy and pathology

    International Nuclear Information System (INIS)

    Hong, Hye Suk; Kim, Min Jung; Chung, Jae Joon; Kim, Myeong Jin; Lee, Jong Tae; Yoo, Hyung Sik


    To perform virtual colonoscopy using electron beam tomography(EBT) in patients in whom a colonic mass was present, and to compare the results with those obtained using barium enema, colonoscopy and gross pathologic specimens. Materials and Methods : Ten patients in whom colonic masses were diagnosed by either barium enema or colonoscopy were involved in this study. There were nine cases of adenocarcinoma and one of tubulovillous adenoma. Using EBT preoperative abdominopelvic CT scans were performed. Axial scans were then three-dimensionally reconstructed to produce virtual colonoscopic images and were compared with barium enema, colonoscopy and gross pathologic specimens. Virtual colonoscopic images of the masses were classified as either 1)polyploid, 2)sessile,3)fungating, or 4)annular constrictive. We also determined whether ulcers were present within the lesions and whether there was obstruction. Results : After virtual colonoscopy, two lesions were classified as polyploid, one as sessile, five as fungating and two as annular constrictive. Virtual colonoscopic images showed good correlation with the findings of barium enema, colonoscopy and gross pathologic specimens. Three of six ulcerative lesions were observed on colonoscopy; in seven adenocarcinomas with partial or total luminal obstruction, virtual colonoscopy visualized the colon beyond the obstructed sites. In one case, barium contrast failed to pass through the obstructed portion and in six cases, the colonoscope similarly failed. Conclusion : Virtual colonoscopies correlated well with barium enema, colonoscopy and gross pathologic specimens. They provide three dimensional images of colonic masses and are helpful for the evaluation of obstructive lesions

  13. Preparation of porous nano barium ferrite and its adsorption properties on uranium

    International Nuclear Information System (INIS)

    Xiong Guoxuan; Huang Haiqing; Zhang Zhibin


    The porous nano barium ferrite was made of Fe(NO 3 ) 3 and Ba(NO 3 ) 2 as raw materials, CTAB as surfactant by method of sol-gel and self-propagating combustion. The composition, morphology and magnetic properties of nano-rod barium ferrite were characterized by XRD, SEM and vibrating sample magnetometer. The adsorption properties of porous nano barium ferrite on uranium were studied with static adsorption and the effects of pH, adsorption temperature and oscillation time on adsorption properties were discussed. The results indicate that the average particle size of porous nano barium ferrite is 45-65 nm, the saturation magnetization and coercivity are 62.83 emu/g and 5481.0 Oe, respectively. Under the condition of the porous nano barium ferrite amount of 0.02 g, pH of 6, adsorption temperature of 25℃ and oscillation time of 30 min, the adsorption capacity of uranium on the porous nano barium ferrite reaches 921 μg/g. (authors)

  14. Comparison of Calcium and Barium Microcapsules as Scaffolds in the Development of Artificial Dermal Papillae. (United States)

    Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu


    This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and calcium microcapsules maintained xenogenic dermal papilla cells in an immunoisolated environment and induced the formation of hair follicle structures. Calcium microcapsules showed better biocompatibility, permeability, and cell viability in comparison with barium microcapsules. Before 18 weeks, calcium microcapsules gathered together, with no substantial immune response. After 32 weeks, some microcapsules were near inflammatory cells and wrapped with fiber. A few large hair follicles were found. Control samples showed no marked changes at the implantation site. Barium microcapsules were superior to calcium microcapsules in structural and mechanical stability. The cells encapsulated in hydrogel barium microcapsules exhibited higher short-term viability. This study established a model to culture DPCs in 3D culture conditions. Barium microcapsules may be useful in short-term transplantation study. Calcium microcapsules may provide an effective scaffold for the development of artificial dermal papilla.

  15. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough

    Directory of Open Access Journals (Sweden)

    Carlos Shuler Nin


    Full Text Available OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons.RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6% of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6% of the patients, whereas the treatment was ineffective in 1 (8.4%. We observed no complications related to barium swallow, such as contrast aspiration.CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.

  16. Experimental studies on 3D printing of barium titanate ceramics for medical applications

    Directory of Open Access Journals (Sweden)

    Schult Mark


    Full Text Available The present work deals with the 3D printing of porous barium titanate ceramics. Barium titanate is a biocompatible material with piezoelectric properties. Due to insufficient flowability of the starting material for 3D printing, the barium titanate raw material has been modified in three different ways. Firstly, barium titanate powder has been calcined. Secondly, flow additives have been added to the powder. And thirdly, flow additives have been added to the calcined powder. Finally, a polymer has been added to the three materials and specimens have been printed from these three material mixtures. The 3D printed parts were then sintered at 1320°C. The sintering leads to shrinkage which differs between 29.51–71.53% for the tested material mixtures. The porosity of the parts is beneficial for cell growth which is relevant for future medical applications. The results reported in this study demonstrate the possibility to fabricate porous piezoelectric barium titanate parts with a 3D printer that can be used for medical applications. 3D printed porous barium titanate ceramics can especially be used as scaffold for bone tissue engineering, where the bone formation can be promoted by electrical stimulation.

  17. MicroRNA-138 is a potential regulator of memory performance in humans

    Directory of Open Access Journals (Sweden)

    Julia eSchröder


    Full Text Available Genetic factors underlie a substantial proportion of individual differences in cognitive functions in humans, including processes related to episodic and working memory. While genetic association studies have proposed several candidate memory genes, these currently explain only a minor fraction of the phenotypic variance. Here, we performed genome-wide screening on 13 episodic and working memory phenotypes in 1,318 participants of the Berlin Aging Study II aged 60 years or older. The analyses highlight a number of novel single nucleotide polymorphisms (SNPs associated with memory performance, including one located in a putative regulatory region of microRNA (miRNA hsa-mir-138-5p (rs9882688, P-value = 7.8x10-9. Expression quantitative trait locus analyses on next-generation RNA-sequencing data revealed that rs9882688 genotypes show a significant correlation with the expression levels of this miRNA in 309 human lymphoblastoid cell lines (P-value = 5x10-4. In silico modeling of other top-ranking GWAS signals identified an additional memory-associated SNP in the 3' untranslated region (3'UTR of DCP1B, a gene encoding a core component of the mRNA decapping complex in humans, predicted to interfere with hsa-mir-138-5p binding. This prediction was confirmed in vitro by luciferase assays showing differential binding of hsa-mir-138-5p to 3'UTR reporter constructs in two human cell lines (HEK293: P-value = 0.0470; SH-SY5Y: P-value = 0.0866. Finally, expression profiling of hsa-mir-138-5p and DCP1B mRNA in human post-mortem brain tissue revealed that both molecules are expressed simultaneously in frontal cortex and hippocampus, suggesting that the proposed interaction between hsa-mir-138-5p and DCP1B may also take place in vivo. In summary, by combining unbiased genome-wide screening with extensive in silico modeling, in vitro functional assays, and gene expression profiling, our study identified miRNA-138 as a potential molecular regulator of human memory

  18. Optimization of multiroute synthesis for polyaniline-barium ferrite composites

    Energy Technology Data Exchange (ETDEWEB)

    Ben Ghzaiel, Tayssir, E-mail: [Université de Tunis El Manar Faculté des Sciences de Tunis, UR11ES18 Unité de Recherche de Chimie Minérale Appliquée, 2092, Tunis (Tunisia); SATIE, ENS Cachan, CNRS, Université Paris-Saclay, 61 av du Président Wilson, F-94230, Cachan (France); Dhaoui, Wadia [Université de Tunis El Manar Faculté des Sciences de Tunis, UR11ES18 Unité de Recherche de Chimie Minérale Appliquée, 2092, Tunis (Tunisia); Pasko, Alexander; Mazaleyrat, Frédéric [SATIE, ENS Cachan, CNRS, Université Paris-Saclay, 61 av du Président Wilson, F-94230, Cachan (France)


    A comparative study of physicochemical and magnetic properties of Polyaniline-BaFe{sub 12}O{sub 19} composites prepared by Solid-Based Polymerization (SBP) and by Aqueous-Based Polymerization (ABP) is carried out. The composites obtained by the latter method underwent a grinding to study the influence of shear stress. Thus, in a systematic approach, an investigation of stirring effect was done by synthesizing these composites using aqueous-based polymerization but without mechanical stirring. Different mass ratio of BaFe{sub 12}O{sub 19} was used to explore their impact on composites properties. X-ray diffraction, FTIR, SEM, TGA, conductivity and vibrating sample magnetometer measurements were performed. Structural and morphological investigations confirmed the presence of polyaniline and barium hexaferrite phase, which were in interaction in the composites regardless the polymerization route. The powder obtained by solid-based pathway revealed distinct particles with uniform distribution for various compositions (wt. %) of BaFe{sub 12}O{sub 19} in Pani, while the composites obtained by aqueous-based polymerization presented agglomerated nanostructures. Thermogravimetric analysis exhibited an improved thermal stability for Pani-BaFe{sub 12}O{sub 19} obtained by solid-based route. The electric conductivity has displayed decreasing trend of DC conductivity with the increase of BaFe{sub 12}O{sub 19} particles in the polymer matrix. Magnetic studies showed a ferromagnetic behaviour for all composites. The saturation magnetization monotonously increased with the increasing of BaFe{sub 12}O{sub 19} amount. The magnetic properties of the powders were mainly related to the hexaferrite loading which was determined using measured magnetic data. These results revealed that magnetization saturation was dependant of volume fraction of ferrite in the composites which was significantly affected by the reaction medium and mechanical stirring. The powders obtained by solid

  19. Effect of ionic strength on barium transport in porous media (United States)

    Ye, Zi; Prigiobbe, Valentina


    Hydraulic fracturing (or fracking) is a well stimulation technique used to extract resources from a low permeability formation. Currently, the most common application of fracking is for the extraction of oil and gas from shale. During the operation, a large volume of brine, rich in hazardous chemicals, is produced. Spills of brine from wells or pits might negatively impact underground water resources and, in particular, one of the major concerns is the migration of radionuclides, such as radium (Ra2+), into the shallow subsurface. However, the transport behaviour of Ra2+ through a reactive porous medium under conditions typical of a brine, i.e., high salinity, is not well understood, yet. Here, a study on the transport behaviour of barium (Ba2+, congener of radium) through a porous medium containing a common mineral such as goethite (FeO(OH)) is presented. Batch and column flood tests were carried out at conditions resembling the produced brine, i.e., large values of ionic strength (I), namely, 1 to 3 mol/kg. The measurements were described with the triple layer surface complexation model coupled with the Pitzer activity coefficient method and a reactive transport model, in the case of the transport tests. The experimental results show that the adsorption of Ba2+ onto FeO(OH) increases with pH but decreases with I and it becomes negligible at the brine conditions. Moreover, even if isotherms show adsorption at large I, at the same conditions during transport, Ba2+ travels without retardation through the FeO(OH) porous medium. The triple layer model agrees very well with all batch data but it does not describe well the transport tests in all cases. In particular, the model cannot match the pH measurements at large I values. This suggests that the chemical reactions at the solid-liquid interface do not capture the mechanism of Ba2+ adsorption onto FeO(OH) at large salinity. Finally, this study suggests that barium, and potentially its congeners, namely, radium

  20. Supramolecular curcumin-barium prodrugs for formulating with ceramic particles. (United States)

    Kamalasanan, Kaladhar; Anupriya; Deepa, M K; Sharma, Chandra P


    A simple and stable curcumin-ceramic combined formulation was developed with an aim to improve curcumin stability and release profile in the presence of reactive ceramic particles for potential dental and orthopedic applications. For that, curcumin was complexed with barium (Ba(2+)) to prepare curcumin-barium (BaCur) complex. Upon removal of the unbound curcumin and Ba(2+) by dialysis, a water-soluble BaCur complex was obtained. The complex was showing [M+1](+) peak at 10,000-20,000 with multiple fractionation peaks of MALDI-TOF-MS studies, showed that the complex was a supramolecular multimer. The (1)H NMR and FTIR studies revealed that, divalent Ba(2+) interacted predominantly through di-phenolic groups of curcumin to form an end-to-end complex resulted in supramolecular multimer. The overall crystallinity of the BaCur was lower than curcumin as per XRD analysis. The complexation of Ba(2+) to curcumin did not degrade curcumin as per HPLC studies. The fluorescence spectrum was blue shifted upon Ba(2+) complexation with curcumin. Monodisperse nanoparticles with size less than 200dnm was formed, out of the supramolecular complex upon dialysis, as per DLS, and upon loading into pluronic micelles the size was remaining in similar order of magnitude as per DLS and AFM studies. Stability of the curcumin was improved greater than 50% after complexation with Ba(2+) as per UV/Vis spectroscopy. Loading of the supramloecular nanoparticles into pluronic micelles had further improved the stability of curcumin to approx. 70% in water. These BaCur supramolecule nanoparticles can be considered as a new class of prodrugs with improved solubility and stability. Subsequently, ceramic nanoparticles with varying chemical composition were prepared for changing the material surface reactivity in terms of the increase in, degradability, surface pH and protein adsorption. Further, these ceramic particles were combined with curcumin prodrug formulations and optimized the curcumin release


    Peyvasteh, Mehran; Askarpour, Shahnam; Ostadian, Nasrollah; Moghimi, Mohammad-Reza; Javaherizadeh, Hazhir


    Hirschsprung's disease is the most common cause of pediatric intestinal obstruction. Contrast enema is used for evaluation of the patients with its diagnosis. To evaluate sensitivity, specificity, positive predictive value, and negative predictive value of radiologic findings for diagnosis of Hirschsprung in patients underwent barium enema. This cross sectional study was carried out in Imam Khomeini Hospital for one year starting from 2012, April. Sixty patients were enrolled. Inclusion criteria were: neonates with failure to pass meconium, abdominal distention, and refractory constipation who failed to respond with medical treatment. Transitional zone, delay in barium evacuation after 24 h, rectosigmoid index (maximum with of the rectum divided by maximum with of the sigmoid; abnormal if VPN, especificidade e sensibilidade foram calculados para cada achado. A idade média dos casos com a doença de Hirschsprung e sem foi 17,90±18,29 meses e 17,8±18,34 meses, respectivamente (p=0,983). Confirmou-se em 30 (M=20, F=10) dos casos. Falha no mecônio foi encontrada em 21 (70%) casos. Sensibilidade, especificidade, VPP e VPN foram de 90%, 80%, 81,8% e 88,8%, respectivamente, para a zona de transição no enema. Sensibilidade, especificidade, VPP e VPN foram 76,7%, 83,3%, 78,1% e 82,1%, respectivamente para o índice de retossigmoide. Sensitividade, especificidade, VPP e VPN foram 46,7%, 100%, 100% e 65,2%, respectivamente, para contração irregular detectada no enema baritado. Sensibilidade, especificidade, VPP e VPN foram de 23,3%, 100%, 100% e 56,6%, respectivamente, para a irregularidade da mucosa. O achado mais sensível foi zona de transição. Os achados mais específicos foram contração irregular, irregularidade da mucosa, e seguido por aparecimento de mucosa em forma de paralelepípedos.

  2. Monte Carlo estimation for pediatric barium meal procedures

    International Nuclear Information System (INIS)

    Filipov, D.; Schelin, H.R.; Denyak, V.; Legnani, A.; Ledesma, J.A.; Paschuk, S.A.; Sauzen, J.; Yagui, A.; Hoff, G.; Khoury, H.J.


    Fluoroscopic barium meal (BM) series involve an X-ray examination of the esophagus, stomach, and duodenum, by the use of a contrast media – the barium sulfate (BaSO4). They are widely used to observe digestive functions or to diagnose abnormalities such as ulcers; tumors; inflammation of the esophagus, stomach, and duodenum; malrotations; vascular rings; and gastroesophageal reflux disease (a common ailment in children). However, this procedure uses long fluoroscopy times and multiple radiographies, resulting in high effective doses to pediatric patients, whose radiosensitivity and life expectancy are higher than in adults. Based on those data, the aims of the current study are to: determine the P K,A (kerma-area product) values, on the patient chest area, and the effective doses to 5 and 10 years old children. Thirty-seven different pediatric patients were studied and stratified into two group sizes: 5 and 10 years old. For each procedure, the following data was recorded: sex, age and upper chest thickness, from the patients; technical parameters of the procedure (kV, fluoroscopy time and number of radiographies); distances (focus-detector and focus-table) and field size on the examination table. Three pairs of LiF:Mg,Ti thermoluminescent dosimeters were positioned at the center of the child´s sternum. After that, upper chest thickness was subtracted from focus-table distance, so focus-patient distance was obtained. Using the field size on the table and applying similar triangles concepts, the field size on the patient was measured, which was multiplied by the mean kerma (from the dosimeters), so that P K,A could be determined. To estimate the effective dose, P K,A and technical parameters of the procedure (kV, total filtration, focus-detector distance and field size on the patient) were written in a Monte Carlo software simulation. The results of P K,A and effective doses were higher than studies used for comparison, which shows the importance of an

  3. Die kontekstuele funksie van Hebreërs 13:8

    African Journals Online (AJOL)

    29 Jul 2015 ... Read online: Scan this QR code with your smart phone or mobile device to read online. Inleiding. Hebreërs 13:8 lui soos volg: Ἰησοῦς Χριστὸς ἐχθὲς καὶ σήμερον ὁ αὐτός καὶ εἰς τοὺς αἰῶνας ['Jesus. Christus is gister en vandag dieselfde en tot in ewigheid'1]. Die funksie wat Hebreërs 13:8 in sy.

  4. Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

    DEFF Research Database (Denmark)

    Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.


    .0139). The phylogeny of isolates was investigated and the variants harbouring the cysteine 138 mutation clustered independently. CONCLUSION: The present study describes a viral genetic polymorphism related to AIDS disease progression. The polymorphism (cysteine 138) has previously been reported to confer decreased......-1 isolates from patients in a long-term non-progressor (LTNP) cohort and a slow-progressor (SP) cohort (n = 11) was analysed and compared with isolates from a control patient group of progressors (n = 18). Most of the patients with delayed disease progression had extensive medical records, providing...... an insight into the LTNP disease profile and allowing for the stratification of patients based on their CD4 cell decline. RESULTS: In sequences from nine patients, most of the functional domains of HIV-1 Nef appeared intact, and no major deletions were observed to possibly account for an effect...

  5. Cytotoxic activities of Euphorbia kopetdaghi against OVCAR-3 and EJ-138 cell lines

    Directory of Open Access Journals (Sweden)

    Aghaei Mahmoud


    Full Text Available Introduction: Over the centuries, the genus Euphorbia was known to be toxic to humans and animals. Recently, in a primary study significant suppressive activity against phytohemagglutinin activated T-cell proliferation has been reported from this plant. Therefore, this study was designed to evaluate the cytotoxic effects of different parts of E. kopetdaghi against cancer cell lines. Methods: Filtration and in vacuo concentration resulted in a green gum which was subjected on silica gel CC (hexane/Acetone, 0→50 to several fractions: F1-F8. The inhibitory effects of obtained fractions with 5, 50, and 500 μg/ml concentrations were evaluated on proliferation and viability of cancer cells (OVCAR and EJ-138 in 48 hours treatment. Finally, cell viability was determined at a wavelength of 570 by 3-4,5-dimethylthiazol-2-yl-2,5-diphenyl tetrazolium bromide (MTT method. Results: Based on studies of microscopic observation and viability testing, F1, F2, F4, F5, F6, and F7 showed significant cytotoxic effect at concentration of 50 and 500 μg/ml against EJ-138 and OVCAR-3 cell lines. These fractions inhibited growth of EJ-138 and OVCAR-3 cells in a concentration-dependent manner. Fraction of F8 induced tumor promotion significantly in EJ-138 and OVCAR-3 cells, respectively. Conclusion: Due to the inhibitory properties of E. kopetdaghi extract and its fractions on cancer cells of OVCAR3 and EJ-13, isolation, purification and identification of compounds presented in the fractions possessing cytotoxic effects are recommended which were the area of our future research.

  6. Radioiodine therapy in management of thyroid carcinoma - A review of 138 patients

    International Nuclear Information System (INIS)

    Hossain, A.S.; Hossain, S.; Hafiz, N.; Taslima, D.A.; Rashid, H.


    Differentiated thyroid carcinomas are being treated by using a widely accepted protocol of surgery and radioiodine therapy followed by supplementation of thyroid hormones in the Nuclear Medicine Centre (NMC), Dhaka Medical College Hospital (DMCH) since 1990. In the present study 138 patients(Male-54, Female-84) with differentiated thyroid cancers received radioiodine therapy for ablation of residual thyroid tissue with a dose of 2.77-3.7 GBq (75-100 mCi), for lymph node metastases 5.55-6.5 GBq(150-175mCi), for lung metastases 5.55 GBq(150 mCi) and for bony metastases 7.4 GBq (200 mCi). Among 138 patients papillary carcinoma was observed in 94 cases (68%; Male-42, Female-52), follicular type was found in 30 cases (22%; Male-8, Female-22) and mixed type in 14 patients (10%, Male-4, Female-10). Single dose of 2.77-3.7 GBq(75-100 mCi) of radioiodine was received by all 138 patients. Among the unablated patients 62 received double doses totalling 9.25 GBq (250 mCi), 44 received three doses 12.95 GBq (350 mCi) and one patient received 8 doses 33.3 GBq (900 mCi). Out of 138 patients single dose ablated 76 cases and 62 remain unablated. Multiple doses ablated 28 patients and 34 still remain unablated and is under follow up. The success and failure in management of patients with differentiated thyroid cancer over 8 years period have been discussed here revealing a satisfactory outcome. (author)

  7. Down-regulation of human cytomegalovirus UL138, a novel latency ...

    Indian Academy of Sciences (India)

    ... using luciferase reporter assays and Western blot analysis in HEK293 cells. In the presence of hcmv-miR-UL36, we observed a 74.6% decrease in luciferase activity and a 46.2% decrease in HCMV UL138 protein expression. Our results indicate that hcmv-miR-UL36 may be a viral miRNA contributing to HCMV replication ...

  8. Clinical, genetic and neuropathological findings in a series of 138 fetuses with a corpus callosum malformation. (United States)

    Alby, Caroline; Malan, Valérie; Boutaud, Lucile; Marangoni, Maria Angela; Bessières, Bettina; Bonniere, Maryse; Ichkou, Amale; Elkhartoufi, Nadia; Bahi-Buisson, Nadia; Sonigo, Pascale; Millischer, Anne-Elodie; Thomas, Sophie; Ville, Yves; Vekemans, Michel; Encha-Razavi, Férechté; Attié-Bitach, Tania


    Corpus callosum malformation (CCM) is the most frequent brain malformation observed at birth. Because CCM is a highly heterogeneous condition, the prognosis of fetuses diagnosed prenatally remains uncertain, making prenatal counseling difficult. We evaluated retrospectively a total of 138 fetuses, 117 with CCM observed on prenatal imaging examination, and 21 after postmortem autopsy. On ultrasound and/or magnetic resonance imaging, CCM was either isolated (N = 40) or associated with other neurological (N = 57) or extra cerebral findings (N = 21/20, respectively). Most fetuses (N = 132) remained without a diagnosis at the time of pregnancy termination. This emphasizes the need to establish a neuropathological classification and to perform a genomic screening using comparative genomic hybridization. A neuropathological examination performed on 138 cases revealed a spectrum of CCMs, classified as follows: agenesis of corpus callosum (55), CC hypoplasia (30), CC dysmorphism (24), and CCM associated with a malformation of cortical development (29). Of interest, after fetopathological examination, only 16/40 malformations were classified as isolated, highlighting the importance of the autopsy following termination of pregnancy. Among the 138 cases, the underlying etiology was found in 46 cases: diabetes (one case), cytomegalovirus infection (one case), 23 chromosome abnormalities, and 21 mendelian conditions. In our series of 138 cases of CCM, prenatal and postmortem examinations identified a variety of genetic causes. However, no diagnosis could be established in 67% of cases. The classification based on the underlying neurodevelopmental defects paves the way for further genetic studies and genotype-phenotype correlations. © 2015 Wiley Periodicals, Inc.

  9. Rapid and accurate determination of barium by instrumental neutron activation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Armelin, Maria Jose A.; Maihara, Vera A.; Saiki, Mitiko, E-mail:, E-mail:, E-mail: [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Trevizam, Anderson R., E-mail: [Universidade Estadual do Centro Oeste (UNICENTRO), Guarapuava, PR (Brazil)


    Barium is an alkaline earth metal naturally present in soils. When available at a high level in the soil it can cause toxicity to plants and animals. Not all the barium is readily available to living organisms. Inorganic and organic barium compounds can be presented as soluble or insoluble forms in the soil. The soluble form of BaS is extremely toxic to humans, animals and plants. Researchers have noted a decrease of K absorption in the plant when Ba concentrations are increased and a change in overall plant growth. In case of animals, Ba tends to be concentrated in the bones which may compete with calcium, although only about 2% barium ingested in dietary is absorbed by the body. Another effect is that the Ba can interfere with the availability of sulfur in the soil due to the sulphate formation of low solubility. Barium and some other elements are considered palioclimatic proxies. For some researchers, barite is perhaps the most appropriate indicator of paleoproductivity because of a high resistance to dissolution. As explained about the barium effects in various situations, it was considered important to study the more appropriated experimental conditions for determination of this element by INAA. Conditions established for this analysis were: a) Irradiation time, 15 and 40 seconds, under thermal flux neutron about 4 x 10{sup 12} n cm{sup -2} s{sup -1}, for determining barium in geological and biological matrices, respectively; b) Decay time, approximately of 4 minutes; c) Counting time of 30 minutes; d) Radionuclide measured {sup 139}Ba. The quality of Ba results was evaluated from the analysis of certified reference materials. The performance of the method was satisfactory, according to the criterion of E.ζ score. Results obtained in this study indicate INAA is a good alternative for Ba determination in geological and biological samples. (author)

  10. Rapid and accurate determination of barium by instrumental neutron activation analysis

    International Nuclear Information System (INIS)

    Armelin, Maria Jose A.; Maihara, Vera A.; Saiki, Mitiko; Trevizam, Anderson R.


    Barium is an alkaline earth metal naturally present in soils. When available at a high level in the soil it can cause toxicity to plants and animals. Not all the barium is readily available to living organisms. Inorganic and organic barium compounds can be presented as soluble or insoluble forms in the soil. The soluble form of BaS is extremely toxic to humans, animals and plants. Researchers have noted a decrease of K absorption in the plant when Ba concentrations are increased and a change in overall plant growth. In case of animals, Ba tends to be concentrated in the bones which may compete with calcium, although only about 2% barium ingested in dietary is absorbed by the body. Another effect is that the Ba can interfere with the availability of sulfur in the soil due to the sulphate formation of low solubility. Barium and some other elements are considered palioclimatic proxies. For some researchers, barite is perhaps the most appropriate indicator of paleoproductivity because of a high resistance to dissolution. As explained about the barium effects in various situations, it was considered important to study the more appropriated experimental conditions for determination of this element by INAA. Conditions established for this analysis were: a) Irradiation time, 15 and 40 seconds, under thermal flux neutron about 4 x 10 12 n cm -2 s -1 , for determining barium in geological and biological matrices, respectively; b) Decay time, approximately of 4 minutes; c) Counting time of 30 minutes; d) Radionuclide measured 139 Ba. The quality of Ba results was evaluated from the analysis of certified reference materials. The performance of the method was satisfactory, according to the criterion of E.ζ score. Results obtained in this study indicate INAA is a good alternative for Ba determination in geological and biological samples. (author)

  11. Accelerating the transit time of barium sulphate suspensions in small bowel examinations

    International Nuclear Information System (INIS)

    Summers, David S.; Roger, Mark D.; Allan, Paul L.; Murchison, John T.


    Purpose: To determine whether hyperosmolar and effervescent agents proven individually to accelerate transit time in the barium small bowel examination have an additive effect when combined, surpassing that of either agent alone. Materials and methods: One hundred and forty-nine patients were randomised to four groups. Three hundred milliliters of barium sulphate alone was given to the first group. Fifteen milliliters of iodinated hyperosmolar contrast agent (Gastrografin, meglumine/sodium diatrizoate, Schering) was given in addition to barium sulphate to the second group while six packets of effervescent granules (Carbex, Ferring) were added for the third group. The final group was given a combination of both additives and barium sulphate. The time taken following ingestion for the contrast column to reach the caecum, as assessed by frequent interval fluoroscopy, was recorded. A subgroup of 32 patients were selected randomly from the four groups, 8 from each and assessed for quality of examination. Statistical assessments were made using Kruskal-Wallis and Mann-Whitney tests. Results: One hundred and nineteen patients were analysed after exclusions. The addition of accelerant to barium sulphate, both individually and in combination significantly reduced the small bowel transit time (p < 0.001). No significant difference existed between the additives when used with barium alone. The combined group had significantly faster transit times compared to the hyperosmolar group (p = 0.02). Differences between combined and effervescent groups tended towards significance (p = 0.09). No significant difference existed between groups when examination quality was assessed. Conclusion: These results suggest that the addition of combined effervescent and hyperosmolar agents to the barium suspension may significantly shorten the small bowel transit time without adversely affecting examination quality. This has implications for patient acceptability of the examination as well as

  12. [Value of preoperative barium contrast examination for the diagnosis and operative planning in gastric cancer]. (United States)

    Wang, Chang-jian; Zhao, Guang-fa; Li, Qing-guo; Chen, Jing-gui; Zhu, Kai; Shi, Ying-qiang; Fu, Hong


    To investigate the value of preoperative barium contrast examination for the diagnosis and operative planning in gastric cancer. Clinical data of 229 gastric cancer patients were analyzed retrospectively. Lesions were divided into three parts: the cardiac, the body, and the antrum. The diagnostic accuracy of localization and the extent of tumor between gastroscopy alone and gastroscopy plus barium contrast were compared with the results of surgical findings. The diagnostic accuracy of localization and the extent of tumor for gastroscopy in the cardiac, the body and the antrum cancers were 100% and 78.4%, 94.6% and 86.5%, 98.1% and 84.6%, respectively, while for gastroscopy plus barium contrast were 100% and 84.8%, 100% and 91.9%, 99.0% and 90.4%, respectively. The diagnostic accuracy of both the localization and the extent of tumor were not significantly different between gastroscopy alone and gastroscopy plus barium contrast (P>0.05). Diagnostic accuracy of the length of esophagus infiltrated by cardiac cancer in gastroscopy was 60.6%, while in gastroscopy plus barium contrast was 90.9%, which was significantly different (Pbarium contrast was more accurate in predicting the possibility of thoracotomy in cardiac cancer infiltrating the lower esophagus. It is necessary to perform preoperative barium contrast examination in cardiac cancer patients, so as to identify whether the lower esophagus is infiltrated and to measure the length of lesion, which can provide evidences for making a decision of thoracotomy. For gastric body and antrum cancer, there is no indication for barium contrast examination if gastroscopy findings are satisfied.

  13. An 8-year review of barium studies in the diagnosis of gastroparesis

    International Nuclear Information System (INIS)

    Levin, A.A.; Levine, M.S.; Rubesin, S.E.; Laufer, I.


    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings

  14. An 8-year review of barium studies in the diagnosis of gastroparesis

    Energy Technology Data Exchange (ETDEWEB)

    Levin, A.A. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States); Levine, M.S. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)], E-mail:; Rubesin, S.E.; Laufer, I. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)


    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings.

  15. Preparation and properties of yttria doped tetragonal zirconia polycrystal/Sr-doped barium hexaferrite ceramic composites

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Shanshan; Zhang, Chao; Guo, Ruisong, E-mail:; Liu, Lan; Yang, Yuexia; Li, Kehang


    Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m{sup 1/2}. - Abstract: The effects of substitution of Ba{sup 2+} by Sr{sup 2+} on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba{sub 1−x}Sr{sub x}Fe{sub 12}O{sub 19}, x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m{sup 1/2} for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase.

  16. Barium inhibits arsenic-mediated apoptotic cell death in human squamous cell carcinoma cells. (United States)

    Yajima, Ichiro; Uemura, Noriyuki; Nizam, Saika; Khalequzzaman, Md; Thang, Nguyen D; Kumasaka, Mayuko Y; Akhand, Anwarul A; Shekhar, Hossain U; Nakajima, Tamie; Kato, Masashi


    Our fieldwork showed more than 1 μM (145.1 μg/L) barium in about 3 μM (210.7 μg/L) arsenic-polluted drinking well water (n = 72) in cancer-prone areas in Bangladesh, while the mean concentrations of nine other elements in the water were less than 3 μg/L. The types of cancer include squamous cell carcinomas (SCC). We hypothesized that barium modulates arsenic-mediated biological effects, and we examined the effect of barium (1 μM) on arsenic (3 μM)-mediated apoptotic cell death of human HSC-5 and A431 SCC cells in vitro. Arsenic promoted SCC apoptosis with increased reactive oxygen species (ROS) production and JNK1/2 and caspase-3 activation (apoptotic pathway). In contrast, arsenic also inhibited SCC apoptosis with increased NF-κB activity and X-linked inhibitor of apoptosis protein (XIAP) expression level and decreased JNK activity (antiapoptotic pathway). These results suggest that arsenic bidirectionally promotes apoptotic and antiapoptotic pathways in SCC cells. Interestingly, barium in the presence of arsenic increased NF-κB activity and XIAP expression and decreased JNK activity without affecting ROS production, resulting in the inhibition of the arsenic-mediated apoptotic pathway. Since the anticancer effect of arsenic is mainly dependent on cancer apoptosis, barium-mediated inhibition of arsenic-induced apoptosis may promote progression of SCC in patients in Bangladesh who keep drinking barium and arsenic-polluted water after the development of cancer. Thus, we newly showed that barium in the presence of arsenic might inhibit arsenic-mediated cancer apoptosis with the modulation of the balance between arsenic-mediated promotive and suppressive apoptotic pathways.

  17. Obtaining of a barium compound by combustion chemistry and their evaluation as Co adsorbent

    International Nuclear Information System (INIS)

    Rosas G, N.


    In this work, barium carbonate synthesized by chemical combustion method using a chemical precursor prepared by the combination of barium nitrate and urea as a fuel, with a 1:1 molar ratio in aqueous solution, the chemical precursor was heated to evaporate excess water, producing a homogeneous viscous liquid, that when heated to 900 centi grades for 5 minutes an exothermic reaction was produced very quickly and abruptly, forming a white powder final product, fine porous, little spongy, dry and crystalline ready to be used as material adsorbent. Additionally, the effect of water on the synthesis by chemical combustion was studied. Simultaneously, and with the purpose of comparing the advantages and disadvantages of the method by chemical combustion, barium carbonate was synthesized by precipitation method using barium nitrate salts and sodium carbonate. Synthesized barium carbonate, was characterized by X-ray diffraction, thermal gravimetric analysis, infrared spectrometry and scanning electron microscopy. We studied the adsorption capacity of Co present in aqueous solution by static tests on materials synthesized at room temperature using the neutron activation analysis. It was found that the synthesis by chemical combustion provides an interesting alternative compared to the synthesis by precipitation because it offers simplicity of synthesis and speed to have a good adsorbent material. It was found that the barium carbonate synthesized by the chemical combustion method using in their synthesis 1.0 ml of water, was the one who achieved the maximum adsorption capacity of 95.6% compared with the barium carbonate prepared by precipitation, which reached a capacity adsorption of 51.48%. (Author)

  18. 14 CFR 91.138 - Temporary flight restrictions in national disaster areas in the State of Hawaii. (United States)


    ... disaster areas in the State of Hawaii. 91.138 Section 91.138 Aeronautics and Space FEDERAL AVIATION... areas in the State of Hawaii. (a) When the Administrator has determined, pursuant to a request and justification provided by the Governor of the State of Hawaii, or the Governor's designee, that an inhabited...

  19. 40 CFR 63.138 - Process wastewater provisions-performance standards for treatment processes managing Group 1... (United States)


    ... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process wastewater provisions-performance standards for treatment processes managing Group 1 wastewater streams and/or residuals removed from Group 1 wastewater streams. 63.138 Section 63.138 Protection of Environment ENVIRONMENTAL...

  20. Molecular mechanism of antagonism between the Y181C and E138K mutations in HIV-1 reverse transcriptase. (United States)

    Xu, Hong-Tao; Oliveira, Maureen; Asahchop, Eugene L; McCallum, Matthew; Quashie, Peter K; Han, Yingshan; Quan, Yudong; Wainberg, Mark A


    Etravirine (ETR) is an expanded-spectrum nonnucleoside reverse transcriptase inhibitor (NNRTI) approved for use as an antiretroviral agent in treatment-experienced patients. Y181C and E138K in HIV-1 RT are among 20 different drug resistance mutations associated with ETR. However, E138K can be consistently selected by ETR when wild-type viruses but not viruses containing Y181C are grown in tissue culture. This study was carried out to evaluate any possible mechanisms that might explain antagonism between the Y181C and E138K mutations. Accordingly, we performed tissue culture studies to investigate the evolutionary dynamics of E138K in both a wild-type (WT) and a Y181C background. We also generated recombinant enzymes containing Y181C and E138K alone or in combination in order to study enzyme processivity, rates of processive DNA synthesis, enzyme kinetics, and susceptibility to ETR. We now show that the presence of the Y181C mutation prevented the emergence of E138K in cell culture and that the simultaneous presence of E138K and Y181C impaired each of enzyme activity, processivity, rate of processive DNA synthesis, and deoxynucleoside triphosphate (dNTP) affinity. The addition of E138K to Y181C also decreased the level of resistance to ETR compared to that obtained with Y181C alone.

  1. Hydrogen diffusion in lead zirconate titanate and barium titanate (United States)

    Alvine, K. J.; Vijayakumar, M.; Bowden, M. E.; Schemer-Kohrn, A. L.; Pitman, S. G.


    Hydrogen is a potential clean-burning, next-generation fuel for vehicle and stationary power. Unfortunately, hydrogen is also well known to have serious materials compatibility issues in metals, polymers, and ceramics. Piezoelectric actuator materials proposed for low-cost, high efficiency high-pressure hydrogen internal combustion engines (HICE) are known to degrade rapidly in hydrogen. This limits their potential use and poses challenges for HICE. Hydrogen-induced degradation of piezoelectrics is also an issue for low-pressure hydrogen passivation in ferroelectric random access memory. Currently, there is a lack of data in the literature on hydrogen species diffusion in piezoelectrics in the temperature range appropriate for the HICE as charged via a gaseous route. We present 1HNMR quantification of the local hydrogen species diffusion within lead zirconate titanate and barium titanate on samples charged by exposure to high-pressure gaseous hydrogen ˜32 MPa. Results are discussed in context of theoretically predicted interstitial hydrogen lattice sites and aqueous charging experiments from existing literature.

  2. Barium from a mini r-process in supernovae (United States)

    Heymann, D.


    McCulloch and Wasserburg (1978) have reported nonlinear isotopic anomalies in barium for two Ca-Al-rich inclusions of the Allende carbonaceous chondrite, known as EK-1-4-1 and C-1. In an attempt to account for these anomalies, it has been proposed that Ba from an r-process of nucleosynthesis, containing Ba-135 and Ba-137, was injected into the primeval color system but was not totally homogenized. Questions arise in connection with the relations of Xe isotopes in carbonaceous chondrites. This has prompted Heymann and Dziczkaniec (1979, 1980, 1981) to study the formation of r-Xe, r-Kr, and r-Te by the mini r-process which is thought to occur in the O, Ne-rich shells of Type II supernovae. Lee et al. (1979) have studied the formation of r-Ba, r-Nd, and r-Sm by the same process. Certain differences regarding the approaches used by Lee et al. and by Heymann and Dziczkaniec make it necessary to restudy the work of Lee et al. Attention is given to the survival probabilities of nuclear species of interest, taking into accounts the elements Cs, Ba, I, and Xe.

  3. Impact of vanadium ions in barium borate glass. (United States)

    Abdelghany, A M; Hammad, Ahmed H


    Combined optical and infrared spectral measurements of prepared barium borate glasses containing different concentrations of V2O5 were carried out. Vanadium containing glasses exhibit extended UV-visible (UV/Vis.) bands when compared with base binary borate glass. UV/Vis. spectrum shows the presence of an unsymmetrical strong UV broad band centered at 214 nm attributed to the presence of unavoidable trace iron impurities within the raw materials used for the preparation of such glass. The calculated direct and indirect optical band gaps are found to decrease with increasing the vanadium content (2.9:137 for indirect and 3.99:2.01 for direct transition). This change was discussed in terms of structural changes in the glass network. Infrared absorption spectra of the glasses reveal the appearance of both triangular and tetrahedral borate units. Electron spin resonance analyses indicate the presence of unpaired species in sufficient quantity to be identified and to confirm the spectral data. Copyright © 2014 Elsevier B.V. All rights reserved.

  4. Synthesis and characterization of La-doped barium stannate

    International Nuclear Information System (INIS)

    Upadhyay, Shail; Ansaree, Javed


    A few samples in the system Ba 1-x La x SnO 3 (x=0.001, 0.05 and 0.10) have been synthesized by combustion method. Powder X-ray diffraction (XRD) pattern of the samples confirms the formation of single phase solid solution formation. It was found that single phase compositions have cubic crystal structure similar to undoped barium stannate. Synthesized powders have also been characterized using SEM, EDXA, DTA, TGA and FTIR techniques. The electrical properties of these samples were studied using the ac impedance spectroscopy technique over a wide range of temperature (50-650℃) in the frequency range of 10 Hz - 1 MHz. Complex impedance plots recorded at different temperatures show that at high temperatures (≥ 300℃) total impedance is due to the contributions of grains and grain boundaries. Resistance of these contributions has been determined. Variation of these resistances with temperature shows the presence of two different regions with different slopes. Similarity in the nature of variation of both the resistances in both the temperature regions confirms that conducting species (phases) responsible for grain, grain boundaries and electrode are the same. Based on the value of activation energy, it is proposed that conduction in the low temperature region (300 - 450℃) is taking place via hopping of doubly ionized oxygen vacancies (V 0 ·· ) whereas, in the high temperature region (450 - 650℃) via hopping of proton i.e. OH · ions. (author)

  5. Pyro- and electromagnetic effects in ferrite/barium titanate composite

    Directory of Open Access Journals (Sweden)

    Andrey A. Pan'kov


    Full Text Available New solutions for tensors of effective pyroelectromagnetic properties of piezoactive composites on the basis of boundary value problem solution for electromagnetic elasticity have been obtained. For the solution of the boundary value problem, new solutions for singular components of the second derivative Green functions for displacements, electric and magnetic potentials in homogeneous transversal isotropic piezoelectromagnetic medium with ellipsoidal grain of heterogeneity have been used. Calculation results on the concentration dependences for effective coefficients of pyromagnetic and electromagnetic coherence of ferrite/barium titanate composite with ellipsoidal, spherical and fibrous inclusions for various polydisperse structures and those of a layered structure composite have been presented. Considerable influence of the shape of the inclusions, features of relative positioning and inversion of the properties of phases on the effective coefficients of pyromagnetic and electromagnetic coherence of the composite material have been revealed. The conclusion is drawn on the preferable use of the pyroelectric phase as spherical inclusions, and ferrite as the composite matrix. This allows for more than a fivefold increase in the effective constant of pyromagnetic coherence of the composite material in comparison with its value for the same structure but with inversion of properties of phases for constant volume fractions of the ferrite and pyroelectric phases.

  6. Medical and occupational dose reduction in pediatric barium meal procedures (United States)

    Filipov, D.; Schelin, H. R.; Denyak, V.; Paschuk, S. A.; Ledesma, J. A.; Legnani, A.; Bunick, A. P.; Sauzen, J.; Yagui, A.; Vosiak, P.


    Doses received in pediatric Barium Meal procedure can be rather high. It is possible to reduce dose values following the recommendations of the European Communities (EC) and the International Commission on Radiological Protection (ICRP). In the present work, the modifications of radiographic techniques made in a Brazilian hospital according to the EC and the ICRP recommendations and their influence on medical and occupational exposure are reported. The procedures of 49 patients before and 44 after the optimization were studied and air kerma-area product (PK,A) values and the effective doses were evaluated. The occupational equivalent doses were measured next to the eyes, under the thyroid shield and on each hand of both professionals who remained inside the examination room. The implemented modifications reduced by 70% and 60% the PK,A and the patient effective dose, respectively. The obtained dose values are lower than approximately 75% of the results from similar studies. The occupational annual equivalent doses for all studied organs became lower than the limits set by the ICRP. The equivalent doses in one examination were on average below than 75% of similar studies.

  7. Flexoelectric sensing using a multilayered barium strontium titanate structure

    International Nuclear Information System (INIS)

    Kwon, S R; Huang, W B; Yuan, F G; Jiang, X N; Zhang, S J


    The flexoelectric effect has been recently explored for its promise in electromechanical sensing. However, the relatively low flexoelectric coefficients of ferroelectrics inhibit the potential to develop flexoelectric sensing devices. In this paper, a multilayered structure using flexoelectric barium strontium titanate (Ba 0.65 Sr 0.35 TiO 3 or BST) ceramic was fabricated in an attempt to enhance the effective flexoelectric coefficients using its inherent scale effect, and hence to improve the flexoelectric sensitivity. The performances of piezoelectric and flexoelectric cantilevers with the same dimensions and under the same conditions were compared. Owing to the flexoelectric scaling effect, under the same force input, the BST flexoelectric structure generated a higher charge output than its piezoelectric P(VDF-TrFE) and PMN-30PT counterparts when its thickness was less than 73.1 μm and 1.43 μm, respectively. Also, amplification of the charge output using the multilayered structure was then experimentally verified. The prototyped structure consisted of three layers of 350 μm-thick BST plates with a parallel electric connection. The charge output was approximately 287% of that obtained using a single-layer structure with the same total thickness of the multilayered structure under the same end deflection input, which suggests high sensitivity sensing can be achieved using multilayer flexoelectric structures. (paper)

  8. Barium variation in Acropora palmata and Montastrea annularis (United States)

    Pingitore, Nicholas E.; Rangel, Yolanda; Kwarteng, Andrew


    The barium contents of Acropora palmata and Montastrea annularis are distinct both in their averages (6 and 9 ppm, respectively) and, more impressively, in their variability (5 to 7 ppm and 6 to 15 ppm). A. palmata contained about 50% more Ba2+ than M. annularis and exhibited more than three times as much variation, as measured by their respective coefficients of variation. In contrast, the means and coefficients of variation of Sr2+ in these groups differed by only 6% and 15%. No obvious environmental or post-depositional causes for the inter-and intra-specific variation of Ba2+ could be found. Previous experiments indicate that the partitioning of Ba2+ into aragonite depends directly on the rate of precipitation. This suggests that Ba2+ does not substitute for Ca2+ but instead is incorporated by occlusion. Since growth rates in A. palmata often exceed those of M. annularis, this appears to be the mechanism which generates higher and more variable concentrations of Ba2+ in A. palmata.

  9. Colonic diverticulosis: evaluation with double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja [Korea Veterans Hospital, Seoul (Korea, Republic of)


    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west.

  10. Colonic diverticulosis: evaluation with double contrast barium enema

    International Nuclear Information System (INIS)

    Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja


    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west

  11. Barium oxide, calcium oxide, magnesia, and alkali oxide free glass (United States)

    Lu, Peizhen Kathy; Mahapatra, Manoj Kumar


    A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.

  12. Expression analysis of multiple myeloma CD138 negative progenitor cells using single molecule microarray readout (United States)

    Jacak, Jaroslaw; Schnidar, Harald; Muresan, Leila; Regl, Gerhard; Frischauf, Annemarie; Aberger, Fritz; Schütz, Gerhard J.; Hesse, Jan


    We present a highly sensitive bioanalytical microarray assay that enables the analysis of small genomic sample material. By combining an optimized cDNA purification step with single molecule cDNA detection on the microarray, the platform has improved sensitivity compared to conventional systems, allowing amplification-free determination of expression profiles with as little as 600 ng total RNA. Total RNA from cells was reverse transcribed into fluorescently labeled cDNA and purified employing a precipitation method that minimizes loss of cDNA material. The microarray was scanned on a fluorescence chip-reader with single molecule sensitivity. Using the newly developed platform we were able to analyze the RNA expression profile of a subpopulation of rare multiple myeloma CD138 negative progenitor (MM CD138neg) cells. The high-sensitivity microarray approach led to the identification of a set of 20 genes differentially expressed in MM CD138neg cells. Our work demonstrates the applicability of a straight-forward single-molecule DNA array technology to current topics of molecular and cellular cancer research, which are otherwise difficult to address due to the limited amount of sample material. PMID:23416329

  13. Benefits of Barium Enema in Patients with Incomplete Colonoscopy. Prospective Study of 45 Cases

    International Nuclear Information System (INIS)

    Gispert, S.; Mayolas, N.; Hidalgo, A.


    To evaluate the usefulness of barium enema in patients with incomplete colonoscopy. There was carried out a prospective 10-month study of 45 patients with incomplete colonoscopy (27 men and 18 women), who were later examined by means of barium enema (33 conventional, 12 double-contrast) in order to check for additional pathology in portions of the colon not visualized by colonoscopy. Barium enema diagnosed six possible additional lesions (13.3%) in portions of the colon not visualized by incomplete colonoscopy (four neoplasia and two non-neoplasia). Regarding the neoplasia two were true positives and two false positives. Both true positives were adenocarcinomas (one synchronous caecum, and another in splenic angle). The two false positives corresponded to fecal matter stuck to the intestinal wall. Regarding the non-neoplasia, multiple stenosis was detected in a patient with Crohn's disease and an enterocolic fistula was found in a patient with sigmoid colon neoplasia. The diagnostic yield of barium enema in the detection of additional pathology in colon portions not visualized by colonoscopy was of 9%. Barium enema following incomplete colonoscopy permits a complete colon evaluation in most cases, and it offers additional diagnostic information. (Author) 21 refs

  14. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE. (United States)

    Anderson, N G; Butler, A P; Scott, N J A; Cook, N J; Butzer, J S; Schleich, N; Firsching, M; Grasset, R; de Ruiter, N; Campbell, M; Butler, P H


    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 microA). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications.

  15. Effect of barium sulfate contrast medium on rheology and sensory texture attributes in a model food. (United States)

    Ekberg, O; Bulow, M; Ekman, S; Hall, G; Stading, M; Wendin, K


    The swallowing process can be visualized using videoradiography, by mixing food with contrast medium, e.g., barium sulfate (BaSO(4)), making it radiopaque. The sensory properties of foods may be affected by adding this medium. To evaluate if and to what extent sensory and rheological characteristics of mango purée were altered by adding barium sulfate to the food. This study evaluated four food samples based on mango purée, with no or added barium sulfate contrast medium (0%, 12.5%, 25.0%, and 37.5%), by a radiographic method, and measured sensory texture properties and rheological characteristics. The sensory evaluation was performed by an external trained panel using quantitative descriptive analysis. The ease of swallowing the foods was also evaluated. The sensory texture properties of mango purée were significantly affected by the added barium in all evaluated attributes, as was the perception of particles. Moreover, ease of swallowing was significantly higher in the sample without added contrast medium. All samples decreased in extensional viscosity with increasing extension rate, i.e., all samples were tension thinning. Shear viscosity was not as dependent on the concentration of BaSO(4) as extensional viscosity. Addition of barium sulfate to a model food of mango purée has a major impact on perceived sensory texture attributes as well as on rheological parameters.

  16. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    International Nuclear Information System (INIS)

    Matoso, Erika; Cadore, Solange


    Barium can be found in waters up to 1 mg L -1 and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L -1 and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  17. Colonoscopy can miss diverticula of the left colon identified by barium enema. (United States)

    Niikura, Ryota; Nagata, Naoyoshi; Shimbo, Takuro; Akiyama, Junichi; Uemura, Naomi


    To identify the diagnostic value of colonoscopy for diverticulosis as determined by barium enema. A total of 65 patients with hematochezia who underwent colonoscopy and barium enema were analyzed, and the diagnostic value of colonoscopy for diverticula was assessed. The receiver operating characteristic area under the curve was compared in relation to age (barium enema. Colonoscopy had a sensitivity of 91% and specificity of 90%. No significant differences were found in the receiver operating characteristic area under the curve (ROC-AUC) for age group or sex. The ROC-AUC of the left colon was significantly lower than that of the right colon (0.81 vs 0.96, P = 0.02). Colonoscopy identified 486 colonic diverticula, while barium enema identified 1186. The detection ratio for the entire colon was therefore 0.41 (486/1186). The detection ratio in the left colon (0.32, 189/588) was significantly lower than that of the right colon (0.50, 297/598) (P barium enema, only half the number of colonic diverticula can be detected by colonoscopy in the entire colon and even less in the left colon.

  18. [Adsorption behavior of immobilized nanometer barium-strontium titanate for cadmium ion in water]. (United States)

    Zhang, Dong; Zhang, Wen-Jie; Guan, Xin; Gao, Hong; He, Hong-Bo


    Nanometer barium-strontium titanate immobilized on silica gel G was successfully prepared by the citrate acid sol-gel method and characterized using X-ray diffraction (XRD), scanning electron microscope (SEM) and Fourier transform infrared spectrophotometer (FTIR). By means of the determination of flame atomic absorption spectrometry (FAAS), the adsorption behavior of immobilized nanometer-barium strontium titanate for cadmium ion was investigated. The results showed that the nanometer barium-strontium titanate was immobilized on the silica gel G firmly, gaining a new sort of adsorbent. And the cadmium ion studied could be quantitatively retained in the pH value range of 4-7. The adsorption behavior followed a Freundlich adsorption isotherm and a pseudo-second-order kinetic model. The thermodynamic constants of the adsorption process, such as enthalpy changes (deltaH), Gibbs free energy changes (deltaG) and entropy changes (deltaS), were evaluated. These showed that the adsorption of cadmium ion by immobilized nanometer barium-strontium titanate was endothermic and spontaneous physical process. The cadmium ion adsorbed could be completely eluted using 1 mol x L(-1) HNO3. A new method for the determination of trace cadmium ion in water based on this immobilized nanometer barium-strontium titanate preconcentration and FAAS determination was proposed. The method has been applied to the determination of trace cadmium ion in tap water and river water with satisfactory results.

  19. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, N.G. [University of Otago, Department of Radiology, Christchurch (New Zealand); Butler, A.P. [University of Otago, Department of Radiology, Christchurch (New Zealand); University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Scott, N.J.A. [University of Otago, Department of Medicine, Christchurch (New Zealand); Cook, N.J. [Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Butzer, J.S. [Karlsruhe Institute of Technology, Physics Department, Karlsruhe (Germany); Schleich, N. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Firsching, M. [Friedrich Alexander University, Physics Department, Erlangen (Germany); Grasset, R.; Ruiter, N. de [University of Canterbury, Hitlab NZ, Christchurch (New Zealand); Campbell, M. [European Organisation for Nuclear Research, Physics Section, Geneva (Switzerland); Butler, P.H. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand)


    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 {mu}A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 {mu}m isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)

  20. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    Energy Technology Data Exchange (ETDEWEB)

    Matoso, Erika, E-mail: [Centro Tecnologico da Marinha em Sao Paulo (CEA/CTMS), Ipero, SP (Brazil). Centro Experimental Aramar; Cadore, Solange, E-mail: [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Quimica. Departamento de Quimica Analica


    Barium can be found in waters up to 1 mg L{sup -1} and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L{sup -1} and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  1. Hydro-MRI with fast sequences in Crohn's disease: Comparison with barium studies

    International Nuclear Information System (INIS)

    Schunk, K.; Kern, A.; Heussel, C.P.; Kalden, P.; Thelen, M.; Orth, T.; Wanitschke, R.


    Purpose: To compare the value of hydro-MRI with that of barium studies in patients with Crohn's disease. Materials and methods: After an oral bowel opacification using 1000 ml of a 2.5% mannitol solution, axial and coronal breathhold sequences (T2W HASTE±FS, contrast-enhanced T1W FLASH FS) were acquired in 46 patients with Crohn's disease at 1,0 T. The findings of hydro-MRI were compared with those of barium studies. Results: In the stomach and the small bowel, hydro-MRI and barium studies demonstrated similar numbers of Crohn's involvements (39 vs. 36); in the colon, hydro-MRI showed clearly more affections (23 vs. 10). Hydro-MRI showed 12.7 cm of inflamed bowel per patient, on average (barium studies: 10,4 cm; p=0,004). There was a good agreement between the two methods regarding the assessment of the extent of Crohn's disease and the severity of bowel stenoses (r=0.89 and 0.88, respectively). Conclusions: For the assessment of Crohn's disease, hydro-MRI is preferable to the barium study because of the superior imaging quality and the lack of radiation exposure. (orig.) [de

  2. Determination of barium in natural waters by ICP-OES technique. Part II: Assessment of human exposure to barium in bottled mineral and spring waters produced in Poland. (United States)

    Garboś, Sławomir; Swiecicka, Dorota


    A method of the classification of natural mineral and spring waters and maximum admissible concentration (MAC) levels of metals present in such types of waters are regulated by Commission Directive 2003/40/EC, Directive 2009/54/EC of the European Parliament and of the Council and Ordinance of Minister of Health of 30 March 2011 on the natural mineral waters, spring waters and potable waters. MAC of barium in natural mineral and spring waters was set at 1.0 mg/l, while World Health Organization determined the Ba guideline value in water intended for human consumption at the level of 0.7 mg/l. The aims of the study were: the determination of barium in natural mineral and spring waters (carbonated, non-carbonated and medium-carbonated waters) produced and bottled on the area of Poland, and assessment of human exposure to this metal presents in the above-mentioned types of waters. The study concerning barium determinations in 23 types of bottled natural mineral waters and 15 types of bottled spring waters (bought in Polish retail outlets) was conducted in 2010. The analyses were performed by validated method of determination of barium in water based on inductively coupled plasma optical emission spectrometry, using modern internal quality control scheme. Concentrations of barium determined in natural mineral and spring waters were in the ranges from 0.0136 mg/l to 1.12 mg/l and from 0.0044 mg/l to 0.43 mg/l, respectively. Only in the single case of natural mineral water the concentration of barium (1.12 mg/l), exceeded above-mentioned MAC for this metal, which is obligatory in Poland and the European Union - 1.0 mg/l. The long-term monitoring of barium concentration in another natural mineral water (2006 - 2010), in which incidental exceeding MAC was observed in 2006, was conducted. All measured barium concentrations in this water were lower than 1.0 mg/l and therefore, it is possible to state that the proper method of mixing waters taken from six independent

  3. Radiation doses to children during modified barium swallow studies

    International Nuclear Information System (INIS)

    Weir, Kelly A.; McMahon, Sandra M.; Long, Gillian; Bunch, Judith A.; Pandeya, Nirmala; Coakley, Kerry S.; Chang, Anne B.


    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 ± 0.0544 mSv, screening time 2.48 ± 0.81 min, and DAP 28.79 ± 41.72 cGy cm 2 . Significant differences were found across three age groups (≤1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)

  4. Dose optimisation of double-contrast barium enema examinations. (United States)

    Berner, K; Båth, M; Jonasson, P; Cappelen-Smith, J; Fogelstam, P; Söderberg, J


    The purpose of the present work was to optimise the filtration and dose setting for double-contrast barium enema examinations using a Philips MultiDiagnost Eleva FD system. A phantom study was performed prior to a patient study. A CDRAD phantom was used in a study where copper and aluminium filtration, different detector doses and tube potentials were examined. The image quality was evaluated using the software CDRAD Analyser and the phantom dose was determined using the Monte Carlo-based software PCXMC. The original setting [100 % detector dose (660 nGy air kerma) and a total filtration of 3.5 mm Al, at 81 kVp] and two other settings identified by the phantom study (100 % detector dose and additional filtration of 1 mm Al and 0.2 mm Cu as well as 80 % detector dose and added filtration of 1 mm Al and 0.2 mm Cu) were included in the patient study. The patient study included 60 patients and up to 8 images from each patient. Six radiologists performed a visual grading characteristics study to evaluate the image quality. A four-step scale was used to judge the fulfillment of three image quality criteria. No overall statistical significant difference in image quality was found between the three settings (P > 0.05). The decrease in the effective dose for the settings in the patient study was 15 % when filtration was added and 34 % when both filtrations was added and detector dose was reduced. The study indicates that additional filtration of 1 mm Al and 0.2 mm Cu and a decrease in detector dose by 20 % from the original setting can be used in colon examinations with Philips MultiDiagnost Eleva FD to reduce the patient dose by 30 % without significantly affecting the image quality. For 20 exposures, this corresponds to a decrease in the effective dose from 1.6 to 1.1 mSv.

  5. Relaxor properties of barium titanate crystals grown by Remeika method (United States)

    Roth, Michel; Tiagunov, Jenia; Dul'kin, Evgeniy; Mojaev, Evgeny


    Barium titanate (BaTiO3, BT) crystals have been grown by the Remeika method using both the regular KF and mixed KF-NaF (0.6-0.4) solvents. Typical acute angle "butterfly wing" BT crystals have been obtained, and they were characterized using x-ray diffraction, scanning electron microscopy (including energy dispersive spectroscopy), conventional dielectric and acoustic emission methods. A typical wing has a triangular plate shape which is up to 0.5 mm thick with a 10-15 mm2 area. The plate has a (001) habit and an atomically smooth outer surface. Both K+ and F- solvent ions are incorporated as dopants into the crystal lattice during growth substituting for Ba2+ and O2- ions respectively. The dopants' distribution is found to be inhomogeneous, their content being almost an order of magnitude higher (up to 2 mol%) at out surface of the plate relatively to the bulk. A few μm thick surface layer is formed where a multidomain ferroelectric net is confined between two≤1 μm thick dopant-rich surfaces. The layer as a whole possess relaxor ferroelectric properties, which is apparent from the appearance of additional broad maxima, Tm, in the temperature dependence of the dielectric permittivity around the ferroelectric phase transition. Intense acoustic emission responses detected at temperatures corresponding to the Tm values allow to observe the Tm shift to lower temperatures at higher frequencies, or dispersion, typical for relaxor ferroelectrics. The outer surface of the BT wing can thus serve as a relaxor thin film for various electronic application, such as capacitors, or as a substrate for BT-based multiferroic structure. Crystals grown from KF-NaF fluxes contain sodium atoms as an additional impurity, but the crystal yield is much smaller, and while the ferroelectric transition peak is diffuse it does not show any sign of dispersion typical for relaxor behavior.


    International Nuclear Information System (INIS)

    Gray, R. O.; McGahee, C. E.; Griffin, R. E. M.; Corbally, C. J.


    Barium II (Ba) stars are chemically peculiar F-, G-, and K-type objects that show enhanced abundances of s-process elements. Since s-process nucleosynthesis is unlikely to take place in stars prior to the advanced asymptotic giant branch (AGB) stage, the prevailing hypothesis is that each present Ba star was contaminated by an AGB companion which is now a white dwarf (WD). Unless the initial mass ratio of such a binary was fairly close to unity, the receiving star is thus at least as likely to be a dwarf as a giant. So although most known Ba stars appear to be giants, the hypothesis requires that Ba dwarfs be comparably plentiful and moreover that they should all have WD companions. However, despite dedicated searches with the IUE satellite, no WD companions have been directly detected to date among the classical Ba dwarfs, even though some 90% of those stars are spectroscopic binaries, so the contamination hypothesis is therefore presently in some jeopardy. In this paper, we analyze recent deep, near-UV and far-UV Galaxy Evolution Explorer (GALEX) exposures of four of the brightest of the class (HD 2454, 15360, 26367, and 221531), together with archived GALEX data for two newly recognized Ba dwarfs: HD 34654 and HD 114520 (which also prove to be spectroscopic binaries). The GALEX observations of the Ba dwarfs as a group show a significant far-UV excess compared to a control sample of normal F-type dwarfs. We suggest that this ensemble far-UV excess constitutes the first direct evidence that Ba dwarfs have WD companions.

  7. Evaluation of antibacterial properties of Barium Zirconate Titanate (BZT nanoparticle

    Directory of Open Access Journals (Sweden)

    Simin Mohseni


    Full Text Available So far, the antibacterial activity of some organic and inorganic compounds has been studied. Barium zirconate titanate [Ba(Zr xTi1-xO3] (x = 0.05 nanoparticle is an example of inorganic materials. In vitro studies have provided evidence for the antibacterial activity of this nanoparticle. In the current study, the nano-powder was synthesized by sol-gel method. X-ray diffraction showed that the powder was single-phase and had a perovskite structure at the calcination temperature of 1000 ºC. Antibacterial activity of the desired nanoparticle was assessed on two gram-positive (Staphylococcus aureus PTCC1431 and Micrococcus luteus PTCC1625 and two gram-negative (Escherichia coli HP101BA 7601c and clinically isolated Klebsiella pneumoniae bacteria according to Radial Diffusion Assay (RDA. The results showed that the antibacterial activity of BZT nano-powder on both gram-positive and gram-negative bacteria was acceptable. The minimum inhibitory concentration of this nano-powder was determined. The results showed that MIC values for E. coli, K. pneumoniae, M. luteus and S. aureus were about 2.3 µg/mL, 7.3 µg/mL, 3 µg/mL and 12 µg/mL, respectively. Minimum bactericidal concentration (MBC was also evaluated and showed that the growth of E. coli, K. pneumoniae, M. luteus and S. aureus could be decreased at 2.3, 14, 3 and 18 µg/mL of BZT. Average log reduction in viable bacteria count in time-kill assay ranged between 6 Log10 cfu/mL to zero after 24 h of incubation with BZT nanoparticle.

  8. Evaluation of antibacterial properties of Barium Zirconate Titanate (BZT) nanoparticle. (United States)

    Mohseni, Simin; Aghayan, Mahdi; Ghorani-Azam, Adel; Behdani, Mohammad; Asoodeh, Ahmad


    So far, the antibacterial activity of some organic and inorganic compounds has been studied. Barium zirconate titanate [Ba(ZrxTi₁-x)O₃] (x = 0.05) nanoparticle is an example of inorganic materials. In vitro studies have provided evidence for the antibacterial activity of this nanoparticle. In the current study, the nano-powder was synthesized by sol-gel method. X-ray diffraction showed that the powder was single-phase and had a perovskite structure at the calcination temperature of 1000 °C. Antibacterial activity of the desired nanoparticle was assessed on two gram-positive (Staphylococcus aureus PTCC1431 and Micrococcus luteus PTCC1625) and two gram-negative (Escherichia coli HP101BA 7601c and clinically isolated Klebsiella pneumoniae) bacteria according to Radial Diffusion Assay (RDA). The results showed that the antibacterial activity of BZT nano-powder on both gram-positive and gram-negative bacteria was acceptable. The minimum inhibitory concentration of this nano-powder was determined. The results showed that MIC values for E. coli, K. pneumoniae, M. luteus and S. aureus were about 2.3 μg/mL, 7.3 μg/mL, 3 μg/mL and 12 μg/mL, respectively. Minimum bactericidal concentration (MBC) was also evaluated and showed that the growth of E. coli, K. pneumoniae, M. luteus and S. aureus could be decreased at 2.3, 14, 3 and 18 μg/mL of BZT. Average log reduction in viable bacteria count in time-kill assay ranged between 6 Log₁₀ cfu/mL to zero after 24 h of incubation with BZT nanoparticle.

  9. Nanofunctionalized zirconia and barium sulfate particles as bone cement additives

    Directory of Open Access Journals (Sweden)

    Riaz Gillani


    Full Text Available Riaz Gillani1, Batur Ercan1, Alex Qiao3, Thomas J Webster1,21Division of Engineering, 2Department of Orthopaedics, Brown University, Providence, RI, USA; 3G3 Technology Innovations, LLC, Pittsford, NY, USAAbstract: Zirconia (ZrO2 and barium sulfate (BaSO4 particles were introduced into a methyl methacrylate monomer (MMA solution with polymethyl methacrylate (PMMA beads during polymerization to develop the following novel bone cements: bone cements with unfunctionalized ZrO2 micron particles, bone cements with unfunctionalized ZrO2 nanoparticles, bone cements with ZrO2 nanoparticles functionalized with 3-(trimethoxysilylpropyl methacrylate (TMS, bone cements with unfunctionalized BaSO4 micron particles, bone cements with unfunctionalized BaSO4 nanoparticles, and bone cements with BaSO4 nanoparticles functionalized with TMS. Results demonstrated that in vitro osteoblast (bone-forming cell densities were greater on bone cements containing BaSO4 ceramic particles after four hours compared to control unmodified bone cements. Osteoblast densities were also greater on bone cements containing all of the ceramic particles after 24 hours compared to unmodified bone cements, particularly those bone cements containing nanofunctionalized ceramic particles. Bone cements containing ceramic particles demonstrated significantly altered mechanical properties; specifically, under tensile loading, plain bone cements and bone cements containing unfunctionalized ceramic particles exhibited brittle failure modes whereas bone cements containing nanofunctionalized ceramic particles exhibited plastic failure modes. Finally, all bone cements containing ceramic particles possessed greater radio-opacity than unmodified bone cements. In summary, the results of this study demonstrated a positive impact on the properties of traditional bone cements for orthopedic applications with the addition of unfunctionalized and TMS functionalized ceramic nanoparticles

  10. Radiation doses to children during modified barium swallow studies

    Energy Technology Data Exchange (ETDEWEB)

    Weir, Kelly A. [University of Queensland, Discipline of Paediatrics and Child Health, School of Medicine, Herston, Queensland (Australia); McMahon, Sandra M. [SpeechNet Speech Pathology Services, Brisbane (Australia); Long, Gillian; Bunch, Judith A. [Royal Children' s Hospital, Department of Medical Imaging, Herston (Australia); Pandeya, Nirmala [Queensland Institute of Medical Research, Herston (Australia); Coakley, Kerry S. [Biomedical Technology Services, Royal Brisbane and Women' s Hospital, Herston (Australia); Chang, Anne B. [Royal Children' s Hospital, Department of Respiratory Medicine, Herston (Australia)


    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 {+-} 0.0544 mSv, screening time 2.48 {+-} 0.81 min, and DAP 28.79 {+-} 41.72 cGy cm{sup 2}. Significant differences were found across three age groups ({<=}1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P = 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)

  11. EPR dosimetric properties of nano-barium sulfate

    International Nuclear Information System (INIS)

    Aboelezz, E.; Hassan, G.M.; Sharaf, M.A.; El-Khodary, A.


    Nano/micro BaSO 4 were prepared through the co-precipitation method to measure ionizing radiation doses using electron paramagnetic resonance (EPR). The nano-BaSO 4 sample was characterized using X-ray diffraction (XRD), and transmission electron microscopy (TEM) techniques. The dose response and fading properties of nano- and micro-phase BaSO 4 were compared in EPR spectra. The prepared nano- and micro-BaSO 4 samples have the same hole and electron centers, which may be attributed to SO 4 − and SO 3 − , respectively. The dosimetric signals for prepared nano- and micro-BaSO 4 have spectroscopic splitting factor (g) with values 2.0025±0.0006 and 2.0027±0.0006, respectively. The nanocrystalline sample has a linear γ-ray dose response over the range 0.4 Gy–1 kGy. The performance parameters which including detection limit and critical level calculated from weighted and unweighted least-squares fitting. The sensitivity of nano-BaSO 4 to γ-ray is one and a half times more than alanine. The lifetime and activation energy for nano-BaSO 4 were estimated by conducting a thermal stability study, and were 5.7±1.1×10 4 years and 0.73±0.14 eV, respectively. The combined and expanded uncertainties accompanying measurements were ±3.89% and ±7.78%, respectively. - Highlights: • Preparation of nano-BaSO 4 using the co-precipitation method. • Study of the dosimetric properties of nano-barium sulfate using the EPR technique. • Comparison between a new EPR dosimeter using nano-materials and standard alanine. • Calculation of the uncertainty budget for nano-BaSO 4

  12. Barium and xenon isotope yields in photopion reactions in cesium-133

    International Nuclear Information System (INIS)

    Sakamoto, K.; Hamajima, Y.; Soto, M.


    The radiochemical yield measurements are reported of barium isotopes from 133 Cs(γ, π - xn) 133-x Ba for x=0, 2, 4, 5, 6, 7 and 9 for bremsstrahlung maximum end-point energies (E 0 )=30∼1050 MeV and of 133 Xe from 133 Cs(γ, π + ) 133m,g Xe for E 0 =300∼1000 MeV. An emphasis was placed on Ba measurements around pion threshold and on runs for different target thickness to assess the interfering secondary particle-induced reactions. A clear evidence of the secondary reactions was found in a form of a shoulder of the yield curves in a range of E 0 π -, the Q value of 133 Cs(γ, π - xn) reaction, and used for the correction at E 0 π - with aids of the reported measurements of the photoprotons from 12 C and other complex nuclei and the cross sections of ( 133 Cs+p) reactions. The yields corrected for the secondaries, σ q (E 0 ), were unfolded into cross sections per photon of energy k, σ(k). The characteristic features of σ q (E 0 ) and/or σ(k) are then discussed in terms of E 0 - and k-dependence and product mass (A P =133-x), by comparing the present results with those currently obtained in our group. It was found that the present results of σ(k) are grossly reproduced by a cascade-evaporation calculation based on the PICA code by Gabriel and Alsmiller, only if the calculated ones are shifted in photon energy by k=30 MeV higher and the cutoff energy for neutron is chosen to be 1 MeV. (author)

  13. Lifetime determination of the 5d(2) F-3(2) state in barium using trapped atoms

    NARCIS (Netherlands)

    De, S.; Dammalapati, U.; Willmann, L.


    Magneto-optically trapped atoms enable the determination of lifetimes of metastable states and higher lying excited states like the 5d(2) F-3(2) state in barium. The state is efficiently populated by driving strong transitions from metastable states within the cooling cycle of the barium

  14. Colonic transit time in patient with slow-transit constipation: Comparison of radiopaque markers and barium suspension method

    International Nuclear Information System (INIS)

    Xu Huimin; Han Jiagang; Na Ying; Zhao Bo; Ma Huachong; Wang Zhenjun


    Background: Colonic transit study provides valuable information before surgical treatment is considered for patient with constipation. The radiopaque markers method is the most common way for evaluating colon transit time. The aim of this study is to compare the barium suspension with the radiopaque makers to assess the colonic mobility in patient with constipation. Methods: Colonic transit time was measured in 11 female patients with slow-transit constipation using both radiopaque markers and barium suspension method. In radiopaque markers method, the patient ingested 20 markers on the first day, and an abdominal radiograph was performed every 24 h until 80% markers were excreted. In barium suspension method, the patient swallowed up to 50 ml of 200% (w/v) barium meal. The abdominal radiographs were taken at the same time point as the former. Results: The total or segmental colonic transit time were obviously prolonged in all patients. Segmental transits time spent in the right colon, left colon and rectosigmoid for radiopaque markers and barium suspension method was, respectively, 30 ± 6 h and 34 ± 7 h; 38 ± 9 h and 32 ± 6 h; 40 ± 8 h and 38 ± 10 h. In the radiopaque markers method, total colonic transit time was 108 ± 14 h and it was 103 ± 13 h in the barium suspension method (P > 0.05). Conclusion: The barium suspension and radiopaque markers gave the similar results for colonic transit time. The barium suspension was a simple and cheap method for evaluating the colonic mobility.

  15. Colonic transit time in patient with slow-transit constipation: Comparison of radiopaque markers and barium suspension method

    Energy Technology Data Exchange (ETDEWEB)

    Xu Huimin [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Department of General Surgery, Weifang People' s Hospital, ShanDong Province 261041 (China); Han Jiagang [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Na Ying [Department of Medical Imaging, Weifang People' s Hospital, ShanDong Province 261041 (China); Zhao Bo; Ma Huachong [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Wang Zhenjun, E-mail: [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China)


    Background: Colonic transit study provides valuable information before surgical treatment is considered for patient with constipation. The radiopaque markers method is the most common way for evaluating colon transit time. The aim of this study is to compare the barium suspension with the radiopaque makers to assess the colonic mobility in patient with constipation. Methods: Colonic transit time was measured in 11 female patients with slow-transit constipation using both radiopaque markers and barium suspension method. In radiopaque markers method, the patient ingested 20 markers on the first day, and an abdominal radiograph was performed every 24 h until 80% markers were excreted. In barium suspension method, the patient swallowed up to 50 ml of 200% (w/v) barium meal. The abdominal radiographs were taken at the same time point as the former. Results: The total or segmental colonic transit time were obviously prolonged in all patients. Segmental transits time spent in the right colon, left colon and rectosigmoid for radiopaque markers and barium suspension method was, respectively, 30 {+-} 6 h and 34 {+-} 7 h; 38 {+-} 9 h and 32 {+-} 6 h; 40 {+-} 8 h and 38 {+-} 10 h. In the radiopaque markers method, total colonic transit time was 108 {+-} 14 h and it was 103 {+-} 13 h in the barium suspension method (P > 0.05). Conclusion: The barium suspension and radiopaque markers gave the similar results for colonic transit time. The barium suspension was a simple and cheap method for evaluating the colonic mobility.

  16. Measurements of barium photocathode quantum yields at four excimer laser wavelengths

    International Nuclear Information System (INIS)

    Van Loy, M.D.; Young, A.T.; Leung, K.N.


    The electron quantum yields from barium cathodes excited by excimer laser radiation at 193, 248, 308, and 351 nm have been determined. Experiments with different cathode surface preparation techniques reveal that deposition of barium film a few microns thick on a clean copper surface under moderate vacuum conditions achieves relatively high quantum efficiencies. Quantum yields measured from surfaces prepared in this manner are 2.3 x 10 -3 at 193 nm, 7.6 x 10 - 4 at 248 nm, 6.1 x 10 -4 at 308 nm, and 4.0 x 10 -4 at 351 nm. Other preparation techniques, such as laser cleaning of a solid barium surface, produced quantum yields that were at least an order of magnitude lower than these values

  17. Detection of colonic polyps in the elderly: Optimization of the single-contrast barium enema examination

    International Nuclear Information System (INIS)

    Gelfand, D.W.; Chen, Y.M.; Ott, D.J.; Munitz, H.A.


    Single-contrast studies account for 75% of barium enema examinations and are often performed in the elderly. By optimizing all factors, the following results were obtained: for polyps of less than 1 cm, 40 of 57 were detected (sensitivity, 70.2%); for polyps of 1 cm or larger, 33 of 35 were detected (sensitivity, 94%). Overall, 73 of 92 polyps were detected (sensitivity, 79.3%). These sensitivities result from meticulous preparation and the use of compression filming, low-density barium, moderate kilovoltages, high-resolution screens, remote control apparatus, and high-bandpass TV fluoroscopy. The authors conclude that an optimal single-contrast barium enema examination detects colonic polyps with a sensitivity approaching that of the double-contrast study and may be employed in elderly patients who cannot undergo the double-contrast study

  18. Double contrast with technique of Insufflated Barium Meal in the radiological study of the esophagus

    International Nuclear Information System (INIS)

    Gallina, F.; Piga, V.; Gallina, M.S.


    The results are reported of the esophagus double contrast examination with Insufflated Barium Meal technique as first part of the routine upper digestive system radiological examination. This technique gives good double contrast without those artifacts using effervescent powders and without modifying the normal radiological alimentary tract examination established way. The double contrast is administered by a special container with a built-in mouthpiece which allows the simultaneous ingestion of barium suspension and air. The esophageal mucosa can be examined as far as the distal tract where frequently the barium contrast stops using different techniques. Good results in 90% of patients have been obtained. The early detection of inflammatory and tumoral lesions has taken particular advantage in patients sometimes asymptomatic

  19. Barium sulphate preparations for use in double contrast examination of the upper gastrointestinal tract

    International Nuclear Information System (INIS)

    Anderson, W.; Harthill, J.E.; James, W.B.; Montgomery, D.


    Physical properties relevant to upper gastrointestinal radiology have been compared for five barium sulphate preparations and related to radiographic results. Evaluation of particles (size and stability) and whole suspension (dispersibility and fluidity) resulted in ranking of the preparations generally in accord with that based on radiological experience in double contrast examinations of the stomach. Experiments with extirpated pig stomach revealed a tendency for large particles in a low viscosity barium sulphate suspension to settle in mucosal grooves. This is believed to contribute to good radiographic definition of both the areae gastricae and small lesions. Particle size is therefore important and susceptibility to flocculation, a possible cause of random change in size during use, was assessed by measuring particle electrophoretic mobility under varying conditions; quantitative differences in suspension flow and dispersibility were also demonstrated. Fluidity and dispersibility together with rapid sedimentation of suitably sized particles resistant to flocculation underlie the successful use of low viscosity high density barium sulphate suspensions. (U.K.)

  20. Imaging diagnosis--duodenobiliary reflux of barium sulfate during esophagogastrography in a dog. (United States)

    Shaikh, Layla; Sharma, Ajay; Secrest, Scott


    A 4-year-old Australian cattle dog presented for regurgitation, 2 months after duodenal resection and anastomosis for a perforated duodenal ulcer. Duodenobiliary reflux of barium sulfate suspension was detected during fluoroscopic esophagogastrography. Follow-up radiography 2 hours later demonstrated persistence of the barium in the gallbladder and biliary tree. Ultrasonography showed an open sphincter of Oddi but no other morphological abnormalities with the gallbladder or biliary system. No side effects or bloodwork abnormalities were noted. This is the first case report of duodenobiliary reflux of barium in a dog. The pathophysiology of this phenomenon and its incidence and significance in human medicine are discussed. © 2014 American College of Veterinary Radiology.

  1. The review of various synthesis methods of barium titanate with the enhanced dielectric properties

    International Nuclear Information System (INIS)

    More, S. P.; Topare, R. J.


    The Barium Titanate is a very well known dielectric ceramic belongs to perovskite structure. It has very wide applications in the field of electronic, electro ceramic, electromechanical and electro-optical applications. Barium Titanate has very high dielectric constant as well as low dielectric loss. Substituted dielectrics are one of the most important technological compounds in modern electro ceramics. Its electrical properties can be tuned flexibly by a simple substitution technique. This has encouraged researchers to select a typical cation to be substituted at cationic sites. In the present paper, the review of various synthesis methods of Barium Titanate compound with the effect of different dopants, the grain size on the dielectric properties at various temperatures is discussed.

  2. SAD phasing with in-house cu Ka radiation using barium as anomalous scatterer. (United States)

    Dhanasekaran, V; Velmurugan, D


    Phasing of lysozyme crystals using co-crystallized barium ions was performed using single-wavelength anomalous diffraction (SAD) method using Cu Ka radiation with in-house source of data collection. As the ion binding sites vary with respect to the pH of the buffer during crystallization, the highly isomorphic forms of lysozyme crystals grown at acidic and alkaline pH were used for the study. Intrinsic sulphur anomalous signal was also utilized with anomalous signal from lower occupancy ions for phasing. The study showed that to solve the structure by SAD technique, 2.8-fold data redundancy was sufficient when barium was used as an anomalous marker in the in-house copper X-ray radiation source for data collection. Therefore, co-crystallization of proteins with barium containing salt can be a powerful tool for structure determination using lab source.

  3. Plasma irregularities caused by cycloid bunching of the CRRES G-2 barium release (United States)

    Bernhardt, P. A.; Huba, J. D.; Pongratz, M. B.; Simons, D. J.; Wolcott, J. H.


    The Combined Release and Radiation Effects Satellite (CRRES) spacecraft carried a number of barium thermite canisters for release into the upper atmosphere. The barium release labeled G-2 showed evidence of curved irregularities not aligned with the ambient magnetic field B. The newly discovered curved structures can be explained by a process called cycloid bunching. Cycloid bunching occurs when plasma is created by photoionization of a neutral cloud injected at high velocity perpendicular to B. If the injection velocity is much larger than the expansion speed of the cloud, the ion trail will form a cycloid that has irregularities spaced by the product of the perpendicular injection speed and the ion gyroperiod, Images of the solar-illuminated barium ions are compared with the results of a three-dimensional kinetic simulation. Cycloid bunching is shown to be responsible for the rapid generation of both curved and field-aligned irregularities in the CRRES G-2 experiment.

  4. Preparation and characterization of nanofibers barium strontium titanate using electrospinning route

    International Nuclear Information System (INIS)

    Faraco, B.S.; Engel, A.B.; Alves, A.K.; Bergmann, C.P.


    The barium strontium titanate (BST) is a ferroelectric material well known for exhibiting a ferroelectric transition temperature that can be adjusted by varying the Ba /Sr ratio. The reduction of the Curie point can be achieved by the substitution of strontium for barium. Due to the combination of interesting properties, such as high crystallographic orientation of grains and high thermal stability, ferroelectric fibers have attracted considerable interest for their potential use as functional ceramic fibers in the reinforcement of ceramics and metals. The electrospinning process is an effective method for the preparation of nano ceramic fibers with uniform diameter and having different composition. The objective of this work was to product and to characterize the structure and morphology of barium strontium titanate nanofibers made using the electrospinning method. (author)

  5. Chlorides retention of barium and chromium in two mangrove species Avicennia germinans and Rhizophora mangrove, developed in waters of the oil industry production, by means of the technique of hydroponics cultivation

    International Nuclear Information System (INIS)

    Grosso, J L; Sanchez L E; Avendano D; Restrepo, R


    The objective of the present study was to determine the phytoremediation mechanism (phytoextraction y/o rhizofiltration) given by the mangroves Rhizophora mangle and Avicennia germinans, when exposed to waters from an oil production field applying the hidroponia technique like system for growing the species. Determination of chlorides, barium and chromium bioaccumulation in tissues of mangrove species under study was compared with content of these elements in an inert substrate without mangroves. Bioaccumulation of the targeted elements was measured after 308 days exposure of the mangroves to production waters with initial barium and chromium contents of 1.25 g.m -3 and 0.002 g.m -3 respectively, and salinity in the range of 2,000 to 3,000 -1 . Bioaccumulation of the studied elements (chlorides, barium and chromium) in tissues of both species was correlated to the increment in biomass of each species, as well as to the general physical condition of the plants. Survival rates higher than 95% of the exposed plants to production water during the time of study, increment in biomass of up to 5.88 -1 , and concentrations of chlorides in tissues in the 0 - 170,000 -1 during the considered period were observed. No significant difference between the two mangrove species was obtained. Bioaccumulation in tissues does not cause symptoms of deficiency in growing rates in the studied plants compared to natural rate indexes. Similarly, the analyses of inert substrate around the mangrove roots showed chloride and barium concentrations, contrary to the results of the targeted elements in the inert substrate when mangroves are not present. Both phytoremediation mechanisms were observed for the two mangrove species

  6. Micromechanical characterisation of failure in acrylic bone cement: the effect of barium sulphate agglomerates. (United States)

    Shearwood-Porter, N; Browne, M; Sinclair, I


    Acrylic bone cement has been established as a method of fixation of load-bearing orthopaedic implants for nearly five decades, and has produced excellent long term clinical results. However, increasing patient BMI values and longer life expectancies are placing ever greater demands on joint replacements, so there is a need to further improve the performance of cemented fixation. Damage accumulation in the in vivo cement mantle due to initiation and coalescence of fatigue micro-cracks has been implicated in the aseptic loosening and failure of implants. While the effect of porosity on crack initiation processes has been widely reported, the relative influence of different radiopacifying agents is less well studied. In particular, barium sulphate radiopacifier particles have been reported to form large agglomerates within the cement that have been linked to initiation of fatigue cracks in vitro. However, there appears to be little understanding of the micromechanical aspects of cement failure due to barium sulphate agglomeration. The present study utilised micro-computed tomography (μCT) and field emission gun scanning electron microscopy (FEG-SEM), alongside mechanical testing, to provide a systematic, quantitative assessment of the effect of barium sulphate agglomeration on crack initiation processes in a conventional, vacuum-mixed acrylic cement. Three-dimensional characterisation of defect populations was performed, with agglomerates of barium sulphate particles found to be large (up to 0.37 mm equivalent spherical diameter), present at spatial densities up to 22 per mm³, and evenly distributed through each cement specimen. Fatigue cracks consistently initiated at the largest agglomerates; furthermore, fatigue life was found to scale consistently with largest defect size. As such, the tendency of barium sulphate particles to agglomerate is clearly evidenced to be detrimental to the fatigue performance of this cement in vitro. Optimisation of mixing techniques

  7. How does esophagus look on barium esophagram in pediatric eosinophilic esophagitis? (United States)

    Al-Hussaini, Abdulrahman; AboZeid, Amany; Hai, Abdul


    The clinical, endoscopic, and histologic findings of eosinophilic esophagitis (EoE) are well characterized; however, there have been very limited data regarding the radiologic findings of pediatric EoE. We report on the radiologic findings of pediatric EoE observed on barium esophagram and correlate them with the endoscopic findings. We identified children diagnosed with EoE in our center from 2004 to 2015. Two pediatric radiologists met after their independent evaluations of each fluoroscopic study to reach a consensus on each case. Clinical and endoscopic data were collected by retrospective chart review. Twenty-six pediatric EoE cases (age range 2-13 years; median 7.5 years) had barium esophagram done as part of the diagnostic approach for dysphagia. Thirteen children had abnormal radiologic findings of esophagus (50%): rings formation (n = 4), diffuse irregularity of mucosa (n = 8), fixed stricture formation (n = 3), and narrow-caliber esophagus (n = 10). Barium esophagram failed to show one of 10 cases of narrow-caliber esophagus and 10 of 14 cases of rings formation visualized endoscopically. The mean duration of symptoms prior to diagnosis of EoE was longer (3.7 vs. 1.7 year; p value 0.019), and the presentation with intermittent food impaction was commoner in the group with abnormal barium esophagram as compared to the group with normal barium esophagram (69% vs. 8%; p value 0.04). Barium swallow study is frequently normal in pediatric EoE. With the exception of narrow-caliber esophagus, our data show poor correlation between radiologic and endoscopic findings.

  8. Individual-specific transgenerational marking of fish populations based on a barium dual-isotope procedure. (United States)

    Huelga-Suarez, Gonzalo; Moldovan, Mariella; Garcia-Valiente, America; Garcia-Vazquez, Eva; Alonso, J Ignacio Garcia


    The present study focuses on the development and evaluation of an individual-specific transgenerational marking procedure using two enriched barium isotopes, (135)Ba and (137)Ba, mixed at a given and selectable molar ratio. The method is based on the deconvolution of the isotope patterns found in the sample into four molar contribution factors: natural xenon (Xe nat), natural barium (Ba nat), Ba135, and Ba137. The ratio of molar contributions between Ba137 and Ba135 is constant and independent of the contribution of natural barium in the sample. This procedure was tested in brown trout ( Salmo trutta ) kept in captivity. Trout were injected with three different Ba137/Ba135 isotopic signatures ca. 7 months and 7 days before spawning to compare the efficiency of the marking procedure at long and short term, respectively. The barium isotopic profiles were measured in the offspring by means of inductively coupled plasma mass spectrometry. Each of the three different isotopic signatures was unequivocally identified in the offspring in both whole eggs and larvae. For 9 month old offspring, the characteristic barium isotope signatures could also be detected in the otoliths even in the presence of a high and variable amount of barium of natural isotope abundance. In conclusion, it can be stated that the proposed dual-isotope marking is inheritable and can be detected after both long-term and short-term marking. Furthermore, the dual-isotope marking can be made individual-specific, so that it allows identification of offspring from a single individual or a group of individuals within a given fish group. © 2011 American Chemical Society

  9. Real time observation of the hydrothermal crystallization of barium titanate using in situ neutron powder diffraction. (United States)

    Walton, R I; Millange, F; Smith, R I; Hansen, T C; O'Hare, D


    The hydrothermal crystallization of barium titanate, BaTiO3, has been studied in situ by time-resolved powder neutron diffraction methods using the recently developed Oxford/ISIS hydrothermal cell. This technique has allowed the formation of the ferroelectric ceramic to be followed in a noninvasive manner in real time and under genuine reaction conditions. In a first set of experiments, Ba(OD)2-8D2O was reacted with two different titanium sources, either crystalline TiO2 (anatase) or amorphous TiO2-H2O in D2O, at 100-140 degrees C and the reaction studied using the POLARIS time-of-flight neutron powder diffractometer, at the ISIS Facility. In a second series of experiments, the reaction between barium chloride and crystalline TiO2 (anatase) in NaOD/D2O was studied at temperatures between 100 and 200 degrees C and at different deuterioxide concentrations using the constant-wavelength D20 neutron powder diffractometer at the Institut Laue Langevin. Quantitative growth and decay curves were determined from analysis of the integrated intensities of Bragg reflections of starting materials and product phases. In both sets of experiments the rapid dissolution of the barium source was observed, followed by dissolution of the titanium source before the onset of crystallization of barium titanate. Using a nucleation-growth model we are able to simulate the growth curve of barium titanate at three temperatures. Our results indicate the predominance of a homogeneous dissolution-precipitation mechanism for the hydrothermal formation of barium titanate, rather than other possible mechanisms that have been discussed in the literature. Analysis of the line widths of the Bragg reflections in the neutron diffraction data indicates that the particle size of the BaTiO3 product phase prepared from the amorphous TiO2-H2O is smaller than that prepared from crystalline TiO2 (anatase).

  10. Imaging assessment of the modified double contrast barium enema using carboxymethylcellulose on radiography and ultrasonography in dogs. (United States)

    Choi, Mihyun; Lee, Namsoon; Kim, Junyoung; Yi, Kangjae; Jung, Joohyun; Yoon, Junghee; Choi, Mincheol


    A modified double contrast barium enema using carboxymethylcellulose was evaluated in beagle dogs and compared with dogs receiving a conventional barium enema. The experimental group was divided into three groups (1, 2, and 3) and given 30 ml/kg of different volume ratios of a barium vs. carboxymethylcellulose mixture. Each group underwent sonography following radiography. The volume ratio of one part barium to three parts carboxymethylcellulose was judged to be the optimal mixture, resulting in a general distribution of contrast and bowel radiolucency on radiographs and adequate postradiography sonography. The modified barium enema using carboxymethylcellulose is useful for assessing the general morphology and mucosal layers of the colon simultaneously on radiographs and ultrasonographs.

  11. Single-dose radiosurgical treatment for hepatic metastases - therapeutic outcome of 138 treated lesions from a single institution

    International Nuclear Information System (INIS)

    Habermehl, Daniel; Herfarth, Klaus K; Bermejo, Justo Lorenzo; Hof, Holger; Rieken, Stefan; Kuhn, Sabine; Welzel, Thomas; Debus, Jürgen; Combs, Stephanie E


    Local ablative therapies such as stereotactically guided single-dose radiotherapy or helical intensity-modulated radiotherapy (tomotherapy) with high single-doses are successfully applied in many centers in patients with liver metastasis not suitable for surgical resection. This study presents results from more than 10 years of clinical experience and evaluates long-term outcome and efficacy of this therapeutic approach. From 1997 to 2009 a total of 138 intrahepatic tumors of 90 patients were irradiated with single doses of 17 to 30 Gy (median dose 24 Gy). Median age of the patients was 64 years (range 31–89 years). Most frequent underlying tumor histologies were colorectal adenocarcinoma (70 lesions) and breast cancer (27 lesions). In 35 treatment sessions multiple targets were simultaneously irradiated (up to four lesions at once). Local progression-free (PFS) and overall survival (OS) after treatment were investigated using uni- and multiple survival regression models. Median overall survival of all patients was 24.3 months. Local PFS was 87%, 70% and 59% after 6, 12 and 18 months, respectively. Median time to local progression was 25.5 months. Patients with a single lesion and no further metastases at time of RT had a favorable median PFS of 43.1 months according to the Kaplan-Meier estimator. The type of tumor showed a statistical significant influence on local PFS, with a better prognosis for breast cancer histology than for colorectal carcinoma in uni- and multiple regression analysis (p = 0.05). Multiple regression analysis revealed no influence of planning target volume (PTV), patient age and radiation dose on local PFS. Treatment was well tolerated with no severe adverse events. This study confirms safety of SBRT in liver lesions, with 6- and 12 months local control of 87% and 70%. The dataset represents the clinical situation in a large oncology setting, with many competing treatment options and heterogeneous patient characteristics

  12. Carbide precipitates in solution-quenched PH13-8 Mo stainless steel

    Indian Academy of Sciences (India)

    Small-angle neutron scattering (SANS) is an important non- destructive technique to investigate the morphology and size distribution of such precipitates in mesoscopic length scale. PH 13-8 Mo stainless steel (nominal composition in wt%: Cr 12.25–13.25, Ni. 7.5–8.5, Mo 2–2.5, Al 0.9–1.35, C 0.5max, P 0.01max, Si 0.1max ...

  13. PCB138, but not PCB153 and PCB180, acts as a weak antiandrogen in vitro

    DEFF Research Database (Denmark)

    Vinggaard, A.M.; Bonefeld-Jørgensen, Eva Cecilie


    The polychlorinated biphenyls (PCBs) constitute a group of persistent environmental chemicals including 209 possible congeners exhibiting a variety of chlorine substitution patterns. Due to their lipophilic nature and resistance toward biotransformation, PCBs accumulate in the food chain and all...... environmental matrixes including human adipose tissue, blood and milk. In most biological extracts PCB#138 (2,2',3,4,4',5-hexaCB), PCB#153 (2,2',4,4',5,5'-hexaCB), and PCB#180 (2,2',3,4,4',5,5'-heptaCB) are the dominating components. Depending on the position and number of chlorine substitutions, different...

  14. Neutron emission following muon capture in Ce-142, Ce-140, Ba-138, and Sn-120. (United States)

    Lucas, G. R., Jr.; Martin, P.; Welsh, R. E.; Jenkins, D. A.; Powers, R. J.; Kunselman, A. R.; Miller, G. H.


    Branching ratios to excited nuclear states formed after muon capture have been measured with Ge(Li) detectors. The delayed gamma rays were observed in studies of muonic Ce-142, Ce-140, Ba-138, and Sn-120, using separated isotopes. The resulting isotopes formed indicate at least a 60% probability of neutron emission upon muon capture, with the most likely product resulting from single-neutron emission. No evidence for delayed proton emission with a probability higher than 2% was found. Using our more precise energies for the observed nuclear transitions, we present revised energy levels schemes for La-141, La-139, Cs-137, and In-119.

  15. Effect of mucolytic pretreatment on gastric mucosal coating with barium sulfate in the rat

    International Nuclear Information System (INIS)

    Lindgren, I.; Nevalainen, T.; Maeki, J.; Soederstroem, K.-O.


    Freshly prepared isolated rat stomachs were used to examine the adherence of barium sulfate particles to the mucosal surface by scanning electron microscopy. The stomachs were pretreated with sodium bicarbonate alone or in connection with N-acetyl-L-cysteine and then treated with barium sulfate specially designed for double contrast examination of the stomach. The best adhesion of the contrast medium was obtained when the mucosa was pretreated with both the alkaline and mucolytic agent indicating that, for the optimum adherence of the contrast medium, the mucosal surface must be as clean as possible. (Auth.)

  16. The structural properties of barium cobalt hexaferrite powder prepared by a simple heat treatment method

    Energy Technology Data Exchange (ETDEWEB)

    Chauhan, Chetna, E-mail: [Electrical Engineering Department, Institute of Technology, Nirma University, Ahmedabad-382 481. Gujarat. India (India); Jotania, Rajshree, E-mail: [Department of Physics, University School of Sciences, Gujarat University, Ahmeabad – 380009. Gujarat. India (India)


    The W-type barium hexaferrite was prepared using a simple heat treatment method. The precursor was calcinated at 650°C for 3 hours and then slowly cooled to room temperature in order to obtain barium cobalt hexaferrite powder. The prepared powder was characterised by different experimental techniques like XRD, FTIR and SEM. The X-ray diffractogram of the sample shows W-and M phases. The particle size calculated by Debye Scherrer formula. The FTIR spectra of the sample was taken at room temperature by using KBr pallet method which confirms the formation of hexaferrite phase. The morphological study on the hexaferrite powder was carried out by SEM analysis.

  17. Elevated Z line: a new sign of Barrett's esophagus on double-contrast barium esophagograms. (United States)

    Levine, Marc S; Ahmad, Nuzhat A; Rubesin, Stephen E


    We describe an elevated Z line as a new radiographic sign of Barrett's esophagus characterized by a transversely oriented, zigzagging, barium-etched line extending completely across the circumference of the midesophagus. An elevated Z line is rarely seen in other patients, so this finding should be highly suggestive of Barrett's esophagus on double-contrast barium esophagograms. If the patient is a potential candidate for surveillance, endoscopy and biopsy should be performed to confirm the presence of Barrett's esophagus. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. Barium meal examination of infants under four months of age presenting with vomiting

    Energy Technology Data Exchange (ETDEWEB)

    Arthur, R.J.; Ziervogel, M.A.; Azmy, A.F.


    One hundred barium meal examinations performed on infants of less than 4 months of age are reviewed. All the infants presented with vomiting as a major symptom and the diagnosis remained in doubt following the initial clinical assessment. Fifty seven per cent of the examinations showed an abnormality of which 45% were throught to be significant. Hypertrophic pyloric stenosis was demonstrated in 23 infants. Other abnormalities included hiatus hernia, gastrooesophageal reflux, and duodenal abnormalities. The value of barium meal examinations in this group of infants is emphasised.

  19. Nanostructured tetragonal barium titanate produced by the polyol and spark plasma sintering (SPS) route (United States)

    Acevedo-Salas, Ulises; Breitwieser, Romain; Gaudisson, Thomas; Nowak, Sophie; Ammar, Souad; Valenzuela, Raúl


    There is a great interest to synthesize ferroelectric ceramics both with fine grain size and significant electric properties. Here, we report the preparation of nanostructured tetragonal barium titanate by combining forced hydrolysis of metallic salts in polyol, soft annealing and 650 °C spark plasma sintering under uniaxial pressure of 120 MPa for 5 min. The stabilization of highly dense (density of 90%), nanostructured (grains about 50 nm) tetragonal barium titanate ceramic was achieved. The produced ceramic exhibited ferroelectric behavior and a dielectric permittivity of 3600 at 1 kHz and room temperature.

  20. Environmental consequences of the placement of radium-barium sludge in tailings areas

    International Nuclear Information System (INIS)

    Huck, P.M.; Brown, J.R.; Multimaki, G.; Murphy, K.L.


    A preliminary evaluation was made of the implications of placing radium-barium sludge in tailings areas. The study was restricted to a consideration of possible increases in the quantities of radionuclides escaping to the environment through either groundwater or surface water, considering the types of tailings treated and the effluent treatment systems currently operating in Canada. It was concluded that the placement of radium/barium sludge in tailings areas should not adversely affect the long-term stability of the radionuclides in the tailings or sludge, based on geochemical inorganic reactions

  1. H- Enhancement Process in a Multicusp Ion Source Operated with a Barium Insert Structure

    Energy Technology Data Exchange (ETDEWEB)

    Leung, K.N.; Van Os, C.F.A.; Kunkel, W.B.


    It has been demonstrated that the H{sup -} output current from a small multicusp source can be substantially enhanced if the hydrogen plasma is seeded with barium. Operating with a barium washer insert at the extraction aperture, it is found that the extractable H{sup -} current is increased by a factor of three if the insert bias potential is optimized. By use of a mixture of xenon and hydrogen gas, it is further demonstrated that the positive hydrogen ions are responsible for the observed H{sup -} enhancement.

  2. Chemical composition of nanomodified composite binder with nano- and microsized barium silicate

    Directory of Open Access Journals (Sweden)

    KOROLEV Evgenij Valerjevich


    Full Text Available There are several possibilities to improve cement-based binders. In particular, many properties of cement stone can be enhanced by means of micro- and nanoscale modification. In a number of previous works we had shown that application of barium hydrosilicates leads to such improvement. The present article is devoted to the investigation of the chemical composition of the cement stone which is modified by means of addition of barium hydrosilicates. The modification was performed on different scales: micro- and nanoscale; the results of simultaneous multi-scale modification are also presented. The examination was carried out with help of different modern research techniques – FT IR spectroscopy, differential thermal analysis and X-ray phase analysis. Identification of the new phases and comparative quantitative assessment of their content are performed. It is found that the use of nano- and micro-sized barium hydrosilicates as additives leads to reduction of portlandite by 27...28%; by means of multi-scale modification it is possible to reduce the content of portlandite much more (by 83.3%. Due to addition of nano- and micro-sized barium-based modifiers both the amount of calcium hydrosilicates in reaction products is enlarged, and structure of the mentioned hydrosilicates is changed (the formation of a fine-grained structure of hydration products takes place. Micro-sized barium hydrosilicates are chemically active additives and promote the formation of an additional quantity of calcium hydrosilicates of type CSH (I. The use of nanoscale barium hydrosilicates promotes the formation of CSH (I and CSH (II calcium hydrosilicates, and also both riversidite and xonotlite. As a result of simultaneous application of nano- and micro-sized barium hydrosilicates the content of CSH (II increases. This can be confirmed by means of differential thermal and X-ray analysis. The amount of CSH (I, riversidite and various tobermorites is also increases. It is

  3. Barium concentrations and speciation in surface waters collected from an active barium mining area in Guizhou Province, southwestern China. (United States)

    Lu, Qinhui; Xu, Xiaohang; Xu, Zhidong; Liang, Longchao; Shang, Lihai; Xiao, Dean; Zhang, Sensen; Jiang, Yuping; Qiu, Guangle


    Barium (Ba) is a toxic element and can cause serious health effects. Humans have experienced increased exposure to Ba due to its intensive usage in industrial areas and daily life. Anthropogenic activities of Ba mining and the manufacture of Ba containing products introduce the element into surrounding areas, posing environmental concerns. Concentrations of total Ba (TBa) and dissolved Ba (DBa) in water samples collected from active Ba mines in Tianzhu, east Guizhou Province, southwestern China were measured to show the regional dispersion of Ba contamination. Aqueous Ba species in water were calculated using the PHREEQC program. The results showed that TBa and DBa concentrations ranged from 6.7 to 483.1 μg/L and from 7.5 to 222.7 μg/L, respectively. TBa concentrations presented a high average value of 126.6 μg/L and greatly exceeded the reported common value of 10 μg/L Ba in surface water set by the Ministry of Environment Protection of China. PHREEQC results indicated that Ba species in water were present as Ba 2+ , BaSO 4 , BaHCO 3 , BaCO 3 , and BaOH + . The distribution of Ba species in water is controlled by pH and total organic carbon (TOC), and the lower pH (pH < 7) the higher the dissolved fractions. The log K d values (K d , dissolved-particulate distribution coefficients) varied from 2.41 to 6.32. Significant correlations were observed among Ba 2+ and K + , Na + , Cl - , NO 3 - , with Pearson correlation coefficients of 0.425, 0.531, 0.853, 0.612, and 0.329, respectively (p < 0.01). Elevated Ba concentrations in water indicated that the Ba contamination and its distribution pattern in local aquatic ecosystems are derived from Ba mining sites in the Tianzhu area.

  4. Barium hydrogen phosphate/gelatin composites versus gelatin-free barium hydrogen phosphate: synthesis and characterization of properties. (United States)

    Gashti, Mazeyar Parvinzadeh; Burgener, Matthias; Stir, Manuela; Hulliger, Jürg


    Recently, attention has been spent on crystal growth of phosphate compounds in gels for studying the mechanism of in vitro crystallization processes. Here, we present a gel-based approach for the synthesis of barium hydrogen phosphate (BHP) crystals using single and double diffusion techniques in gelatin. The composite crystals were compared with analytical grade BHP powder, single and polycrystalline BHP materials using Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), scanning pyroelectric microscopy (SPEM), optical microscopy (OM), thermal gravimetric analysis (TGA) and X-ray diffraction (XRD). FTIR spectra showed surface adsorption of gelatin molecules by using BHP stacked sheets due to CH2 stretching, CH2 bending and amide I vibrations are found in a gelatin content of about 2% determined by dissolution. SEM shows various crystal morphologies of the BHP/gelatin composites forming bundled micro-flakes to irregular bundled needles and spheres different from gel-free crystals. The variety in morphology depends on the ion concentration, pH of gel as well as the method of crystal growth. SPEM investigation of BHP/gelatin aggregates revealed polar domains showing alteration of the polarization. Moreover, BHP/gelatin composite crystals showed a higher thermal stability in comparison with analytical grade BHP or/and BHP single crystals due to strong interactions between gelatin and BHP. The XRD diffraction analysis demonstrated that the single and double diffusion techniques in gelatin led to the formation of orthorhombic BHP. This study demonstrates that gelatin is a useful high molecular weight biomacromolecule for controlling the crystallization of a composite material by producing a variety of morphological forms. Copyright © 2014 Elsevier Inc. All rights reserved.


    International Nuclear Information System (INIS)

    Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang


    Precise determinations of 48 Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive 48 Ca/ 44 Ca anomalies in all analyzed CAIs after normalization to 42 Ca/ 44 Ca, and it is clearly shown that there is no simple correlation between 48 Ca/ 44 Ca and 50 Ti/ 48 Ti anomalies, in agreement with Jungck et al. Compared to the 48 Ca/ 44 Ca versus 50 Ti/ 48 Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated 50 Ti/ 48 Ti. Assuming the 48 Ca/ 44 Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess 50 Ti anomalies in CAIs can be calculated by subtracting the part associated with 48 Ca/ 44 Ca. These excesses show a linear correlation with 138 La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system 48 Ca, 50 Ti, and 138 La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II

  6. Clinical characteristics of 138 Chinese female patients with idiopathic hypogonadotropic hypogonadism. (United States)

    Tang, Rui-Yi; Chen, Rong; Ma, Miao; Lin, Shou-Qing; Zhang, Yi-Wen; Wang, Ya-Ping


    To evaluate the clinical features of Chinese women with idiopathic hypogonadotropic hypogonadism (IHH). We retrospectively reviewed the clinical characteristics, laboratory and imaging findings, therapeutic management and fertility outcomes of 138 women with IHH. All patients had been treated and followed up at an academic medical centre during 1990-2016. Among the 138 patients, 82 patients (59.4%) were diagnosed with normosmic IHH and 56 patients (40.6%) were diagnosed with Kallmann syndrome (KS). The patients with IHH experienced occasional menses (4.3%), spontaneous thelarche (45.7%) or spontaneous pubarche (50.7%). Women with thelarche had a higher percentage of pubarche ( P   <  0.001) and higher gonadotropin concentrations ( P   <  0.01). Olfactory bulb/sulci abnormalities were found during the magnetic resonance imaging (MRI) of all patients with KS. Most patients with IHH had osteopenia and low bone age. Among the 16 women who received gonadotropin-releasing hormone treatment, ovulation induction or assisted reproductive technology, the clinical pregnancy rate was 81.3% and the live birth rate was 68.8%. The present study revealed that the phenotypic spectrum of women with IHH is broader than typical primary amenorrhoea with no secondary sexual development, including occasional menses, spontaneous thelarche or pubarche. MRI of the olfactory system can facilitate the diagnosis of KS. Pregnancy can be achieved after receiving appropriate treatment. © 2017 The authors.

  7. Clinical characteristics of 138 Chinese female patients with idiopathic hypogonadotropic hypogonadism

    Directory of Open Access Journals (Sweden)

    Rui-yi Tang


    Full Text Available Objective: To evaluate the clinical features of Chinese women with idiopathic hypogonadotropic hypogonadism (IHH. Methods: We retrospectively reviewed the clinical characteristics, laboratory and imaging findings, therapeutic management and fertility outcomes of 138 women with IHH. All patients had been treated and followed up at an academic medical centre during 1990–2016. Results: Among the 138 patients, 82 patients (59.4% were diagnosed with normosmic IHH and 56 patients (40.6% were diagnosed with Kallmann syndrome (KS. The patients with IHH experienced occasional menses (4.3%, spontaneous thelarche (45.7% or spontaneous pubarche (50.7%. Women with thelarche had a higher percentage of pubarche (P < 0.001 and higher gonadotropin concentrations (P < 0.01. Olfactory bulb/sulci abnormalities were found during the magnetic resonance imaging (MRI of all patients with KS. Most patients with IHH had osteopenia and low bone age. Among the 16 women who received gonadotropin-releasing hormone treatment, ovulation induction or assisted reproductive technology, the clinical pregnancy rate was 81.3% and the live birth rate was 68.8%. Conclusions: The present study revealed that the phenotypic spectrum of women with IHH is broader than typical primary amenorrhoea with no secondary sexual development, including occasional menses, spontaneous thelarche or pubarche. MRI of the olfactory system can facilitate the diagnosis of KS. Pregnancy can be achieved after receiving appropriate treatment.

  8. [Clinical analysis of 138 multiple primary cancers diagnosed of digestive system malignant tumor initially]. (United States)

    Lyu, J M; Xiong, H C; Wu, B; Zhou, X Q; Hu, J


    Objective: To study the clinical characteristics, strategy of treatment and prognosis of multiple primary cancers(MPC) diagnosed of digestive system malignant tumor firstly. Methods: From January, 2000 to December, 2015, the clinical, follow-up and prognostic data of 138 MPC patients diagnosed of digestive system malignant tumor firstly were retrospectively analyzed. Results: 138 cases were found in 10 580 cases with malignant tumors, and the incidence was 1.30%. There were 129 cases of duplex primary cancers, 8 cases of triple primary cancers and 1 case of quintuple primary cancers. The repetitive primary cancer was occurred in digestive system (61cases, 44.2%) most frequently, with the next in respiratory system (46 cases, 33.3%). 52.2% (72 cases) suffered second primary cancer in 2 years after first primary cancer diagnosed, and 75.4% (104 cases) in 5 years. The median overall survival in patients with all cancer lesions radically treated was 168 months, better than any other treatment (68 months, P digestive system malignant tumor most frequently occurred in the digestive system and respiratory system. More concern should be attracted in follow-up, especially in the first 5 years. The key to improve patient' prognosis was radical treatment to every primary cancer.

  9. 75 FR 54921 - Withdrawal of Regulatory Guides 1.38, 1.94, and 1.116 (United States)


    ... Guide 1.38, ``Quality Assurance Requirements for Packaging, Shipping, Receiving, Storage, and Handling....116, ``Quality Assurance Requirements for Installation, Inspection, and Testing of Mechanical... Development Branch, Division of Engineering, Office of Nuclear Regulatory Research, U.S. Nuclear Regulatory...

  10. Environmental controls on barium incorporation into planktic foraminifer, Globorotalia truncatulinoides (United States)

    Richey, J. N.; Reynolds, C. E.; Fehrenbacher, J. S.


    The Ba/Ca of planktic foraminifera in marine sediment cores has been used primarily to track changes in riverine input over time, and thus may be a potentially powerful proxy for reconstructing past changes in the terrestrial hydrologic cycle. Using Ba/Ca as a proxy for riverine freshwater input requires the assumption that Ba/Ca in foraminiferal calcite reflects the Ba/Ca of seawater, and that the partition coefficient for barium between seawater and foraminiferal calcite is independent of the influence of temperature, salinity, pH, alkalinity and light availability. Although it has been shown that this partition coefficient is nearly identical for common species of spinose planktic foraminifera (e.g., Globigerinoides ruber, Orbulina universa, Globigerinoides sacculifer), some non-spinose species have been demonstrated to have Ba/Ca ratios that are much higher than that of co-occurring spinose specimens. We investigate environmental controls on Ba/Ca in the tests of Globorotalia truncatulinoides, a planktic species of foraminifera with a unique life history in the Gulf of Mexico (GoM). G. truncatulinoides experiences 92% of its annual flux to the sediment trap during winter (JFM) in the GoM. The Mg/Ca and ∂18O of the ontogenetic calcite suggests that primary calcification occurs within the surface mixed layer (0-150 meters), and a thick secondary crust is added at depths below the thermocline. We use LA-ICP-MS to analyze the Ba/Ca of both encrusted and non-encrusted G. truncatulinoides from a sediment trap time series in the GoM and find that the Ba/Ca in ontogenetic calcite of non-encrusted specimens varies between 10 and 200 mmol/mol, while the Ba/Ca of the secondary crust varies between 0 and 3 mmol/mol. The Ba/Ca of the non-encrusted G. truncatulinoides specimens is two to three orders of magnitude higher than that of co-occurring spinose planktic foraminifera (O. universa and G. ruber) in the GoM sediment trap, while the secondary crust has Ba/Ca similar to

  11. Prospective comparison of air-contrast barium enema and colonoscopy in patients with fecal occult blood: a pilot study. (United States)

    Rockey, Don C; Koch, Johannes; Yee, Judy; McQuaid, Kenneth R; Halvorsen, Robert A


    The utility of air-contrast barium enema and colonoscopy for evaluation of the colon has been debated. Air-contrast barium enema is less expensive and invasive than colonoscopy, but it also is less sensitive and specific. Further, although air-contrast barium enema may be less painful than colonoscopy, it often is poorly tolerated by patients. Thus, this study compared the sensitivity and the specificity of air-contrast barium enema and colonoscopy for detection of colonic lesions in patients with fecal occult blood. Over a 30-month period, patients with fecal occult blood were recruited. Patients underwent standard air-contrast barium enema, followed by colonoscopy 7 to 14 days later. Colonoscopists were blinded to the results of air-contrast barium enema until the colonoscopy was completed, after which the results were disclosed. If the findings were discrepant, colonoscopy was repeated. A total of 100 patients were evaluated. Nine air-contrast barium enemas were reported to be inadequate, and the cecum was not intubated at colonoscopy in two patients. In the remaining patients, 5 cancers were identified (1 each cecum, transverse colon, descending colon, sigmoid colon, and rectum) by both studies. Sixty-six polypoid lesions were identified in 30 patients. Diverticula were identified in 42 patients by air-contrast barium enema and in 18 patients by colonoscopy. Air-contrast barium enema detected 3 of 36 polypoid lesions 5 mm or less in diameter, 5 of 15 adenomas 6 to 9 mm in size, and 4 of 15 adenomas 10 mm or greater in diameter (sensitivity 8%, 33%, and 27%, respectively). After excluding patients with diverticula, air-contrast barium enema detected 3 of 7 adenomas 10 mm or greater in size. Overall, 12 polypoid lesions or filling defects were identified by air-contrast barium enema that could not be verified by colonoscopy. The specificity of air-contrast barium enema for lesions 1.0 cm or greater in size was 100%; for those 6 mm or greater, it was 97%. Air

  12. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage. (United States)

    Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J


    Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3).

  13. Interactions between nitrogen molecules and barium atoms on Ru (0001) surface

    International Nuclear Information System (INIS)

    Zhao Xinxin; Mi Yiming; Xu Hongxia; Wang Lili; Ren Li; Tao Xiangming; Tan Mingqiu


    We had performed first principles calculations on interactions between nitrogen molecules and barium atoms on Ru (0001) surface using density function theory methods. It was shown that effects of barium atoms weakened the bond strength of nitrogen molecules. The bond length of nitrogen molecule increases from 0.113 nm on Ru (001)-N 2 to 0.120 nm on Ru (001)-N 2 /Ba surface. While stretch vibrational frequency of nitrogen molecule decreased from 2222 cm -1 and charge transfer toward nitrogen molecule increased from 0.3 e to 1.1 e. Charge was mainly translated from 6 s orbitals of barium atoms to 4 d orbitals of substrate, which enhanced the hybridization between 4 d and 2 π orbitals and increased the dipole moment of 5 σ and d π orbitals of nitrogen molecule. The molecular dipole moment of nitrogen molecule was increased by -0.136 e Anstrom. It was suggested that barium had some characters to be an electronic promoter on the process of activating nitrogen molecules on Ru (0001) surface. (authors)

  14. Compensation filtration for decubitus radiography during double-contrast barium enema examinations

    International Nuclear Information System (INIS)

    Feczko, P.J.; Haggar, A.M.; Rauch, P.L.; Halpert, R.D.; Simms, S.M.


    Lateral decubitus images obtained during double-contrast barium enema examinations may be difficult to interpret because of the large difference in density between the various parts of the radiographs. Several types of filters are described which can be used to rectify this problem, thus improving the quality of the decubitus radiographs and achieving a slight reduction in radiation exposure

  15. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    CERN Document Server

    Anderson, NG; Firsching, M; de Ruiter, N; Schleich, N; Butzer, J S; Cook, N J; Grasset, R; Campbell, M; Scott, N J A; Anderson, N G


    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 A mu A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct f...

  16. Barium enema and endoscopy for the detection of colorectal neoplasia: Sensitivity, specificity, complications and its determinants

    International Nuclear Information System (INIS)

    Zwart, Ingrid M. de; Griffioen, Gerrit; Shaw, M. Pertaap Chandie; Lamers, Cornelis B.H.W.; Roos, Albert de


    AIM: To analyse sensitivity, specificity and complication rate of endoscopy, and barium enema for the detection of colorectal neoplasia. MATERIALS AND METHODS: A MEDLINE search was performed (1980-2000) directed at the endoscopic and radiologic literature on barium enema. Articles were selected based on the type of study, availability of sensitivity and specificity values in sizeable patient groups, and reports on complications. Sixty articles were included in the analysis. RESULTS: Endoscopy proved to have superior sensitivity for polyps in patients at high-risk for colorectal neoplasia. The role of endoscopy and radiology in average-risk screening populations is not known. Sensitivity and specificity rates ranged widely, probably due to bias. For the detection of small polyps endoscopy has superior performance, whereas sensitivity is similar for endoscopy and barium enema for the detection of larger (>1 cm) polyps and tumours. Overall, endoscopy is associated with a higher complication rate. CONCLUSION: Endoscopy is the preferred detection method in high-risk patients. The role of endoscopy and radiology in a screening setting requires evaluation. This review provides the test characteristics of endoscopy and radiology which are relevant for a cost-effectiveness analysis. Double-contrast barium enema may play an important role for screening purposes, owing to its good sensitivity for detecting larger (>1 cm) polyps and its lack of major complications. Zwart, I.M. de et al. (2001)

  17. Use of barium-strontium carbonatite for flux welding and surfacing of mining machines (United States)

    Kryukov, R. E.; Kozyrev, N. A.; Usoltsev, A. A.


    The results of application of barium-strontium carbonatite for modifying and refining iron-carbon alloys, used for welding and surfacing in ore mining and smelting industry, are generalized. The technology of manufacturing a flux additive containing 70 % of barium-strontium carbonatite and 30 % of liquid glass is proposed. Several compositions of welding fluxes based on silicomanganese slag were tested. The flux additive was introduced in an amount of 1, 3, 5 %. Technological features of welding with the application of the examined fluxes are determined. X-ray spectral analysis of the chemical composition of examined fluxes, slag crusts and weld metal was carried out, as well as metallographic investigations of welded joints. The principal possibility of applying barium-strontium carbonatite as a refining and gas-protective additive for welding fluxes is shown. The use of barium-strontium carbonatite reduces the contamination of the weld seam with nonmetallic inclusions: non-deforming silicates, spot oxides and brittle silicates, and increases the desulfurizing capacity of welding fluxes.

  18. Growth and study of barium oxalate single crystals in agar gel

    Indian Academy of Sciences (India)


    by X-ray powder diffractometry, infrared spectroscopy, thermogravimetric and differential thermal analysis. An attempt is ... Quality. Transparent, opaque. Opaque. Size. 17 × 4 × 2, 4 × 3 × 2 and 4 mm diameter 4 mm diameter. Figure 1. Dendritic growth of barium oxalate. interstitial and spherulitic growth well inside the gel on.

  19. Dietary intake of barium, bismuth, chromium, lithium, and strontium in a Spanish population (Canary Islands, Spain). (United States)

    González-Weller, Dailos; Rubio, Carmen; Gutiérrez, Ángel José; González, Gara Luis; Caballero Mesa, José María; Revert Gironés, Consuelo; Burgos Ojeda, Antonio; Hardisson, Arturo


    The aim of this study was to analyze barium, bismuth, chromium, lithium, and strontium contents in food and beverages consumed by the population of the Canary Islands (Spain) as well as determine dietary intake of these metals in the archipelago as a whole and in its individual islands. To this end, 440 samples were analyzed by ICP-OES and GFAAS. Barium concentrations ranged from 5.210 ± 2.117 mg/kg in nuts to 0.035 ± 0.043 mg/L in water. Viscera exhibited the highest levels of bismuth (38.07 ± 36.80 mg/kg). The cold meat and sausages group stood out for its high chromium concentrations (0.494 ± 0.257 mg/kg). The highest concentration of lithium and strontium came out in nuts (8.761 ± 5.368 mg/kg and 9.759 ± 5.181 mg/kg, respectively). The total intakes of barium, bismuth, chromium, lithium, and strontium were 0.685, 1.274, 0.087, 3.674, and 1.923 mg/day, respectively. Cereals turned out to contribute most to the dietary intake of barium, bismuth, chromium, and lithium in the Canary Islands, while fruit contributes most to the strontium intake. We also performed a metal intake study by age and sex of the population and compared the outcome with data from other regions, both national and international.

  20. Oxidation of Alcohols by Ferric Nitrate in the Presence of Barium ...

    African Journals Online (AJOL)


    Oxidation of Alcohols by Ferric Nitrate in the Presence of. Barium Chloride or Silica Sulphuric Acid under Mild. Heterogeneous Conditions. Davood Habibi,a* Mohammad Ali Zolfigol,a* Farhad Shirini,b Maliheh Safaiee,a Masumeh Abedini b and Payam Rahmani a a Faculty of Chemistry, Bu-Ali Sina University, Hamadan, ...

  1. Magnetic studies of cobalt doped barium hexaferrite nanoparticles prepared by modified sol-gel method

    Energy Technology Data Exchange (ETDEWEB)

    Shalini, M. Govindaraj; Sahoo, Subasa C., E-mail: [Department of Physics, Central University of Kerala, Riverside Transit Campus, Padnekkad, Kasaragod, Kerala - 671314 (India)


    M-type barium hexaferrite (BaFe{sub 12}O{sub 19}) and cobalt doped barium hexaferrite (BaFe{sub 11}CoO{sub 19}) nanopowders were synthesized by modified sol-gel auto-combustion technique and were annealed at 900°C in air for 4 hours. The annealed powders were studied in the present work and X-ray diffraction studies showed pure phase formation after annealing. The average grain size in the nanopowder sample was decreased after doping. Magnetization value of 60 emu/g was observed at 300 K for the barium hexaferrite and was reduced to 54 emu/g after doping. The coercivity of 5586 Oe was observed at 300 K for the undoped sample and was found to be decreased in the doped sample. As the measurement temperature was decreased from 300 K to 60 K, magnetization value was increased in both the samples compared to those at 300 K. The coercivity of the undoped sample was found to decrease whereas it was increased for the doped sample at 60 K. The observed magnetic properties may be understood on the basis of modified exchange interaction and anisotropy in the doped sample compared to that of pure barium hexaferrite.

  2. Adsorption of Pb(II) present in aqueous solution on calcium, strontium and barium hydroxy apatites

    International Nuclear Information System (INIS)

    Vilchis G, J.


    Calcium, strontium and barium hydroxy apatites were successfully synthesized by chemical precipitation method, the obtained powders were characterized by the techniques of X-ray diffraction (XRD), scanning electron microscopy (Sem), semi-quantitative elemental analysis (EDS), infrared spectroscopy (IR), and N 2 physisorption studies, complementary to these analytical techniques, was determined the surface fractal dimension (Df), and the amount of surface active sites of the materials, in order to know application as ceramic for water remediation. The ability of Pb(II) ion adsorption present in aqueous solution on the hydroxy apatites synthesized by batch type experiments was studied as a function of contact time, concentration of the adsorbate and temperature. The maximum lead adsorption efficiencies obtained were 0.31, 0.32 and 0.26 mg/g for calcium, strontium and barium hydroxy apatites respectively, achieved an equilibrium time of 20 minutes in the three solid-liquid systems studied. Experimental data were adequately adjusted at the adsorption kinetic model pseudo-second order, for the three cases. Moreover, experimental data of the strontium and calcium hydroxy apatites were adjusted to the Langmuir adsorption isotherm, indicating that the adsorption was through a monolayer, whereas barium hydroxyapatite was adjusted to the Freundlich adsorption isotherm, indicating a multilayer adsorption. The thermodynamic parameters obtained during adsorption studies as a function of temperature showed physisorption, exothermic and spontaneous processes respectively. The results showed that the calcium hydroxyapatite, strontium and barium are an alternative for the Pb(II) ion adsorption present in wastewaters. (Author)

  3. A comparison of radiographer and radiologist reports on radiographer conducted barium enemas

    International Nuclear Information System (INIS)

    Murphy, M.; Loughran, C.F.; Birchenough, H.; Savage, J.; Sutcliffe, C.


    Purpose: To compare radiographer and radiologist reports on radiographer conducted barium enemas. Method: Two specially trained, experienced radiographers performed barium enemas and prepared provisional reports without consulting radiologists. Later, formal radiologist reports were issued. The reports of each were compared and correlated with clinical findings derived from case note review. Results:Seven hundred and eighty eight patients had barium enemas. Males numbered 295 (37.5%) and females 493 (62.5%). Patients ages ranged from 17 to 95 years (mean 62). The radiologist reported 244 as normal, 432 as diverticular change, 70 with polyps (31 of which had co-existent diverticular disease), 31 with carcinomas and 12 with colitis (three of which had co-existent diverticular disease). Taking the radiologist reports as gold-standard radiographer reports were concordant in 753 (95.5%). There were 35 (4.5%) discordant radiographer reports of these 19 were false-positive diagnoses of polyps and six false positive diagnoses of diverticular change. There were seven false-negative diagnoses of polyps (only one of these was found to have a polyp at follow-up endoscopy). There was one false-negative diagnosis of colitis and two false-negative reports of diverticular change. On follow up there were no false negative diagnoses of carcinoma by either radiographer or radiologist. There was one concordant false-positive diagnosis of carcinoma. Conclusion:Radiographers with specialized training can report barium enemas to a high standard

  4. A comparison of radiographer and radiologist reports on radiographer conducted barium enemas

    Energy Technology Data Exchange (ETDEWEB)

    Murphy, M.; Loughran, C.F.; Birchenough, H.; Savage, J.; Sutcliffe, C


    Purpose: To compare radiographer and radiologist reports on radiographer conducted barium enemas. Method: Two specially trained, experienced radiographers performed barium enemas and prepared provisional reports without consulting radiologists. Later, formal radiologist reports were issued. The reports of each were compared and correlated with clinical findings derived from case note review. Results:Seven hundred and eighty eight patients had barium enemas. Males numbered 295 (37.5%) and females 493 (62.5%). Patients ages ranged from 17 to 95 years (mean 62). The radiologist reported 244 as normal, 432 as diverticular change, 70 with polyps (31 of which had co-existent diverticular disease), 31 with carcinomas and 12 with colitis (three of which had co-existent diverticular disease). Taking the radiologist reports as gold-standard radiographer reports were concordant in 753 (95.5%). There were 35 (4.5%) discordant radiographer reports of these 19 were false-positive diagnoses of polyps and six false positive diagnoses of diverticular change. There were seven false-negative diagnoses of polyps (only one of these was found to have a polyp at follow-up endoscopy). There was one false-negative diagnosis of colitis and two false-negative reports of diverticular change. On follow up there were no false negative diagnoses of carcinoma by either radiographer or radiologist. There was one concordant false-positive diagnosis of carcinoma. Conclusion:Radiographers with specialized training can report barium enemas to a high standard.

  5. Seasonal variability in the input of lead, barium and indium to Law Dome, Antarctica

    DEFF Research Database (Denmark)

    Burn-Nunes...[], L.J.; Vallelonga, Paul Travis; Loss, R.D.


    Lead (Pb) isotopic compositions and concentrations, and barium (Ba) and indium (In) concentrations have been determined at monthly resolution in five Law Dome (coastal Eastern Antarctica) ice core sections dated from similar to 1757 AD to similar to 1898 AD. 'Natural' background Pb concentrations...

  6. Barium enema with reference to rectal biopsy for the diagnosis and ...

    African Journals Online (AJOL)

    Background: Hirschsprung disease is congenital disease caused by a lack of ganglion cells in the distal bowel wall which results in functional obstruction of the aganglionic segment due to failure of relaxation during peristalsis. Barium enema is the best imaging modality to diagnose Hirschsprung disease but the gold ...

  7. Barium versus Nonbarium Stimuli: Differences in Taste Intensity, Chemesthesis, and Swallowing Behavior in Healthy Adult Women (United States)

    Nagy, Ahmed; Steele, Catriona M.; Pelletier, Cathy A.


    Purpose: The authors examined the impact of barium on the perceived taste intensity of 7 different liquid tastant stimuli and the modulatory effect that these differences in perceived taste intensity have on swallowing behaviors. Method: Participants were 80 healthy women, stratified by age group (60) and genetic taste status…

  8. Dispersive waves induced by self-defocusing temporal solitons in a beta-barium-borate crystal

    DEFF Research Database (Denmark)

    Zhou, Binbin; Bache, Morten


    We experimentally observe dispersive waves in the anomalous dispersion regime of a beta-barium-borate (BBO) crystal, induced by a self-defocusing few-cycle temporal soliton. Together the soliton and dispersive waves form an energetic octave-spanning supercontinuum. The soliton was excited...

  9. Mechanical and Microstructural Evaluation of Barium Strontium Titanate Thin Films for Improved Antenna Performance and Reliability

    National Research Council Canada - National Science Library

    Hubbard, C


    Ferroelectric barium strontium titanate (Ba(1-x)SrxTiO3 BSTO) films of 1-micron nominal thickness were deposited on single crystals of sapphire and electroded substrates at substrate temperatures varying from 30 deg C to 700 deg C...

  10. Proposed Oral Reference Dose (RfD) for Barium and Compounds (Final Report, 2004) (United States)

    This document is the final report from the 2004 external peer review of the Proposed Oral Reference Dose (RfD) for Barium and Compounds, prepared by the U.S. Environmental Protection Agency (EPA), National Center for Environmental Assessment (NCEA), for the Integrated Risk...

  11. Barium stone formation in the vagina of a child with persistent cloaca ...

    African Journals Online (AJOL)

    Persistent cloaca is a severe form of malformation of the anorectum. A distal colostogram is important in the planning of its treatment. We report herein a case of a girl who had barium stone formation within her vagina following a distal colostogram. Water soluble contrasts are recommended for this procedure. Key words: ...

  12. Effects of barium and cadmium on the population development of the marine nematode Rhabditis (Pellioditis) marina. (United States)

    Lira, V F; Santos, G A P; Derycke, S; Larrazabal, M E L; Fonsêca-Genevois, V G; Moens, T


    Offshore oil and gas drilling often involves the use of fluids containing barium and traces of other heavy metals. These may affect the environment, but information on their toxicity to benthic biota remains scant. Here, we present results of a 10-day bioassay with the marine nematode Rhabditis (Pellioditis) marina at different loads of barium (0-10 ,000 ppm nominal concentrations) and cadmium (0-12 ppm) in the range of concentrations reported from drilling-impacted sediments. Barium did not affect the fitness and population development of R. (P.) marina at concentrations up to 300 ppm, but did cause a decrease in population abundance and an increase in development time from concentrations of 400-2000 ppm onwards. Increased mortality occurred at 4800 ppm Ba. For cadmium, LOEC and EC₅₀ values for total population abundance were 2.95 and 8.82 ppm, respectively. Cd concentrations as low as 2.40 to 2.68 caused a decrease in the abundance of adult nematodes, indicating that assays covering more generations would likely demonstrate yet more pronounced population-level effects. Our results indicate that oil and gas drilling activities may potentially have important implications for the meiobenthos through the toxicity of barium and associated metals like cadmium. Copyright © 2011 Elsevier Ltd. All rights reserved.

  13. Effect of boric acid sintering aid on densification of barium ferrite

    Indian Academy of Sciences (India)


    Abstract. Boric acid has been added in 0⋅1–0⋅6% range for studying the densification characteristics of solid state sintered barium hexaferrite. Sintering studies have been carried out at three different temperatures. Physical properties like density and porosity have been studied for all compositions. The phase identification.

  14. Diffuse X-ray scattering and far infrared absorption of barium and lead β" aluminas

    DEFF Research Database (Denmark)

    Hayes, W.; Kjær, Kristian; Pratt, F. L.


    The authors have carried out high-momentum-resolution studies in diffuse X-ray scattering of barium and lead B" aluminas in the temperature range 20-700 degrees C. They have also measured the vibrational spectra of these compounds between 2K and 300K in the energy range 10-100 cm-1. The results...

  15. A plasmonic modulator based on metal-insulator-metal waveguide with barium titanate core

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Lavrinenko, Andrei


    We design a plasmonic modulator which can be utilized as a compact active device in photonic integrated circuits. The active material, barium titanate (BaTiO3), is sandwiched between metal plates and changes its refractive index under applied voltage. Some degree of switching of ferroelectric...

  16. Electromechanical Response of Polycrystalline Barium Titanate Resolved at the Grain Scale

    DEFF Research Database (Denmark)

    Majkut, Marta; Daniels, John E.; Wright, Jonathan P.


    critical for understanding bulk polycrystalline ferroic behavior. Here, three-dimensional X-ray diffraction is used to reconstruct a 3D grain map (grain orientations and neighborhoods) of a polycrystalline barium titanate sample and track the grain-scale non-180° ferroelectric domain switching strains...

  17. A study on the behaviour of M-type barium hexagonal ferrite based ...

    Indian Academy of Sciences (India)

    Keywords. Hexagonal ferrite; radar cross-section; microwave acsorbing paint. Abstract. This paper deals with development of single- and double-layer microwave absorbing paints using Mn-substituted barium hexagonal ferrite. The comparative studies of both theoretical and experimental results at Ku band have been ...

  18. On film quality in barium-air double contrast colon study

    International Nuclear Information System (INIS)

    Rhu, Sang Hyung; Rhee, Jae Ho; Kim, Hai Sung; Cheung, Hwan


    The colon double contrast study provides valuable diagnostic information by means of appropriate control of Kvp and mAa when making double contrast image by injecting air into the colon after coating the colon wall by appropriately diluted Barium solution. The following experiments were performed the results of which allowed to improve the quality of film in barium-air double contrast colon study: (1) Do the pictures have uniform density when measured with a densitometer from three measuring points established in the picture by changing Kvp and mAs depending on the thickness of the patient? (2) Is the quality of the picture improved by being compensated from the adjacent area when using a wedge filter in routine check lateral decubitus and erect view? (3) What is the optimum dilution of barium solution which gives the best result for colon wall coating? The above experiments revealed that as the patient's thickness increased, it should be considered to increase mAs as well as Kvp and a wedge filter could give diagnostically very informative pictures in routine-check lateral decubitus and erect view. And 70-80% solution of Barium-water mixture provided the best quality of double contrast image

  19. Effect of barium doping on the physical properties of zinc oxide ...

    Indian Academy of Sciences (India)


    Home; Journals; Pramana – Journal of Physics; Volume 87; Issue 1. Effect of barium doping on the physical properties of zinc oxide ... Proceedings of the International Workshop/Conference on Computational Condensed Matter Physics and Materials Science (IWCCMP-2015). Posted on November 27, 2015. Guest Editors: ...

  20. an oxalate-peroxide complex used in the preparation of doped barium titanate

    NARCIS (Netherlands)

    van der Gijp, S.; Winnubst, Aloysius J.A.; Verweij, H.


    A method is described for the preparation of homogeneously doped barium titanate, which can be applied in non-linear dielectric elements. Ba and Ti salts are dissolved, mixed with hydrogen peroxide and added to a solution of ammonium oxalate, resulting in the formation of an insoluble peroxo-oxalate

  1. Growth behaviour of twisted ribbons of barium carbonate/silica self-assembled ceramics

    International Nuclear Information System (INIS)

    Garcia-Ruiz, J.M.; Moreno, A.


    Twisted ribbons of self-assembled crystal aggregates of barium carbonate, in the presence of silicate ions at pH 9.5 grow at constant rate between 20 and 50 mu m/min. The morphological behaviour depends on temperature, while it was demonstrated to be independent of the viscosity of the growth environment. (Author) 7 refs

  2. Nanostructure Development in Alkoxide-Carboxylate-Derived Precursor Films of Barium Titanate

    NARCIS (Netherlands)

    Stawski, Tomasz; Veldhuis, Sjoerd; Besselink, R.; Castricum, H.L.; Portale, G.; Blank, David H.A.; ten Elshof, Johan E.


    The structural evolution in wet alkoxide-carboxylate sol–gel precursor films of barium titanate upon drying was investigated by time-resolved small-angle X-ray scattering (SAXS). The morphology of as-dried amorphous precursor thin films was investigated by transmission electron microscopy (TEM) and

  3. Influence of fuel ratios on auto combustion synthesis of barium ferrite ...

    Indian Academy of Sciences (India)


    Maximum magnetization and coercivity values are also greater for 1 : 2 ratios. These values measured at room temperature are found to ... barium ferrite synthesis at a lower pH value of 7 and their influence on size, morphology and ..... Benito G, Morales M P, Requena J, Raposa V,. Vazquez M and Moya J S 2001 J. Magn.

  4. Effect of boric acid sintering aid on densification of barium ferrite

    Indian Academy of Sciences (India)


    Physical properties like density and porosity have been studied for all compositions. The phase identification and microstructural investigation on the fractured surface have been carried out to understand the effect of sintering aid on the densification characteristics. Keywords. Barium ferrite; sintering aid; densification. 1.

  5. Dielectric properties and vacancy-like defects in plasma-sprayed barium titanate.

    Czech Academy of Sciences Publication Activity Database

    Ctibor, Pavel; Čížek, J.; Sedláček, J.; Lukáč, František


    Roč. 100, č. 7 (2017), s. 2972-2983 ISSN 0002-7820 Institutional support: RVO:61389021 Keywords : barium titanate * plasma spraying * vacancies Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 2.841, year: 2016

  6. Effect of barium doping on the physical properties of zinc oxide ...

    Indian Academy of Sciences (India)


    Jun 9, 2016 ... Effect of barium doping on the physical properties of zinc oxide nanoparticles elaborated via sonochemical synthesis method. KEKELI N'KONOU1,2, MUTHIAH HARIS2,∗, YENDOUBÉ LARE1,. MAZABALO BANETO1 and KOSSI NAPO1. 1Laboratoire sur l'Énergie Solaire, Université de Lomé, BP 1515, ...

  7. Complete sulphate removal from neutralised acidic mine drainage with barium carbonate

    CSIR Research Space (South Africa)

    Swanepoel, H


    Full Text Available sulphate removal is achieved. However, further treatment is required in order to reduce the sulphate concentration to below 500 mg/l, which is the required concentration for discharge into waterways. The CSIR developed and patented the ABC (alkali-barium-calcium...

  8. Growth and study of barium oxalate single crystals in agar gel

    Indian Academy of Sciences (India)

    Barium oxalate was grown in agar gel at ambient temperature. The effect of various parameters like gel concentration, gel setting time and concentration of the reactants on the growth of these crystals was studied. Prismatic platy shaped spherulites and dendrites were obtained. The grown crystals were characterized by ...

  9. The impact of high-density barium use in double contrast radiographic methods for gastric cancer screening in Niigata, Japan. (United States)

    Wakai, Shizuko; Tanabe, Naohito; Suzuki, Hiroshi


    Use of high-density barium (= or > 180 w/v%) has been widely spread in community-based mass screening for gastric cancer in Japan. However, the impact on outcomes of the screening has not been fully evaluated. Then, we investigated the advantage of high-density barium use by comparing the outcomes between a period with high-density barium and that with low-density barium (barium decreases the positive finding rate in initial mass screening x-ray examinations by 12% (odds ratio, 0.88; 95% confidence interval, 0.86 - 0.90) and increase the gastric cancer detection rate by diagnostic examination by 15% (odds ratio, 1.15; 95% confidence interval, 1.01-1.31). We conclude that introduction of high-density barium has improved the efficiency of mass screening for gastric cancer by decreasing unnecessary diagnostic examinations and reducing the total personal and public health costs. Thus, nationwide use of high-density barium is recommended for mass gastric cancer screening in Japan.

  10. Comparative evaluation of the fecal-tagging quality in CT colonography: barium vs. iodinated oral contrast agent. (United States)

    Nagata, Koichi; Singh, Anand Kumar; Sangwaiya, Minal Jagtiani; Näppi, Janne; Zalis, Michael E; Cai, Wenli; Yoshida, Hiroyuki


    The purpose of this evaluation was to compare the tagging quality of a barium-based regimen with that of iodine-based regimens for computed tomographic (CT) colonography. Tagging quality was assessed retrospectively in three different types of fecal-tagging CT colonographic cases: 24 barium-based cases, 22 nonionic iodine-based cases, and 24 ionic iodine-based cases. For the purpose of evaluation, the large intestine was divided into six segments, and the tagging homogeneity of a total of 420 segments (70 patients) was graded by three blinded readers from 0 (heterogeneous) to 4 (homogeneous). For barium-based cases, the average score for the three readers was 2.4, whereas it was 3.4 for nonionic iodine and 3.6 for ionic iodine. The percentages of segments that were assigned scores of 4 (excellent tagging [100%]) were 11.6%, 61.9%, and 72.9% for the barium-based, nonionic iodine-based, and ionic iodine-based regimens, respectively. The homogeneity scores of iodine-based fecal-tagging regimens were significantly higher than those of the barium-based fecal-tagging regimen (P barium-based regimen (P barium-based fecal-tagging regimen. Iodine-based fecal-tagging regimens can provide an appropriate method for use in nonlaxative or minimum-laxative CT colonography.

  11. Clearance of barium from the oesophagus with diet cola and metoclopramide: A one stop approach to patients with dysphagia

    International Nuclear Information System (INIS)

    Mitchell, J.; Farrow, R.; Hussaini, S.H.; Dalton, H.R.


    AIM: To establish a 'one-stop' dysphagia service in which a consultation, barium swallow and endoscopy can all be performed in the same hospital visit. MATERIALS AND METHODS: In order to allow both barium swallow examination and endoscopy to be performed on the same day, a novel technique for clearing barium from the upper gastrointestinal tract was established. Following the barium swallow examination, patients were given diet cola and metoclopramide syrup. If appropriate, an upper gastrointestinal endoscopy was then performed shortly afterwards. The service was piloted for 6 months in which time 25 patients were investigated in this way. RESULTS: All patients were seen within 2 weeks of referral. The mean time between barium swallow and endoscopy was 3 h 38 min (range, 1 h 50 min to 5 h 20 min). In all 24 patients in whom an endoscopy was performed, barium had been satisfactorily cleared from the oesophagus and stomach. CONCLUSION: This technique allows both barium swallow and upper gastrointestinal endoscopy to be performed on the same day, providing a rapid, safe and accurate diagnosis with minimum patient inconvenience. Mitchell, J. (2001)

  12. 1,2,4-Diazaphospholide complexes of barium: mechanism of formation and crystallographic characterization. (United States)

    Pi, Chengfu; Wan, Li; Liu, Weiping; Pan, Zaifu; Wu, Haoyu; Wang, Yunhua; Zheng, Wenjun; Weng, Linhong; Chen, Zhenxia; Wu, Limin


    A number of barium 1,2,4-diazaphospholide (dp(-)) complexes have been prepared by protonolysis of barium bis[bis(trimethylsilyl)]amide (Ba[N(SiMe(3))(2)](2)(THF)(2)) and the corresponding 1,2,4-diazaphospholes. The bis(3,5-diphenyl-1,2,4-diazaphospholide)-tetrakis(tetrahydrofuran)barium [eta(2)(N,N)-3,5-Ph(2)dp)(2)Ba(THF)(4)] (1) and bis(3,5-diphenyl-1,2,4-diazaphospholide)-tetrakis(dimethylsulfoxide)barium [eta(2)(N,N)-3,5-Ph(2)dp)(2)Ba(DMSO)(4)] (2) were prepared by the reactions of Ba[N(SiMe(3))(2)](2)(THF)(2) and 3,5-diphenyl-1,2,4-diazaphosphole (H[3,5-Ph(2)dp]) in tetrahydrofuran (THF) or dimethylsulfoxide (DMSO), respectively, while the bis(3,5-disubstituted-1,2,4-diazaphospholide)-(18-crown-6) barium complexes [trans-eta(2)(N,N)-dp)(2)Ba(18-crown-6)] (3), [cis-eta(2)(N,N)-tBu(2)dp)(2)Ba(18-crown-6)] (4), [trans-eta(2)(N,N)-tBu(2)dp)(2)Ba(18-crown-6)] (5), [cis-eta(2)(N,N)-Ph(2)dp)(2)Ba(18-crown-6)] (6), and [trans-eta(2)(N,N)-Ph(2)dp)(2)Ba(18-crown-6)] (7) were synthesized by the reaction of Ba[N(SiMe(3))(2)](2)(THF)(2) and the corresponding 1,2,4-diazaphospholes in the presence of 18-crown-6 in THF or DMSO. Complexes 1, 2, 3, 4, and 7 have been structurally characterized. Complex 4 is the first structurally characterized barium complex in which the two organic ligands are located on the same side of 18-crown-6 (cis conformation). The (31)P{(1)H} NMR spectra suggested a partial dissociation of the barium 1,2,4-diazaphospholides 2, 4, and 7 into the corresponding ion associated complexes in solutions.

  13. Gastroesophageal reflux: comparison of barium studies with 24-h pH monitoring

    International Nuclear Information System (INIS)

    Pan, John J.; Levine, Marc S.; Redfern, Regina O.; Rubesin, Stephen E.; Laufer, Igor; Katzka, David A.


    Objective: To determine the correlation between massive gastroesophageal reflux (GER) on barium studies and pathologic acid reflux on 24-h pH monitoring. Methods: A search of hospital records from January 1997 to January 2001 revealed 28 patients who underwent both barium studies and 24-h pH monitoring. The radiologic reports were reviewed to determine the presence and degree of GER. Patients with reflux to or above the thoracic inlet either spontaneously or with provocative maneuvers in the recumbent position were classified as having massive reflux, whereas the remaining patients with reflux below the thoracic inlet or no reflux comprised the control group. The pH monitoring reports were also reviewed to determine if pathologic acid reflux was present in the recumbent position. The findings on these studies were then compared to determine the frequency of pathologic acid reflux in the recumbent position on pH monitoring in patients with massive reflux on barium studies compared with the control group. Results: Massive GER was observed on barium studies in 11 (39%) of the 28 patients and reflux below the thoracic inlet or no reflux in the remaining 17 patients (61%) who comprised the control group. All 11 patients (100%) with massive reflux on barium studies had pathologic acid reflux on pH monitoring in the recumbent position compared with six (35%) of 17 patients in the control group (P=0.0009). The pH in the distal esophagus on pH monitoring was less than 4.0 for 13.1% of the recumbent period for patients with massive GER on barium studies compared with 6.2% of the recumbent period for the control group (P=0.0076). Conclusion: Although 24-h pH monitoring remains the gold standard for the detection of GER, our experience suggests that patients with massive reflux on barium studies are so likely to have pathologic acid reflux in the recumbent position that these individuals can be further evaluated and treated for their gastroesophageal reflux disease (GERD

  14. Fabrication and electrical characterization of 15% yttrium-doped barium zirconate-nitrate freeze drying method combined with vacuum heating

    International Nuclear Information System (INIS)

    Imashuku, Susumu; Uda, Tetsuya; Nose, Yoshitaro; Awakura, Yasuhiro


    Research highlights: → Very fine 15% yttrium-doped barium zirconate powder of particle size about 30 nm was obtained by synthesizing at 500 deg. C in vacuum from powder mixed by the nitrate freeze-drying method. → Large and homogeneous grains of 15% yttrium-doped barium zirconate were easily obtained using the synthesized powder. → Grain boundary resistance was not inversely proportional to the grain size as theoretically expected. → Specific grain boundary conductivity varies with samples because impurities and/or evaporation loss of barium oxide might affect the grain-boundary resistance in 15% yttrium-doped barium zirconate. - Abstract: We applied a nitrate freeze-drying method to obtain a fine synthesized powder of 15% yttrium-doped barium zirconate. Fine 15% yttrium-doped barium zirconate powder of particle size about 30 nm was obtained by synthesizing at 500 deg. C in vacuum from a powder mixed by the nitrate freeze-drying method. However, we could not obtain such fine powder by synthesizing in air. Using the powder synthesized in vacuum, large and homogeneous grains of 15% yttrium-doped barium zirconate were easily obtained after sintering. Then, the bulk and grain boundary resistance were evaluated by AC 2-terminal measurement of sample in the form of bar and pellet and DC 4-terminal measurement of bar-shape sample. The grain boundary resistance was not inversely proportional to the grain size as theoretically expected. We concluded that specific grain boundary conductivity varies with samples. Some impurities, evaporation loss of barium oxide and/or other unexpected reasons might affect the grain boundary resistance in 15% yttrium-doped barium zirconate.

  15. miR-9-5p, miR-675-5p and miR-138-5p Damages the Strontium and LRP5-Mediated Skeletal Cell Proliferation, Differentiation, and Adhesion

    Directory of Open Access Journals (Sweden)

    Tianhao Sun


    Full Text Available This study was designed to evaluate the effects of strontium on the expression levels of microRNAs (miRNAs and to explore their effects on skeletal cell proliferation, differentiation, adhesion, and apoptosis. The targets of these miRNAs were also studied. Molecular cloning, cell proliferation assay, cell apoptosis assay, quantitative real-time PCR, and luciferase reporter assay were used. Strontium altered the expression levels of miRNAs in vitro and in vivo. miR-9-5p, miR-675-5p, and miR-138-5p impaired skeletal cell proliferation, cell differentiation and cell adhesion. miR-9-5p and miR-675-5p induced MC3T3-E1 cell apoptosis more specifically than miR-138-5p. miR-9-5p, miR-675-5p, and miR-138-5p targeted glycogen synthase kinase 3 β (GSK3β, ATPase Aminophospholipid Transporter Class I Type 8A Member 2 (ATP8A2, and Eukaryotic Translation Initiation Factor 4E Binding Protein 1 (EIF4EBP1, respectively. Low-density lipoprotein receptor-related protein 5 (LRP5 played a positive role in skeletal development. miR-9-5p, miR-675-5p, and miR-138-5p damage strontium and LRP5-mediated skeletal cell proliferation, differentiation, and adhesion, and induce cell apoptosis by targeting GSK3β, ATP8A2, and EIF4EBP1, respectively.

  16. Granulomatous colitis: findings on double contrast barium enema and follow-up studies

    International Nuclear Information System (INIS)

    Song, Jong Gi; Han, Joon Koo; Kim, Seung Hoon; Choo, Sung Wook; Kim, Seung Cheol; Choi, Byung Ihn


    To evaluate the radiologic findings of granulomatous colitis on double contrast barium enema and changes on follow-up studies. Serial double contrast barium enema of six patients with granulomatous colitis confirmed by endoscopic biopsy were reviewed. We analyzed the radiologic findings and their follow-up changes, including aphthous ulcers, lymphoid hyperplasia, deep ulcers, cobble stone appearance, geographic ulcers, asymmetric involvement of ulcers, skip lesions, sinus tract, fistula formation, pseudosacculation, focal stricture, and small bowel involvement. Pretreatment double contrast barium enema findings were aphthous ulcers in five patients, deep ulcer in six, cobble stone appearance in five, longitudinal geographic ulcers in two, fistulas in one, pseudosacculations in two, focal stricture in one, and pseudopolyps in six. Also, anal ulcers were observed in two patients, asymmetric involvement of ulcers in three, skip lesions in four, and small bowel involvement in five in five patients proved to have inactive disease after treatment, aphthous ulcers and deep ulcers disappeared. Geographic ulcers of two patients and anal ulcer of one patients decreased in size or depth. Pseudosacculation in one patient disappeared. Pseudopolyps decreased in two patients, increased in one, and decreased after increase in two. One patient whose disease remained active after treatment showed maintenance or increase of ulcers or fistula. And their pseudosacculation or focal stricture unchanged and pseudopolyps decreased. The major radiologic findings of chronic granulomatous colitis on double contrast barium enema are aphthous ulcer, deep ulcer, cobble stone appearance, discontinuity of the lesion and coexistence of ulcers and pseudopolyps. And, double contrast barium enema is good follow-up modality because its findings correlate with clinical course of the granulomatous colitis after treatment

  17. Barium enema and CT volumetry for predicting pathologic response to preoperative chemoradiotherapy in rectal cancer patients. (United States)

    Murono, Koji; Kawai, Kazushige; Tsuno, Nelson H; Ishihara, Soichiro; Yamaguchi, Hironori; Sunami, Eiji; Kitayama, Joji; Watanabe, Toshiaki


    Preoperative chemoradiotherapy has been widely used for the prevention of local recurrence of locally advanced rectal cancer, and the effect of chemoradiotherapy is known to be associated with overall survival. We aimed to evaluate the association of the pathologic response grade with tumor recurrence rate after chemoradiotherapy, using radiographic analysis and the Response Evaluation Criteria in Solid Tumors as the parameters. This study was conducted at a single tertiary care institution in Japan. This was a retrospective cohort study of patients undergoing preoperative chemoradiotherapy. A total of 101 low rectal cancer patients receiving preoperative chemoradiotherapy from July 2004 to August 2012 were enrolled. The tumor reduction rate was measured with the use of traditional Response Evaluation Criteria in Solid Tumors, barium enema, and CT volumetry, and the correlation between the reduction rate and the pathologic response grade was examined. The tumor reduction rate assessed according to Response Evaluation Criteria in Solid Tumors showed no association with the pathologic response grade (p =0.61). In contrast, the radiographic response rate by both barium enema and CT volumetry strongly correlated with the pathologic response grade (p barium enema, and CT volumetry had a lower recurrence rate (p =0.03, p =0.03, p =0.0002, and p =0.001). The difference between high responders and low responders was especially prominent by barium enema and CT volumetry. The study is limited by its retrospective nature. Double-contrast barium enema and CT volumetry were superior to Response Evaluation Criteria in Solid Tumors in evaluating the effect of chemoradiotherapy and predicting the likelihood of tumor recurrence.

  18. Spectral K-edge subtraction imaging of experimental non-radioactive barium uptake in bone. (United States)

    Panahifar, Arash; Samadi, Nazanin; Swanston, Treena M; Chapman, L Dean; Cooper, David M L


    To evaluate the feasibility of using non-radioactive barium as a bone tracer for detection with synchrotron spectral K-edge subtraction (SKES) technique. Male rats of 1-month old (i.e., developing skeleton) and 8-month old (i.e., skeletally mature) were orally dosed with low dose of barium chloride (33mg/kg/day Ba 2+ ) for 4weeks. The fore and hind limbs were dissected for imaging in projection and computed tomography modes at 100μm and 52μm pixel sizes. The SKES method utilizes a single bent Laue monochromator to prepare a 550eV energy spectrum to encompass the K-edge of barium (37.441keV), for collecting both 'above' and 'below' the K-edge data sets in a single scan. The SKES has a very good focal size, thus limits the 'crossover' and motion artifacts. In juvenile rats, barium was mostly incorporated in the areas of high bone turnover such as at the growth plate and the trabecular surfaces, but also in the cortical bone as the animals were growing at the time of tracer administration. However, the adults incorporated approximately half the concentration and mainly in the areas where bone remodeling was predominant and occasionally in the periosteal and endosteal layers of the diaphyseal cortical bone. The presented methodology is simple to implement and provides both structural and functional information, after labeling with barium, on bone micro-architecture and thus has great potential for in vivo imaging of pre-clinical animal models of musculoskeletal diseases to better understand their mechanisms and to evaluate the efficacy of pharmaceuticals. Copyright © 2016 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  19. Age of Sulfate Methane Transition Zone Determined by Modelling Barium Sulfate Growth (United States)

    Lin, S.; Wang, W. C.; Lien, K. L.; Liu, C. C.; Fan, L. F.


    Methane seep to the sediment/water interface could initiate anaerobic methane oxidation (AOM) with subsequent build up of chemosynthetic community, carbonate, pyrite and a number of other authigenic mineral formation. Determination the duration, sequence and time of methane seeps are keys to understand how methane seep to the environment and degree of alteration to the vicinity area. However, limited method existed in defining time of methane seep since there are some known problems involving typical dating methods, i.e. old carbon on C14 of fossil test or authigenic carbonate, thorium from surrounding matrix on U/Th authigenic carbonate dating. In this study, we have employed barium determination method (Dickens, 2001) to model timing of methane seep at two locations in the South China Sea. Our objective is to compare timing of the barium accumulation near the sulfate methane transition zone (SMTZ) on these two different locations and to seek if a similar mechanism driving the methane seep at two locations far apart. Dissolved barium, total sediment barium and aluminum were measured as well as pore water sulfate, and sediment pyrite concentrations. Time for the barium sulfate accumulation is calculated by: T = C/F, C= ∫ I x p x (1-Ø) Our results show that SMTZ is stabilized at each site for a duration of about 4000-5000 years. AOM process have been active at both sites at about the same time. In conjunction, pyrite also accumulated at a depth near the SMTZ as a result of methane oxidation. This result show that AOM could stay at the SMTZ for a relatively long period of time, on a scale of thousands of years.

  20. Edge detection of barium-filled stomach picture by one-dimensional collation method

    International Nuclear Information System (INIS)

    Nakamura, Shizuo


    The method for the contour edge detection of barium- filled stomach pictures by X-ray for the automatic screening is described using computer technique. It is necessary for the automatic screening of barium- filling pictures to detect accurately the outline of stomachs because the analysis of repletion pictures is performed by checking the disorder of marginal contours and abnormal stomach shapes. However, the detection of the coutour lines is difficult to be successful for the reason that the contrast of stomach pictures to background is low, a stomach is not necessarily filled completely with barium and the shadow of barium flowing into intestines is superimposed on stomach images and the shading is likely to occur. The engineering processing against these problems is not yet solved. In order to reduce the noise due to differential operator, the proposed method determines the boundary of a thing generally by the threshold value of density, and defines the edge of the thing from the differential waveform of density in the vicinity of the boundary. In addition, the method corrects the detection error caused by the local nonconformity of parameters by comparing the edges between the adjacent lines. As a result, in spite of its simple algorithm, the edges with good continuity and less noise can be detected, and the method is not much affected by shading. This method was found to be applicable to the images of others than stomachs. The extraction of the contour of barium- filling pictures requires the high level recognition processing instead of the simple conditioning. (Wakatsuki, Y.)

  1. Structural and magnetic behaviour of aluminium doped barium hexaferrite nanoparticles synthesized by solution combustion technique

    Energy Technology Data Exchange (ETDEWEB)

    Dhage, Vinod N.; Mane, M.L.; Keche, A.P.; Birajdar, C.T. [Department of Physics, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad (M.S.) 431004 (India); Jadhav, K.M., E-mail: [Department of Physics, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad (M.S.) 431004 (India)


    Nanocrystalline M-type Al{sup 3+} substituted barium hexaferrite samples having generic formula BaFe{sub 12-x}Al{sub x}O{sub 19} (where x=0.00, 0.25, 0.50, 0.75, 1.00) were synthesized by the solution combustion technique. The precursors were prepared using stoichiometric amounts of Ba{sup 2+}, Fe{sup 3+} and Al{sup 3+} nitrate solutions with citric acid as a chelating agent. The barium nitrate to citric acid ratio was taken as 1:2 and pH of the solution was kept at 8. The sintered samples were characterized by XRD, EDAX, SEM, TEM and VSM techniques. Pure barium hexaferrite shows only single phase hexagonal structure while samples at 0.25{<=}x{>=}1.00 show {alpha}-Fe{sub 2}O{sub 3} peaks with M-phase of barium hexaferrite in the X-ray diffraction pattern. The lattice parameters (a and c) obtained from XRD data decreases with increase in aluminium content x. The particle size obtained from X-ray diffraction data is in the nanometer range. The magnetic behaviour of the samples was studied using vibrating sample magnetometer technique. The saturation magnetization (M{sub s}) and magneton number (n{sub B}) decrease from 38.567 to 21.732 emu/g and from 7.6752 to 4.2126{mu}{sub B,} respectively, with increase in Al{sup 3+} substitution x from x=0.0 to 1.0. -- Research highlights: {yields} Preparation of barium hexaferrite by solution combustion. {yields} Characterization techniques used are XRD, VSM, TEM, EDAX and SEM. {yields} Substitution of Al{sup 3+} ions. {yields} Structural properties. {yields} Magnetic properties.

  2. Results of the radiological survey at 23 Yardboro Avenue, Albany, New York (AL138)

    International Nuclear Information System (INIS)

    Marley, J.L.


    A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. The property at 23 Yardboro Avenue in Albany, New York (AL138) was the subject of a radiological investigation initiated May 7, 1986. The property was a residence with a one and one-half-story frame house located on a rectangular lot. An asphalt driveway or parking area is located at the east side of the house. An area of /approximately/10 m /times/ 14 m at the rear was inaccessible. A diagram of the property showing the approximate boundaries and the 3-m grid network established for measurements outside the house is shown. The lot included in the radiological survey was /approximately/14 m wide by 36 m deep. Front and rear views of the property are shown. 13 refs., 5 figs., 5 tabs

  3. HH137 and 138: Discovering New Knots and a Molecular Outflow with Gemini and APEX (United States)

    Ferrero, L. V.; Cappa, C. E.; Gomez, M.


    We present a multi-frequency study of HH 137 and HH 138 using Gemini images and APEX molecular line data, as well as Spitzer images. Several 2.12 micron knots linked to HH137 are identified in the Gemini image. 12^CO(3-2), 13^CO(3-2), and C18^O(3-2) line data reveal the molecular counterpart of HH 137. Spitzer combined images suggest the location of the exciting source of HH 137, almost coincident with a high-density molecular clump detected in C18^O. We derive the main physical parameters of the molecular clump and the molecular outflow, and propose a simple scenario for the whole complex.

  4. Primary immunodeficiency in south China: clinical features and a genetic subanalysis of 138 children. (United States)

    Zeng, H; Tao, Y; Chen, X; Zeng, P; Wang, B; Wei, R; Yao, C; Xie, Y; Li, F; Tang, Y; Cui, Y; Sun, G


    We analyzed the clinical features of 138 patients with primary immunodeficiency (PID) and performed genetic testing on a subset of patients in order to complete gaps in research on PID in South China and thus improve pediatricians' ability to recognize and diagnose PID. We performed a retrospective analysis based on the medical records of PID patients hospitalized in our institution between May 1999 and June 2012. Gene sequencing was performed in 59 cases. Children with PID usually present with fever and repeated infections that generally affect the respiratory and digestive tracts. Growth retardation is observed in some cases. Of the 138 patients, 113 were boys, median age at onset was 5 months (range, 0-119 months), and age at diagnosis was 10 months (2-159 months). A family history of repeated infection or death of family members in infancy because of recurrent infections was recorded in 20 cases (14.49%). Antibody defects were detected in 48 cases (34.78%), combined immunodeficiency disease in 45 cases (32.61%), and other well-defined immunodeficiency syndromes in 45 cases (32.61%). Of the 59 patients from the genetic subanalysis, 24 (15.94%) had a genetic mutation (x-linked agammaglobulinemia, 8 cases; severe combined immunodeficiency, 8 cases; hyperimmunoglobulin M syndrome, 3 cases; hyperimmunoglobulin E syndrome, 3 cases; chronic granulomatous disease, 2 cases). We detected 4 novel mutations. No relevant mutations were found in the remaining 35 cases.After treatment with intravenous immunoglobulin and anti-infectious agents, 16 patients died in hospital, and 5 cases died after discontinuing treatment (mortality, 15.22%). In recent years, the number of patients with PID has risen gradually in South China. Genetic testing can confirm diagnosis. Since PID seriously affects children's quality of life, it is important to diagnose, treat, and intervene early.We hope our clinical and genetic analyses of children with PID can provide diagnostic guidance for

  5. Barium-induced skeletal muscle paralysis in the rat, and its relationship to human familial periodic paralysis (United States)

    Schott, G. D.; McArdle, B.


    An in vivo study of skeletal muscle paralysis induced by intravenous barium chloride has been made in curarized and non-curarized rats. The influence of potassium and calcium chlorides, propranolol, ouabain, and prior adrenalectomy on the paralysis has also been studied. Paralysis is found to be due to a direct effect on skeletal muscle, and to correlate well with the development of hypokalaemia. Possible mechanisms of action of barium are discussed, and attention is drawn to the similarity between barium poisoning and hypokalaemic familial periodic paralysis. PMID:4813426

  6. Obtaining of barium sulfate from solution formed after desulfation of the active mass of scrap lead-acid batteries

    Directory of Open Access Journals (Sweden)

    O. A. Kalko


    Full Text Available Analyses of literature data about processes for solution utilization formed after desulfation of the active mass of scrap lead-acid batteries is performed. Optimal conditions for obtaining of barium sulfate sediment from ammonium sulfate solute and chemically pure Ba(OH2×8H2O и BaCl2×2H2O were found experimentally. In laboratory the commercial barium sulfate from sulfate solutions, that are waste of recycling process of battery scrap, with application of chloride and barium hydroxide was production. The possibility of using this product were discussed.

  7. Multicomponent doped barium strontium titanate thin films for tunable microwave applications (United States)

    Alema, Fikadu Legesse

    In recent years there has been enormous progress in the development of barium strontium titanate (BST) films for tunable microwave applications. However, the properties of BST films still remain inferior compared to bulk materials, limiting their use for microwave technology. Understanding the film/substrate mismatch, microstructure, and stoichiometry of BST films and finding the necessary remedies are vital. In this work, BST films were deposited via radio frequency magnetron sputtering method and characterized both analytically and electrically with the aim of optimizing their properties. The stoichiometry, crystal structure, and phase purity of the films were studied by varying the oxygen partial pressure (OPP) and total gas pressure (TGP) in the chamber. A better stoichiometric match between film and target was achieved when the TGP is high (> 30 mTorr). However, the O2/Ar ratio should be adjusted as exceeding a threshold of 2 mTorr in OPP facilitates the formation of secondary phases. The growth of crystalline film on platinized substrates was achieved only with a lower temperature grown buffer layer, which acts as a seed layer by crystallizing when the temperature increases. Concurrent Mg/Nb doping has significantly improved the properties of BST thin films. The doped film has shown an average tunability of 53%, which is only ˜8 % lower than the value for the undoped film. This drop is associated with the Mg ions whose detrimental effects are partially compensated by Nb ions. Conversely, the doping has reduced the dielectric loss by ˜40 % leading to a higher figure of merit. Moreover, the two dopants ensure a charge neutrality condition which resulted in significant leakage current reduction. The presence of large amounts of empty shallow traps related to Nb Ti localize the free carriers injected from the contacts; thus increase the device control voltage substantially (>10 V). A combinatorial thin film synthesis method based on co-sputtering of two BST

  8. Paclitaxel-Fe3O4 nanoparticles inhibit growth of CD138–  CD34– tumor stem-like cells in multiple myeloma-bearing mice

    Directory of Open Access Journals (Sweden)

    Yang C


    Full Text Available Cuiping Yang,1,3,* Jing Wang,2,* Dengyu Chen,1,* Junsong Chen,1 Fei Xiong,4 Hongyi Zhang,1 Yunxia Zhang,2 Ning Gu,4 Jun Dou11Department of Pathogenic Biology and Immunology, Medical School, 2Department of Gynecology and Obstetrics, Zhongda Hospital, Southeast University, Nanjing, 3Department of Pathogenic Biology and Immunology, School of Basic Medicine, Jiangxi University of Traditional Chinese Medicine, Nanchang, 4School of Biological Science and Medical Engineering, Southeast University, Nanjing, People’s Republic of China*These authors contributed equally to this workBackground: There is growing evidence that CD138– CD34– cells may actually be tumor stem cells responsible for initiation and relapse of multiple myeloma. However, effective drugs targeted at CD138– CD34– tumor stem cells are yet to be developed. The purpose of this study was to investigate the inhibitory effect of paclitaxel-loaded Fe3O4 nanoparticles (PTX-NPs on CD138– CD34– tumor stem cells in multiple myeloma-bearing mice.Methods: CD138– CD34– cells were isolated from a human U266 multiple myeloma cell line using an immune magnetic bead sorting method and then subcutaneously injected into mice with nonobese diabetic/severe combined immunodeficiency to develop a multiple myeloma-bearing mouse model. The mice were treated with Fe3O4 nanoparticles 2 mg/kg, paclitaxel 4.8 mg/kg, and PTX-NPs 0.64 mg/kg for 2 weeks. Tumor growth, pathological changes, serum and urinary interleukin-6 levels, and molecular expression of caspase-3, caspase-8, and caspase-9 were evaluated.Results: CD138– CD34– cells were found to have tumor stem cell characteristics. All the mice developed tumors in 40 days after injection of 1 × 106 CD138– CD34– tumor stem cells. Tumor growth in mice treated with PTX-NPs was significantly inhibited compared with the controls (P <  0.005, and the groups that received nanoparticles alone (P < 0.005 or paclitaxel alone (P < 0.05. In addition

  9. Revaluation on detection of metastatic cancer of the colorectum with barium enema. Comparison with computed tomography and colonoscopy

    International Nuclear Information System (INIS)

    Watari, Jiro; Mizukami, Yusuke; Tanabe, Hirotaka


    The findings with barium enema were analyzed and compared to those with computed tomography and colonoscopy in 15 patients with metastatic cancer of the colorectum, which were from 8 gastric, 2 colonic, 2 ovarian, 1 pancreatic, 1 prostatic carcinomas and 1 unknown origin. Primary cancers of intra-abdominal cavity origin tended to make multiple colorectal metastases (91.7%). With barium enema colonic and rectal involvement was mostly expressed as the tethered type and the diffuse type by Ishikawa's classification, respectively. Computed tomography detected direct tumor invasion to the colorectum in 4 cases. Of the other 11 cases, 8 patients (72.3%) showed abnormally thickened colorectal wall. Colonoscopy detected only 3 (37.5%) out of 8 lesions seen in 4 patients who had undergone colonoscopy before barium enema. Many of the lesions missed were the tethered type involvement. Barium enema is the most sensitive method to detect metastatic cancer of the colorectum. (author)

  10. Method of selective dissolution for characterization of particulate forms of radium and barium in natural and waste waters

    International Nuclear Information System (INIS)

    Benes, P.; Sedlacek, J.; Sebesta, F.; Sandrik, R.


    A new method is proposed for characterization of particulate forms of radium and barium in natural and waste waters. Particulate solids suspended in 1-3 l. of water are first concentrated by membrane filtration or by centrifugation to 20-50 ml of a concentrate which is then filtered through a small-size membrane filter. The solids retained by the filter are successively washed with three selective solvents releasing ''loosely bound'', ''acid soluble'' and ''barium sulfate'' forms of radium and barium. Compositions and volumes of the selective solvents have been chosen using model experiments and partially checked by analysis of natural samples. Radium and barium ''in crystalline detritus'' remain on the filter and are determined after an acid digestion of the filter. The principal criteria and selectivity of the method are discussed. (author)

  11. Genome-Wide Analysis of CCA1-Like Proteins in Soybean and Functional Characterization of GmMYB138a

    Directory of Open Access Journals (Sweden)

    Shaomin Bian


    Full Text Available Plant CIRCADIAN CLOCK ASSOCIATED1 (CCA1-like proteins are a class of single-repeat MYELOBLASTOSIS ONCOGENE (MYB transcription factors generally featured by a highly conserved motif SHAQK(Y/FF, which play important roles in multiple biological processes. Soybean is an important grain legume for seed protein and edible vegetable oil. However, essential understandings regarding CCA1-like proteins are very limited in soybean. In this study, 54 CCA1-like proteins were identified by data mining of soybean genome. Phylogenetic analysis indicated that soybean CCA1-like subfamily showed evolutionary conservation and diversification. These CCA1-like genes displayed tissue-specific expression patterns, and analysis of genomic organization and evolution revealed 23 duplicated gene pairs. Among them, GmMYB138a was chosen for further investigation. Our protein–protein interaction studies revealed that GmMYB138a, but not its alternatively spliced isoform, interacts with a 14-3-3 protein (GmSGF14l. Although GmMYB138a was predominately localized in nucleus, the resulting complex of GmMYB138a and GmSGF14l was almost evenly distributed in nucleus and cytoplasm, supporting that 14-3-3s interact with their clients to alter their subcellular localization. Additionally, qPCR analysis suggested that GmMYB138a and GmSGF14l synergistically or antagonistically respond to drought, cold and salt stresses. Our findings will contribute to future research in regard to functions of soybean CCA1-like subfamily, especially regulatory mechanisms of GmMYB138a in response to abiotic stresses.

  12. [Comparison of iodinated and barium-containing contrast media of different viscosity in the detection of pharyngeal perforation]. (United States)

    Keberle, M; Wittenberg, G; Trusen, A; Baumgartner, W; Hahn, D


    In contrast to esophageal perforations, the more radiopaque barium-suspensions are not as important as iodinated aqueous contrast agents for the detection of pharyngeal perforations. This study was performed to find out whether the highly different viscosities (of iodinated and barium-containing contrast agents with comparable radiopacities) are a reason for this. Viscosity, subjective difference in contrast, and CT-density of an iodinated aqueous (Telebrix) and a 50 wt/vol% barium-containing contrast agent (Micropaque) were determined. Moreover, to exclude postoperative perforation, 104 patients were prospectively examined by pharyngography using both contrast media. Pharyngographies of patients with perforation were later compared by two independent readers. All patients with perforation were followed up clinically to exclude complications due to barium administration. In-vitro comparison showed comparable radiopacity but the 50 wt/vol% barium-suspension was much more viscous than the iodinated contrast agent. During pharyngography, totally, 14 perforations were clearly delineated with the iodinated aqueous contrast agent. However, two of them were not detected with the barium-suspension. All the other perforations presented equally. Given a sufficient radiopacity, a low viscosity appears to be essential for a contrast agent to detect especially pharyngeal perforations. Thus, we recommend the sole use of an iodinated contrast agent (at suspicion of aspiration as isoosmolar variant) for this purpose.

  13. Follow-up barium study after a negative water-soluble contrast examination for suspected esophageal leak: is it necessary? (United States)

    Sanchez, Thomas R; Holz, Grant S; Corwin, Michael T; Wood, Robert J; Wootton-Gorges, Sandra L


    The purpose of this study was to determine the value of follow-up barium esophogram in diagnosing esophageal injury or leak if the initial water-soluble contrast examination of the esophagus is normal. An institutional review board (IRB)-approved retrospective review of all pediatric patients less than 18 years old referred to the radiology department for evaluation of esophageal injury or leak was performed for a 9-year period from 2005 to 2014. The majority of patients had unexplained pneumomediastinum, chest trauma (gunshot or puncture wound), or foreign body ingestion as the reason for the referral. Forty-nine patients (age range 10 days to 17 years) underwent an initial water-soluble esophogram immediately followed by a barium esophogram. Forty-six studies were negative on both water-soluble contrast and barium studies. Two studies were both positive on the initial water-soluble contrast and subsequent barium studies. A single study showed the esophageal leak only in the water-soluble study, with the follow-up barium exam being normal. The result of this study indicates that a single-contrast water-soluble esophogram alone is sensitive in the diagnosis of esophageal injury or leak. It has a 100 % sensitivity and negative predictive value. A follow-up barium esophogram only increases the study time and radiation dose to the patient.

  14. Enhanced constitutive invasion activity in human nontumorigenic keratinocytes exposed to a low level of barium for a long time. (United States)

    Thang, Nguyen D; Yajima, Ichiro; Ohnuma, Shoko; Ohgami, Nobutaka; Kumasaka, Mayuko Y; Ichihara, Gaku; Kato, Masashi


    We have recently demonstrated that exposure to barium for a short time (≤4 days) and at a low level (5 µM = 687 µg/L) promotes invasion of human nontumorigenic HaCaT cells, which have characteristics similar to those of normal keratinocytes, suggesting that exposure to barium for a short time enhances malignant characteristics. Here we examined the effect of exposure to low level of barium for a long time, a condition mimicking the exposure to barium through well water, on malignant characteristics of HaCaT keratinocytes. Constitutive invasion activity, focal adhesion kinase (FAK) protein expression and activity, and matrix metalloproteinase 14 (MMP14) protein expression in primary cultured normal human epidermal keratinocytes, HaCaT keratinocytes, and HSC5 and A431 human squamous cell carcinoma cells were augmented following an increase in malignancy grade of the cells. Constitutive invasion activity, FAK phosphorylation, and MMP14 expression levels of HaCaT keratinocytes after treatment with 5 µM barium for 4 months were significantly higher than those of control untreated HaCaT keratinocytes. Taken together, our results suggest that exposure to a low level of barium for a long time enhances constitutive malignant characteristics of HaCaT keratinocytes via regulatory molecules (FAK and MMP14) for invasion. © 2013 Wiley Periodicals, Inc.

  15. Effects of barium chloride treatment of uranium mill tailings and ore on radon emanation and 226Ra levels. Progress report

    International Nuclear Information System (INIS)

    Ibrahim, S.A.; Flot, S.L.


    The purpose of this study was to investigate the effect of barium chloride treatments on: reduction of 222 Rn emanation from mill wastes; reduction of 226 Ra levels in wastewater; and decreased leachability of 226 Ra from mill wastes. Baseline 226 Ra concentrations were determined for ore and tailings as well as radon emanation fractions. Uranium ore was treated with soluble barium at concentrations of 10, 25, 50, and 100 mg per litre of slurry. The leach-liquor declined in 226 Ra concentration by as much as 50%. When soluble potassium as well as barium was used in the treatment process at equal concentrations of 10, 25, 50, and 100 mg per litre of slurry, a similar reduction was observed. No significant difference was noted between the two treatment regimes. An accelerated leaching experiment was performed on the ore treated with barium chloride. All treatment groups except that treated with 10 mg of soluble barium per litre of slurry showed significant decreases in leachability. Available 222 Rn (corresponds with radon emanation fraction) was measured in treated and untreated ore. Ore treated with concentrations of Ba ++ up to 1.00 mg per gram of ore did not show a statistically significant reduction in available 222 Rn, however when potassium sulfate was also added, a significant decline was noted. This study suggests that barium chloride treatments reduce radon emanation from mill wastes and reduce 226 Ra levels in wastewater. Leachability of 226 Ra from treated samples decreased markedly. 19 references, 8 figures, 7 tables

  16. Intra-individual comparison of patient acceptability of multidetector-row CT colonography and double-contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, S.A. [Department of Intestinal Imaging, St Mark' s and Northwick Park Hospitals, London (United Kingdom)]. E-mail:; Halligan, S. [Department of Intestinal Imaging, St Mark' s and Northwick Park Hospitals, London (United Kingdom); Burling, D. [Department of Intestinal Imaging, St Mark' s and Northwick Park Hospitals, London (United Kingdom); Bassett, P. [Department of Intestinal Imaging, St Mark' s and Northwick Park Hospitals, London (United Kingdom); Bartram, C.I. [Department of Intestinal Imaging, St Mark' s and Northwick Park Hospitals, London (United Kingdom)


    AIMS: To compare the subjective acceptability of CT colonography in comparison with barium enema in older symptomatic patients, and to ascertain preferences for future colonic investigation. MATERIALS AND METHODS: The study population comprised 78 persons aged 60 years or over with symptoms suggestive of colorectal neoplasia, who underwent CT colonography followed the same day by barium enema. A 25-point questionnaire was administered after each procedure and an additional follow-up questionnaire a week later. Responses were compared using Wilcoxon matched pairs testing, Mann-Whitney test statistics and binomial exact testing. RESULTS: Participants suffered less physical discomfort during CT colonography (p=0.03) and overall satisfaction was greater compared with barium enema (p=0.03). On follow-up, respondents reported significantly better tolerance of CT colonography (p=0.002), and were less prepared to undergo barium enema again (p<0.001). Of 52 subjects expressing an opinion, all preferred CT to barium enema. CONCLUSION: Patient satisfaction was higher with CT colonography than barium enema. CT colonography caused significantly less physical discomfort and was overwhelmingly preferred by patients.

  17. Sensibility analysis of the effect of various key parameters on fission product concentration (Mass Number 133 to 138)

    International Nuclear Information System (INIS)

    Sola, A.


    An analytical sensitivity analysis has been made of the effect of various parameters on the evaluation of fission product concentration. Such parameters include cross-sections, decay constants, branching ratios, fission yields, flux and time. The formulae are applied to isotopes of the iodine, xenon, caesium and barium series. The agreement between analytically obtained data and that derived from a computer-evaluated model is good, suggesting that the analytical representation includes all the important parameters useful to the evaluation of the fission product concentrations

  18. Removal of hexavalent chromium from aqueous solution by barium ion cross-linked alginate beads

    Directory of Open Access Journals (Sweden)

    Uzaşçı Sesil


    Full Text Available Barium ion cross-linked alginate beads have shown great affinity to toxic hexavalent chromium ions in aqueous solution, contrary to the traditional calcium alginate beads. The adsorption experiments were carried out by the batch contact method. The optimal pH for removal was found to be pH 4. The equilibrium was established in 4 h and the removal efficiency of chromium (VI was found as 95%. The adsorption data fit well with Langmuir and Freundlich isotherms. The maximum chromium (VI adsorption capacity determined from Langmuir isotherm was 36.5 mg/g dry alginate beads. Our study suggests that barium alginate beads can be used as cost-effective and efficient adsorbents for the removal of chromium (VI from contaminated waters.

  19. History and Evolution of the Barium Swallow for Evaluation of the Pharynx and Esophagus. (United States)

    Levine, Marc S; Rubesin, Stephen E


    This article reviews the history of the barium swallow from its early role in radiology to its current status as an important diagnostic test in modern radiology practice. Though a variety of diagnostic procedures can be performed to evaluate patients with dysphagia or other pharyngeal or esophageal symptoms, the barium study has evolved into a readily available, non-invasive, and cost-effective technique that can facilitate the selection of additional diagnostic tests and guide decisions about medical, endoscopic, or surgical management. This article focuses on the evolution of fluoroscopic equipment, radiography, and contrast media for evaluating the pharynx and esophagus, the importance of understanding pharyngoesophageal relationships, and major advances that have occurred in the radiologic diagnosis of select esophageal diseases, including gastroesophageal reflux disease, infectious esophagitis, eosinophilic esophagitis, esophageal carcinoma, and esophageal motility disorders.

  20. Effects of barium sulfate as a contrast medium to enterocutaneous fistulas

    International Nuclear Information System (INIS)

    Pelster, F.W.; Reichelt, S.; Arndt, M.; Eising, E.G.


    Fistulation following thoracic and epigastric interventions are conservatively treated, as a rule, because of the high rate of complications expected from reoperation. With properly functioning anastomotic transit, insufficiencies usually undergo spontaneous healing, within four to six weeks. Enterocutaneous fistulae developed in 29 of 271 patients with intrathoracic oesophagastric or oesophagojejunal anastomosis. Syringeal ramification into pleural or abdominal cavities were eliminated by means of an absorbable contrast medium, before barium sulphate was orally administered to all patients. Thoracic fistulae were closed after 21.8 days on average, while 20.3 days was the average period required for closure of epigastric fistulae. Barium sulphate was found to stimulate fistular tissue granulation, so that obliteration of the fistular system occurred much sooner, as compared to conservative treatment. The patient's quality of life can thus be improved, and hospitalisation can be shortened. Neither locally delimited nor systemic complications were observed in any of the cases described. (author)

  1. Characterization of the third-order optical nonlinearity spectrum of barium borate glasses (United States)

    Santos, S. N. C.; Almeida, J. M. P.; Paula, K. T.; Tomazio, N. B.; Mastelaro, V. R.; Mendonça, C. R.


    Borate glasses have proven to be an important material for applications ranging from radiation dosimetry to nonlinear optics. In particular, B2O3-BaO based glasses are attractive to frequency generation since their barium metaborate phase (β-BaB2O4 or β-BBO) may be crystallized under proper heat treatment. Despite the vast literature covering their linear and second-order optical nonlinear properties, their third-order nonlinearities remain overlooked. This paper thus reports a study on the nonlinear refraction (n2) of BBO and BBS-DyEu glasses through femtosecond Z-scan technique. The results were modeled using the BGO approach, which showed that oxygen ions are playing a role in the nonlinear optical properties of the glasses studied here. In addition, the barium borate glasses containing rare-earths ions were found to exhibit larger nonlinearities, which is in agreement with previous studies.

  2. Mapping of strain mechanisms in barium titanate by three-dimensional X-ray diffraction

    DEFF Research Database (Denmark)

    Majkut, Marta

    This thesis presents an in-situ three-dimensional study of the grain-scale response of a prototypical piezoelectric ceramic, barium titanate (BT), to an exernally applied electric field. Piezoceramics take advantage of the coupling of electrical and mechanical energies for use in sensors and actu......This thesis presents an in-situ three-dimensional study of the grain-scale response of a prototypical piezoelectric ceramic, barium titanate (BT), to an exernally applied electric field. Piezoceramics take advantage of the coupling of electrical and mechanical energies for use in sensors...... to study the material at the grain scale. First, we use the intensity ratios of split diffraction peaks to extract grain-scale domain volume fractions for 139 grains. We find that even in the as-processed state there exist unequal volume fractions of each domain type, which we attribute to a heterogeneous...

  3. Depletion of barium and radium-226 in Black Sea surface waters over the past thirty years

    International Nuclear Information System (INIS)

    Kenison Falkner, K.K.; Edmond, J.M.; O'Neill, D.J.; Todd, J.F.; Moore, W.S.


    The nearly landlocked waters of the Black Sea support a valuable fishery, but are also particularly vulnerable to anthropogenic disturbance. Here we use dissolved barium and radium-226 as tracers, to investigate the biogeochemical health of the sea. Both elements are brought to surface waters by vertical mixing of deeper, enriched waters, and by rivers; these inputs should ordinarily be balanced by outflow of surface waters at the Bosphorus, and by biologically mediated removal of 226 Ra-bearing barite. We show, however, that surface-water inventories have been substantially depleted over the past few decades: recent (1988-89) barium concentrations were 1.6 times lower than in 1958 and 1967. These observations suggest that steady-state cycling of these elements has been perturbed by increased primary productivity, presumably fuelled by nutrients from industry and agricultural runoff, and to a lesser extent by decreased fluvial sediment loads owing to extensive impoundment of rivers in the region. (author)

  4. The Static and Molecular Structure of Barium Dibromide: A Theoretical Study

    International Nuclear Information System (INIS)

    Guerbuez, H.


    The geometry of barium dibromide was first determined by electron diffraction by Akishin and Spiridov. That study concluded that the molecule is linear, but recent modern electron diffraction and quantum chemical studies of BaBr 2 indicated that its equilibrium geometry is bent. The geometrical parameters, namely, bond lengths and bond angles of barium dibromide were calculated from different levels of computation and experimentally. In this work we have calculated the molecular structure of the BaCl 2 using the Interionic Force model. On the other hand, we have calculated the interionic potentials with two different rigid ion model potentials (RIM) which one is the Vashista-Rahman (VR) semi-empirical potential and second one is the RIM potential with parametrization of Tatlipinar. These two model potential are compared with each other by reproducing the experimental static structure. The structure calculations have been performed by solving numerically the hypernetted chain approximate of liquids

  5. Self-assembly of a tetrahedral 58-nuclear barium vanadium oxide cluster. (United States)

    Kastner, Katharina; Puscher, Bianka; Streb, Carsten


    We report the synthesis and characterization of a molecular barium vanadium oxide cluster featuring high nuclearity and high symmetry. The tetrameric, 2.3 nm cluster H(5)[Ba(10)(NMP)(14)(H(2)O)(8)[V(12)O(33)](4)Br] is based on a bromide-centred, octahedral barium scaffold which is capped by four previously unknown [V(12)O(33)](6-) clusters in a tetrahedral fashion. The compound represents the largest polyoxovanadate-based heterometallic cluster known to date. The cluster is formed in organic solution and it is suggested that the bulky N-methyl-2-pyrrolidone (NMP) solvent ligands allow the isolation of this giant molecule and prevent further condensation to a solid-state metal oxide. The cluster is fully characterized using single-crystal XRD, elemental analysis, ESI mass spectrometry and other spectroscopic techniques.

  6. Ammonia synthesis with barium-promoted iron–cobalt alloys supported on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus


    Iron–cobalt alloys supported on carbon were investigated as ammonia synthesis catalysts. Barium was found to have a promoting effect for Fe with an optimum atomic ratio Ba/Fe of 0.35. At this Ba loading, a local maximum for the NH3 synthesis activity was found at 4 wt% Co by varying the Fe/Co ratio....... Samples containing only Co and no Fe, however, yielded by far the most active catalysts (7.0 μmol (NH3) g−1 s−1, 673 K, 10 bar). Barium was a very efficient promoter for Co, increasing the NH3 synthesis activity by more than two orders of magnitude compared to the unpromoted Co samples, while...

  7. Fabrication and Characterization of Carbonized Rice Husk/Barium Titanate Nanocomposites (United States)

    Melvin, G. J. H.; Wang, Z.; Ni, Q.-Q.; Siambun, N. J.; Rahman, M. M.


    Carbon materials were prepared by carbonizing rice husk (RHs) at 2500°C. Few- and multi-layer graphene were obtained from this carbonization process. Barium titanate (BTO) nanoparticles were fabricated by using sol-gel method. Then, the BTO nanoparticles were grafted onto the surface of carbonized rice husk (CRH) to fabricate CRH/BTO nanocomposites. The nanocomposites were characterized using scanning transmission electron microscopy (STEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), Raman measurement, and X-ray photoelectron spectroscopy (XPS). Based on the broadening of (1 1 0) peak from XRD result, the average crystalline size of BTO nanoparticles were calculated to be 16.5 nm. Coexistence of cubic and tetragonal phase of BTO nanoparticles is expected, based on the XRD and Raman results. From XPS result, carbon, barium, titanium, and oxygen peaks were also observed. The combination of CRH with BTO can integrate the properties of these two components to form nanocomposites for broad applications.

  8. Microwave assisted synthesis and characterization of barium titanate nanoparticles for multi layered ceramic capacitor applications. (United States)

    Thirumalai, Sundararajan; Shanmugavel, Balasivanandha Prabu


    Barium titanate is a common ferroelectric electro-ceramic material having high dielectric constant, with photorefractive effect and piezoelectric properties. In this research work, nano-scale barium titanate powders were synthesized by microwave assisted mechano-chemical route. Suitable precursors were ball milled for 20 hours. TGA studies were performed to study the thermal stability of the powders. The powders were characterized by XRD, SEM and EDX Analysis. Microwave and Conventional heating were performed at 1000 degrees C. The overall heating schedule was reduced by 8 hours in microwave heating thereby reducing the energy and time requirement. The nano-scale, impurity-free and defect-free microstructure was clearly evident from the SEM micrograph and EDX patterns. LCR meter was used to measure the dielectric constant and dielectric loss values at various frequencies. Microwave heated powders showed superior dielectric constant value with low dielectric loss which is highly essential for the fabrication of Multi Layered Ceramic Capacitors.

  9. High-sensitivity accelerometer composed of ultra-long vertically aligned barium titanate nanowire arrays. (United States)

    Koka, Aneesh; Sodano, Henry A


    A configuration that shows great promise in sensing applications is vertically aligned piezoelectric nanowire arrays that allow facile interfacing with electrical interconnects. Nano-electromechanical systems developed using piezoelectric nanowires have gained interest primarily for their potential in energy harvesting applications, because they are able to convert several different sources of mechanical energy into useful electrical power. To date, no results have demonstrated the capability to use aligned piezoelectric nanowire arrays as a highly accurate nano-electromechanical system based dynamic sensor with a wide operating bandwidth and unity coherence. Here we report the growth of vertically aligned (~45 μm long) barium titanate nanowire arrays, realized through a two-step hydrothermal synthesis approach, and demonstrate their use as an accurate accelerometer. High sensitivity of up to 50 mV g(-1) is observed from the sensor composed of vertically aligned barium titanate nanowire arrays, thus providing performance comparable to many of the commercial accelerometer systems.

  10. Barium titanate thin films deposited by electrophoresis on p-Doped Si (001) substrates. (United States)

    Barbosa, J G; Pereira, M R; Moura, C; Mendes, J A; Almeida, B G


    Barium titanate (BaTiO3) thin films have been prepared by electrophoretic deposition on p-doped and platinum covered silicon (Si) substrates. Their structure, nanostructure and dielectric properties were characterized. The as-deposited films were polycrystalline and composed by barium titanate nanograins with an average grain size approximately 9 nm. Annealing at high temperatures promoted grain growth, so that the samples annealed at 600 degrees C presented average grain sizes approximately 24 nm. From Raman spectroscopy measurements it was found that the tetragonal (ferroelectric) BaTiO3 phase was stabilized on the films. Also, at higher annealing temperatures, cation disorder was reduced on the films. From measurements of the temperature dependence of the dielectric permittivity the corresponding paraelectric-ferroelectric phase transition was determined. The observed transition temperature (approximately 100 degrees C) was found to be below the BaTiO3 bulk or thick film values, due to the small nanosized grains composing the films.

  11. Preparation of stable dispersion of barium titanate nanoparticles: Potential applications in biomedicine. (United States)

    Ciofani, G; Danti, S; Moscato, S; Albertazzi, L; D'Alessandro, D; Dinucci, D; Chiellini, F; Petrini, M; Menciassi, A


    Nanoscale structures and materials have been explored in many biological applications because of their extraordinary novel properties. Here we propose a study of cellular interactions with barium titanate nanoparticles, an interesting ceramic material that has received a lot of interest in the nanotechnology research, but without any attention about its biological potential. We introduced for the first time an efficient method for the preparation of stable aqueous dispersions of barium titanate nanoparticles, characterized with FIB, TEM and AFM imaging, light scattering, Z-potential and UV/vis analysis. Finally, we presented a systematic study of short-term cytotoxicity of the prepared dispersion based both on quantitative (metabolism, proliferation) and qualitative (apoptosis, viability, differentiation) assays. Copyright (c) 2009 Elsevier B.V. All rights reserved.

  12. Formation of nanocrystalline barium titanate in benzyl alcohol at room temperature. (United States)

    Veldhuis, Sjoerd A; Vijselaar, Wouter J C; Stawski, Tomasz M; ten Elshof, Johan E


    Nanocrystalline barium titanate (8-10 nm crystallite size) was prepared at temperatures of 23-78 °C through reaction of a modified titanium alkoxide precursor in benzyl alcohol with barium hydroxide octahydrate. The room temperature formation of a perovskite phase from solution is associated with the use of benzyl alcohol as solvent medium. The formation mechanism was elucidated by studying the stability and interaction of each precursor with the solvent and with each other using various experimental characterization techniques. Density functional theory (DFT) computational models which agreed well with our experimental data could explain the formation of the solid phase. The stability of the Ti precursor was enhanced by steric hindrance exerted by phenylmethoxy ligands that originated from the benzyl alcohol solvent. Electron microscopy and X-ray diffraction indicated that the crystallite sizes were independent of the reaction temperature. Crystal growth was inhibited by the stabilizing phenylmethoxy groups present on the surface of the crystallites.

  13. Surface-initiated polymerization from barium titanate nanoparticles for hybrid dielectric capacitors. (United States)

    Paniagua, Sergio A; Kim, Yunsang; Henry, Katherine; Kumar, Ritesh; Perry, Joseph W; Marder, Seth R


    A phosphonic acid is used as a surface initiator for the growth of polystyrene and polymethylmethacrylate (PMMA) from barium titanate (BTO) nanoparticles through atom transfer radical polymerization with activators regenerated by electron transfer. This results in the barium titanate cores embedded in the grafted polymer. The one-component system, PMMA-grafted-BTO, achieves a maximum extractable energy density of 2 J/cm(3) at a field strength of ∼220 V/μm, which exhibits a 2-fold increase compared to that of the composite without covalent attachment or the neat polymer. Such materials have potential applications in hybrid capacitors due to the high permittivity of the nanoparticles and the high breakdown strength, mechanical flexibility, and ease of processability due to the organic polymer. The synthesis, processing, characterization, and testing of the materials in capacitors are discussed.

  14. Characterization of individual barium titanate nanorods and their assessment as building blocks of new circuit architectures. (United States)

    Zagar, Kristina; Hernandez-Ramirez, Francisco; Prades, Joan Daniel; Morante, Joan Ramon; Rečnik, Aleksander; Ceh, Miran


    In this work, we report on the integration of individual BaTiO(3) nanorods into simple circuit architectures. Polycrystalline BaTiO(3) nanorods were synthesized by electrophoretic deposition (EPD) of barium titanate sol into aluminium oxide (AAO) templates and subsequent annealing. Transmission electron microscopy (TEM) observations revealed the presence of slabs of hexagonal polymorphs intergrown within cubic grains, resulting from the local reducing atmosphere during the thermal treatment. Electrical measurements performed on individual BaTiO(3) nanorods revealed resistivity values between 10 and 100 Ω cm, which is in good agreement with typical values reported in the past for oxygen-deficient barium titanate films. Consequently the presence of oxygen vacancies in their structure was indirectly validated. Some of these nanorods were tested as proof-of-concept humidity sensors. They showed reproducible responses towards different moisture concentrations, demonstrating that individual BaTiO(3) nanorods may be integrated in complex circuit architectures with functional capacities.

  15. Impedance spectroscopy and dielectric studies of nanocrystalline iron doped barium strontium titanate ceramics

    Directory of Open Access Journals (Sweden)

    Reenu Jacob


    Full Text Available Barium titanate compounds have great research attention due to their good electric and in some case interesting magnetic properties. The synthesis and characterization of iron doped barium strontium titanate (BSFTO make an attempt to understand its structure and investigate electric/dielectric properties. The formation of a perovskite compound with tetragonal phase was confirmed through X-ray structural studies. Dielectric and electrical impedance properties of the sintered BSFTO ceramics were measured in the frequency range from 42 Hz to 2 MHz and at different temperatures (up to 600 °C. It was shown that the properties of this material are highly dependent on temperature and frequency. The nature of frequency dependence of AC conductivity confirms the Jonscher’s power law. The temperature dependence of DC conductivity obeys the Arrhenius behaviour.

  16. Structure and Dynamics of Water on Aqueous Barium Ion and the {001} Barite Surface

    International Nuclear Information System (INIS)

    Stack, Andrew G.; Rustad, James R.


    The structure of water and its dynamics affect a number of fundamental properties of an interface. Yet, these properties are often inaccessible experimentally and computational studies including solvent are comparatively few. Here, we estimate the structure and kinetics of water exchange of aqueous barium ions and barium ions within the {001} barite surface using molecular dynamics and the reactive flux method. For the aqueous ion, the Ba-O distance to water in the first hydration shell was found to be 280 pm with a coordination number of 8.3, and the best estimate of the exchange rate constant is 4.8 x 10 9 s -1 , closely matching experimental estimates. For the barite surface, the first shell water distance was 282 pm, with a coordination number of 0.9 and the best estimate of the rate constant for exchange is 1.7 x 10 10 s -1 , 3.5 times faster than that of the aqueous ion.

  17. Liver Abscess and Portal Vein Thrombosis Due to Ileal Diverticulitis Mediated by Barium Fluoroscopy. (United States)

    Kubo, Haremaru; Asai, Genki; Haraguchi, Kou; Shibahara, Yu; Kihara, Toshihiro; Yamakawa, Genta; Kira, Fumitaka; Higashi, Hisato; Morishita, Shinji; Fujie, Hajime; Matsumoto, Masao; Shimura, Wahei


    We report a case of liver abscess and portal vein thrombosis, which occurred due to diverticulitis at the terminal ileum in a 59-year-old man. The patient underwent a barium fluoroscopic examination 1 month before presenting to our hospital. He also showed liver dysfunction due to thrombosis at the superior mesenteric and portal veins. His inflammation gradually subsided after the initiation of treatment, but the recovery was not sufficient. Thus, surgery was performed. The patient condition improved after surgery and he was discharged. Barium examinations are relatively safe, but can sometimes cause severe adverse effects in patients with certain risk factors, and an appropriate diagnosis and treatment are necessary when symptoms appear.

  18. Quasi-epitaxial barium hexaferrite thin films prepared by a topotactic reactive diffusion process (United States)

    Meng, Siqin; Yue, Zhenxing; Zhang, Xiaozhi; Li, Longtu


    Quasi-epitaxial barium hexaferrite thin films (BaM) with crystallographic c-axis parallel to film normal were prepared through a topotactic reactive diffusion process using two-step solution deposition on c-plane sapphire. The two-step spin coating process involves preparing an epitaxial hematite film, coating the film with barium precursor solution and thermal annealing. The crystal orientation and magnetic anisotropy of BaM thin films were investigated by X-ray diffraction analysis, SEM observation and magnetic measurements. Hysteresis loops showed good magnetic anisotropy and high remanence ratio (RR) Mr/Ms = 0.97. The films fabricated by two-step spin coating process displayed wider rocking curve width but better magnetic anisotropy than one-step spin coating. The possible mechanism of this discrepancy is discussed in this paper.

  19. Quasi-epitaxial barium hexaferrite thin films prepared by a topotactic reactive diffusion process

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Siqin; Yue, Zhenxing, E-mail:; Zhang, Xiaozhi; Li, Longtu


    Quasi-epitaxial barium hexaferrite thin films (BaM) with crystallographic c-axis parallel to film normal were prepared through a topotactic reactive diffusion process using two-step solution deposition on c-plane sapphire. The two-step spin coating process involves preparing an epitaxial hematite film, coating the film with barium precursor solution and thermal annealing. The crystal orientation and magnetic anisotropy of BaM thin films were investigated by X-ray diffraction analysis, SEM observation and magnetic measurements. Hysteresis loops showed good magnetic anisotropy and high remanence ratio (RR) Mr/Ms = 0.97. The films fabricated by two-step spin coating process displayed wider rocking curve width but better magnetic anisotropy than one-step spin coating. The possible mechanism of this discrepancy is discussed in this paper.

  20. Analysis of the magnetic properties nanoscale barium hexaferrite (BHF) prepared by milling and ultrasonic method

    International Nuclear Information System (INIS)

    Novizal; Edie, Sasito; Manawan, Mykel T.E.


    Barium hexaferrite (BHF) is well established material which widely used respectively as permanent magnets. In this research, we report our recent investigation on magnetic properties analysis of barium hexaferrite (BHF) compounds with a ratio of Fe/Ba: 11 prepared by a mechanical alloying process and high power ultrasonic destruction to promote the soft magnetic properties. The investigation carried out by Scanning Electron Microscope (SEM) shows the grain size between 500-1500 nm, it indicates that each grain is composed of several crystallites or polycrystalline. By mean of X-ray diff raction revealed the phase composition and the mean crystallite size <70 nm. The Characterization of the magnetic properties of the effects of downsizing the particle size of ∼ 200 nm to ∼ 50 nm by the ultasonik method provide saturation value of 0.35 T, remanent 0.24 T and the coercivity is 115 kA / m. (paper)

  1. Characterization of individual barium titanate nanorods and their assessment as building blocks of new circuit architectures

    International Nuclear Information System (INIS)

    Zagar, Kristina; Recnik, Aleksander; Ceh, Miran; Hernandez-Ramirez, Francisco; Morante, Joan Ramon; Prades, Joan Daniel


    In this work, we report on the integration of individual BaTiO 3 nanorods into simple circuit architectures. Polycrystalline BaTiO 3 nanorods were synthesized by electrophoretic deposition (EPD) of barium titanate sol into aluminium oxide (AAO) templates and subsequent annealing. Transmission electron microscopy (TEM) observations revealed the presence of slabs of hexagonal polymorphs intergrown within cubic grains, resulting from the local reducing atmosphere during the thermal treatment. Electrical measurements performed on individual BaTiO 3 nanorods revealed resistivity values between 10 and 100 Ω cm, which is in good agreement with typical values reported in the past for oxygen-deficient barium titanate films. Consequently the presence of oxygen vacancies in their structure was indirectly validated. Some of these nanorods were tested as proof-of-concept humidity sensors. They showed reproducible responses towards different moisture concentrations, demonstrating that individual BaTiO 3 nanorods may be integrated in complex circuit architectures with functional capacities.

  2. Radiographer and radiologist perception error in reporting double contrast barium enemas: A pilot study

    International Nuclear Information System (INIS)

    Booth, Alison M.; Mannion, Richard A.J.


    Purpose: The practice of radiographers performing double contrast barium enemas (DCBE) is now widespread and in many centres the radiographer's opinion is, at least, contributing to a dual reporting system [Bewell J, Chapman AH. Radiographer performed barium enemas - results of a survey to assess progress. Radiography 1996;2:199-205; Leslie A, Virjee JP. Detection of colorectal carcinoma on double contrast barium enema when double reporting is routinely performed: an audit of current practice. Clin Radiol 2001;57:184-7; Culpan DG, Mitchell AJ, Hughes S, Nutman M, Chapman AH. Double contrast barium enema sensitivity: a comparison of studies by radiographers and radiologists. Clin Radiol 2002;57:604-7]. To ensure this change in practice does not lead to an increase in reporting errors, this study aimed to compare the perception abilities of radiographers with those of radiologists. Methods: Three gastro-intestinal (GI) radiographers and three consultant radiologists independently reported on a selection of 50 DCBE examinations, including the level of certainty in their comments for each examination. A blinded comparison of the results with an independent 'standard report' was recorded. Results: The results demonstrate there was no significant difference in perception error for any of the levels of certainty, for single reporting, for double reading by a radiographer/radiologist or by two radiologists. Conclusions: The study shows that radiographers can perceive abnormalities on DCBE at similar sensitivities and specificities as radiologists. While the participants in the study may be typical of a district general hospital, the nature of the study gives it limited external validity. As a pilot, the results demonstrate that, with slight modification, the methodology could be used for a larger study

  3. Consolidation of weak lime mortars by means of saturated solution of calcium hydroxide or barium hydroxide

    Czech Academy of Sciences Publication Activity Database

    Slížková, Zuzana; Drdácký, Miloš; Viani, Alberto


    Roč. 16, č. 4 (2015), s. 452-460 ISSN 1296-2074 R&D Projects: GA MK(CZ) DF11P01OVV012; GA MŠk(CZ) LO1219 Keywords : lime water * barium water * lime mortar * consolidation * peeling test * mechanical characteristic * physical characteristic * metakaolin Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 1.533, year: 2015

  4. Influence of fuel ratios on auto combustion synthesis of barium ferrite ...

    Indian Academy of Sciences (India)

    Abstract. Single-domain barium ferrite nano particles have been synthesized with narrow particle-size distribution using an auto combustion technique. In this process, citric acid was used as a fuel. Ratios of cation to fuel were maintained variously at 1 : 1, 1 : 2 and 1 : 3. The pH was 7 in all cases. Of all three cases, a cation ...

  5. X-Ray Fluorescence Analysis for Barium, Zinc, Calcium and Phosphorus in Oil Additives. (United States)


    above procedures. This paper describes a technique whereby the sample mixture, consisting of additive, alkyd resin and zirconium octoate, is converted...zirconium octoate in white spirit. ++ Alkyd Resin Mixture : Beckosol (50-003) diluted 11 with white spirit (barium, zinc, calcium and phosphorus free...Calibration Standards The appropriate amount of the above additive, (or Conostan concentrate), was diluted with the alkyd resin so that the concentration of

  6. Randomized clinical trial on the use of antispasmodic drugs in barium enema: impact on radiological practice

    International Nuclear Information System (INIS)

    Goei, Reginald; Kessels, Alphons H.; Nix, Maarten; Knipschild, Paul G.


    Purpose: To assess the willingness of radiologists to change their practice when the results of a randomized clinical trial (RCT) on the use of antispasmodic drugs in barium enema are presented. Materials and Methods: During the years 1994 and 1995 two postal questionnaires were sent to 481 practicing radiologists who were all members of the Netherlands Society of Radiology. In the first questionnaire the respondents were asked to give the characteristics of their practices in performing daily barium enema. The data from this questionnaire was used as a reference. The second questionnaire was sent to the respondents together with an abstract on the randomized clinical trial supporting the use of antispasmodic drugs in barium enema. We also indicated a preference for Buscopan over Glucagon as the antispasmodic drug. The willingness to change prescription habits was measured by comparing the data of the two questionnaires. Results: Of 481 practicing radiologists, 312 responded to the first questionnaire and gave information of their prescription habits (response rate 64%). These 312 responders were sent an abstract of the RCT and were asked to fill out a second questionnaire to determine their willingness to change their practice. Two hundred and sixty-seven radiologists responded (response rate 86%). A significant number of 119 (51%) were willing to increase the use of antispasmodic drugs. A significant number of 128 (55%) chose to increase the use of Buscopan, while a significant number of 81 (32%) were willing to decrease the use of Glucagon. Conclusion: Direct exposure to the results of an RCT recommending the use of antispasmodic drugs in barium enema, especially Buscopan, is likely to increase its use by practicing radiologists

  7. Kinetics of barium sulphate reaction crystallization in crystallizers with internal circulation

    Directory of Open Access Journals (Sweden)

    J. Koralewska


    Full Text Available Kinetic calculation results describing the observed nucleation and growth rates of barium sulphate crystals precipitated in an integrated reaction-crystallization process in a barium sulphate-ammonium chloride-water system are presented and analyzed. The scope of experiments included two continuous model DTM-type crystallizers (Draft Tube Magma with internal circulation of the suspension forced by a liquid jet-pump device responsible for stable and intensive enough ascending/descending flow of BaSO4 crystal magma in a mixing chamber. For comparison purposes the experimental data corresponding to a continuous DT (Draft Tube crystallizer with propeller agitator are presented and discussed. The various types of laboratory crystallizers used were fed with concentrated water solution of barium chloride (of 10 or 24 mass % and - in a stoichiometric proportion - crystalline ammonium sulphate, assuming isothermal (348 K and hydrodynamic (average residence time of suspension in a crystallizer: 900 s process conditions. The observed nucleation and growth rates of barium sulphate crystals were estimated on the basis of crystal size distributions (CSDs using convenient calculation scheme derived for an MSMPR (Mixed Suspension Mixed Product Removal model approach. Considering the experimental population density distribution courses, a size-dependent growth (SDG phenomenon was taken into account in the kinetic calculations. Five SDG kinetic models recommended in the accessible literature were used for kinetic parameter values estimation. It was proved statistically, that Rojkowski’s two SDG models (hyperbolic and exponential best suit for our own experimental data description. The experimental data presented can be practically applied for improving the constructions of liquid jet-pump DTM crystallizers recommended for reaction crystallization of sparingly soluble inorganic salts (especially for high concentrations of reaction substrates in the modern

  8. Doping a mixture of two smectogenic liquid crystals with barium titanate nanoparticles. (United States)

    Lorenz, Alexander; Zimmermann, Natalie; Kumar, Satyendra; Evans, Dean R; Cook, Gary; Fernández Martínez, Manuel; Kitzerow, Heinz-S


    A mixture of two smectic liquid crystals was doped with harvested ferroelectric barium titanate nanoparticles and investigated with wide- and small-angle X-ray scattering during cooling from the isotropic phase. A decrease in the isotropic to nematic and in the nematic to partially bilayer smectic-A(d) (SmA(d)) phase transition temperatures was observed accompanied by an increase of the layer spacing in the SmA(d) phase.

  9. Modelling of conjugate heat transfer in barium titanate plates heated by the air flow (United States)

    Kozyulin, Nikolay; Bobrov, Maxim; Hrebtov, Michael


    We present the results of simulation of conjugate heat transfer between the grid of barium titanate plates and the hot air flow. The air temperature undergoes rapid change and the thermal front propagation and heat exchange with the solid plates have been studied for several plate configurations. The results show that the air heat could be effectively absorbed by the plates during the time of thermal front propagation, making such configuration attractive for pyroelectric energy harvesting applications.

  10. Preliminary experiments on phase conjugation for flow visualization. [barium titanate single crystals (United States)

    Weimer, D.; Howes, W. L.


    Barium titanate single crystals are discussed in the context of: the procedure for polarizing a crystal; a test for phase conjugation; transients in the production of phase conjugation; real time readout by a separate laser of a hologram induced within the crystal, including conjugation response times to on-off switching of each beam; and a demonstration of a Twyman-Green interferometer utilizing phase conjugation.

  11. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO ...

    Indian Academy of Sciences (India)


    the synthesis of BaTiO3 from the mixture of barium car- bonate and titanium dioxide employing microwave heat- ing. They observed that hypostoichiometric TiO2 (TiO2–x) reacted with BaCO3 in the presence of microwave field at temperature as low as 350°C to give the mixture of hexa- gonal and tetragonal forms of BaTiO3 ...

  12. Clinical Diagnosis of Achalasia: How Reliable is the Barium X-Ray?


    El-Takli, I; O’Brien, P; Paterson, WG


    Manometry is considered to be the gold standard for the diagnosis of achalasia. However, many physicians believe that contrast radiography, classically showing esophageal dilation with bird-beak narrowing of the gastroesophageal junction, is also accurate in either diagnosing or excluding the disorder. The aim of the current study was to determine the accuracy of barium x-ray in the diagnosis of achalasia. The radiological diagnosis of all patients manometrically diagnosed with achalasia (usi...

  13. Clinical diagnosis of achalasia: How reliable is the barium x-ray?


    El-Takli, I; O’Brien, P; Paterson, WG


    Manometry is considered to be the gold standard for the diagnosis of achalasia. However, many physicians believe that contrast radiography, classically showing esophageal dilation with bird-beak narrowing of the gastroesophageal junction, is also accurate in either diagnosing or excluding the disorder. The aim of the current study was to determine the accuracy of barium x-ray in the diagnosis of achalasia. The radiological diagnosis of all patients manometrically diagnosed with achalasia (usi...

  14. Influence of fuel ratios on auto combustion synthesis of barium ferrite

    Indian Academy of Sciences (India)

    Abstract. Single-domain barium ferrite nano particles have been synthesized with narrow particle-size distribution using an auto combustion technique. In this process, citric acid was used as a fuel. Ratios of cation to fuel were maintained variously at 1 : 1, 1 : 2 and 1 : 3. The pH was 7 in all cases. Of all three cases, a cation ...

  15. Unidirectional potassium fluxes in renal distal tubule: effects of chloride and barium

    International Nuclear Information System (INIS)

    Ellison, D.H.; Velazquez, H.; Wright, F.S.


    Low luminal concentrations of chloride stimulate net potassium secretion by the renal distal tubule, independent of changes in transepithelial voltage. These effects are not prevented by the luminal application of the potassium channel blocking agent barium. Because net potassium secretion comprises secretory and absorptive components, we sought to evaluate the effects of chloride and barium on unidirectional potassium fluxes in the renal distal tubule. In vivo microperfusion methods were used in anesthetized Sprague-Dawley rats. Perfusion solutions contained either 42 K or 86 Rb as tracers for potassium. Tracer efflux coefficients, indicating apparent potassium permeability, were similar when measured using either isotope. Net potassium flux was determined as the difference between perfusion and collected rate, and unidirectional absorptive potassium flux was calculated as the product of the mean luminal potassium concentration and the tracer efflux coefficient. During perfusion with a solution that resembled fluid normally arriving at the early distal tubule, the absorptive potassium flux was approximately 25% of the unidirectional secretory flux. Reducing lumen chloride concentration increased net potassium secretion, because blood-to-lumen potassium flux increased from 61 +/- 12.7 to 96 +/- 14.6 pmol/min. Barium reduced both absorptive and secretory fluxes but did not prevent the stimulation of net potassium secretion that occurs when luminal chloride concentration is reduced. Apparent potassium permeability during perfusion with a solution that resembled fluid normally arriving at the early distal tubule was 800 nm/s when corrected for voltage

  16. Water-soluble contrast media compared with barium in enteric follow-through

    International Nuclear Information System (INIS)

    Laerum, F.; Stordahl, A.; Aase, S.


    The local effects and radiographic efficacy of 4 water-soluble contrast media, barium and saline were evaluated in 86 anaesthetized rats with the distal ileum ligated. The rats were observed for 8 hours after instillation of 3 ml of the test substance via orogastric tube. Radiographs were taken after 1, 4 and 8 hours of observation. After 8 hours the intestines were weighed and biopsied for light microscopy, and blood and urine were sampled for testing. Sodium diatrizoate caused increased fluid influx to the bowel lumen and, like barium, provided poorer radiographic images as compared with iohexol, ioxaglate or iodixanol. Barium showed slower progression through the small bowel than the other agents, while sodium diatrizoate was the most rapidly progressing contrast medium and caused the greatest distension. Correlation to osmolality was obvious. No significant morphologic effects on the small bowel mucosa were seen in any of the groups. Low-osmolar, water-soluble contrast media may have prospects for clinical use in patients with suspected small bowel obstruction. (orig.)

  17. Sensitivity of single and double contrast barium enema in the detection of colorectal carcinoma

    International Nuclear Information System (INIS)

    Myllylae, V.; Paeivansalo, M.; Laitinen, S.; Oulu Univ.


    The preoperative barium enema of the 188 colorectal carcinoma patients operated at the Oulu University Central Hospital (Finland) during 1977-1982 were examined retrospectively. Altogether 112 single contrast studies and 87 double contrast studies had been made on these patients. The single contrast barium enemas had resulted in a correct diagnosis of colorectal carcinoma in 93 cases (sensitivity 83%). The correct diagnosis in the double contrast studies numbered 71 (sensitivity 82%). Most of the overlooked carcinomas were located in the caecum, in the sigmoid or the rectum. Most of the errors made in the single contrast studies were due to detection errors and poor evacuation. The most common failures in double contrast enemas were detection errors and nonvisualisation of the sigmoid. The authors recommend use of the double contrast technique and suggest that the two methods of barium enema be used to complement each other. A false negative diagnosis delayed the operation of the colorectal carcinoma patients by 2.2 months (median). (orig.) [de

  18. Radium-226 and barium as tracers of water masses in the North Atlantic (GA01-GEOTRACES) (United States)

    Le Roy, Emilie; Sanial, Virginie; Charette, Matthew; Henderson, Paul; Jacquet, Stéphanie; García-Ibáñez, Maribel; Pérez, Fiz; Lherminer, Pascale; Souhaut, Marc; Jeandel, Catherine; Lacan, François; van Beek, Pieter


    In this study, we report concentrations of radium-226 (226Ra, t1/2=1602 y) and barium determined along the GEOVIDE section conducted in the North Atlantic (May-July 2014; Portugal-Greenland-Canda) in the framework of the international GEOTRACES program. A high vertical resolution (up to 22 depths per station) was achieved by analyzing small volumes (˜10 L) of seawater for 226Ra using a radon emanation technique. We will present the distribution of 226Ra activities and barium concentrations in contrasting biogeochemical regions of the North Atlantic (Iberian margin, West European Basin, Reykjanes Ridge, Irminger Sea, Greenland margin and Labrador Sea). These regions strongly differ in terms of boundary inputs, biogeochemistry and deep water formation. We observe a linear correlation between 226Ra and barium along the GEOVIDE section, which results from the dominantly conservative behavior of the two tracers. However, deviations from the linear correlation between 226Ra and Ba are found in several places. The potential causes for such deviations are investigated. Optimum multi-parameter (OMP) analysis was thus used to distinguish the relative importance of physical transport (i.e., water mass mixing) from non-conservative processes (sedimentary, river or hydrothermal inputs; uptake by particles) on the 226Ra and Ba distribution in the North Atlantic.

  19. Routine filtration for decubitus radiography during double contrast barium enema examinations

    International Nuclear Information System (INIS)

    Camellini, V.; Abelli, P.; Marconi, G.


    A wedge-shaped plexiglass compensation filter for use in lateral decubitus radiographs of double contrast barium enema examinations has been designed. This filter, which has been used since February 1985, was compared with a second plexiglass filter, made by E-Z-EM. Voltage and amperage were kept contrast. Two different experiments were conducted in order to demonstrate the benefits of routine use of this compensation filter. First, the changes in skin dose were assessed using an ionization chamber on phantom. Secondly, three radiologists examined a series of 80 consecutive barium enemas without knowing which had been performed using the new filter. Out of the 70 examinations they considered excellent, as many as 45 had been performed with the new filter. Personal experience and the studies described show that the use of a compensation filter improves the accuracy and thus the diagnostic quality of the examinations as it enhances the detail of the anatomic structure of the colon; moreover the filter reduces skin exposure by up to 73.1% (EZ-E-EM filter 47.3%) and, at the same time, less radiographic films are needed. Routine use of a plexiglass compensation filter in lateral decubitus radiographs while performing a double contrast barium enema examination, is strongly recommended especially in obese patients

  20. Factors influencing the detection of abnormalities in barium enemas performed by junior radiologists

    Energy Technology Data Exchange (ETDEWEB)

    Vehmas, T. [Department of Occupational Medicine, Finnish Institute of Occupational Health, Helsinki and Department of Radiology, Helsinki University Central Hospital, Helsinki (Finland)]. E-mail:


    Aim: To study the effects of patient variability, technical examination and radiologist-related factors on the radiological diagnosis of barium enema studies. Materials and Methods: Twenty-one residents (12 women and nine men, age 26-39 years) performed 523 double contrast barium enemas in a university hospital. Diagnoses were classified as normal (n=203), diverticulosis (n=224), polyps (n=25), tumours (n=20) and other (n=46); five were missing diagnoses. Binary and multinomial logistic regressions were used to study the relations between the independent variables and the radiological diagnoses. Results: Patients' advanced age (p<0.001) and obesity (p=0.041) were significant positive predictors for the detection of any abnormalities, as was good or moderate study quality (p=0.023). However, patients' obesity was negatively associated with the detection of polyps (p=0.037). Pathological findings were associated with higher dose-area products (p=0.047) than normal cases. Residents' advanced age (p=0.029) and experience (a high number of previously performed barium enemas; p=0.009) were negative predictors for the detection of pathological findings. Conclusion: Patients' obesity hampers polyp detection, possibly due to decreased image quality or coexisting diverticula. The most experienced and oldest residents missed positive findings, possibly due to insufficient consultation of supervising radiologists, emphasizing the need for their optimal cooperation.