WorldWideScience

Sample records for barium 137 target

  1. Barium

    International Nuclear Information System (INIS)

    Present article is devoted to barium content in fluoride. In order to obtain the comprehensive view on barium distribution in fluorite 303 mono mineral fractions of various geologic deposits and ores of Kazakhstan, Uzbekistan, Tajikistan and some geologic deposits of Russia were analyzed. The barium content in fluorite of geologic deposits of various mineralogical and genetic type was defined. The basic statistical estimation of barium distribution in fluorite were evaluated.

  2. Metabolism of 137cesium, 137barium in the rat. Therapeutics of the contamination

    International Nuclear Information System (INIS)

    The authors carry out research into the distribution kinetics, the metabolism and the excretion of 137Cs - 137Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors)

  3. Barium-137 M milkers based on 12-molybdo cerate column matrix. Vol. 3

    International Nuclear Information System (INIS)

    The interaction of 134 Cs+ and 131,133 Ba2+ radiotracers (10-4 M for each) in HCl, H N O3, Na Cl, Na N O3, and N H4 Cl solutions on 12-Molybdo cerate (IV) has been studied by batch equilibrium at room temperature. The corresponding distribution coefficients (Kd values in mi/g) were determined as a function of the composition of the reaction medium and drying temperature; 50, 150 and 200 degree C of the molybdate matrix under comparable conditions, Cs+ ions are strongly retained on the adsorbent material than Ba2+ ions. Elution performance of the daughter 134m Ba (T1/2=2.7 min.) from its parent 137 Cs (T1/2=30 y) was investigated on small chromatographic columns of the matrix. Based on the data obtained, 2 g 12-molybdo cerate (IV), dried at 200 degree C, loaded with 1 mCi 137 Cs/137m Ba milkers was prepared. The generated 137m Ba daughter was continuously eluted by passing a mixture solution of 0.1 M HCl + 0.1 M N H4 Cl as eluent through the column bed at flow rates of 1 and 2 m1/min. Eluate assessment proved reproducibility of the elution yields about 58% 137m Ba in 5 m1 eluate. Radionuclidic and chemical purity of the eluate proved to be suitable for use in nuclear medicine and also industrial applications. 6 figs., 1 tab

  4. production of carrier -free 131 cesium from neutron irradiated barium targets

    International Nuclear Information System (INIS)

    this work describes the production of carrier-free radioactive 131 Cs from bulk amounts of Ba CO3 (1g each) as target material irradiated at ETRR-1, ETRR-2 and IRI research reactors. Cesium-131 was prepared according to the thermal neutron reaction 130Ba (n,γ ) 131 Ba (β- decay)131 Cs. Carrier-free 131Cs is separated from the irradiated barium target, by precipitation of Ba2+ cations with addition of SO42- anions in excess and filtration of the formed precipitate . quality control investigations including radionuclidic, radiochemical and chemical purity of 131 Cs product has proved its suitability for nuclear medicine use

  5. MicroRNA-137 Targets Carboxyl-terminal Binding Protein 1 in Melanoma Cell Lines

    Directory of Open Access Journals (Sweden)

    Yu Deng, Hui Deng, Feng Bi, Jing Liu, Lynn T. Bemis, David Norris, Xiao-Jing Wang, Qinghong Zhang

    2011-01-01

    Full Text Available Carboxyl-terminal binding protein 1 (CtBP1 is a transcriptional co-repressor that represses expression of various tumor suppressor genes. In the present study, we identified miR-137 as a potential regulator of CtBP1 expression in melanoma cells. Expression of miR-137 in melanoma cell lines was found to inversely correlate with CtBP1 levels. Target Scan predicted a putative site for miR-137 within the CtBP1 3′ untranslated region (3′UTR at nt 710-716, which is highly conserved across species. To explore the mechanism of miR-137 targeting CtBP1, we performed an Argonaute 2 (Ago2-pull down assay, and miR-137 was identified in complex with CtBP1 mRNA. miR-137 suppressed CtBP1 3' UTR luciferase-reporter activity, and this effect was lost with deletion of the putative 3' UTR target-site. Consistent with the results of the reporter assay, ectopic expression of miR-137 reduced expression levels of CtBP1. Furthermore, expression of miR-137 increased the immediate downstream effectors of CtBP1, such as E-cadherin and Bax. The human miR-137 gene is located at chromosome 1p22, which has previously been determined to be a susceptive region for melanoma. This study suggests miR-137 may act as a tumor suppressor by directly targeting CtBP1 to inhibit epithelial-mesenchymal transition (EMT and inducing apoptosis of melanoma cells, thus illustrating a functional link between miR-137 and CtBP1 in melanoma development.

  6. Metabolism of {sup 137}cesium, {sup 137}barium in the rat. Therapeutics of the contamination; Metabolisme du {sup 137}cesium, {sup 137}baryum chez le rat. Therapeutique de la contamination

    Energy Technology Data Exchange (ETDEWEB)

    Remy, J.; Philippon, A.; Lafuma, J.; Walter, C. [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires. Departement de la Protection Sanitaire, Laboratoire de Radiopathologie

    1967-07-01

    The authors carry out research into the distribution kinetics, the metabolism and the excretion of {sup 137}Cs - {sup 137}Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors) [French] Les auteurs etudient experimentalement la cinetique de distribution, le metabolisme et l

  7. Immunotherapy of melanoma with the immune costimulatory monoclonal antibodies targeting CD137

    Directory of Open Access Journals (Sweden)

    Li SY

    2013-09-01

    Full Text Available Shi-Yan Li, Yizhen Liu Cancer Research Institute, Scott and White Healthcare, Temple, TX, USA Abstract: Knowledge of how the immune system recognizes and attempts to control cancer growth and development has improved dramatically. The advent of immunotherapies for cancer has resulted in robust clinical responses and confirmed that the immune system can significantly inhibit tumor progression. Until recently, metastatic melanoma was a disease with limited treatment options and a poor prognosis. CD137 (also known as 4-1BB a member of the tumor necrosis factor (TNF receptor superfamily, is an activation-induced T cell costimulator molecule. Growing evidence indicates that anti-CD137 monoclonal antibodies possess strong antitumor properties, the result of their powerful capability to activate CD8+ T cells, to produce interferon (IFN-γ, and to induce cytolytic markers. Combination therapy of anti-CD137 with other anticancer agents, such as radiation, has robust tumor-regressing abilities against nonimmunogenic or poorly immunogenic tumors. Of importance, targeting CD137 eliminates established tumors, and the fact that anti-CD137 therapy acts in concert with other anticancer agents and/or radiation therapy to eradicate nonimmunogenic and weakly immunogenic tumors is an additional benefit. Currently, BMS-663513, a humanized anti-CD137 antibody, is in clinical trials in patients with solid tumors, including melanoma, renal carcinoma, ovarian cancer, and B-cell malignancies. In this review, we discuss the basis of the therapeutic potential of targeting CD137 in cancer treatment, focusing in particular, on BMS-663513 as an immune costimulatory monoclonal antibody for melanoma immunotherapy. Keywords: anti-CD137 monoclonal antibodies, immune costimulator molecule, BMS-663513

  8. miR-137 suppresses tumor growth of malignant melanoma by targeting aurora kinase A.

    Science.gov (United States)

    Chang, Xiao; Zhang, Haiping; Lian, Shi; Zhu, Wei

    2016-07-01

    As an oncogene, aurora kinase A (AURKA) is overexpressed in various types of human cancers. However, the expression and roles of AURKA in malignant melanoma are largely unknown. In this study, a miR-137-AURKA axis was revealed to regulate melanoma growth. We found a significant increase in levels of AURKA in melanoma. Both genetic knockdown and pharmacologic inhibition of AURKA decreased tumor cell growth in vitro and in vivo. Further found that miR-137 reduced AURKA expression through interaction with its 3' untranslated region (3'UTR) and that miR-137 was negatively correlated with AURKA expression in melanoma specimens. Overexpression of miR-137 decreased cell proliferation and colony formation in vitro. Notably, re-expression of AURKA significantly rescued miR-137-mediated suppression of cell growth and clonality. In summary, these results reveal that miR-137 functions as a tumor suppressor by targeting AURKA, providing new insights into investigation of therapeutic strategies against malignant melanoma. PMID:27233613

  9. Potential impact of miR-137 and its targets in schizophrenia

    Directory of Open Access Journals (Sweden)

    Carrie eWright

    2013-04-01

    Full Text Available The significant impact of microRNAs (miRNAs on disease pathology is becoming increasingly evident. These small non-coding RNAs have the ability to post-transcriptionally silence the expression of thousands of genes. Therefore, dysregulation of even a single miRNA could confer a large polygenic effect. Schizophrenia is a genetically complex illness thought to involve multiple genes each contributing a small risk. Large genome-wide association studies identified miR-137, a miRNA shown to be involved in neuronal maturation, as one of the top risk genes. To assess the potential mechanism of impact of miR-137 in this disorder and identify its targets, we used a combination of literature searches, Ingenuity Pathway Analysis (IPA, and freely accessible bioinformatics resources. Using TargetScan and the Schizophrenia Gene Resource (SZGR database, we found that in addition to CSMD1, C10orf26, CACNA1C, TCF4, and ZNF804A, five schizophrenia risk genes whose transcripts are also validated miR-137 targets, there are other schizophrenia-associated genes that may be targets of miR-137, including ERBB4, GABRA1, GRIN2A, GRM5, GSK3B, NRG2 and HTR2C. IPA analyses of all the potential targets identified several nervous system functions as the top canonical pathways including synaptic long-term potentiation, a process implicated in learning and memory mechanisms and recently shown to be altered in patients with schizophrenia. Among the subset of targets involved in nervous system development and function, the top scoring pathways were ephrin receptor signaling and axonal guidance, processes that are critical for proper circuitry formation and were shown to be disrupted in schizophrenia. These results suggest that miR-137 may indeed play a substantial role in the genetic etiology of schizophrenia by regulating networks involved in neural development and brain function.

  10. Potential Impact of miR-137 and Its Targets in Schizophrenia.

    Science.gov (United States)

    Wright, Carrie; Turner, Jessica A; Calhoun, Vince D; Perrone-Bizzozero, Nora

    2013-01-01

    The significant impact of microRNAs (miRNAs) on disease pathology is becoming increasingly evident. These small non-coding RNAs have the ability to post-transcriptionally silence the expression of thousands of genes. Therefore, dysregulation of even a single miRNA could confer a large polygenic effect. Schizophrenia is a genetically complex illness thought to involve multiple genes each contributing a small risk. Large genome-wide association studies identified miR-137, a miRNA shown to be involved in neuronal maturation, as one of the top risk genes. To assess the potential mechanism of impact of miR-137 in this disorder and identify its targets, we used a combination of literature searches, ingenuity pathway analysis (IPA), and freely accessible bioinformatics resources. Using TargetScan and the schizophrenia gene resource (SZGR) database, we found that in addition to CSMD1, C10orf26, CACNA1C, TCF4, and ZNF804A, five schizophrenia risk genes whose transcripts are also validated miR-137 targets, there are other schizophrenia-associated genes that may be targets of miR-137, including ERBB4, GABRA1, GRIN2A, GRM5, GSK3B, NRG2, and HTR2C. IPA analyses of all the potential targets identified several nervous system (NS) functions as the top canonical pathways including synaptic long-term potentiation, a process implicated in learning and memory mechanisms and recently shown to be altered in patients with schizophrenia. Among the subset of targets involved in NS development and function, the top scoring pathways were ephrin receptor signaling and axonal guidance, processes that are critical for proper circuitry formation and were shown to be disrupted in schizophrenia. These results suggest that miR-137 may indeed play a substantial role in the genetic etiology of schizophrenia by regulating networks involved in neural development and brain function. PMID:23637704

  11. miR-137 acts as a tumor suppressor in papillary thyroid carcinoma by targeting CXCL12.

    Science.gov (United States)

    Dong, Su; Jin, Meishan; Li, Ye; Ren, Peiyou; Liu, Jia

    2016-04-01

    Accumulating evidence has shown that aberrantly expressed microRNAs (miRs) are extensively involved in tumorigenesis. microRNA-137 (miR-137) has been reported as a tumor suppressor in various types of cancer. However, the biological function and underlying molecular mechanism of miR-137 in papillary thyroid carcinoma (PTC) remain largely unknown. Therefore, the present study aimed to investigate the expression pattern of miR-137 and its functional significance in PTC. Quantitative RT-PCR (qRT-PCR) assay showed that miR-137 expression was significantly downregulated in human PTC tissues, and its expression was significantly negatively correlated with tumor-node-metastasis (TNM) stage and lymph node metastasis. Functional assays showed that forced expression of miR-137 in PTC cells significantly inhibited proliferation, colony formation, migration and invasion in vitro. Importantly, on the basis of bioinformatic analysis and luciferase reporter assay, we found that miR-137 directly targeted the 3'-untranslated region (3'-UTR) of C-X-C motif chemokine 12 (also known as SDF-1) (CXCL12). qRT-PCR and western blot analysis further verified the results and demonstrated that miR-137 could downregulate CXCL12 expression in PTC cells. We also confirmed that CXCL12 expression was increased in PTC tissues and was inversely correlated with miR-137. In addition, our results also showed that downregulation of CXCL12 mimicked the effects of miR-137 overexpression, and upregulation of CXCL12 partially reversed the inhibitory effects of miR-137 in PTC cells. These results showed that miR-137 may function as a tumor suppressor in PTC by targeting CXCL12, suggesting that miR-137 may act as a potential target for PTC treatment. PMID:26847706

  12. Barium enema

    Science.gov (United States)

    Barium enema is a special x-ray of the large intestine, which includes the colon and rectum. ... to a bag that holds a liquid containing barium sulfate. This is a contrast material that highlights ...

  13. Barium Sulfate

    Science.gov (United States)

    Barium sulfate is used to help doctors examine the esophagus (tube that connects the mouth and stomach), ... dimensional pictures of the inside of the body). Barium sulfate is in a class of medications called ...

  14. miR-137, a new target for post-stroke depression?

    Institute of Scientific and Technical Information of China (English)

    Lixia Zhao; Huazi Li; Ruiyou Guo; Teng Ma; Rongyao Hou; Xiaowei Ma; Yifeng Du

    2013-01-01

    Expression of miR-137 is downregulated in brain tissue from patients with depression and suicidal behavior, and is also downregulated in peripheral blood from stroke patients. However, it is not yet known if miR-137 acts as a bridge between stroke and depression. To test this, we used middle cerebral artery occlusion and chronic mild stress to establish a post-stroke depression model in rats. Compared with controls, we found significantly lower miR-137 levels in the brain and peripheral blood from post-stroke depression rats. Injection of a miR-137 antagonist into the brain ventricles upregulated miR-137 levels, and improved behavioral changes in post-stroke depression rats. Lu-ciferase assays showed miR-137 bound to the 3′UTR of Grin2A, regulating Grin2A expression in a neuronal cel line. Grin2A gene overexpression in the brain of post-stroke depression rats, noticea-bly suppressed the inhibitory effect of miR-137 on post-stroke depression. Overal , our results show that miR-137 suppresses Grin2A protein expression through binding to Grin2A mRNA, thereby ex-erting an inhibitory effect on post-stroke depression. Our results offer a new therapeutic direction for post-stroke depression.

  15. Barium Sulfate

    Science.gov (United States)

    ... using x-rays or computed tomography (CAT scan, CT scan; a type of body scan that uses ... be clearly seen by x-ray examination or CT scan. ... more times before an x-ray examination or CT scan.If you are using a barium sulfate ...

  16. Potential Impact of miR-137 and Its Targets in Schizophrenia

    OpenAIRE

    Wright, Carrie; Turner, Jessica A.; Calhoun, Vince D.; Perrone-Bizzozero, Nora

    2013-01-01

    The significant impact of microRNAs (miRNAs) on disease pathology is becoming increasingly evident. These small non-coding RNAs have the ability to post-transcriptionally silence the expression of thousands of genes. Therefore, dysregulation of even a single miRNA could confer a large polygenic effect. Schizophrenia is a genetically complex illness thought to involve multiple genes each contributing a small risk. Large genome-wide association studies identified miR-137, a miRNA shown to be in...

  17. BARIUM RECOVERY PROCESS

    Science.gov (United States)

    Blanco, R.E.

    1959-07-21

    A method of separating barium from nuclear fission products is described. In accordance with the invention, barium may be recovered from an acidic solution of neutron-irradiated fissionable material by carrying ihe barium cut of solution as a sulfate with lead as a carrier and then dissolving the barium-containing precipitate in an aqueous solution of an aliphatic diamine chelating reagent. The barium values together with certain other metallic values present in the diamine solution are then absorbed onto a cation exchange resin and the barium is selectively eluted from the resin bed with concentrated nitric acid.

  18. Barium enema (image)

    Science.gov (United States)

    A barium enema is performed to examine the walls of the colon. During the procedure, a well lubricated enema tube is inserted gently into the rectum. The barium, a radiopaque (shows up on X-ray) contrast ...

  19. Radioisotope analyzer of barium

    International Nuclear Information System (INIS)

    Principle of operation and construction of radioisotope barium sulphate analyzer type MZB-2 for fast determination of barium sulphate content in barite ores and enrichment products are described. The gauge equipped with Am-241 and a scintillation detector enables measurement of barium sulphate content in prepared samples of barite ores in the range 60% - 100% with the accuracy of 1%. The gauge is used in laboratories of barite mine and ore processing plant. 2 refs., 2 figs., 1 tab. (author)

  20. Concomitant targeting of programmed death-1 (PD-1) and CD137 improves the efficacy of radiotherapy in a mouse model of human BRAFV600-mutant melanoma.

    Science.gov (United States)

    Kroon, Paula; Gadiot, Jules; Peeters, Marlies; Gasparini, Alessia; Deken, Marcel A; Yagita, Hideo; Verheij, Marcel; Borst, Jannie; Blank, Christian U; Verbrugge, Inge

    2016-06-01

    T cell checkpoint blockade with antibodies targeting programmed cell death (ligand)-1 (PD-1/PD-L1) and/or cytotoxic T lymphocyte-antigen 4 (CTLA-4) has improved therapy outcome in melanoma patients. However, a considerable proportion of patients does not benefit even from combined α-CTLA-4 and α-PD-1 therapy. We therefore examined to which extent T cell (co)stimulation and/or stereotactic body radiation therapy (SBRT) could further enhance the therapeutic efficacy of T cell checkpoint blockade in a genetically engineered mouse melanoma model that is driven by PTEN-deficiency, and BRAFV600 mutation, as in human, but lacks the sporadic UV-induced mutations. Tumor-bearing mice were treated with different combinations of immunomodulatory antibodies (α-CTLA-4, α-PD-1, α-CD137) or interleukin-2 (IL-2) alone or in combination with SBRT. None of our immunotherapeutic approaches (alone or in combination) had any anti-tumor efficacy, while SBRT alone delayed melanoma outgrowth. However, α-CD137 combined with α-PD-1 antibodies significantly enhanced the anti-tumor effect of SBRT, while the anti-tumor effect of SBRT was not enhanced by interleukin-2, or the combination of α-CTLA-4 and α-PD-1. We conclude that α-CD137 and α-PD-1 antibodies were most effective in enhancing SBRT-induced tumor growth delay in this mouse melanoma model, outperforming the ability of IL-2, or the combination of α-CTLA-4 and α-PD-1 to synergize with SBRT. Given the high mutational load and increased immunogenicity of human melanoma with the same genotype, our findings encourage testing α-CD137 and α-PD-1 alone or in combination with SBRT clinically, particularly in patients refractory to α-CTLA-4 and/or α-PD-1 therapy. PMID:27160390

  1. Tailored Barium Swallow Study

    Science.gov (United States)

    ... View Denver Pollen Count You are here: Programs & Services > Tests We Offer > Imaging Tests Tailored Barium Swallow Study The TBS is a special study that is completed in radiology. The test evaluates the mouth and the throat ...

  2. Evaluation of Transmutation of 137Cs(r,n) 136Cs Using Ultra-Intense Lasers in Solid Targets

    Institute of Scientific and Technical Information of China (English)

    R. Sadighi-Bonabi; O. Kokabee

    2006-01-01

    Relativistic electrons produced in ultra-intense laser-solid interaction generate highly collimated γ-ray beams through Bremsstrahlung that can be used to induce photonuclear reactions. Photonuclear transmutation (of (γ, n) type) of 137Cs, one of the hazardous nuclear wastes with half-life of 30.17 years which cannot be transmuted practically with neutron bombardment due to its very low neutron capture cross section, has been considered. Nuclear activity of produced 136Cs with half-life of 13.16 days has been evaluated analytically using available experimental data. With irradiating a 137Cs sample by p-polarized laser light of 1020 Wcm-2 and the repetition rate of 10 Hz for 30mm, the activity of 0.24 Bq is obtained. It is found that intensity has a large effect in yield around 1021 Wcm-2. For similar laser with intensity of 5×1021 Wcm-2, the activity increases with a factor of 105.

  3. Lower GI Series (Barium Enema)

    Science.gov (United States)

    ... barium into a bedpan or nearby toilet. A health care professional may give you an enema to flush out the rest of the barium. An x-ray technician and a radiologist perform a lower gastrointestinal (GI) series at a ...

  4. Observed Barium Emission Rates

    Science.gov (United States)

    Stenbaek-Nielsen, H. C.; Wescott, E. M.; Hallinan, T. J.

    1993-01-01

    The barium releases from the CRRES satellite have provided an opportunity for verifying theoretically calculated barium ion and neutral emission rates. Spectra of the five Caribbean releases in the summer of 1991 were taken with a spectrograph on board a U.S. Air Force jet aircraft. Because the line of sight release densities are not known, only relative rates could be obtained. The observed relative rates agree well with the theoretically calculated rates and, together with other observations, confirm the earlier detailed theoretical emission rates. The calculated emission rates can thus with good accuracy be used with photometric observations. It has been postulated that charge exchange between neutral barium and oxygen ions represents a significant source for ionization. If so. it should be associated with emissions at 4957.15 A and 5013.00 A, but these emissions were not detected.

  5. New barium tantalum sulphides

    International Nuclear Information System (INIS)

    The authors discuss a new barium tantalum sulphide, Ba3Ta2S8, prepared by sulphurization of a mixture of BaCO3 and Ta2O5. The electron and powder X-ray diffraction patterns of the compound are indexed on the basis of a monoclinic cell with lattice constants. A structure model is proposed. The refinement based on the powder X-ray diffraction intensities is performed

  6. Barium calcium hydroxyapatite solid solutions

    International Nuclear Information System (INIS)

    The replacement of calcium by barium in the hydroxyapatite structure by solid-state reaction at different temperatures and by precipitation from an aqueous system has been investigated by X-ray diffraction and i.r. absorption analyses. The products obtained by solid-state reaction at 1200 deg C are solid solutions over the range of barium concentration 60 to 100 atom %. The lattice dimensions and the i.r. frequencies of the solid solutions vary linearly with the atom % of barium. Only small amounts of barium can be incorporated in hydroxyapatite by precipitation from the aqueous system. (author)

  7. Cesium-137

    International Nuclear Information System (INIS)

    This sheet belongs to a collection which relates to the use of radionuclides essentially in unsealed sources. Its goal is to gather on a single document the most relevant information as well as the best prevention practices to be implemented. These sheets are made for the persons in charge of radiation protection: users, radioprotection-skill persons, labor physicians. Each sheet treats of: 1 - the radio-physical and biological properties; 2 - the main uses; 3 - the dosimetric parameters; 4 - the measurement; 5 - the protection means; 6 - the areas delimitation and monitoring; 7 - the personnel classification, training and monitoring; 8 - the effluents and wastes; 9 - the authorization and declaration administrative procedures; 10 - the transport; and 11 - the right conduct to adopt in case of incident or accident. This sheet deals specifically with Cesium-137

  8. Photon attenuation characteristics of barium enriched cement

    International Nuclear Information System (INIS)

    Nuclear radiations are widely used in several applications of nuclear sciences, medicine and industry. In the design and construction of installations housing high intensity radioactive sources and other radiation generating equipment, a variety of shielding materials are used to minimise the exposure to the individuals. Among the materials used, lead is best known for radiation shielding due to its high density and atomic number. However, in construction of radiation facilities, lead in the form of bricks or slabs cannot be substituted for cement as building material. As an alternative, barium enriched cement, which apart from better compressive strength, smoother surface finish and high abrasive resistance, offers adequate shielding to gamma radiations. In the present work, attenuation properties of commercial as well as barium enriched cements have been studied and compared with that of lead for photons of 662 and 1250 keV emitted from 137Cs and 60Co, respectively. Although photon attenuation data can be obtained by mixture rule theoretically, it is necessary to determine this data experimentally before use

  9. Barium zirconate base ceramics

    International Nuclear Information System (INIS)

    The chemical corrosion at high temperatures is a serious problem in the refractory materials field, leading to degradation and bath contamination by elements of the refractory. The main objective of this work was to search for ceramics that could present higher resistance to chemical attack by aggressive molten oxides. The general behaviour of a ceramic material based on barium zirconate (Ba Zr O3) with the addition of different amounts of liquid phase former was investigated. The densification behaviour occurred during different heat treatments, as well as the microstructure development, as a function of the additives and their reactions with the main phase, were observed and are discussed. (author)

  10. Individual-specific transgenerational marking of fish populations based on a barium dual-isotope procedure.

    Science.gov (United States)

    Huelga-Suarez, Gonzalo; Moldovan, Mariella; Garcia-Valiente, America; Garcia-Vazquez, Eva; Alonso, J Ignacio Garcia

    2012-01-01

    The present study focuses on the development and evaluation of an individual-specific transgenerational marking procedure using two enriched barium isotopes, (135)Ba and (137)Ba, mixed at a given and selectable molar ratio. The method is based on the deconvolution of the isotope patterns found in the sample into four molar contribution factors: natural xenon (Xe nat), natural barium (Ba nat), Ba135, and Ba137. The ratio of molar contributions between Ba137 and Ba135 is constant and independent of the contribution of natural barium in the sample. This procedure was tested in brown trout ( Salmo trutta ) kept in captivity. Trout were injected with three different Ba137/Ba135 isotopic signatures ca. 7 months and 7 days before spawning to compare the efficiency of the marking procedure at long and short term, respectively. The barium isotopic profiles were measured in the offspring by means of inductively coupled plasma mass spectrometry. Each of the three different isotopic signatures was unequivocally identified in the offspring in both whole eggs and larvae. For 9 month old offspring, the characteristic barium isotope signatures could also be detected in the otoliths even in the presence of a high and variable amount of barium of natural isotope abundance. In conclusion, it can be stated that the proposed dual-isotope marking is inheritable and can be detected after both long-term and short-term marking. Furthermore, the dual-isotope marking can be made individual-specific, so that it allows identification of offspring from a single individual or a group of individuals within a given fish group. PMID:22103693

  11. MR Colonography with fecal tagging: Barium vs. barium ferumoxsil

    DEFF Research Database (Denmark)

    Achiam, M.P.; Chabanova, E.; Logager, V.B.; Thomsen, H.S.; Rosenberg, J.

    2008-01-01

    . Materials and Methods. Twenty patients referred to CC underwent dark lumen MRC prior to the colonoscopy. Two groups of patients received two different oral contrast agents (barium sulfate and barium sulfate/ferumoxsil) as a laxative-free fecal tagging prior to the MRC. After MRC, the contrast agent was...... rated qualitatively (with the standard method using contrast-to-wall ratio) and subjectively (using a visual analog scale [VAS]) by three different blinded observers. Results. Evaluated both qualitatively and subjectively, the tagging efficiency of barium sulfate/ferumoxsil was significantly better (P...... <.05) than barium sulfate alone. The VAS method for evaluating the tagging efficiency of contrast agents showed a high correlation (observer 11, r = 0.91) to the standard method using contrast-to-wall ratio and also a high interclass correlation (observer 11 and III = 0.89/0.85). MRC found I of 22 (5...

  12. Doped barium titanate nanoparticles

    Indian Academy of Sciences (India)

    T K Kundu; A Jana; P Barik

    2008-06-01

    We have synthesized nickel (Ni) and iron (Fe) ion doped BaTiO3 nanoparticles through a chemical route using polyvinyl alcohol (PVA). The concentration of dopant varies from 0 to 2 mole% in the specimens. The results from X-ray diffractograms and transmission electron micrographs show that the particle diameters in the specimen lie in the range 24–40 nm. It is seen that the dielectric permittivity in doped specimens is enhanced by an order of magnitude compared to undoped barium titanate ceramics. The dielectric permittivity shows maxima at 0.3 mole% doping of Fe ion and 0.6 mole% of Ni ion. The unusual dielectric behaviour of the specimens is explained in terms of the change in crystalline structure of the specimens.

  13. New barium tantalum sulphides

    International Nuclear Information System (INIS)

    A new barium tantalum sulphide has been synthesized by the reaction of CS2 with a mixture of BaCO3 and Ta2O5. The chemical analysis of the compound was performed for 3 components (Ba, Ta and S), and the chemical composition was found to be BaTa2S5. The powder X-ray diffraction peaks were indexable on the basis of a hexagonal cell with lattices constants of a=3.32A, c=25.13A. However, the electron diffraction measurements show that the structure is more complex than that observed by powder X-ray diffraction. The compound indicates metallic behavior and Pauli paramagnetism

  14. Abundance analysis of barium and mild barium stars

    CERN Document Server

    Smiljanic, R; Silva, L

    2007-01-01

    High signal to noise, high resolution spectra were obtained for a sample of normal, mild barium, and barium giants. Atmospheric parameters were determined from the FeI and FeII lines. Abundances for Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Sr, Y, Zr, Ba, La, Ce, Nd, Sm, Eu, and Gd, were determined from equivalent widths and model atmospheres in a differential analysis, with the red giant Eps Vir as the standard star. The different levels of s-process overabundances of barium and mild barium stars were earlier suggested to be related to the stellar metallicity. Contrary to this suggestion, we found in this work no evidence for barium and mild barium to have a different range in metallicity. However, comparing the ratio of abundances of heavy to light s-process elements, we found some evidence that they do not share the same neutron exposure parameter. The exact mechanism controlling this difference is still not clear. As a by-product of this analysis we identify two normal red giants misclass...

  15. Barium aluminate cement: its application

    International Nuclear Information System (INIS)

    The technology of manufacturing barium aluminate cement from barium sulfate and alumina, using a rotary kiln for firing the clinker is described. The method of granulation of the homogenized charge was used. Conditions of using the ''to mud'' method in industry were indicated. The physical and chemical properties of barium aluminate cement are determined and the quality of several batches of cement prepared on a semi-industrial scale and their suitability for making highly refractory concretes are tested. The optimal composition of the concretes is determined as a function of the mixing water and barium aluminate cement contents. Several experimental batches of concretes were used in the linings of furnaces in the steel industry. The suitability of these cements for use in fields other than steelmaking is examined. It is established that calcium aluminate cement has certain limited applications

  16. Discovery of the Barium Isotopes

    OpenAIRE

    SHORE, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; Schuh, A.; Thoennessen, M

    2009-01-01

    Thirty-eight barium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  17. Barium light source method and apparatus

    Science.gov (United States)

    Curry, John J. (Inventor); MacDonagh-Dumler, Jeffrey (Inventor); Anderson, Heidi M. (Inventor); Lawler, James E. (Inventor)

    2002-01-01

    Visible light emission is obtained from a plasma containing elemental barium including neutral barium atoms and barium ion species. Neutral barium provides a strong green light emission in the center of the visible spectrum with a highly efficient conversion of electrical energy into visible light. By the selective excitation of barium ionic species, emission of visible light at longer and shorter wavelengths can be obtained simultaneously with the green emission from neutral barium, effectively providing light that is visually perceived as white. A discharge vessel contains the elemental barium and a buffer gas fill therein, and a discharge inducer is utilized to induce a desired discharge temperature and barium vapor pressure therein to produce from the barium vapor a visible light emission. The discharge can be induced utilizing a glow discharge between electrodes in the discharge vessel as well as by inductively or capacitively coupling RF energy into the plasma within the discharge vessel.

  18. Decorporation of cesium-137

    International Nuclear Information System (INIS)

    Cesium radio-isotopes, especially cesium-137 (137Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, 137Cs is a major contaminant which can cause severe β, γirradiations and contaminations. 137Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the 137Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  19. Analysis of europium doped luminescent barium thioaluminate

    Institute of Scientific and Technical Information of China (English)

    张东璞; 喻志农; 薛唯; 章婷; 丁瞾; 王武育

    2010-01-01

    Europium-doped barium thioaluminate sputtering target was synthesized by powder sintering method and thin film was deposited by radio frequency(RF) sputtering.X-ray diffractometer(XRD) pattern indicated that the main compound of the target was BaAl4S7.Oxygen was the main impurity which led to the formation of BaAl2O4.It was shown that both BaAl4S7 and BaAl2S4 were contained in the as-grown thin films and a 471.7 nm emission peak in the PL spectra appeared due to a combination of BaAl4S7:Eu2+ and BaAl2S4:Eu2...

  20. Management of cesium loaded AMP- Part I preparation of 137Cesium concentrate and cementation of secondary wastes

    International Nuclear Information System (INIS)

    Separation of 137cesium from High Level Waste can be achieved by use of composite-AMP, an engineered form of Ammonium Molybdo-Phosphate(AMP). Direct vitrification of cesium loaded composite AMP in borosilicate glass matrix leads to separation of water soluble molybdate phase. A proposed process describes two different routes of selective separation of molybdates and phosphate to obtain solutions of cesium concentrates. Elution of 137Cesium from composite-AMP by decomposing it under flow conditions using saturated barium hydroxide was investigated. This method leaves molybdate and phosphate embedded in the column but only 70% of total cesium loaded on column could be eluted. Alternatively composite-AMP was dissolved in sodium hydroxide and precipitation of barium molybdate-phosphate from the resultant solution, using barium nitrate was investigated by batch methods. The precipitation technique gave over 99.9% of 137Cesium activity in solutions, free of molybdates and phosphates, which is ideally suited for immobilization in borosilicate glass matrix. Detailed studies were carried out to immobilize secondary waste of 137Cesium contaminated barium molybdate-phosphate precipitates in the slag cement matrix using vermiculite and bentonite as admixtures. The cumulative fraction of 137Cs leached from the cement matrix blocks was 0.05 in 140 days while the 137Cs leach rate was 0.001 gm/cm2/d. (author)

  1. The problem of the barium stars

    Science.gov (United States)

    Bohm-Vitense, E.; Nemec, J.; Proffitt, C.

    1984-01-01

    Ultraviolet observations of barium stars and other cool stars with peculiar element abundances are reported. Those observations attempted to find hot white dwarf companions. Among six real barium stars studied, only Zeta Cap was found to have a white dwarf companion. Among seven mild, or marginal, barium stars studied, at least three were found to have hot subluminous companions. It is likely that all of them have white dwarf companions.

  2. Radioisotope barium sulphate gauge MZB-2

    International Nuclear Information System (INIS)

    A method and the gauge for measuring content of barium sulphate are described. The gauge is intended for fast determination of barium sulphate in barite ore and in output products of the enrichment process. The measuring range 60-100% of BaSO4, accuracy ±1% and measuring time 60 s were reached. The barium sulphate gauge is used in barite mine ''Boguszow'' in Poland. (author)

  3. ONE CASE REPORT OF ACUTE POISONING BY BARIUM CARBONATE

    Institute of Scientific and Technical Information of China (English)

    GE Qin-min; BIAN Fan; WANG Shu-yun; SHEN Sheng-hui

    2009-01-01

    @@ Most barium poisoning cases were caused by oral intake by mistake. Recent years, barium carbonate poisoning has been rare to be reported. Here we reported a case of acute barium carbonate toxication taken orally on purpose.

  4. Cesium-137 in biosphere

    International Nuclear Information System (INIS)

    The behaviour of cesium-137 in environment is reviewed. Problems on 137Cs migration in environment, on metabolism andbiological effects are considered. Data on nuclide accumulation in various plants, ways of their entering the man's organism are presented. It is marked that the rate of 137Cs metabolism in the man's organism depends considerably on age, sex, temperature of environment, conditions for activity, water and mineral metabolism and some other factors. It is shown that the annual effective equivalent dose per capita will increase to 2000 yr. up to 1 μSv, that constitutes 0.05% of the average value of irradiation by a natural source

  5. Barium Depletion in Hollow Cathode Emitters

    Science.gov (United States)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira

    2009-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the ow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  6. Processing science of barium titanate

    Science.gov (United States)

    Aygun, Seymen Murat

    Barium titanate and barium strontium titanate thin films were deposited on base metal foils via chemical solution deposition and radio frequency magnetron sputtering. The films were processed at elevated temperatures for densification and crystallization. Two unifying research goals underpin all experiments: (1) To improve our fundamental understanding of complex oxide processing science, and (2) to translate those improvements into materials with superior structural and electrical properties. The relationships linking dielectric response, grain size, and thermal budget for sputtered barium strontium titanate were illustrated. (Ba 0.6Sr0.4)TiO3 films were sputtered on nickel foils at temperatures ranging between 100-400°C. After the top electrode deposition, the films were co-fired at 900°C for densification and crystallization. The dielectric properties were observed to improve with increasing sputter temperature reaching a permittivity of 1800, a tunability of 10:1, and a loss tangent of less than 0.015 for the sample sputtered at 400°C. The data can be understood using a brick wall model incorporating a high permittivity grain interior with low permittivity grain boundary. However, this high permittivity value was achieved at a grain size of 80 nm, which is typically associated with strong suppression of the dielectric response. These results clearly show that conventional models that parameterize permittivity with crystal diameter or film thickness alone are insufficiently sophisticated. Better models are needed that incorporate the influence of microstructure and crystal structure. This thesis next explores the ability to tune microstructure and properties of chemically solution deposited BaTiO3 thin films by modulation of heat treatment thermal profiles and firing atmosphere composition. Barium titanate films were deposited on copper foils using hybrid-chelate chemistries. An in-situ gas analysis process was developed to probe the organic removal and the

  7. Determination of Corrections in the Absolute Measurement of 137Cs

    International Nuclear Information System (INIS)

    A method, of determining corrections in absolute measurements of 137Cs by 4π proportional counter is described. The correction for self-absorption of 137Cs beta particles from sources formed by vacuum deposition of CsCl on standard carrier films was determined. These samples, which had negligible self-absorption, were measured by 4π counter. The radioactive substance on the film was then dissolved, and by the addition of carrier was converted to a form similar to that of sources usually used for absolute measurement. The correction determined for self-absorption was higher than the value expected from comparison with other radionuclides having near Eβmax. The correction for internal conversion coefficient and gamma efficiency of the beta detector was determined with 137mBa samples. Barium was separated as BaSO4 precipitate and deposited on a standard carrier film used for absolute measurement with a layer thickness of about 1 mg/cm2. These samples were simultaneously measured by means of a 4π beta proportional counter and a Nal(Tl) scintillation counter. From corresponding counting rates in both counters, and from both known efficiencies, the value for a correction appropriate to one disintegration of 137mBa was calculated. The values measured were used further for computation of the internal conversion coefficient and the half-life of 137'mBa, which was ascertained to be 155 ± 3 s. (author)

  8. Barium methylphosphonates: synthesis, characterization and mutual interconversions

    Czech Academy of Sciences Publication Activity Database

    Beneš, L.; Melánová, Klára; Svoboda, Jan; Zima, Vítězslav

    Strasbourg: University of Strasbourg, Francie, 2015. P64. [ISIC18 International Symposium on Intercalation Compounds. 31.05.2015-04.06.2015, Strasbourg] R&D Projects: GA ČR(CZ) GA14-13368S Institutional support: RVO:61389013 Keywords : hydrates of barium methylphosphonate * barium hydrogen methylphosphonate * powder X-ray diffraction Subject RIV: CA - Inorganic Chemistry

  9. CT-Guided Percutaneous Transthoracic Localization of Pulmonary Nodules Prior to Video-Assisted Thoracoscopic Surgery Using Barium Suspension

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Nyoung Keun; Park, Chang Min; Kang, Chang Hyun; Jeon, Yoon Kyung; Choo, Ji Yung; Lee, Hyun Ju; Goo, Jin Mo [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    2012-11-15

    To describe our initial experience with CT-guided percutaneous barium marking for the localization of small pulmonary nodules prior to video-assisted thoracoscopic surgery (VATS). From October 2010 to April 2011, 10 consecutive patients (4 men and 6 women; mean age, 60 years) underwent CT-guided percutaneous barium marking for the localization of 10 small pulmonary nodules (mean size, 7.6 mm; range, 3-14 mm): 6 pure ground-glass nodules, 3 part-solid nodules, and 1 solid nodule. A 140% barium sulfate suspension (mean amount, 0.2 mL; range, 0.15-0.25 mL) was injected around the nodules with a 21-gauge needle. The technical details, surgical findings and pathologic features associated with barium localizations were evaluated. All nodules were marked within 3 mm (mean distance, 1.1 mm; range, 0-3 mm) from the barium ball (mean diameter, 9.6 mm; range, 8-16 mm) formed by the injected barium suspension. Pneumothorax occurred in two cases, for which one needed aspiration. However, there were no other complications. All barium balls were palpable during VATS and visible on intraoperative fluoroscopy, and were completely resected. Both the whitish barium balls and target nodules were identifiable in the frozen specimens. Pathology revealed one invasive adenocarcinoma, five adenocarcinoma-in-situ, two atypical adenomatous hyperplasias, and two benign lesions. In all cases, there were acute inflammations around the barium balls which did not hamper the histological diagnosis of the nodules. CT-guided percutaneous barium marking can be an effective, convenient and safe pre-operative localization procedure prior to VATS, enabling accurate resection and diagnosis of small or faint pulmonary nodules.

  10. A new double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jun Sang; Cho, Won Sik; Lee, Sung Woo; Lee, Mun Gyu; Jeon, Jeong Dong; Jaun, Woo Ki; Han, Chung Yul [Inje College Paik Hospital, Pusan (Korea, Republic of)

    1987-12-15

    A new technic of the barium enema was proposed for the better colonic double contrast study with the average 204ml of 50w/v% barium, applied to 109 serial patients. The barium was introduced to sigmoid colon, and then pushed to a mid transverse colon by the air insufflation through an enema syringe, a new device. An advance to cecum is accomplished by the air insufflation and/or the position change of the patient. The barium transfer method was developed for the best spot film exposure, through colon, by the position change of the patient, the tilting of the x-ray table and the air insufflation with the enema syringe. The mean angle of the x-ray table tilted was -10 .deg. at the beginning the barium enema till the barium sent past the splenic flexure, -15 . deg. for the best lateral view of rectum and -18 .deg. for the bet prone PA view of rectosigmoid colon. This was a simple, better and economic double contrast barium enema for the cooperative patients.

  11. Synthesis of barium titanium oxide from barium sulphate and anatase. Study of equimolar mixtures under different atmospheres

    International Nuclear Information System (INIS)

    To enable the ceramization of a barium sulphate-rich radioactive waste the synthesis of barium titanium oxide is studied by using anatase and barium sulphate. As a function of the calcination atmosphere, helium (or air) and Ar/H2, two reactions are studied. A mechanism of barium titanium oxide synthesis in helium (or in air) is proposed

  12. Double contrast barium meal and acetylcysteine

    International Nuclear Information System (INIS)

    In a prospective double blind study, acetylcysteine, a local and systemic respiratory tract mucolytic agent, or a placebo, were given to 100 patients prior to a double contrast barium meal to decrease the gastric mucus viscosity and to make the mucus layer thinner, in order to permit barium to outline the furrows surrounding the areae gastricae instead of the overlying thick mucus. However, acetylcysteine failed to improve either visualization of the areae gastricae or the general quality of the double contrast barium meal. (orig.)

  13. Barium adsorption on the (110) and (111) molybdenum faces

    Energy Technology Data Exchange (ETDEWEB)

    Azizov, U.V.; Sabirov, S.T.; Dzhalilov, S.T. (Tashkentskij Gosudarstvennyj Univ. (USSR))

    1982-07-01

    Barium adsorption on Mo faces (110) and (111) was investigated by thermoemission and Cs surface ionization methods to obtain a more broad representation of barium adsorption at higher temperatures of cathode. Experiments show that the substrate temperature increase at a constant barium concentration results in the formation of small barium islands. At that, barium is under similar energy conditions in the small islands formed on the face (110) independent of relative areas of the islands.

  14. Knockdown of GPR137,G Protein-coupled receptor 137, Inhibits the Proliferation and Migration of Human Prostate Cancer Cells.

    Science.gov (United States)

    Ren, Jizhong; Pan, Xiuwu; Li, Lin; Huang, Yi; Huang, Hai; Gao, Yi; Xu, Hong; Qu, Fajun; Chen, Lu; Wang, Linhui; Hong, Yi; Cui, Xingang; Xu, Danfeng

    2016-05-01

    GPR137 belongs to the G protein-coupled receptor family involving the regulation of transmembrane signal transduction that launches pivotal cellular functions. However, its function in prostate cancer (PCa) has been rarely reported. It was found in this study that GPR137 was upregulated in PCa tissues as compared with that in paracancerous tissues. To see whether GPR137 could serve as a potential therapeutic target for PCa, GPR137 was knocked down to verify its biological function in PCa cells. Lentivirus-introduced short hairpin RNA (shRNA) was designed to silence GPR137 gene. It was found that silencing of GPR137 gene suppressed the proliferation and colony formation of PCa cell lines PC-3 and DU145. Further study indicated that growth inhibition by GPR137 knockdown was associated with cell cycle arrest at G0/G1 phase. Furthermore, silencing of GPR137 repressed the invasion and migration abilities of PC-3 cells via downregulating slug and snail and upregulating E-cadherin. Collectively, these findings imply that GPR137 plays an important role in the occurrence and progression of PCa and may prove to be a potential therapeutic target for the treatment of advanced PCa. PMID:26669804

  15. Fabrication of thin target of 138Ba by vacuum evaporation

    International Nuclear Information System (INIS)

    Target fabrication is a highly sophisticated and crucial step in nuclear physics experiments. The success of any nuclear experiment is primarily determined by the quality and quantity of the target. 138Ba target is prepared for the evaporation residue cross section measurement of 188Pt populated through the reaction with 50Ti ion beam. Barium is a highly reactive metal and upon exposure to air at room temperature it will readily react with oxygen. Presently no information is available in the literature for the thin barium target fabrication through vacuum evaporation method. The two previous attempts available in literature were in sputtering method using barium nitrate or barium carbonate

  16. Barium Isotopes in Single Presolar Grains

    Science.gov (United States)

    Pellin, M. J.; Davis, A. M.; Savina, M. R.; Kashiv, Y.; Clayton, R. N.; Lewis, R. S.; Amari, S.

    2001-01-01

    Barium isotopic compositions of single presolar grains were measured by laser ablation laser resonant ionization mass spectrometry and the implications of the data for stellar processes are discussed. Additional information is contained in the original extended abstract.

  17. An experimental study on barium peritonitis in rats

    International Nuclear Information System (INIS)

    Barium sulfate is universally used contrast media in gastrointestinal roentgenology, and spillage of barium into peritoneal cavity can occur. The references on effect of barium sulfate in the peritoneal cavity have been scattered and the results are varied. In 80 rats, body weight of 130 gm to 150 gm, sterile pure barium, sterile commercial barium, intestinal content, and mixed pure barium and intestinal content were experimentally injected into the peritoneal cavity. Consecutive weekly laparotomy and microscopic examination were done for 4 weeks. The results are as followings: 1. Mind inflammatory reaction and mild adhesion after sterile pure barium injection. 2. Mild inflammatory reaction and moderate adhesion after sterile commercial barium injection. 3. Acute peritonitis and abscess formation after intestinal content injection. 4. High mortality due to severe acute peritonitis, and severe adhesion in survivors after injection of both pure barium and intestinal content.

  18. Bacterial Reduction Of Barium Sulphate By Sulphate-Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Luptáková Alena

    2015-12-01

    Full Text Available Acid mine drainage (AMD is a worldwide problem leading to contamination of water sources. AMD are characterized by low pH and high content of heavy metals and sulphates. The barium salts application presents one of the methods for the sulphates removing from AMD. Barium chloride, barium hydroxide and barium sulphide are used for the sulphates precipitation in the form of barium sulphate. Because of high investment costs of barium salts, barium sulphide is recycled from barium sulphate precipitates. It can be recycled by thermic or bacterial reduction of barium sulphate. The aim of our study was to verify experimentally the possibility of the bacterial transformation of BaSO4 to BaS by sulphate-reducing bacteria. Applied BaSO4 came from experiments of sulphates removal from Smolnik AMD using BaCl2.

  19. Venous barium embolization, a rare, potentially fatal complication of barium enema: 2 case reports

    International Nuclear Information System (INIS)

    Venous embolization of barium has been recognized for 4 decades as one of the most dreaded complications of barium enema. Fortunately, the condition is extremely rare. In this report, the radiographic findings in 2 cases of venous embolization (one involving the portal vein and one systematic) are described, and ways to decrease the risk of this complication are discussed. (author)

  20. Thermochemical hydrogen production via a cycle using barium and sulfur - Reaction between barium sulfide and water

    Science.gov (United States)

    Ota, K.; Conger, W. L.

    1977-01-01

    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653-866 C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. An expression was derived for the rate of hydrogen formation.

  1. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    International Nuclear Information System (INIS)

    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  2. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    Energy Technology Data Exchange (ETDEWEB)

    Baştürka, Emre; Madakbaş, Seyfullah; Kahraman, Memet Vezir, E-mail: smadakbas@marmara.edu.tr [Department of Chemistry, Marmara University, Istanbul (Turkey)

    2016-03-15

    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  3. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮

    2001-01-01

    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  4. Chemical abundances and kinematics of barium stars

    Science.gov (United States)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Silva, J. V. Sales

    2016-04-01

    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, alpha-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of alpha-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anti-correlated with the metallicity. Our kinematical analysis showed that 90% of the barium stars belong to the thin disk population. Based on their luminosities, none of the barium stars are luminous enough to be an AGB star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  5. Chemical abundances and kinematics of barium stars

    Science.gov (United States)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Sales Silva, J. V.

    2016-07-01

    In this paper, we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scaleheight, radial velocities, abundances of the Na, Al, α-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars cannot be represented by a single Gaussian distribution. The abundances of α-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anticorrelated with the metallicity. Our kinematical analysis showed that 90 per cent of the barium stars belong to the thin disc population. Based on their luminosities, none of the barium stars are luminous enough to be an asymptotic giant branch star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  6. Suicide with cesium 137

    International Nuclear Information System (INIS)

    Report on first case of suicide with radioactive substance in Bulgaria is given. A defectoscopist with cyclothymic structure of character and psychotraumatic family environment made a second and successful attempt at suicide, this time by means of external irradiation with 137Cs with an activity of 5.3 C in the course of two hours. He irradiated his heart region and the first three fingers of his right hand. A grave picture of acute, local irradiation injury lasting four months with lethal outcome. The authors treat the psychological motives in the behaviour of these suicides and the reasons which determine the small number of suicide carried out with radioactive substance. (author)

  7. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium...

  8. Coprecipitation of iron and silver with barium fluoride

    International Nuclear Information System (INIS)

    Distribution of trace contaminants of iron and silver at coprecipitation of barium fluoride is studied in present work. It is defined that iron almost completely coprecipitated with barium fluoride in wide range of ph 5.5-12. Silver coprecipitated with barium fluoride in ph range 4-7. The value of coprecipitation varies from 94% to 100%.

  9. Recrystallization of 223Ra with barium sulfate

    International Nuclear Information System (INIS)

    In this work, the kinetics of barium sulfate recrystallization has been studied in acidic 0.01 mol dm-3 sodium sulfate solution using 223Ra and 133Ba tracers at very low total radium concentration, i.e. less than 10-13 mol dm-3. It was found that the system follows the homogeneous recrystallization model and that recrystallization rates, inferred by the decrease of 223Ra and 133Ba in the aqueous solution, are fast. Therefore, even at very low concentrations, below the solubility limit, radium will be retained by barium sulfate-a mineral present in the deep underground repository. (author)

  10. Printed Barium Strontium Titanate capacitors on silicon

    International Nuclear Information System (INIS)

    In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography

  11. Printed Barium Strontium Titanate capacitors on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Sette, Daniele [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg); Kovacova, Veronika [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Defay, Emmanuel, E-mail: emmanuel.defay@list.lu [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg)

    2015-08-31

    In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography.

  12. Barium from a mini r-process in supernovae

    Science.gov (United States)

    Heymann, D.

    1983-01-01

    McCulloch and Wasserburg (1978) have reported nonlinear isotopic anomalies in barium for two Ca-Al-rich inclusions of the Allende carbonaceous chondrite, known as EK-1-4-1 and C-1. In an attempt to account for these anomalies, it has been proposed that Ba from an r-process of nucleosynthesis, containing Ba-135 and Ba-137, was injected into the primeval color system but was not totally homogenized. Questions arise in connection with the relations of Xe isotopes in carbonaceous chondrites. This has prompted Heymann and Dziczkaniec (1979, 1980, 1981) to study the formation of r-Xe, r-Kr, and r-Te by the mini r-process which is thought to occur in the O, Ne-rich shells of Type II supernovae. Lee et al. (1979) have studied the formation of r-Ba, r-Nd, and r-Sm by the same process. Certain differences regarding the approaches used by Lee et al. and by Heymann and Dziczkaniec make it necessary to restudy the work of Lee et al. Attention is given to the survival probabilities of nuclear species of interest, taking into accounts the elements Cs, Ba, I, and Xe.

  13. Enterogastroesophageal reflux during barium enema: Report of a case

    International Nuclear Information System (INIS)

    Enterogastric reflux during barium enema examination has been ascribed to various causes including incompetence of the ilepcecal valve, shunt, fistula, excessive barium etc. Recently we have encountered a case of complete enterogastroesphageal regurgitation during barium enema examination performed for the reduction of the ileocolic intuosusception in 6 months old baby. The regurgitation occurred only in the first of two barium enema examinations conducted at one month interval for recurring intussusception. The barium-saline solution used in the present study was not more than 350 ml in quantity. No organic or physical causes of such a complete regurgitation could be determined

  14. Decorporation of cesium-137; Decorporation du cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)

    1997-12-31

    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  15. 75 FR 19657 - Barium Chloride From China

    Science.gov (United States)

    2010-04-15

    ... Commission found that the domestic interested party group response to its notice of institution (74 FR 31757... COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Notice of Commission determination to conduct a full five-year review concerning the antidumping duty order on...

  16. Impurities in barium titanate posistor ceramics

    Czech Academy of Sciences Publication Activity Database

    Korniyenko, S. M.; Bykov, I. P.; Glinchuk, M. J.; Laguta, V. V.; Belous, A. G.; Jastrabík, Lubomír

    2000-01-01

    Roč. 239, - (2000), s. 1209-1218. ISSN 0015-0193 Institutional research plan: CEZ:AV0Z1010914 Keywords : barium titanate phase transition * ESR * positive temperature coefficient of resistivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.547, year: 2000

  17. 75 FR 20625 - Barium Chloride From China

    Science.gov (United States)

    2010-04-20

    ... established a schedule for the conduct of this review (74 FR 62587, November 30, 2010). Subsequently, counsel... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION:...

  18. Thermal decomposition of barium valerate in argon

    DEFF Research Database (Denmark)

    Torres, P.; Norby, Poul; Grivel, Jean-Claude

    2015-01-01

    The thermal decomposition of barium valerate (Ba(C4H9CO2)(2)/Ba-pentanoate) was studied in argon by means of thermogravimetry, differential thermal analysis, IR-spectroscopy, X-ray diffraction and hot-stage optical microscopy. Melting takes place in two different steps, at 200 degrees C and 280...

  19. Gamma-ray spectroscopic determination of iodine-131 and cesium-137 in foods: Two collaborative studies

    International Nuclear Information System (INIS)

    The AOAC method for iodine-131, cesium-137, and barium-140 in milk by gamma-ray spectroscopy (48.025-48.029) was extended to include other foods for the radionuclides iodine-131 and cesium-137. Two collaborative studies were performed to validate this extension. In the first study, a food sample containing 119 pCi 131I/kg and 53 pCi 137Cs/kg was sent to each of 45 laboratories for triplicate analyses. For 25 responses, the mean of the reported values was 123.8 pCi/kg for iodine-131, and for 27 responses, the mean was 53.4 pCi/kg for cesium-137. Repeatability (within-laboratory) standard deviations (Sr) for iodine-131 and cesium-137 were 4.6 and 3.7 pCi/kg, respectively. Reproducibility (among-laboratories) standard deviations (SR) for iodine-131 and cesium-137 were 12.1 and 6.0 pCi/kg, respectively. In the second study, a food sample containing 25 pCi 131I/kg and 27 pCi 137Cs/kg was sent to each of 54 laboratories for triplicate analyses. For 21 responses, the mean of the reported values was 25.0 pCi/kg for iodine-131, and for 19 responses, the mean was 28.9 pCi/kg for cesium-137. Sr Values were 4.0 and 1.6 pCi/kg for iodine-131 and cesium-137, respectively, and SR values were 5.0 and 2.8 pCi/kg, respectively. The method extension was adopted official first action

  20. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    International Nuclear Information System (INIS)

    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound

  1. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, J.P. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Duarte, G.W. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Research Group in Technology and Information, Centro Universitário Barriga Verde (UNIBAVE), Santa Catarina, SC (Brazil); Caldart, C. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Kniess, C.T. [Post-Graduate Program in Professional Master in Management, Universidade Nove de Julho, São Paulo, SP (Brazil); Montedo, O.R.K.; Rocha, M.R. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Riella, H.G. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Fiori, M.A., E-mail: fiori@unochapeco.edu.br [Post-Graduate Program in Environmental Science, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil); Post-Graduate Program in Technology and Management of the Innovation, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil)

    2015-11-15

    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound.

  2. Performance of cement solidification with barium for high activity liquid waste including sulphate

    International Nuclear Information System (INIS)

    The target liquid waste to be solidified is generated from PWR primary loop spent resin treatment with sulphate acid, so, its main constituent is sodium sulphate and the activity of this liquid is relatively high. Waste form of this liquid waste is considered to be a candidate for the subsurface disposal. The disposed waste including sulphate is anticipated to rise a concentration of sulphate ion in the ground water around the disposal facility and it may cause degradation of materials such as cement and bentonite layer and comprise the disposal facility. There could be two approaches to avoid this problem, the strong design of the disposal facility and the minimization of sulphaste ion migration from the solidified waste. In this study, the latter approach was examined. In order to keep the low concentration of sulphate ion in the ground water, it is effective to make barium sulphate by adding barium compound into the liquid waste in solidification. However, adding equivalent amount of barium compound with sulphate ion causes difficulty of mixing, because production of barium sulphate causes high viscosity. In this study, mixing condition after and before adding cement into the liquid waste was estimated. The mixing condition was set with consideration to keep anion concentration low in the ground water and of mixing easily enough in practical operation. Long term leaching behavior of the simulated solidified waste was also analyzed by PHREEQC. And the concentration of the constitution affected to the disposal facility was estimated be low enough in the ground water. (author)

  3. Suicide with 137 cesium

    International Nuclear Information System (INIS)

    A case report is presented of suicide by radiation exposure after a preceding attempt with potassium ferrocyanide. The subject, a 30-year-old nondestructive-testing technician, held with his right fingers and then placed in his left shirt pocket a metal-canned 5,3-Ci 137Cs source. Despite appearance of signs of severe topical injury by day 3 after the incident and development of systemic toxicity symptoms with indications of affection of internal organs by day 16, medical aid was not sought until day 21 when efforts at management proved unable to prevent fatal outcome. A prominent distinguishing characteristic of this mode of suicide is that the deed's sequelae are delayed in coming into effect. Cases known to have occurred are extremely rare (only two have been described in the literature). This is likely to be related to a distinct unpopularity of radioactive materials as well as their limited availability to the general public. The subjects that did use them were radiation workers having access to such substances; being acquainted with the biological effects of radiation, they, nevertheless, have chosen this protracted and distressful way of taking their lives. (A.B.)

  4. Recovery and purification of 4.66 TBq(126 Ci) of 137Cs from a 20-year-old spent sealed source

    International Nuclear Information System (INIS)

    An attempt to recover and purify 4.66 TBq(126 Ci) of 137Cs as solution from a 20-year-old doubly encapsulated sealed source containing 137CsCl was made successfully. The primary capsule was first cut open to retrieve the secondary capsule. The top end of the secondary SS capsule was then cut to render it as an open cylinder and the 137CsCl pellet inside was dissolved in small aliquots of water. Each aliquot of the 137CsCl solution was dispensed into glass vials, sealed, assayed and stored. Barium formed during the radioactive decay of 137Cs was removed by carbonate precipitation. Chloride was removed by heating with HNO3 and evaporation. About 91.8% of the total activity could be recovered and used subsequently for making brachytherapy sources.

  5. Standardization of 137 Cs+137m Ba by Liquid Scintillation

    International Nuclear Information System (INIS)

    A procedure for the preparation of a stable, homogeneous solution of ''137 Cs+''137m Ba, for use in liquid scintillation measurements, is described. Its count rate stability and spectral time evolution has been followed for several weeks. The solution has been standardised by the CIEMAT/NIST method in both Ultima-Gold and Insta-Gel, to a combined uncertainty lower than 0,51% (k=1)

  6. Liquid-Phase Processing of Barium Titanate Thin Films

    Science.gov (United States)

    Harris, David Thomas

    . Our system exhibits flux-film-substrate interactions that can lead to dramatic changes to the microstructure. This effect is especially pronounced onc -sapphire, with Al diffusion from the substrate leading to formation of an epitaxial BaAl2O4 second phase at the substrate-film interface. The formation of this second phase in the presence of a liquid phase seeds {111} twins that drive abnormal grain growth. The orientation of the sapphire substrate determines the BaAl2O 4 morphology, enabling control the abnormal grain growth behavior. CuO additions leads to significant grain growth at 900 °C, with average grain size approaching 500 nm. The orthorhombic-tetragonal phase transition is clearly observable in temperature dependent measurements and both linear and nonlinear dielectric properties are improved. All films containing CuO are susceptible to aging. A number of other systems were investigated for efficacy at temperatures below 900 °C. Pulsed laser deposition was used to study flux + BaTiO 3 targets, layered flux films, and in situ liquids. RF-magnetron sputtering using a dual-gun approach was used to explore integration on flexible foils with Ba1-xSrxTiO3. Many of these systems were based on the BaO-B2O3 system, which has proven effective in thin films, multilayer ceramic capacitors, and bulk ceramics. Modifiers allow tailoring of the microstructure at 900 °C, however no compositions were found, and no reports exist in the open literature, that provide significant grain growth or densification below 900 °C. Liquid phase fluxes offer a promising path forward for low temperature processing of barium titanate, with the ultimate goal of integration with metalized silicon substrates. This work demonstrates significant improvements to dielectric properties and the necessity of understanding interactions in the film-flux-substrate system.

  7. Radioactive Barium Ion Trap Based on Metal-Organic Framework for Efficient and Irreversible Removal of Barium from Nuclear Wastewater.

    Science.gov (United States)

    Peng, Yaguang; Huang, Hongliang; Liu, Dahuan; Zhong, Chongli

    2016-04-01

    Highly efficient and irreversible capture of radioactive barium from aqueous media remains a serious task for nuclear waste disposal and environmental protection. To address this task, here we propose a concept of barium ion trap based on metal-organic framework (MOF) with a strong barium-chelating group (sulfate and sulfonic acid group) in the pore structures of MOFs. The functionalized MOF-based ion traps can remove >90% of the barium within the first 5 min, and the removal efficiency reaches 99% after equilibrium. Remarkably, the sulfate-group-functionalized ion trap demonstrates a high barium uptake capacity of 131.1 mg g(-1), which surpasses most of the reported sorbents and can selectively capture barium from nuclear wastewater, whereas the sulfonic-acid-group-functionalized ion trap exhibits ultrafast kinetics with a kinetic rate constant k2 of 27.77 g mg(-1) min(-1), which is 1-3 orders of magnitude higher than existing sorbents. Both of the two MOF-based ion traps can capture barium irreversibly. Our work proposes a new strategy to design barium adsorbent materials and provides a new perspective for removing radioactive barium and other radionuclides from nuclear wastewater for environment remediation. Besides, the concrete mechanisms of barium-sorbent interactions are also demonstrated in this contribution. PMID:26999358

  8. Prospects for Barium Tagging in Gaseous Xenon

    International Nuclear Information System (INIS)

    Tagging events with the coincident detection of a barium ion would greatly reduce the background for a neutrino-less double beta decay search in xenon. This paper describes progress towards realizing this goal. It outlines a source that can produce large quantities of Ba++ in gas, shows that this can be extracted to vacuum, and demonstrates a mechanism by which the Ba++ can be efficiently converted to Ba+ as required for laser identification.

  9. Production of translationally cold barium monohalide ions

    OpenAIRE

    DePalatis, M. V.; Chapman, M.S.

    2013-01-01

    We have produced sympathetically cooled barium monohalide ions BaX$^+$ (X = F, Cl, Br) by reacting trapped, laser cooled Ba$^+$ ions with room temperature gas phase neutral halogen-containing molecules. Reaction rates for two of these (SF$_6$ and CH$_3$Cl) have been measured and are in agreement with classical models. BaX$^+$ ions are promising candidates for cooling to the rovibrational ground state, and our method presents a straightforward way to produce these polar molecular ions.

  10. Chemical abundances and kinematics of barium stars

    CERN Document Server

    de Castro, D B; Roig, F; Jilinski, E; Drake, N A; Chavero, C; Silva, J V Sales

    2016-01-01

    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, $alpha$-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code {\\sc moog}. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of $alpha$-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heav...

  11. Barium hexaferrite nanoparticles: Synthesis and magnetic properties

    Energy Technology Data Exchange (ETDEWEB)

    Martirosyan, K.S., E-mail: karen.martirosyan@utb.edu [Department of Chemical and Biomolecular Engineering, University of Houston, Houston, TX 77204 (United States); Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Department of Electrical and Computer Engineering, University of Houston, Houston, TX 77204 (United States); Galstyan, E. [Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Hossain, S.M.; Wang Yiju [Department of Electrical and Computer Engineering, University of Houston, Houston, TX 77204 (United States); Litvinov, D. [Department of Chemical and Biomolecular Engineering, University of Houston, Houston, TX 77204 (United States); Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Department of Electrical and Computer Engineering, University of Houston, Houston, TX 77204 (United States)

    2011-01-15

    Carbon combustion synthesis is applied to rapid and energy efficient fabrication of crystalline barium hexaferrite nanoparticles with the average particle size of 50-100 nm. In this method, the exothermic oxidation of carbon nanoparticles with an average size of 5 nm with a surface area of 80 m{sup 2}/g generates a self-propagating thermal wave with maximum temperatures of up to 1000 deg. C. The thermal front rapidly propagates through the mixture of solid reactants converting it to the hexagonal barium ferrite. Carbon is not incorporated in the product and is emitted from the reaction zone as a gaseous CO{sub 2}. The activation energy for carbon combustion synthesis of BaFe{sub 12}O{sub 19} was estimated to be 98 kJ/mol. A complete conversion to hexagonal barium ferrite is obtained for carbon concentration exceeding 11 wt.%. The magnetic properties H{sub c}{approx}3000 Oe and M{sub s}{approx}50.3 emu/g of the compact sintered ferrites compare well with those produced by other synthesis methods.

  12. Barium hexaferrite nanoparticles: Synthesis and magnetic properties

    International Nuclear Information System (INIS)

    Carbon combustion synthesis is applied to rapid and energy efficient fabrication of crystalline barium hexaferrite nanoparticles with the average particle size of 50-100 nm. In this method, the exothermic oxidation of carbon nanoparticles with an average size of 5 nm with a surface area of 80 m2/g generates a self-propagating thermal wave with maximum temperatures of up to 1000 deg. C. The thermal front rapidly propagates through the mixture of solid reactants converting it to the hexagonal barium ferrite. Carbon is not incorporated in the product and is emitted from the reaction zone as a gaseous CO2. The activation energy for carbon combustion synthesis of BaFe12O19 was estimated to be 98 kJ/mol. A complete conversion to hexagonal barium ferrite is obtained for carbon concentration exceeding 11 wt.%. The magnetic properties Hc∼3000 Oe and Ms∼50.3 emu/g of the compact sintered ferrites compare well with those produced by other synthesis methods.

  13. Lanthanide doped strontium-barium cesium halide scintillators

    Science.gov (United States)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew

    2015-06-09

    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  14. Spasmolytic effect of peppermint oil in barium during double-contrast barium enema compared with Buscopan

    Energy Technology Data Exchange (ETDEWEB)

    Asao, T.; Kuwano, H.; Ide, M.; Hirayama, I.; Nakamura, J.-I.; Fujita, K.-I.; Horiuti, R

    2003-04-01

    AIM: To evaluate the efficacy of peppermint oil in barium as a spasmolytic agent during a double-contrast barium enema (DCBE). MATERIALS AND METHODS: A total of 383 DCBEs with positive results from occult blood tests were assessed. Patients were assigned to one of four groups: peppermint in barium (n=91), peppermint in tube (n=90), Buscopan (n=105), or no treatment (n=97). After a screening sigmoidoscopy, the DCBEs were performed using air as a distending gas. In the Buscopan group, the DCBE was performed with an intramuscular injection of 20 mg Buscopan at the start of the examination. Patients in the no-treatment group underwent DCBE without any spasmolytic agent. A peppermint oil preparation (30 ml) was mixed in the barium solution for patients in the peppermint-in-barium group, and the same dose of peppermint oil was included in the enema tube in the peppermint-in-tube group. The presence of spasm on a series of spot films was evaluated without information about the type of spasmolytic agent used. RESULTS: The percentage of patients in the four groups (no treatment, Buscopan, peppermint in tube, and peppermint in barium) with absence of spasm in the entire colon on the series of spot films was 13.4, 38.1, 41.8, and 37.8%, respectively. In the group using peppermint oil or Buscopan, the rate of patients with non-spasm examination was higher than that in no-treatment group (p<0.0005). Peppermint oil had the same spasmolytic effect as the systemic administration of Buscopan in the transverse and descending colon. Peppermint oil had a stronger effect in the caecum and the ascending colon than a Buscopan injection (p<0.005). There was no advantage to placing peppermint oil in the enema tube over mixing it in the barium solution. A total of 157 polyps were found during the DCBE procedures, and no differences were observed in the number of lesions among the four groups. Peppermint oil did not impair image quality. CONCLUSION: Barium solution mixed with peppermint oil

  15. 137Cs metabolism during pregnancy

    International Nuclear Information System (INIS)

    Data from two pregnant women contaminated with 137 Cs, body burdens of 0.2 and 300 MBq, respectively, at the time of the Goiania accident, were compared. The first one, with lower 137 Cs body burden was exposed during the fourth month of pregnancy, while the second became pregnant three years and eight months after 137 Cs intake. For the first woman 137 Cs concentrations were similar for the mother, infant and placenta, indicating an easy and homogeneous transport of 137 Cs from mother to fetus. The whole-body monitoring data from the second woman, who became pregnant four years after intake, did not show a reduction in biological half-life during the pregnancy. Cs concentration in the mother was found to be 13 times higher than in the infant. One possible reason for this result is that four after intake. Cs is supposed to be concentrated mainly in skeletal muscle tissue. During the pregnancy the blood flux becomes higher in most of organs and tissues except brain, liver and skeletal muscle tissue. In this case, the physiological changes due to pregnancy did not modify the cesium retention. (author)

  16. Barium enema findings of milk allergy in infants

    International Nuclear Information System (INIS)

    We wanted to evaluate the barium enema findings of milk allergy in infants. Retrospective evaluation of the plain abdominal radiography and barium enema findings was performed in fifteen young infants suffering with milk allergy. The presence of gaseous distension, rectal gas, paralytic ileus and mechanical obstruction was evaluated on the plain radiography. The presence of spasm, a transitional zone, a reversed rectosigmoid index and mucosal irregularity was analyzed on the barium enema; the presence of barium retention was also evaluated on 24-hour-delayed plain radiography. Paralytic ileus was the most common finding on the plain radiography (93%). On the barium enema, continuous spasm of the colon, ranging from the rectum to the descending colon, was revealed in ten infants (67%). A transitional zone was observed in one infant and a reversed rectosigmoid index was revealed in four. Mucosal irregularity was observed in two infants. Barium retention was demonstrated in 11 of fifteen cases: throughout the entire colon (n = 3), from the rectum to the descending colon (n = 7), and up to the transverse colon (n = 1). The most common barium enema finding of milk allergy in infants was spasm of the distal colon. The other findings were a transitional zone, a reversed rectosigmoid index, mucosal irregularity and barium retention

  17. Synthesis of double perxenate of lanthanum and barium

    International Nuclear Information System (INIS)

    Synthesis of double perxenate of lanthanum and barium on the basis of sodium perxenate and lanthanum and barium acetates, is described. The obtained compound is characterized by means of element analysis, x-ray-electron-, IR- and RS-spectroscopy. Its thermal stability and water solubility are determined

  18. BARIUM IN TEETH AS INDICATOR OF BODY BURDEN

    Science.gov (United States)

    A study was conducted to determine the biological availability of naturally occurring barium in a municipal drinking water by the analysis of barium in deciduous teeth of children. The grade school children of two Illinois towns were chosen for the study. The towns were chosen ba...

  19. Industrial treatment of solutions of fission products. Separation of caesium-137

    International Nuclear Information System (INIS)

    Two types of chemical treatment can be considered for the manufacture of solid sources for industrial uses from fission product solutions remaining after plutonium extraction: a) concentration of the solution and preparation of solid sources from the bulk material, without separation, b) separation of one or several fission products from which the sources are made. Examination of the radio-chemical composition of the mixture of fission products that will be available from the Marcoule reactors (G1, G2 and G3) shows that caesium-137 accounts for 30 per cent of the γ energy available immediately after the plutonium separation, 70 per cent two years after and 100 per cent after five years. There is practically no advantage in making sources from bulk fission products, since the separation of caesium-137 is no more complicated and yet it results in a material with more potential uses. The separation of caesium-137 by a method based on the standard phospho-tungstate precipitation method has been considered. Previously, the precipitated caesium phospho-tungstate was dissolved and caesium was recovered from the solution by cation-exchange or by removal of phosphate and tungstate ions by anion-exchange. A study has now been made, of the metathesis of caesium phospho-tungstate to barium phosphate and tungstate by the action of barium hydroxide, the caesium being obtained in solution as the hydroxide. The advantages of this new procedure are: - greater decontamination of caesium-137 without further purification, - possibility of direct transformation to caesium sulphate, - general simplification of the procedure and, consequently, of the equipment. (author)

  20. Immunotherapy with Agonistic Anti-CD137: Two Sides of a Coin

    Institute of Scientific and Technical Information of China (English)

    YonglianSun; JonathanH.Chen; YangxinFu

    2004-01-01

    CD137 (4-1BB), a member of the TNF receptor superfamily, is an inducible T cell costimulatory receptor primarily expressed on activated CD4+ and CD8+ T cells. Agonistic monoclonal antibodies (mAbs) against CD137 greatly enhance T cell-mediated immune responses against many types of tumors and viruses. Surprisingly, these agonists also showed therapeutic effects in several autoimmune diseases. These findings suggest that in different disease environments, CD137 engagement with agonist mAb in vivo can diametrically modulate immune response outcomes. Therefore, CD137 agonists represent a promising immunotherapeutic approach to a wide array of disparate immune disorders. However, CD137's potency in modulating immune response necessitates caution when targeting CD137 clinically. Cellular & Molecular Immunology. 2004;1(1):31-36.

  1. Immunotherapy with Agonistic Anti-CD137: Two Sides of a Coin

    Institute of Scientific and Technical Information of China (English)

    Yonglian Sun; Jonathan H.Chen; Yangxin Fu

    2004-01-01

    CD137 (4-1BB), a member of the TNF receptor superfamily, is an inducible T cell costimulatory receptor primarily expressed on activated CD4+ and CD8+ T cells. Agonistic monoclonal antibodies (mAbs) against CD137 greatly enhance T cell-mediated immune responses against many types of tumors and viruses. Surprisingly, these agonists also showed therapeutic effects in several autoimmune diseases. These findings suggest that in different disease environments, CD137 engagement with agonist mAb in vivo can diametrically modulate immune response outcomes. Therefore, CD137 agonists represent a promising immunotherapeutic approach to a wide array of disparate immune disorders. However, CD137's potency in modulating immune response necessitates caution when targeting CD137 clinically. Cellular & Molecular Immunology. 2004;1(1):31-36.

  2. Colour centres in barium hexaaluminate (phase I)

    International Nuclear Information System (INIS)

    Colour centres produced by X-ray irradiation of barium hexaaluminate (phase I) with β-alumina structure are studied by electron paramagnetic resonance, optical absorption, and thermally stimulated luminescence. It is shown that in addition to the F+ centres characteristic of β-alumina phases, this compound presents other colour centres such as F, O-, and possibly V-type centres. The stability of these defects is investigated by means of thermal bleaching experiments and thermally stimulated luminescence. An alternative model to the generally accepted one is proposed, for the F+ centres, together with a mechanism of defect formation. (author)

  3. Short-cavity squeezing in barium

    Science.gov (United States)

    Hope, D. M.; Bachor, H-A.; Manson, P. J.; Mcclelland, D. E.

    1992-01-01

    Broadband phase sensitive noise and squeezing were experimentally observed in a system of barium atoms interacting with a single mode of a short optical cavity. Squeezing of 13 +/- 3 percent was observed. A maximum possible squeezing of 45 +/- 8 percent could be inferred for out experimental conditions, after correction for measured loss factors. Noise reductions below the quantum limit were found over a range of detection frequencies 60-170 MHz and were best for high cavity transmission and large optical depths. The amount of squeezing observed is consistent with theoretical predictions from a full quantum statistical model of the system.

  4. Duodenal diverticula demonstrated by barium examination

    Energy Technology Data Exchange (ETDEWEB)

    Christiansen, T.; Thommesen, P.

    An investigation for biliary tract calculi and food-stimulated gastro-oesophageal reflux was carried out in 37 patients with duodenal diverticula demonstrated by barium examination. Sixty per cent of the diverticula were located in the descending part of the duodenum. Biliary tract calculi were demonstrated in 38 per cent and food-stimulated gastro-oesophageal reflux in 81 per cent of the patients. The detection of a duodenal diverticulum should result in a supplementary investigation for gallstones and gastrooesophageal reflux and its sequelae.

  5. Barium dithionate as an EPR dosemeter.

    Science.gov (United States)

    Baran, M P; Bugay, O A; Kolesnik, S P; Maksimenko, V M; Teslenko, V V; Petrenko, T L; Desrosiers, M F

    2006-01-01

    Electron paramagnetic resonance (EPR) dosimetry is growing in popularity and this success has encouraged the search for other dosimetric materials. Previous studies of gamma-irradiated barium dithionate (BaS(2)O(6) x 2H(2)O) have shown promise for its use as a radiation dosemeter. This work studies in greater detail several essential attributes of the system. Special attention has been directed to the study of EPR response dependences on microwave power, irradiation temperature, minimum detectable dose and post-irradiation stability. PMID:16565205

  6. Scattering lengths of calcium and barium isotopes

    OpenAIRE

    Dammalapati, U.; Willmann, L.; Knoop, S.

    2011-01-01

    We have calculated the s-wave scattering length of all the even isotopes of calcium (Ca) and barium (Ba), in order to investigate the prospect of Bose-Einstein condensation (BEC). For Ca we have used an accurate molecular potential based on detailed spectroscopic data. Our calculations show that Ca does not provide other isotopes alternative to the recently Bose condensed 40Ca that suffers strong losses because of a very large scattering length. For Ba we show by using a model potential that ...

  7. Redistribution of cesium-137 in southeastern watersheds

    International Nuclear Information System (INIS)

    Sediment samples from 14 southeastern agricultural reservoirs and surface samples from representative soils from the contributing water shed areas were analyzed for 137Cs. The concentrations of 137Cs measured reflect the nature of the watershed, its cover, its use, and man's activities. Since the redistribution of 137Cs was assumed to result from soil erosion, recent erosion rates can be calculated from the measured 137Cs accumulations in sediments and from the decreases in the 137Cs calculated to have been deposited on upland soils. Measured concentrations of 137Cs ranged from 14 to 158 nCi/m2 in surface soils. As much as 525 nCi/m2 of 137Cs was measured in the deposited sediment profile. Watershed budgets for 137Cs were calculated for three representative watersheds using available sediment survey information and the measured 137Cs concentrations

  8. Barium cardiotoxicity: Relationship between ultrastructural damage and mechanical effects.

    Science.gov (United States)

    Delfino, G; Amerini, S; Mugelli, A

    1988-01-01

    The ultrastructural damage in guinea-pig ventricular strips caused by barium was analysed. At a concentration of 1 mmol/litre, barium chloride caused a dramatic increase in the developed tension associated with the onset of automaticity. The ultrastructural analysis demonstrated that barium caused notable and consistent alterations which affected most myocyte components. Various degenerative aspects were observed in mitochondria and in the contractile apparatus. Glycogen deposits were completely depleted. Preparations driven at 4 Hz (i.e. the rate of spontaneous firing of barium-treated preparations) showed moderate ultrastructural alterations, thus demonstrating that the increase in the rate of beating is not the only determinant of the observed damage. These results suggest that the myocardial toxicity of barium is due not only to the well-known modifications in membrane permeability, but possibly also to alterations in cell function. PMID:20702358

  9. Barium and radium migration in unconsolidated Canadian geological materials

    International Nuclear Information System (INIS)

    This report describes the results of laboratory studies on the distribution coefficients of radium and barium in samples of unconsolidated geologic materials. Graphs of Ksub(d) versus solution concentration for the respective elements showed constant Ksub(d) values in the low concentration range suggesting that, at low concentrations, a distribution coefficient is a valid means of representing the geochemical reactions of both barium and radium. The Ksub(d) values for barium range between 60 and 3500 ml/g. The values appear to be influenced by the amount of barium occurring naturally in the soil materials and thus there is little possiblility of using barium as an analog of radium in laboratory experiments. The Ksub(d) values of radium vary from 50 to 1000 ml/g indicating that a wide range of geological materials have a substantial capacity to retard the migration of radium

  10. The Novel Formation of Barium Titanate Nanodendrites

    Directory of Open Access Journals (Sweden)

    Chien-Jung Huang

    2014-01-01

    Full Text Available The barium titanate (BaTiO3 nanoparticles with novel dendrite-like structures have been successfully fabricated via a simple coprecipitation method, the so-called BaTiO3 nanodendrites (BTNDs. This method was remarkable, fast, simple, and scalable. The growth solution is prepared by barium chloride (BaCl2, titanium tetrachloride (TiCl4, and oxalic acid. The shape and size of BaTiO3 depend on the amount of added BaCl2 solvent. To investigate the influence of amount of BaCl2 on BTNDs, the amount of BaCl2 was varied in the range from 3 to 6 mL. The role of BaCl2 is found to have remarkable influence on the morphology, crystallite size, and formation of dendrite-like structures. The thickness and length of the central stem of BTND were ~300 nm and ~20 μm, respectively. The branchings were found to occur at irregular intervals along the main stem. Besides, the formation mechanism of BTND is proposed and discussed.

  11. High resolution studies of barium Rydberg states

    International Nuclear Information System (INIS)

    The subtle structure of Rydberg states of barium with orbital angular momentum 0, 1, 2 and 3 is investigated. Some aspects of atomic theory for a configuration with two valence electrons are reviewed. The Multi Channel Quantum Defect Theory (MQDT) is concisely introduced as a convenient way to describe interactions between Rydberg series. Three high-resolution UV studies are presented. The first two, presenting results on a transition in indium and europium serve as an illustration of the frequency doubling technique. The third study is of hyperfine structure and isotope shifts in low-lying p states in Sr and Ba. An extensive study of the 6snp and 6snf Rydberg states of barium is presented with particular emphasis on the 6snf states. It is shown that the level structure cannot be fully explained with the model introduced earlier. Rather an effective two-body spin-orbit interaction has to be introduced to account for the observed splittings, illustrating that high resolution studies on Rydberg states offer an unique opportunity to determine the importance of such effects. Finally, the 6sns and 6snd series are considered. The hyperfine induced isotope shift in the simple excitation spectra to 6sns 1S0 is discussed and attention is paid to series perturbers. It is shown that level mixing parameters can easily be extracted from the experimental data. (Auth.)

  12. NANOSCALE BARIUM HYDROSILICATES: CHOOSING THE SYNTHESIS TECHNOLOGY

    Directory of Open Access Journals (Sweden)

    GRISHINA Anna Nikolaevna

    2013-08-01

    Full Text Available Cement concretes are the most used materials in modern civil engineering. Due to that such materials draw great attention both in the Russian Federation and abroad. The possibility to enhance the manufacturability and operational properties of concretes results in significant reduction of overall operating costs. Many enhancement methods have been elaborated. Among them there is one based on introduction of calcium hydrosilicates into construction composition. The authors set up a hypothesis that similarity between properties and structures of different hydrosilicates (for example, alkaline earth metals and metals of the second group will provide similar increased operational characteristics. The specialists of Research and Educational Center «Nanotechnology» are developing cement composites nanomodification methods which include introduction of nanodimensional barium hydrosilicates particles. The synthesis of barium hydrosilicates particles can be done with the use of many technologies, different by energy consumption or performing complexity. Taking into account both these factors, one can assume that low-temperature sol-gel synthesis from diluted water solutions is the proper technology. The present paper shows that this assumption is correct. The selection of certain technology is made by the means of multiobjective optimization, which is in turn is performed by the means of linear scalarization. This method, while not always giving the Pareto optimal solutions, can be easily implemented. The particle size distribution is taken into consideration during selection of objectives and weights. It is shown that selected technology allows manufacturing nanoparticles with median size about 30 nm.

  13. Coprecipitation of europium with barium sulphate

    International Nuclear Information System (INIS)

    The distribution behaviour of the trivalent europium ion at a micro-component scale, between barium sulphate and aqueous solution, was studied at ambient temperature. Experiments were carried out using radioactive tracers. Results indicate an enrichment of the micro component in the solid phase relative to the solution. The effects of the concentrations of the micro and macro-elements on the coprecipitation have been examined. Europium distribution coefficient DEu increases from 1.1 ± 0.2 to 3.2 ± 0.4 when initial europium concentration decreases from more than 17 x 10-5 to 1.4 x 10-5 M, in sulphuric media with SO42- in excess or CBa2+/CSO42- Eu. The coprecipitation of europium with barium sulphate as a heterovalent solid-solution is described by heterogeneous model obeying the Doerner and Hoskins logarithmic partition law. The weaker partition coefficients lower than unity (λ = 0.25 when CEu(III) ∼ 1.4 x 10-5 M and λ = 0.13 when CBa2+/CSO42- -5 ≤ CEu(III) = 153.5 x 10-5 M) lead to crystals increasingly enriched in the trace element. (orig.)

  14. Do all barium stars have a white dwarf companion?

    Science.gov (United States)

    Dominy, J. F.; Lambert, D. L.

    1983-01-01

    International Ultraviolet Explorer short-wavelength, low-dispersion spectra were analyzed for four barium, two mild barium, and one R-type carbon star in order to test the hypothesis that the barium and related giants are produced by mass transfer from a companion now present as a white dwarf. An earlier tentative identification of a white dwarf companion to the mild barium star Zeta Cyg is confirmed. For the other stars, no ultraviolet excess attributable to a white dwarf is seen. Limits are set on the bolometric magnitude and age of a possible white dwarf companion. Since the barium stars do not have obvious progenitors among main-sequence and subgiant stars, mass transfer must be presumed to occur when the mass-gaining star is already on the giant branch. This restriction, and the white dwarf's minimum age, which is greater than 8 x 10 to the 8th yr, determined for several stars, effectively eliminates the hypothesis that mass transfer from an asymptotic giant branch star creates a barium star. Speculations are presented on alternative methods of producing a barium star in a binary system.

  15. Cesium-137, a drama recounted; Cesio-137, um drama recontado

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Suzane de Alencar

    2013-01-15

    The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)

  16. Designed microstructures in textured barium hexaferrite

    Science.gov (United States)

    Hovis, David Brian

    It is a fundamental principle of materials science that the microstructure of a material defines its properties and ultimately its performance for a given application. A prime example of this can be found in the large conch shell Strombus gigas, which has an intricate microstructure extending across five distinct length scales. This microstructure gives extraordinary damage tolerance to the shell. The structure of Strombus gigas cannot be replicated in a modern engineering ceramic with any existing processing technique, so new processing techniques must be developed to apply this structure to a model material. Barium hexaferrite was chosen as a model material to create microstructures reminiscent of Strombus gigas and evaluate its structure-property relations. This work describes novel processing methods to produce textured barium hexaferrite with no coupling between the sample geometry and the texture direction. This technique, combining magnetic field-assisted gelcasting with templated grain growth, also allows multilayer samples to be fabricated with different texture directions in adjacent layers. The effects of adding either B2O3 or excess BaCO 3 on the densification and grain growth of barium hexaferrite was studied. The texture produced using this technique was assessed using orientation imaging microscopy (OIM) at Oak Ridge National Laboratory. These measurements showed peak textures as high as 60 MRD and sharp interfaces between layers cast with different texture directions. The effect of oxygen on the quality of gelcasting is also discussed, and it is shown that with proper mold design, it is possible to gelcast multiple layers with differing texture directions without delamination. Monolithic and multilayer samples were produced and tested in four point bending to measure the strength and work of fracture. Modulus measurements, made with the ultrasonic pulse-echo technique, show clear signs of microcracking in both the isotropic and textured samples

  17. 7 CFR 58.137 - Excluded milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Excluded milk. 58.137 Section 58.137 Agriculture... Milk § 58.137 Excluded milk. A plant shall not accept milk from a producer if: (a) The milk has been in...) Three of the last five milk samples have exceeded the maximum bacterial estimate of 500,000 per...

  18. 21 CFR 137.105 - Flour.

    Science.gov (United States)

    2010-04-01

    ... Related Products § 137.105 Flour. (a) Flour, white flour, wheat flour, plain flour, is the food prepared... any natural deficiency of enzymes, malted wheat, malted wheat flour, malted barley flour, or any... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Flour. 137.105 Section 137.105 Food and Drugs...

  19. 21 CFR 137.175 - Phosphated flour.

    Science.gov (United States)

    2010-04-01

    ... Related Products § 137.175 Phosphated flour. Phosphated flour, phosphated white flour, and phosphated wheat flour, conform to the definition and standard of identity, and are subject to the requirements for... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Phosphated flour. 137.175 Section 137.175 Food...

  20. 25 CFR 137.6 - Power development.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Power development. 137.6 Section 137.6 Indians BUREAU OF... CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.6 Power development. The cost of the power development at... power development shall be disposed of as required by the terms and conditions of the act of March...

  1. 21 CFR 137.190 - Cracked wheat.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cracked wheat. 137.190 Section 137.190 Food and... Related Products § 137.190 Cracked wheat. Cracked wheat is the food prepared by so cracking or cutting into angular fragments cleaned wheat other than durum wheat and red durum wheat that, when tested...

  2. 21 CFR 137.195 - Crushed wheat.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Crushed wheat. 137.195 Section 137.195 Food and... Related Products § 137.195 Crushed wheat. Crushed wheat, coarse ground wheat, is the food prepared by so crushing cleaned wheat other than durum wheat and red durum wheat that, when tested by the...

  3. 14 CFR 137.41 - Personnel.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Personnel. 137.41 Section 137.41 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS... Operating Rules § 137.41 Personnel. (a) Information. The holder of an agricultural aircraft...

  4. 5 CFR 185.137 - Initial decision.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Initial decision. 185.137 Section 185.137 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.137 Initial decision. (a) The ALJ shall issue an initial decision based only on the record,...

  5. 7 CFR 4279.137 - Financial statements.

    Science.gov (United States)

    2010-01-01

    ... accordance with Generally Accepted Accounting Principles will be required. (b) If specific circumstances... 7 Agriculture 15 2010-01-01 2010-01-01 false Financial statements. 4279.137 Section 4279.137... § 4279.137 Financial statements. (a) The lender will determine the type and frequency of submission...

  6. 45 CFR 96.137 - Payment schedule.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Payment schedule. 96.137 Section 96.137 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION BLOCK GRANTS Substance Abuse Prevention and Treatment Block Grant § 96.137 Payment schedule. (a) The Block Grant money that may be...

  7. 21 CFR 211.137 - Expiration dating.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Expiration dating. 211.137 Section 211.137 Food... § 211.137 Expiration dating. (a) To assure that a drug product meets applicable standards of identity, strength, quality, and purity at the time of use, it shall bear an expiration date determined...

  8. Chemical composition of Eu2+ luminescence in the barium hexaaluminates

    International Nuclear Information System (INIS)

    This paper consists of two parts. In the first part the chemical composition of two kinds of barium hexaaluminate (one poor and one rich in barium) is explained using the local electroneutrality concept. In the second part a reinvestigation of the Eu2+ luminescence in these compounds is reported. The emission spectrum of each of the two compounds shows a blue and a green emission bank. The blue emission bank is ascribed to Eu2+ ions at barium sites, whereas the green emission band is identified with Eu2+ ions incorporated at aluminum sites within spinel blocks of the structure

  9. Magic Wavelength of an Optical Clock Transition of Barium

    International Nuclear Information System (INIS)

    Similar to most of the other alkaline earth elements, barium atoms can be candidates for optical clocks, thus the magic wavelength for an optical lattice is important for the clock transition. We calculate the magic wavelength of a possible clock transition between 6s21S0 and 6s5d3 D2 states of barium atoms. Our theoretical result shows that there are three magic wavelengths 615.9nm, 641.2nm and 678.8nm for a linearly polarized optical lattice laser for barium. (atomic and molecular physics)

  10. The schizophrenia risk gene product miR-137 alters presynaptic plasticity.

    Science.gov (United States)

    Siegert, Sandra; Seo, Jinsoo; Kwon, Ester J; Rudenko, Andrii; Cho, Sukhee; Wang, Wenyuan; Flood, Zachary; Martorell, Anthony J; Ericsson, Maria; Mungenast, Alison E; Tsai, Li-Huei

    2015-07-01

    Noncoding variants in the human MIR137 gene locus increase schizophrenia risk with genome-wide significance. However, the functional consequence of these risk alleles is unknown. Here we examined induced human neurons harboring the minor alleles of four disease-associated single nucleotide polymorphisms in MIR137. We observed increased MIR137 levels compared to those in major allele-carrying cells. microRNA-137 gain of function caused downregulation of the presynaptic target genes complexin-1 (Cplx1), Nsf and synaptotagmin-1 (Syt1), leading to impaired vesicle release. In vivo, miR-137 gain of function resulted in changes in synaptic vesicle pool distribution, impaired induction of mossy fiber long-term potentiation and deficits in hippocampus-dependent learning and memory. By sequestering endogenous miR-137, we were able to ameliorate the synaptic phenotypes. Moreover, reinstatement of Syt1 expression partially restored synaptic plasticity, demonstrating the importance of Syt1 as a miR-137 target. Our data provide new insight into the mechanism by which miR-137 dysregulation can impair synaptic plasticity in the hippocampus. PMID:26005852

  11. A novel barium polymeric membrane sensor for selective determination of barium and sulphate ions based on the complex ion associate barium(II)-Rose Bengal as neutral ionophore

    Energy Technology Data Exchange (ETDEWEB)

    Othman, A.M. [Genetic Engineering and Biotechnology Research Institute (GEBRI), Minufiya University, Sadat City (Egypt); El-Shahawi, M.S. [Chemistry Department, Faculty of Science at Damiatta, Mansoura University, Damiatta, Dumyat 34517 (Egypt)]. E-mail: mohammad_el_shahawi@yahoo.co.uk; Abdel-Azeem, M. [Chemistry Department, Faculty of Science at Damiatta, Mansoura University, Damiatta, Dumyat 34517 (Egypt)

    2006-01-12

    A simple, long life, rapid response and sensitive barium(II)-PVC membrane sensor that typically follows Nernstian behavior has been developed for the assay of barium(II) ions. The developed sensor has been made by incorporating the complex ion associate of barium(II)-Rose Bengal (Ba-RB) as an ionophore into a plasticized PVC matrix. The sensor is stable and exhibited fast potential response of 20 s and gave a good linear response with a Nernstian slope of 28.5 {+-} 0.4 mV/decade of activity within the concentration range 5 x 10{sup -5} to 10{sup -1} M over a wide range of pH 4.5-10.0 for barium(II) ions. The developed sensor showed comparatively good selectivity for barium(II) ions with respect to other alkali, alkaline earth, transition and heavy metal ions. The plasticizer o-nitrophenyloctyl ether controlled significantly the calibration slope and the lifetime of the fabricated sensor. The proposed sensor was used successfully for the analysis of barium(II) ions in wastewater samples and in lithophone pigment with excellent recovery percentages in the range 98.9-99.8 {+-} 1.6%. The determination of sulphate in fresh and potable water samples with the developed sensor has been also achieved successfully. The described sensor provides a reliable means with good correlation with the data obtained by atomic absorption spectrometry (AAS) and other spectrophotometric methods for the analysis of trace amounts of barium(II) and/or sulphate ions in different matrices.

  12. A novel barium polymeric membrane sensor for selective determination of barium and sulphate ions based on the complex ion associate barium(II)-Rose Bengal as neutral ionophore

    International Nuclear Information System (INIS)

    A simple, long life, rapid response and sensitive barium(II)-PVC membrane sensor that typically follows Nernstian behavior has been developed for the assay of barium(II) ions. The developed sensor has been made by incorporating the complex ion associate of barium(II)-Rose Bengal (Ba-RB) as an ionophore into a plasticized PVC matrix. The sensor is stable and exhibited fast potential response of 20 s and gave a good linear response with a Nernstian slope of 28.5 ± 0.4 mV/decade of activity within the concentration range 5 x 10-5 to 10-1 M over a wide range of pH 4.5-10.0 for barium(II) ions. The developed sensor showed comparatively good selectivity for barium(II) ions with respect to other alkali, alkaline earth, transition and heavy metal ions. The plasticizer o-nitrophenyloctyl ether controlled significantly the calibration slope and the lifetime of the fabricated sensor. The proposed sensor was used successfully for the analysis of barium(II) ions in wastewater samples and in lithophone pigment with excellent recovery percentages in the range 98.9-99.8 ± 1.6%. The determination of sulphate in fresh and potable water samples with the developed sensor has been also achieved successfully. The described sensor provides a reliable means with good correlation with the data obtained by atomic absorption spectrometry (AAS) and other spectrophotometric methods for the analysis of trace amounts of barium(II) and/or sulphate ions in different matrices

  13. Theoretical isotope shifts in neutral barium

    CERN Document Server

    Nazé, Cédric; Godefroid, Michel

    2015-01-01

    The present work deals with a set of problems in isotope shifts of neutral barium spectral lines. Some well known transitions ($6s^2~^1S_0-6s6p~^{1,3}P^o_1$ and $6s^2~^1S_0-6p^2~^3P_0$) are first investigated. Values of the changes in the nuclear mean-square charge radius are deduced from the available experimental isotope shifts using our ab initio electronic factors. The three sets $\\{ \\delta\\langle r^2\\rangle^{A,A'}\\} $ obtained from these lines are consistent with each other. The combination of the available nuclear mean-square radii with our electronic factors for the $6s5d~^3D_{1,2} -6s6p~^{1}P^o_1$ transitions produces isotope shift values in conflict with the laser spectroscopy measurements of Dammalapati et al. (Eur. Phys. J. D 53, 1 (2009)).

  14. Chemical abundance analysis of 19 barium stars

    CERN Document Server

    Yang, G C; Spite, M; Chen, Y Q; Zhao, G; Zhang, B; Liu, G Q; Liu, Y J; Liu, N; Deng, L C; Spite, F; Hill, V; Zhang, C X

    2016-01-01

    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures, surface gravities, metallicity and microturbulent velocity) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their light elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn and Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-ca...

  15. Barium hexaferrite ferrofluids - preparation and physical properties

    Science.gov (United States)

    Müller, R.; Hiergeist, R.; Steinmetz, H.; Ayoub, N.; Fujisaki, M.; Schüppel, W.

    1999-07-01

    Barium hexaferrite BaFe 12-2 xTi xCo xO 19 ferrofluids have been prepared for the first time using oleic acid as surfactant and Isopar M ® as carrier liquid. The initial susceptibility versus temperature for zero-field cooling of the ferrofluid was obtained by a vibrating sample magnetometer. TEM pictures of the fluid show isolated particles and only small agglomerates and a mean particle diameter of approx. 8 nm. Numerical calculations of the magneto-viscous effect, based on the local-equilibrium magnetic state model, clearly show the benefit for Ba-ferrite ferrofluids resulting from the high uniaxial anisotropy compared to magnetite ferrofluids. Rheological measurements were performed with a rotational-type viscometer with magnetic field perpendicular to the hydrodynamic vortex axis.

  16. Radar absorption properties of doped barium hexaferrite

    International Nuclear Information System (INIS)

    Full text: Since the 1950s, it has been known that barium hexaferrite exhibits a ferrimagnetic resonance at about 48 GHz. Early research was directed at finding dopants that would increase this frequency to enable the preparation of lossless waveguide components. However, more recent efforts have explored the potential of doped barium hexaferrite as a radar absorbing material in the low GHz frequency range. In particular, Nedkov et al demonstrated that partial substitution of the iron with cobalt-titanium, to give Ba(Co0.5Ti0.5)xFe11.9-xMn0.1O19 with x = 1.6, could reduce the ferrimagnetic resonance frequency to 15 GHz. The small amount of manganese was included 'to improve the dielectric properties' of the material. In this work we increased the doping to x = 2.2 to arrive at a resonance frequency of just 1.35 GHz, which lies within the operational frequency range of typical airborne early warning and control (AEWAC) radar systems. An increase in the resonance signal at this concentration is believed to be associated with the onset of a switch from axial to planar magnetocrystalline anisotropy, as reported by Kreisel et al . It is uncertain why our resonance frequency for x = 2.2 is significantly lower than the value of 2.56 GHz reported elsewhere for a Mn-free specimen with x = 2.6. Chromium was also tested as a new dopant material but proved unsuccessful in reducing the resonant frequency below 40 GHz, the upper limit of the microwave network analyser that was employed. All specimens were prepared using solid state reaction of stoichiometric amounts of oxides and carbonates, and characterised using x-ray powder diffraction and 57Fe Moessbauer spectroscopy

  17. The Karlsruhe 4π barium fluoride detector

    International Nuclear Information System (INIS)

    A new experimental approach has been implemented for accurate measurements of neutron capture cross sections in the energy range from 5 to 200 keV. The Karlsruhe 4π Barium Fluoride Detector consists of 42 crystals shaped as hexagonal and pentagonal truncated pyramids forming a spherical shell with 10 cm inner radius and 15 cm thickness. All crystals are supplied with reflector and photomultiplier, thus representing independent gamma-ray detectors. Each detector module covers the same solid angle with respect to a gamma-ray source located in the centre. The energy resolution of the 4π detector is 14% at 662 keV and 7% at 2.5 MeV gamma-ray energy, the overall time reslution is 500 ps and the peak efficiency 90% at 1 MeV. The detector allows to register capture cascades with 95% probability above a threshold energy of 2.5 MeV in the sum energy spectrum. Neutrons are produced via the 7Li(p,n)7Be reaction using the pulsed proton beam of a Van de Graaff accelerator. The neutron spectrum can be taylored according to the experimental requirements in an energy range from 5 to 200 keV by choosing appropriate proton energies. A collimated neutron beam is passing through the detector and hits the sample in the centre. The energy of captured neutrons is determined via time of flight, the primary flight path being 77 cm. The combination of short primary flight path, a 10 cm inner radius of the spherical BaF2 shell, and the low capture cross section of barium allows to discriminate background due to capture of sample scattered neutrons in the scintillator by time of flight, leaving part of the neutron energy range completely undisturbed. (orig./HSI)

  18. Determination of {sup 135}Cs and {sup 137}Cs in environmental samples: A review

    Energy Technology Data Exchange (ETDEWEB)

    Russell, B.C., E-mail: ben.russell@npl.co.uk [GAU-Radioanalytical, Ocean and Earth Science, University of Southampton, National Oceanography Centre, Southampton, SO14 3ZH (United Kingdom); National Physical Laboratory, Hampton Road, Teddington, Middlesex, TW11 0LW (United Kingdom); Croudace, Ian W.; Warwick, Phil E. [GAU-Radioanalytical, Ocean and Earth Science, University of Southampton, National Oceanography Centre, Southampton, SO14 3ZH (United Kingdom)

    2015-08-26

    Radionuclides of caesium are environmentally important since they are formed as significant high yield fission products ({sup 135}Cs and {sup 137}Cs) and activation products ({sup 134}Cs and {sup 136}Cs) during nuclear fission. They originate from a range of nuclear activities such as weapons testing, nuclear reprocessing and nuclear fuel cycle discharges and nuclear accidents. Whilst {sup 137}Cs, {sup 134}Cs and {sup 136}Cs are routinely measurable at high sensitivity by gamma spectrometry, routine detection of long-lived {sup 135}Cs by radiometric methods is challenging. This measurement is, however, important given its significance in long-term nuclear waste storage and disposal. Furthermore, the {sup 135}Cs/{sup 137}Cs ratio varies with reactor, weapon and fuel type, and accurate measurement of this ratio can therefore be used as a forensic tool in identifying the source(s) of nuclear contamination. The shorter-lived activation products {sup 134}Cs and {sup 136}Cs have a limited application but provide useful early information on fuel irradiation history and have importance in health physics. Detection of {sup 135}Cs (and {sup 137}Cs) is achievable by mass spectrometric techniques; most commonly inductively coupled plasma mass spectrometry (ICP-MS), as well as thermal ionisation (TIMS), accelerator (AMS) and resonance ionisation (RIMS) techniques. The critical issues affecting the accuracy and detection limits achievable by this technique are effective removal of barium to eliminate isobaric interferences arising from {sup 135}Ba and {sup 137}Ba, and elimination of peak tailing of stable {sup 133}Cs on {sup 135}Cs. Isobaric interferences can be removed by chemical separation, most commonly ion exchange chromatography, and/or instrumental separation using an ICP-MS equipped with a reaction cell. The removal of the peak tailing interference is dependent on the instrument used for final measurement. This review summarizes and compares the analytical procedures

  19. Determination of 135Cs and 137Cs in environmental samples: A review

    International Nuclear Information System (INIS)

    Radionuclides of caesium are environmentally important since they are formed as significant high yield fission products (135Cs and 137Cs) and activation products (134Cs and 136Cs) during nuclear fission. They originate from a range of nuclear activities such as weapons testing, nuclear reprocessing and nuclear fuel cycle discharges and nuclear accidents. Whilst 137Cs, 134Cs and 136Cs are routinely measurable at high sensitivity by gamma spectrometry, routine detection of long-lived 135Cs by radiometric methods is challenging. This measurement is, however, important given its significance in long-term nuclear waste storage and disposal. Furthermore, the 135Cs/137Cs ratio varies with reactor, weapon and fuel type, and accurate measurement of this ratio can therefore be used as a forensic tool in identifying the source(s) of nuclear contamination. The shorter-lived activation products 134Cs and 136Cs have a limited application but provide useful early information on fuel irradiation history and have importance in health physics. Detection of 135Cs (and 137Cs) is achievable by mass spectrometric techniques; most commonly inductively coupled plasma mass spectrometry (ICP-MS), as well as thermal ionisation (TIMS), accelerator (AMS) and resonance ionisation (RIMS) techniques. The critical issues affecting the accuracy and detection limits achievable by this technique are effective removal of barium to eliminate isobaric interferences arising from 135Ba and 137Ba, and elimination of peak tailing of stable 133Cs on 135Cs. Isobaric interferences can be removed by chemical separation, most commonly ion exchange chromatography, and/or instrumental separation using an ICP-MS equipped with a reaction cell. The removal of the peak tailing interference is dependent on the instrument used for final measurement. This review summarizes and compares the analytical procedures developed for determination of 135Cs/137Cs, with particular focus on ICP-MS detection and the methods applied

  20. Experimental determination of barium isotope fractionation during diffusion and adsorption processes at low temperatures

    Science.gov (United States)

    van Zuilen, Kirsten; Müller, Thomas; Nägler, Thomas F.; Dietzel, Martin; Küsters, Tim

    2016-08-01

    Variations in barium (Ba) stable isotope abundances measured in low and high temperature environments have recently received increasing attention. The actual processes controlling Ba isotope fractionation, however, remain mostly elusive. In this study, we present the first experimental approach to quantify the contribution of diffusion and adsorption on mass-dependent Ba isotope fractionation during transport of aqueous Ba2+ ions through a porous medium. Experiments have been carried out in which a BaCl2 solution of known isotopic composition diffused through u-shaped glass tubes filled with silica hydrogel at 10 °C and 25 °C for up to 201 days. The diffused Ba was highly fractionated by up to -2.15‰ in δ137/134Ba, despite the low relative difference in atomic mass. The time-dependent isotope fractionation can be successfully reproduced by a diffusive transport model accounting for mass-dependent differences in the effective diffusivities of the Ba isotope species (D137Ba /D134Ba =(m134 /m137) β). Values of β extracted from the transport model were in the range of 0.010-0.011. Independently conducted batch experiments revealed that adsorption of Ba onto the surface of silica hydrogel favoured the heavier Ba isotopes (α = 1.00015 ± 0.00008). The contribution of adsorption on the overall isotope fractionation in the diffusion experiments, however, was found to be small. Our results contribute to the understanding of Ba isotope fractionation processes, which is crucial for interpreting natural isotope variations and the assessment of Ba isotope ratios as geochemical proxies.

  1. Upper gastrointestinal barium evaluation of duodenal pathology: A pictorial review

    Institute of Scientific and Technical Information of China (English)

    Pankaj; Gupta; Uma; Debi; Saroj; Kant; Sinha; Kaushal; Kishor

    2014-01-01

    Like other parts of the gastrointestinal tract(GIT), duodenum is subject to a variety of lesions both congenital and acquired. However, unlike other parts of the GIT viz. esophagus, rest of the small intestine and large intestine, barium evaluation of duodenal lesions is technically more challenging and hence not frequently reported. With significant advances in computed tomography technology, a thorough evaluation including intraluminal, mural and extramural is feasible in a single non-invasive examination. Notwithstanding, barium evaluation still remains the initial and sometimes the only imaging study in several parts of the world. Hence,a thorough acquaintance with the morphology of various duodenal lesions on upper gastrointestinal barium examination is essential in guiding further evaluation. We reviewed our experience with various common and uncommon barium findings in duodenal abnormalities.

  2. Liquid-phase-deposited barium titanate thin films on silicon

    International Nuclear Information System (INIS)

    Using a mixture of hexafluorotitanic acid, barium nitrate and boric acid, high refractive index (1.54) barium titanate films can be deposited on silicon substrates. The deposited barium titanate films have featureless surfaces. The deposition temperature is near room temperature (800C). However, there are many fluorine and silicon incorporations in the films. The refractive index of the as-deposited film is 1.54. By current-voltage measurement, the leakage current of the as-deposited film with a thickness of 1000 A is about 9.48x10-7 A cm-2 at the electrical field intensity of 0.3 MV cm-1. By capacitance-voltage measurement, the effective oxide charge of the liquid-phase-deposited barium titanate film is 3.06x1011 cm-2 and the static dielectric constant is about 22. (author)

  3. Synthesis, photoluminescence and magnetic properties of barium vanadate nanoflowers

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Jing [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Chongqing University of Science and Technology, Chongqing 401331 (China); Hu, Chenguo, E-mail: hucg@cqu.edu.cn [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Xi, Yi [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Peng, Chen [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Wan, Buyong; He, Xiaoshan [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China)

    2011-06-15

    Graphical abstract: The flower-shaped barium vanadate was obtained for the first time. The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. Research highlights: {yields} In the paper, the flower-shaped barium vanadate were obtained for the first time. The CHM method used here is new and simple for preparation of barium vanadate. {yields} The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. The strong bluish-green emission was observed. {yields} The ferromagnetic behavior of the barium vanadate nanoflowers was found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g. {yields} The mechanisms of PL and magnetic property of barium vanadate nanoflowers have been discussed. -- Abstract: The flower-shaped barium vanadate has been obtained by the composite hydroxide mediated (CHM) method from V{sub 2}O{sub 5} and BaCl{sub 2} at 200 {sup o}C for 13 h. XRD and XPS spectrum of the as-synthesized sample indicate it is hexagonal Ba{sub 3}V{sub 2}O{sub 8} with small amount of Ba{sub 3}VO{sub 4.8} coexistence. Scan electron microscope and transmission electron microscope display that the flower-shaped crystals are composed of nanosheets with thickness of {approx}20 nm. The UV-visible spectrum shows that the barium vanadate sample has two optical gaps (3.85 eV and 3.12 eV). Photoluminescence spectrum of the barium vanadate flowers exhibits a visible light emission centered at 492 and 525 nm which might be attributed to VO{sub 4} tetrahedron with T{sub d} symmetry in Ba{sub 3}V{sub 2}O{sub 8}. The ferromagnetic behavior of the barium vanadate nanoflowers has been found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g, which is mainly due to the presence of a non

  4. Investigation of neutron-deficient isotopes in the barium-region

    International Nuclear Information System (INIS)

    Bombarding targets of 106Cd, 108Cd and 110Cd with 16O ions of 52.5-66.0 MeV neutron deficient barium, cesium and xenon isotopes were produced and have been studied using excitation functions and neutron-gamma, proton-gamma, alpha-gamma and gamma-gamma coincidence measurements. Partial level schemes for 123Ba and 121Ba were proposed. A number of gamma transitions was assigned to the different product nuclei. The measured particle emission probabilities from the compound nuclei are compared with different evaporation models. The models mostly underestimate neutron emission and often overestimate the emission of alpha particles. (orig.)

  5. Capacitively coupled electrolyte-conductivity sensor based on high-k material of barium strontium titanate

    OpenAIRE

    Huck, C.; Poghossian, A; Baecker, M; Chaudhuri, S.; Zander, W; Schubert, J.; Begoyan, V. K.; Buniatyan, V. V.; Wagner, Patrick Hermann; Schoening, M. J

    2014-01-01

    A miniaturized capacitively coupled contactless conductivity detection (C4D) sensor based on high-kperovskite oxide of barium strontium titanate (BST) has been implemented for the first time. The BST films(∼120 nm thick) of Ba0.25Sr0.75TiO3composition were prepared on a p-Si-SiO2-Pt structure by pulsed laserdeposition technique using BST targets fabricated by the self-propagating high-temperature synthesismethod. The Pt electrodes were buried into the SiO2layer to obtain a planar structure. F...

  6. Lifetime Measurement for 6snp Rydberg States of Barium

    Institute of Scientific and Technical Information of China (English)

    SHEN Li; WANG Lei; YANG Hai-Feng; LIU Xiao-Jun; LIU Hong-Ping

    2011-01-01

    @@ We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states.This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence.The lifetimes determined with our method for barium Rydberg 6snp(n=37-59)series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J.Phys.B 14(1981)4489, 29(1996)655]on experiments.%We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states. This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence. The lifetimes determined with our method for barium Rydberg 6snp (n=37-59) series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J. Phys. B 14 (1981) 4489, 29 (1996) 655] onexperiments.

  7. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department`s mission as stated in that document. ``The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.``

  8. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    International Nuclear Information System (INIS)

    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department's mission as stated in that document. ''The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.''

  9. Depletion of Alloreactive T-Cells by Anti-CD137-Saporin Immunotoxin.

    Science.gov (United States)

    Lee, Sang C; Seo, Kwang W; Kim, Hye J; Kang, Sang W; Choi, Hye-Jeong; Kim, Ansuk; Kwon, Byoung S; Cho, Hong R; Kwon, Byungsuk

    2015-01-01

    Depletion of alloreactive T-lymphocytes from allogeneic bone marrow transplants may prevent graft-versus-host disease (GVHD) without impairing donor cell engraftment, immunity, and the graft-versus-leukemia (GVL) effect. Alloreactive T-cells may be identified by their expression, upon activation, of CD137, a costimulatory receptor and putative surrogate marker for antigen-specific effector T-cells. In this context, we tested the use of anti-CD137-saporin immunotoxin to selectively deplete mouse and human alloreactive T-cells. Anti-CD137 antibodies were internalized by cells within 4 h of binding to the cell surface CD137, and anti-CD137-saporin immunotoxin effectively killed polyclonally activated T-cells or antigen-stimulated T-cells. Transfer of donor T-cells after allodepletion with anti-CD137-saporin immunotoxin failed to induce any evident expression of GVHD; however, a significant GVL effect was observed. Targeting of CD137 with an immunotoxin was also effective in killing polyclonally activated or alloreactive human T-cells. Our results indicate that anti-CD137-saporin immunotoxin may be used to deplete alloreactive T-cells prior to bone marrow transplantation and thereby prevent GVHD and the relapse of leukemia. PMID:24594433

  10. Electrooptic and piezoelectric measurements in photorefractive barium titanate and strontium barium niobate

    International Nuclear Information System (INIS)

    The authors measured the low-frequency (''unclamped'') electrooptic and piezoelectric coefficients in undoped BaTiO/sub 3/ and Sr/sub x/Ba/sub 1-x/Nb/sub 2/O/sub 6/ (chi - 0.61) crystals using interferometric techniques. The contribution of the piezoelectric effect to the Pockels measurement is discussed. For an applied ac electric field in the range 0.1-200 V/cm, the electrooptic and piezoelectric effects are linear in the magnitude of of the applied field and independent of its frequency in the range of 10 Hz-100 kHz. The unclamped electrooptic coefficients of poled BaTiO/sub 3/ single crystals are r/sub 13/ = 19.5 +- 1 pm/V and r/sub 33/ = 97 +- 7 pm/V, and for strontium barium niobate are r/sub 13/ = 47 +- 5 pm/V and r/sub 33/ = 235 +- 21 pm/V, all measured at a wavelength of 514.5 nm and at T = 230C. For the barium titanate samples the measured Pockels coefficient r/sub c/ identical to r/sub 33/ - (n/sub 1//n/sub 3/)/sup 3/r/sub 13/ = 79 +- 6 pm/V in good agreement with the value r/sub c/ = 76 +- 7 pm/V computed from the above values of r/sub 13/ and r/sub 33/, where n/sub 1/ and n/sub 3/ are the ordinary and extraordinary indexes of refraction, respectively. The measured piezoelectric coefficient is d/sub 23/ = +28.7 +- 2 pm/V for barium titanate, and is d/sub 23/ = +24.6 +- 2 pm/V for strontium barium niobate. They also measured the photoreflective coupling of two optical beams in the crystals, and they show that the dependence of the coupling strength on beam polarization is in fair agreement with the measured values of the Pockels coefficients

  11. Dicty_cDB: SLA137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA137 (Link to dictyBase) - - - Contig-U16449-1 SLA137Z (Link... to Original site) - - SLA137Z 491 - - - - Show SLA137 Library SL (Link to library) Clone ID SLA137 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA1-B/SLA137Q.Seq.d/ Representative seq. ID SLA13...7Z (Link to Original site) Representative DNA sequence >SLA137 (SLA137Q) /CSM/SL/SLA1-B/SLA137Q.Seq.d/ XXXXX...ATAAAAAAAAAAAAAAAA sequence update 1997. 5. 8 Translated Amino Acid sequence ---AWVDENGGGTMIPVSVSFEKALLDLSSD

  12. A direct molecular link between the autism candidate gene RORa and the schizophrenia candidate MIR137

    Science.gov (United States)

    Devanna, Paolo; Vernes, Sonja C.

    2014-02-01

    Retinoic acid-related orphan receptor alpha gene (RORa) and the microRNA MIR137 have both recently been identified as novel candidate genes for neuropsychiatric disorders. RORa encodes a ligand-dependent orphan nuclear receptor that acts as a transcriptional regulator and miR-137 is a brain enriched small non-coding RNA that interacts with gene transcripts to control protein levels. Given the mounting evidence for RORa in autism spectrum disorders (ASD) and MIR137 in schizophrenia and ASD, we investigated if there was a functional biological relationship between these two genes. Herein, we demonstrate that miR-137 targets the 3'UTR of RORa in a site specific manner. We also provide further support for MIR137 as an autism candidate by showing that a large number of previously implicated autism genes are also putatively targeted by miR-137. This work supports the role of MIR137 as an ASD candidate and demonstrates a direct biological link between these previously unrelated autism candidate genes.

  13. Magnetoresistance studies on barium doped nanocrystalline manganite

    International Nuclear Information System (INIS)

    An energetically attractive, simple, fast and a novel low temperature (300 deg. C) solution combustion route for the synthesis of crystalline and homogeneous nanoparticles of lanthanum barium manganese oxide La0.9Ba0.1MnO3+δ (LBMO) is reported. Formation and homogeneity of the solid solutions have been confirmed by powder X-ray diffraction (PXRD) and energy dispersive X-ray analysis (EDS) respectively. The Rietveld analysis shows both as-formed as well as calcined samples are in cubic phase with space group pm3m. The microstructure and agglomerated particle size of the compounds are examined by scanning electron microscope. Infrared spectroscopy revealed that both Mn-O-Mn bending mode and Mn-O stretching mode are influenced by calcination temperature. The magnetoresistance measurement on sintered LBMO pellet exhibits a broad metal-insulator transition (TM-I) at around 228 K. At 1 T applied magnetic field, LBMO shows magnetoresistance (MR) of 10%, whereas for 4 and 7 T, the negative magnetoresistance values are in the range 51 and 59% respectively at TM-I. The experimental resistivity data of the present investigation are fitted to a simple empirical equation in order to understand conduction mechanism in this compound

  14. Optical properties of calcium barium niobate

    International Nuclear Information System (INIS)

    We report on optical measurements on the novel tungsten bronze type calcium barium niobate. [001]-oriented transparent and colorless single crystals were grown by the Czochralski method with dimensions of 12 mm in diameter and about 80 mm in length. With its relatively high Curie temperature of about 538 K for the congruently melting composition of 28.1 mole% calcium and its high nonlinear coefficients, CBN is a promising material for future applications. Recent experiments revealed, that the application of an external electric field of several kV/cm to CBN at room temperature leads to an increasing opacity of the sample. This might be a drawback considering the future usability of CBN in optical systems. We present investigations on the transmittance behaviour of CBN under external electric fields, demonstrating the erasement of the clouding without affecting the polarization. Experiments have been performed at temperatures ranging from room temperature to approximately 480 K. When heating up the sample, its colorless appearance changes to a light yellow, which can be attributed to a shift of the band edge to longer wavelengths with increasing temperature. To further investigate the transmittance properties of CBN, measurements of the band edge under various temperatures up to the ferroelectric phase transition have been performed.

  15. Leachability of barium-radium sulphate sludges

    International Nuclear Information System (INIS)

    This paper presents results from the first phase of a research program designed to examine the leachability of radium-226 from barium-radium sulphate sludges. Batch leaching tests were performed. Results showed that liquid:solid contact time was relatively unimportant; radium in the sludge was stable in the presence of deionized water with a slight increase in the amount leached per gram of sludge occurring at higher liquid:solid ratios. Not unexpectedly, low and high values of leachant pH increased radium leaching. Both monovalent and divalent salt solutions also increased leaching; however, dissolved radium-226 activity levels in the leachate decreased as leachant molarity increased. For divalent salts this can be explained by the common ion effect; for monovalent salts it is opposite to results expected from solubility considerations. The interpretation of all results is complicated by the fact that in most tests, the amount of radium-226 present in the leachate was lower than the calculated contribution from the mother liquour present with the sludge. This apparent ability of the sludge to absorb radium from solution may be related to dissolution and reprecipitation of the sludge during the leaching tests

  16. Chemical compositions of four barium stars

    CERN Document Server

    Liang, Y C; Chen, Y Q; Qiu, H M; Zhang, B

    2003-01-01

    Chemical compositions of four barium stars HD 26886, HD 27271, HD 50082 and HD 98839 are studied based on high resolution, high signal-to-noise Echelle spectra. Results show that all of them are disk stars. Their \\alpha and iron peak elements are similar to the solar abundances. The neutron-capture process elements are overabundant relative to the Solar. The heavy-element abundances of the strong Ba star HD 50082 are higher than those of other three mild Ba stars. Its mass is 1.32Msun (+0.28,-0.22Msun), and is consistent with the average mass of strong Ba stars (1.5Msun). For mild Ba star HD 27271 and HD 26886, the derived masses are 1.90Msun (+0.25,-0.20Msun) and 2.78Msun (+0.75,-0.78M_sun), respectively, which are consistent with the average mass of mild Ba stars. We also calculate the theoretical abundances of Ba stars by combining the AGB stars nucleosynthesis and wind accretion formation scenario of Ba binary systems. The comparisons between the observed abundance patterns of the sample stars with the th...

  17. 137Cs in freshwater fish in Finland

    International Nuclear Information System (INIS)

    The paper deals with an evaluation of the importance of Finnish freshwater fish as a source of 137Cs in the diet. Freshwater fish were analysed for 137Cs in 1982. The 137Cs concentration factors from water to edible fish were determined for the same year. The evaluation is based on an extensive surface water investigation performed from 1965 to 1967. Along with the continuous fallout monitoring since the beginning of the 1960'es, this material makes it possible to valuate the 137Cs levels in surface water right up to the 1980'es. In 1982 the Finns received an average of 90 Bq 137Cs from freshwater fish. This dose constitutes a quarter of the 137Cs uptake from the total food consumtion in Finland in 1982

  18. The diagnostic value of barium enema in acute appendicitis

    International Nuclear Information System (INIS)

    Acute appendicitis is the most common acute surgical condition of the abdomen. When the clinical presentation is atypical, barium enema has proven to be safe and useful in confirming the diagnosis and reducing the negative surgical exploration. However, the performance of barium enema in acute appendicitis has known contraindication primarily because of fear of leakage by perforation of the inflamed appendix. This study using barium enema as a diagnostic aid in acute appendicitis with atypical clinical presentation was performed to further support the previously noted efficacy and safety of this procedure. The results were as followings: 1. In case of acute appendicitis with atypical clinical presentation, the use of barium enema as a diagnostic aid increased the accuracy of diagnosis and decreased the negative surgical exploration. In women between 11 to 50 years old age, especially, it played important role differentiating appendicitis from nonsurgical acute abdomen. 2. The results of the study were 92.31% in sensitivity, 7.69% in false positive, 6.9% in false negative, and 10.26% in negative appendectomy. 3. None of case of leakage of barium by perforation of the inflamed appendix was noted, therefore, barium enema was thought to be safe as a diagnostic aid in acute appendicitis. 4. A simple partial or non filling of appendix without other associated positive finding could not exclude appendicitis, therefore, close clinical observation was necessary. 5. The positive findings of barium enema and their sensitivity were as followings: 1. Non filling of appendix: 90% 2. Partial filling of appendix: 91.7% 3. Displacement or a local impression on terminal ileum: 100%

  19. Cs-137 migration in soil near NPPs

    International Nuclear Information System (INIS)

    A convective-diffusion model has been employed for describing Cs-137 migration in soil. The migration parameters were determined by comparing the calculated vertical distribution profiles with the experimental ones. The migration parameters dependence on the soil state has been studied. Cs-137 penetration rate was found to be function of the soil type, surface state, soil wetness and orography. The obtained values are presented. A method is suggested for revealing the soil surface contamination by Cs-137 produced during NPP operation with distinguishing it from the global contamination background. For this purpose Cs-137 content in the upper 5 mm soil layer is estimated

  20. Cesium-137 in grass from Chernobyl fallout

    International Nuclear Information System (INIS)

    Grass ecosystem was monitored for 137Cs, a relatively long-lived radionuclide, for about 16 years since the Chernobyl reactor accident occurred on April 26, 1986. Cesium-137 in grass gramineae or poaceae the species, ranged from 122.9 Bq kg-1 (September 4, 1986) to 5.8 mBq kg-1 (October 16, 2001) that is a range of five orders of magnitude. It was observed that there was a trend of decreasing 137Cs with time reflecting a removal half-time of 40 months (3 1/3 years), which is the ecological half-life, T ec of 137Cs in grassland

  1. Elastic scattering cross sections of metastable barium on helium and argon

    International Nuclear Information System (INIS)

    Barium atoms in the 1D2, 3D2 and 3D3 metastable excited states have been observed by their low field Zeeman resonances using an Atomic Beam Magnetic Resonance Spectrometer. The 1S0 ground state is also observed. The scattering of Ba atoms in each of these states by helium or argon atoms (in their ground states) was performed by allowing a secondary beam to intersect the Ba beam at 900 (crossed beam geometry). The ratio of the cross sections for scattering from different excited Ba states and the same target atom was measured to a precision of 1 to 2 percent. By a combination of further experiment and calculation the absolute cross sections were also measured. It is argued that the elastic scattering dominates so that the measured cross section is sigma/sub elastic/. Comparison of the scattering of Ba(1S0) and Ba(1,3D2,3) for either target gas shows that the ground state cross section is larger by a factor of 1.8 than for the excited states. This somewhat surprising result is in accord with naive pictures of the ''size'' of the 5d 6s electronic configuration of the excited barium compared with the ground state configuration, 6s2

  2. Radiological protection and routinary controls of an activimeter with a cesium and barium sources in an nuclear medicine center

    International Nuclear Information System (INIS)

    In the present work the results when carrying out the routine controls in a Deluxe Isotope (Calibrator II) equipment, with some sources of Cesium 137 and Barium 133, in a Nuclear Medicine Center that operates from the year 1983 in a modern one construction inside the Institute of Neoplastic Illnesses (INEN) are shown. Taking in account the Radiological Protection measures to verify if the equipment responds to the personnel's demands in the measurements of activities of the diverse radionuclides that are used in different types of exams that are carried out in this Nuclear Medicine Center are the objectives of this work. This Center was equipped initially with donated equipment by the International Atomic Energy Agency (IAEA) with those that it develops assistance, educational works and of research, giving services to patients of the INEN and other public and private medical centers. (Author)

  3. Preparation of barium hexaferrite powders using oxidized steel scales waste

    Science.gov (United States)

    Septiani, Ardita; Idayanti, Novrita; Kristiantoro, Tony

    2016-02-01

    Research on preparation of barium hexaferrite powders has been done using Hot Strip Mill scales as raw materials. Hot Strip Mill scales are oxidized steel scales waste from steel industrial process. The method used for preparing the barium hexaferrite powders was solid state reaction method. Oxidized steel scales were milled using ball mill for 10 hours, then screened through a 250 mesh sieve to obtain powders with maximum size of 63 µm. Powders were roasted at 600°C temperature for 4 hours to obtain hematite (Fe2O3) phase. Roasted powders were then mixed with barium carbonate, and were subsequently milled for 16 hours. After mixing, powders were calcined with an increasing rate of 10°C/min and maintained at 1100°C for 3 hours. Calcination process was performed to acquire barium hexaferrite phase. X-ray Diffraction (XRD) characterization in conjunction with RIR analysis showed that 85 wt. % of barium hexaferrite is formed. The magnetic properties of powders were characterized using Permagraph. It is found the value of remanent induction is 1.09 kG, coercivity of 2.043 kOe, and the maximum energy product of 0.25 MGOe.

  4. Barium Depletion in the NSTAR Discharge Cathode After 30,000 Hours of Operation

    Science.gov (United States)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira

    2010-01-01

    Dispenser hollow cathodes rely on a consumable supply of barium released by impregnant materials in the pores of a tungsten matrix to maintain a low work function surface. Examinations of cathode inserts from long duration ion engine tests show deposits of tungsten at the downstream end that appear to block the flow of barium from the interior. In addition, a numerical model of barium transport in the insert plasma indicates that the barium partial pressure in the insert may exceed the equilibrium vapor pressure of the dominant barium-producing reaction, and it was postulated previously that this would suppress barium loss in the upstream part of the insert. New measurements of the depth of barium depletion from a cathode insert operated for 30,352 hours reveal that barium loss is confined to a narrow region near the downstream end, confirming this hypothesis.

  5. Sputtered Modified Barium Titanate for Thin-Film Capacitor Applications

    Directory of Open Access Journals (Sweden)

    Robert Mamazza

    2012-04-01

    Full Text Available New apparatus and a new process for the sputter deposition of modified barium titanate thin-films were developed. Films were deposited at temperatures up to 900 °C from a Ba0.96Ca0.04Ti0.82Zr0.18O3 (BCZTO target directly onto Si, Ni and Pt surfaces and characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray photoelectron spectroscopy (XPS. Film texture and crystallinity were found to depend on both deposition temperature and substrate: above 600 °C, the as-deposited films consisted of well-facetted crystallites with the cubic perovskite structure. A strongly textured Pt (111 underlayer enhanced the (001 orientation of BCZTO films deposited at 900 °C, 10 mtorr pressure and 10% oxygen in argon. Similar films deposited onto a Pt (111 textured film at 700 °C and directly onto (100 Si wafers showed relatively larger (011 and diminished intensity (00ℓ diffraction peaks. Sputter ambients containing oxygen caused the Ni underlayers to oxidize even at 700 °C: Raising the process temperature produced more diffraction peaks of NiO with increased intensities. Thin-film capacitors were fabricated using ~500 nm thick BCZTO dielectrics and both Pt and Ni top and bottom electrodes. Small signal capacitance measurements were carried out to determine capacitance and parallel resistance at low frequencies and from these data, the relative permittivity (er and resistivity (r of the dielectric films were calculated; values ranged from ~50 to >2,000, and from ~104 to ~1010 Ω∙cm, respectively.

  6. Studies of hexacelsian and celsian barium aluminosilicates

    Science.gov (United States)

    Lee, Kuo-Tong

    1998-09-01

    The first part of this work (chapter 3) describes the reaction paths leading to the formation of BaAlsb2Sisb2Osb8 (BAS) from a mixture of gamma-BaCOsb3,\\ alpha-Alsb2Osb3, and amorphous SiOsb2 powders. Heat treatments conducted from 600 to 1200sp°C in air were used to transform the powder mixtures into hexacelsian BAS. The phase evolution to BAS was examined by x-ray diffraction. Several experiments were designed to microscopically reproduce the solid-solid interfaces expected during the synthesis of BAS and enabled the author to describe the different stages of the reaction. There exist two reaction paths in formation of BAS in this study: (1) formation of a series of barium silicates leading to BaO*2SiOsb2 (BSsb2) which then reacts with Alsb2Osb3 to form BAS and (2) formation of BaO*Alsb2Osb3 (BA) which then reacts with SiOsb2 to form BAS. The kinetics of the latter is slower than that of the former because the reaction between BaO*Alsb2Osb3 and SiOsb2 to form BAS includes a bond breaking process. The second part (chapter 4) of this research was undertaken to study the role of additives on the kinetics of the transformation of hexacelsian to celsian. Pre-synthesized hexacelsian powders doped with various additives were heated at temperatures ranging from 850 to 1400sp°C for 4 hrs. Semi-quantitative analysis of XRD was used to determine the extent of the hexacelsian-to-celsian transformation. This work was extended further to investigate the mechanisms involved in the transformation. Defect structures developed in the additive-containing celsian provide insights about the sites occupied by the cations added. Experimental results indicate that the doping of ˜0.99A cations in promoting the conversion of hexacelsian to celsian is by forming an interstitial solid solution in hexacelsian and ˜0.66A cations form a substitutional solid solution. In a kinetic study on the CaO- or MgO-enhanced transformation, values of rate constant, k, and Avlami constant, n, at

  7. Occupational doses in pediatric barium meal procedures

    International Nuclear Information System (INIS)

    Ionizing radiation has become an indispensable tool when it comes to diagnosis and therapy. However, its use should happen in a rational manner, taking into account the risks to which the staff is being exposed. Barium meal (BM), or upper gastrointestinal (GI) studies, using fluoroscopy, are widely used for gastroesophageal reflux disease diagnostic in children and professionals are required to stay inside the examination room to position and immobilize pediatric patients during the procedure. Therefore, it is very important that proffessionals strictly follow the technical standards of radiation protection. According to the ICRP and the NCRP recommendations, the annual limit equivalent doses for eyes, thyroid and hands are, espectively, 20 mSv, 150 mSv and 500 mSv. Based on those data, the aim of the current study is to estimate the annual equivalent dose for eyes, thyroid and hands of professionals who perform BM procedures in children. This was done using properly package LiF:Mg,Cu,P thermoluminescent dosimeters in 37 procedures; 2 pairs were positioned near each staff´s eye, 2 pairs on each professional´s neck (on and under the lead protector) and 2 pairs on both staff´s hands. The range of the estimative annual equivalent doses, for eyes, thyroid and hands, are, respectively: 14 – 36 mSv, 7 – 22 mSv and 14 – 58 mSv. Only the closest staff to the patient exceeded the annual equivalent doses in the eyes (around 80% higher than the limit set by ICRP). However, the results from this study, for hands and thyroid, compared to similar studies, show higher values. Therefore, the optimization implementation is necessary, so that the radiation levels can be reduced. (authors)

  8. Method for the extraction chromatographic separation of barium from other elements with dibenzo-18-crown-6

    International Nuclear Information System (INIS)

    A method has been developed for the extraction chromatographic separation of barium from 0.01 M picric acid solution with dibenzo-18-crown-6 coated on hydrophobic silica gel as the stationary phase. Various mineral acids can be used as stripping agents. Barium was separated from other elements by selective extraction and the separation of barium from alkali and alkaline earth metals, uranium, thorium and lead was achieved. The method was applied to the determination of barium in real samples. (author)

  9. Electron microscopy of barium bismuth titanate multilayer ceramics

    International Nuclear Information System (INIS)

    For a number of years bismuth containing compounds have been used with pre-calcined barium titanate to reduce the sintering temperature of the capacitor formulations. As reported earlier the backscattered electron (BSE) SEM micrographs of the bismuth containing barium titanate ceramic reveal that the grains having an average size of 1.2μm consist of a two phase structure consisting of relatively pure barium titanate grain cores surrounded by bismuth rich grain shells. The TEM and STEM studies along with the EDS analyses show that the bismuth concentration increases sharply as one steps towards the grain boundary with a maximum bismuth content at the grain boundary. It is the purpose of this work to investigate the distribution of bismuth in these formulations including the bismuth content, if any, at the ceramic metal interface as affected by the sintering temperature. The subsequent effect on the electrical resistivity of these ceramics in the multilayer configuration is reported

  10. Economically dissolving barium sulfate scale with a chelating agent

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, E.A.; Scheuerman, R.E.

    1977-06-21

    A composition is described for dissolving a barium sulfate scale from a subterranean or other relatively remote location into which fluid can be flowed. Fluid is flow-flowed into the remote location so that a stream of fluid contacts and flows along the surface of the scale. The composition and flow rate of the fluid are adjusted so that (1) the scale is contacted by a stream of aqueous solution in which each portion contains enough dissolved aminopolyacetic acid salt chelating agent to dissolve barium sulfate, and (2) substantially all upstream portions of the scale are contacted by a succession of portions of the aqueous liquid which are substantially unsaturated with respect to dissolved barium-chelant complex. (5 claims)

  11. Barium titanate thick films prepared by screen printing technique

    Directory of Open Access Journals (Sweden)

    Mirjana M. Vijatović

    2010-06-01

    Full Text Available The barium titanate (BaTiO3 thick films were prepared by screen printing technique using powders obtained by soft chemical route, modified Pechini process. Three different barium titanate powders were prepared: i pure, ii doped with lanthanum and iii doped with antimony. Pastes for screen printing were prepared using previously obtained powders. The thick films were deposited onto Al2O3 substrates and fired at 850°C together with electrode material (silver/palladium in the moving belt furnace in the air atmosphere. Measurements of thickness and roughness of barium titanate thick films were performed. The electrical properties of thick films such as dielectric constant, dielectric losses, Curie temperature, hysteresis loop were reported. The influence of different factors on electrical properties values was analyzed.

  12. Radiation dose in mass screening for gastric cancer with high-concentration barium sulphate compared with moderate-concentration barium sulphate

    International Nuclear Information System (INIS)

    Full text: Recently, high-concentration barium sulfate has been developed and is used in many medical facilities. This study compared radiation dose using high-concentration and moderate-concentration barium sulfate. The dose was evaluated with an experimental method using a gastric phantom and with a clinical examination. In the former, the dose and X-ray tube load were measured on the phantom with two concentrations of barium sulfate. In the latter, the fluoroscopic dose-area product (DAP), the radiographic DAP and their sum, the total DAP, were investigated in 150 subjects (112 males, 38 females) treated with both concentrations of barium sulfate. The effective dose was calculated by the software of PCXMC in every case. The results of the experimental evaluation indicated that the effective dose and X-ray tube load were greater with high-concentration barium sulfate than with moderate-concentration barium sulfate (p < 0.05). The results of the clinical evaluation indicated that the fluoroscopic DAP was greater with moderate-concentration barium sulfate than with high-concentration barium sulfate (p < 0.05), but the radiographic DAP was quite the reverse, so the total DAP and effective dose were almost same with both concentrations of barium sulfate. We conclude that high-concentration barium sulfate does not increase radiation dose in mass screening for gastric cancer.

  13. Reaction sintering of a zirconia-containing barium feldspar ceramic

    International Nuclear Information System (INIS)

    Zircon (ZrSiO4) is a natural mineral resource known to react with certain oxides to produce a dispersion of zirconia particles within ceramic or glass-ceramic matrices. Barium aluminosilicates, particularly the celsian polymorphs of BaO- Al2O3 2SiO2 display oxidation resistance and refractory characteristics commensurate with the properties required of high temperature materials. Such properties, coupled with the high melting point of ZrO2 (2680 deg C), suggest that barium aluminosilicates and zirconia are an ideal combination from which to fabricate high temperature materials. A recent study has indicated that a barium aluminosilicate containing up to 40mol% ZrO2 can be prepared via a sol-gel process. However, the desire to utilise a natural resource in the form of zircon in the present work has led to the choice of reaction sintering as an alternative processing route. The current work was undertaken to investigate the possibility of forming a zirconia-containing barium feldspar composite material using the reaction sintering of zircon and assuming the following stoichiometric reaction: 2ZrSiO4 + BaCO3 + Al2O3 → 2ZrO2 + BaO-Al2O3-2SiO2 + CO2 ↑. The reaction sintering of zircon with alumina and barium carbonate produces a composite material comprising distributed ZrO2 in a continous barium feldspar matrix. Yttria added during processing allows a significant fraction of the ZrO2 to be retained as tetragonal phase to room temperature and thus the potential for a measure of transformation toughening

  14. Reaction sintering of a zirconia-containing barium feldspar ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Nordmann, A.; Cheng, Y-B.; Muddle, B. C. [Monash Univ., Clayton, VIC (Australia). Dept. of Materials Engineering

    1996-12-31

    Zircon (ZrSiO{sub 4}) is a natural mineral resource known to react with certain oxides to produce a dispersion of zirconia particles within ceramic or glass-ceramic matrices. Barium aluminosilicates, particularly the celsian polymorphs of BaO- Al{sub 2}O{sub 3} 2SiO{sub 2} display oxidation resistance and refractory characteristics commensurate with the properties required of high temperature materials. Such properties, coupled with the high melting point of ZrO{sub 2} (2680 deg C), suggest that barium aluminosilicates and zirconia are an ideal combination from which to fabricate high temperature materials. A recent study has indicated that a barium aluminosilicate containing up to 40mol% ZrO{sub 2} can be prepared via a sol-gel process. However, the desire to utilise a natural resource in the form of zircon in the present work has led to the choice of reaction sintering as an alternative processing route. The current work was undertaken to investigate the possibility of forming a zirconia-containing barium feldspar composite material using the reaction sintering of zircon and assuming the following stoichiometric reaction: 2ZrSiO{sub 4} + BaCO{sub 3} + Al{sub 2}O{sub 3} {yields} 2ZrO{sub 2} + BaO-Al{sub 2}O{sub 3}-2SiO{sub 2} + CO{sub 2} {up_arrow}. The reaction sintering of zircon with alumina and barium carbonate produces a composite material comprising distributed ZrO{sub 2} in a continous barium feldspar matrix. Yttria added during processing allows a significant fraction of the ZrO{sub 2} to be retained as tetragonal phase to room temperature and thus the potential for a measure of transformation toughening. 14 refs., 2 tabs., 6 figs.

  15. Compact pulse forming line using barium titanate ceramic material

    Science.gov (United States)

    Kumar Sharma, Surender; Deb, P.; Shukla, R.; Prabaharan, T.; Shyam, A.

    2011-11-01

    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO3) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber.

  16. Compact pulse forming line using barium titanate ceramic material.

    Science.gov (United States)

    Kumar Sharma, Surender; Deb, P; Shukla, R; Prabaharan, T; Shyam, A

    2011-11-01

    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO(3)) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber. PMID:22129008

  17. 49 CFR 173.182 - Barium azide-50 percent or more water wet.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or...

  18. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished...

  19. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  20. The adhesiometer: a simple device to measure adherence of barium sulfate to intestinal mucosa.

    Science.gov (United States)

    Salomonowitz, E; Frick, M P; Cragg, A H; Lund, G

    1984-04-01

    A simple, inexpensive device assessing barium sulfate adherence to alimentary tract mucosa was tested in an animal study using pigs and dogs. Interaction of gastric, intestinal, and colonic mucosal lining with three different barium preparations was studied. In both pigs and dogs, barium adherence to gastric mucosa was significantly stronger when compared with colonic mucosa. PMID:6608230

  1. 137Cs in northern Adriatic sediments

    International Nuclear Information System (INIS)

    The activity of 137Cs in shallow northern Adriatic sediments was obtained on the basis of measurement results from 25 sediment box cores, sampled during the Adriatic Scientific COoperation Program (ASCOP) 16 cruise in the summer 1990. 137Cs was determined in surface sediments (0-3 cm) and 12-15 cm-deep sediment. It was found that the lowest caesium concentrations correspond to sands, which are spread along the Croatian coast. Parallel to the Italian coast, 137Cs concentrations in pelites are the highest. It seems that the influence of Po River is significant for 137Cs activities in recent marine sediments along Italian coast south of Po River delta. Significantly higher 137Cs activities in 0-3 cm sediment layer can be attributed to the deposition caused by Chernobyl accident. (author)

  2. Desorption of 137Cs+ from mosses

    Directory of Open Access Journals (Sweden)

    OLGICA NEDIC

    2002-09-01

    Full Text Available Mosses are biomonitors that accumulate large amounts of various pollutants, including radionuclides. In this work we investigated the possibility of 137Cs extraction from mosses, as well as the significance of species specificity on the efficiency of 137Cs desorption. Salt and acid solutions were used as extraction media. It was shown that a 5 % solution of both ammonium oxalate and phosphoric acid was able to desorb 81.8 % of 137Cs+ from Homalothecium sericeum, which was 39.9 % more than desorption from water. At the same time, most of the desorbed 137Cs+ was incorporated in crystals that precipitated from the solution. An interspecies difference in respect to 137Cs+ desorption was noticed.

  3. Esophageal intramural pseudodiverticulosis characterized by barium esophagography: a case report

    LENUS (Irish Health Repository)

    O'Connor, Owen J

    2010-05-21

    Abstract Introduction Esophageal intramural pseudodiverticulosis is a rare condition characterized by the dilatation of the submucosal glands. Case presentation We present a case of esophageal intramural pseudodiverticulosis in a 72-year-old Caucasian man who presented with dysphagia and with a background history of alcohol abuse. An upper gastrointestinal endoscopy of our patient showed an esophageal stricture with abnormal mucosal appearances, but no malignant cells were seen at biopsy. Appearances on a barium esophagram were pathognomonic for esophageal intramural pseudodiverticulosis. Conclusion We demonstrate the enduring usefulness of barium esophagography in the characterization of abnormal mucosal appearances at endoscopy.

  4. Kinetics of thermal decomposition of barium zirconyl oxalate

    International Nuclear Information System (INIS)

    Kinetics of the thermal decomposition of anhydrous barium zirconyl oxalate and a carbonate intermediate have been studied. Decomposition of the anhydrous oxalate, though it could be explained based on a contracting-cube model, is quite complex. Kinetics of decomposition of the intermediate carbonate Ba2Zr2O5CO3 is greatly influenced by thermal effects during its formation. (α-t) curves are sigmoidal and obey a power law equation followed by first order decay. Presence of carbon in the vacuum-prepared carbonate has a strong deactivating effect. Decomposition of the carbonate is accompanied by growth in particle size of the product barium zirconate. (Author)

  5. Photoionization and Photoelectric Loading of Barium Ion Traps

    CERN Document Server

    Steele, A V; Churchill, L R; Griffin, P F

    2007-01-01

    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading technique that employs an in-expensive UV epoxy curing lamp to generate photoelectrons.

  6. Photoionization and Photoelectric Loading of Barium Ion Traps

    OpenAIRE

    Steele, A. V.; Churchill, L. R.; Griffin, P. F.; Chapman, M. S.

    2007-01-01

    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading t...

  7. Equations of state for barium in high-pressure phases

    International Nuclear Information System (INIS)

    The universal equation of state with an arbitrary reference point presented by the author (Fang Zheng-Hua 1998 Phys. Rev. B 50 16 238) is applied successfully to the analysis of the experimental compression data of barium in different structural phases (I, II, and V). The comparison given in this paper shows that this equation suits for the isothermal compression behaviour of barium in the high-pressure phases (II and V) better than the Birch-Murnaghan equation. The applicability of equations of state for solids in high-pressure phases is also discussed. (author)

  8. Chemical abundance analysis of 19 barium stars

    Science.gov (United States)

    Yang, Guo-Chao; Liang, Yan-Chun; Spite, Monique; Chen, Yu-Qin; Zhao, Gang; Zhang, Bo; Liu, Guo-Qing; Liu, Yu-Juan; Liu, Nian; Deng, Li-Cai; Spite, Francois; Hill, Vanessa; Zhang, Cai-Xia

    2016-01-01

    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures Teff, surface gravities log g, metallicity [Fe/H] and microturbulence velocity ξt) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants as indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their Na, Al, α- and iron-peak elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-capture) process elements relative to the Sun. Their median abundances of [Ba/Fe], [La/Fe] and [Eu/Fe] are 0.54, 0.65 and 0.40, respectively. The Y I and Zr I abundances are lower than Ba, La and Eu, but higher than the α- and iron-peak elements for the strong Ba stars and similar to the iron-peak elements for the mild stars. There exists a positive correlation between Ba intensity and [Ba/Fe]. For the n-capture elements (Y, Zr, Ba, La), there is an anti-correlation between their [X/Fe] and [Fe/H]. We identify nine of our sample stars as strong Ba stars with [Ba/Fe] >0.6 where seven of them have Ba intensity Ba=2-5, one has Ba=1.5 and another one has Ba=1.0. The remaining ten stars are classified as mild Ba stars with 0.17<[Ba/Fe] <0.54.

  9. Potential value of Cs-137 capsules

    Energy Technology Data Exchange (ETDEWEB)

    Bloomster, C.H.; Brown, D.R.; Bruno, G.A.; Hazelton, R.F.; Hendrickson, P.L.; Lezberg, A.J.; Tingey, G.L.; Wilfert, G.L.

    1985-04-01

    We determined the value of Cs-137 compared to Co-60 as a source for the irradiation of fruit (apples and cherries), pork and medical supplies. Cs-137, in the WESF capsule form, had a value of approximately $0.40/Ci as a substitute for Co-60 priced at approximately $1.00/Ci. The comparison was based on the available curies emitted from the surface of each capsule. We developed preliminary designs for fourteen irradiation facilities; seven were based on Co-60 and seven were based on Cs-137. These designs provided the basis for estimating capital and operating costs which, in turn, provided the basis for determining the value of Cs-137 relative to Co-60 in these applications. We evaluated the effect of the size of the irradiation facility on the value of Cs-137. The cost of irradiation is low compared to the value of the product. Irradiation of apples for disinfestation costs $.01 to .02 per pound. Irradiation for trichina-safe pork costs $.02 per pound. Irradiation of medical supplies for sterilization costs $.07 to .12 per pound. The cost of the irradiation source, either Co-60 or Cs-137, contributed only a minor amount to the total cost of irradiation, about 5% for the fruit and hog cases and about 20% for the medical supply cases. We analyzed the sensitivity of the irradiation costs and Cs-137 value to several key assumptions.

  10. 137Cs concentration in stingray (Dasyatis akajei)

    International Nuclear Information System (INIS)

    137Cs, which is of great interest and importance as an indicator of radioactive pollution in marine environments, is one of the long-lived artificial radio-nuclides introduced by the atmospheric deposition of debris from nuclear explosions mainly before 1962. For the estimation of effects of the effluents from nuclear facilities, it is necessary to know the natural variations in the concentration of 137Cs and factors affecting variations in marine organisms. We observed positive correlation between growth and 137Cs in 4 species among 14 major teleost species from fishing grounds along the coast of Japan. No increase in 137Cs concentration with increase of growth was observed in 2 species. In the remaining species no specific correlation is observed. These differences in the patterns were dependent on a change of feed habits with growth. As little is known of the 137Cs concentration in selachian we have investigated the natural variations of 137Cs in stingray. The correlation between growth and the concentration of 137Cs in stingray will be discussed. (author)

  11. Potential value of Cs-137 capsules

    International Nuclear Information System (INIS)

    We determined the value of Cs-137 compared to Co-60 as a source for the irradiation of fruit (apples and cherries), pork and medical supplies. Cs-137, in the WESF capsule form, had a value of approximately $0.40/Ci as a substitute for Co-60 priced at approximately $1.00/Ci. The comparison was based on the available curies emitted from the surface of each capsule. We developed preliminary designs for fourteen irradiation facilities; seven were based on Co-60 and seven were based on Cs-137. These designs provided the basis for estimating capital and operating costs which, in turn, provided the basis for determining the value of Cs-137 relative to Co-60 in these applications. We evaluated the effect of the size of the irradiation facility on the value of Cs-137. The cost of irradiation is low compared to the value of the product. Irradiation of apples for disinfestation costs $.01 to .02 per pound. Irradiation for trichina-safe pork costs $.02 per pound. Irradiation of medical supplies for sterilization costs $.07 to .12 per pound. The cost of the irradiation source, either Co-60 or Cs-137, contributed only a minor amount to the total cost of irradiation, about 5% for the fruit and hog cases and about 20% for the medical supply cases. We analyzed the sensitivity of the irradiation costs and Cs-137 value to several key assumptions

  12. Biokinetic model for 137 Cs

    International Nuclear Information System (INIS)

    The main objective of this work was to provide a realistic biokinetic model for 137 Cs metabolism. This model was based on the retention of cesium in 57 people contaminated in the Goiania accident, ages 1 to 73 y old, complemented by data obtained in an experiment with beagle dogs, and data taken from the open literature. Cesium is distributed among all tissues and organs of the body. Its main retention site is the skeletal muscle tissue. Mathematically, cesium retention in the body may be described by a sum of three terms exponential equation. The first term represents the fraction which is rapidly eliminated in urine. This fraction is weight dependent (negative correlation). The second term represents the retention of cesium in tissues and organs of the body. For children and adolescents, the second term biological half-life is a function of the weight. For adults, it is correlated with sex. Men present a higher retention of cesium than women. The third term correspond to a retention fraction of the order of 0,1% of the initial body burden. It is characterized by a very long half-life and represents a subcellular retention of cesium in the skeletal muscle tissue. During pregnancy the transfer factor from the mother to the fetus is correlated to the amount of cesium in the blood and it is equal to 1, if the intake of cesium occurs pregnancy. (author)

  13. Investigation of copper-zinc superoxide dismutase Ser-137 and Ala-137 mutants

    International Nuclear Information System (INIS)

    Ser- and Ala-137 mutants of human copper-zinc superoxide dismutase (Cu,ZnSOD) have been thoroughly characterized in an attempt to understand the subtle effect of the nature of the residue at position 137 on the structure of the copper site and on the activity profile. The results show that the nature of the residue at position 137 determines the presence of water in the active cavity as monitored through water 1H nuclear magnetic relaxation dispersion. Also, the hyperfine shifts experienced by the protons of His-48 in the Cu2Co2 derivative are sensitive to the group at the 137 position. These effects are not detected through electronic and EPR spectroscopies. The activity profiles of Ser-137 and Ala-137 mutants are virtually identical and are very close to that of the Ile-137 mutant at pH a between 6 and 7. The affinity of N3- for the Ser-137 and Ala-137 mutants is very similar to that for the wild type. This is again at variance with the Ile-137 derivative that shows an N3- affinity twice as large. 50 refs., 6 figs., 2 tabs

  14. Cs-137 content in a spruce stand

    International Nuclear Information System (INIS)

    The Cs-137 content of a spruce stand was investigated in soil, plant and animal biomasses of a 100 m. 100 m permanent study-site. The total content was 119 kBq.m-2. Most of all, 82.7% were found in soil, of that about 59.5% were bound in the 4 cm thick humus layer. The Cs-137 content of the above growing plant-biomass was 13050 Bq.m-2, these are 11.1% of the total. The Cs-137 contribution, bound in animal biomass was insignificant small. (orig.)

  15. Measurements of cesium-137 internal decontamination

    International Nuclear Information System (INIS)

    In the accident with Cs 137 which took place in Goiania, it could be verified that the majority of the victims presented internal and external contamination. In order to minimize deposits in internal organs and tissues and to enhance the excretion of Cs 137 we started treating the patients with: (1) Prussian Blue, oral administration, in about 46 patients, (2) Diuretics, oral administration, in 17 patients, and (3) Increasing the Cs 137 elimination by the sweat. Those proceedings were done under rigourous clinical evaluation and with data from radiochemical assay of excreta and afterwards with data obtained through the ''in vivo'' analysis though Whole Body Counting (Body Burden). (author)

  16. BARIUM AND RADIUM REMOVAL FROM GROUNDWATER BY ION EXCHANGE

    Science.gov (United States)

    The primary objective of this study was to determine the applicability of weak acid exchange resin in the hydrogen form for removal of hardness, barium and radium from groundwater. Weak acid resin in the hydrogen form eliminates the addition of sodium to drinking water. The capac...

  17. PROPOSED ORAL REFERENCE DOSE (RFD) FOR BARIUM AND COMPOUNDS

    Science.gov (United States)

    The Integrated Risk Information System (IRIS) is a database of EPA's consensus opinion of the human health effects that may result from exposure to various substances found in the environment. A Toxicological Review and IRIS Summary were prepared for barium and compounds in 1998 ...

  18. Barium titanate inverted opals-synthesis, characterization, and optical properties

    Energy Technology Data Exchange (ETDEWEB)

    Soten, I.; Miguez, H.; Yang, S.M.; Petrov, S.; Coombs, N.; Tetreault, N.; Ozin, G.A. [Toronto Univ., ON (Canada). Dept. of Chemistry; Matsuura, N.; Ruda, H.E. [Toronto Univ., ON (Canada). Dept. of Metallurgy and Materials Science

    2002-01-01

    The engineering of cubic or tetragonal polymorphs of nanocrystalline barium titanate inverted opals has been achieved by thermally induced transformations. Optical characterization demonstrated photonic crystal behavior of the opals. The tuning of the ferroelectric-paraelectric transition around the Curie temperature is shown in this paper. (orig.)

  19. Nanocrystals formation on Ho3+ doped strontium barium niobate glass

    International Nuclear Information System (INIS)

    The study of two different methods to obtain strontium barium niobate nanocrystals immersed in a glass matrix has been carried out. Ho2O3-doped SrO-BaO-Nb2O5-B2O3 glasses were fabricated using the melt quenching method. Glass ceramic samples were obtained from the precursor glass by thermal treatment in a furnace and by laser irradiation. These glass ceramic samples are formed by a glassy phase and a crystalline phase of strontium barium niobate nanocrystals. This structure was confirmed by X-ray diffraction and Atomic Force Microscope images. The incorporation of Ho3+ ions in the strontium barium niobate nanocrystals were corroborated by optical measurements, which produced an increment in the luminescence intensity compared to the precursor glass. - Research Highlights: →Ho doped strontium barium niobate nanocrystals have been obtained. →XRD, AFM and optical measurements corroborate the formation of SBN. →A laser irradiation technique has been carried out successfully.

  20. Removal of barium and radium from groundwater. Environmental research brief

    International Nuclear Information System (INIS)

    A research project was undertaken to investigate processes for removing barium and radium from drinking water. Special emphasis was placed on ion exchange processes that can be used without adding large concentrations of sodium to the water. The wastes from radium and barium removal processes were also characterized, and processes suitable for treatment of ion-exchange brines were evaluated. The report discusses two ion-exchange processes that can be used for barium and radium removal accompanied by either partial or no hardness removal. The calcium-form, strong-acid ion-exchange resin can be used for barium and radium removal without significant change in hardness or the concentration of other salts. This resin can be regenerated with CaC12 brine. The radium-selective complexer (RSC) will remove radium without altering hardness or other salt concentration. The capacity of this resin for waters with low total dissolved solids (TDS) (<1000 to 2000 mg/L TDS) is in excess of 30,000 pCi/dry g; however, if the TDS is increased to about 40,000 mg/L, the capacity drops to 200 to 300 pCi/dry g. Thus using this resin to remove radium from spent brine does not appear feasible

  1. CNO and F abundances in the barium star HD 123396

    CERN Document Server

    Alves-Brito, Alan; Yong, David; Meléndez, Jorge; Vásquez, Sergio

    2011-01-01

    [Abridged] Barium stars are moderately rare chemically peculiar objects which are believed to be the result of the pollution of an otherwise normal star by material from an evolved companion on the asymptotic giant branch (AGB). We aim to derive carbon, nitrogen, oxygen, and fluorine abundances for the first time from infrared spectra of the barium red giant star HD 123396 to quantitatively test AGB nucleosynthesis models for producing barium stars via mass accretion. High-resolution and high S/N infrared spectra were obtained using the Phoenix spectrograph mounted at the Gemini South telescope. The abundances were obtained through spectrum synthesis of individual atomic and molecular lines, using the MOOG stellar line analysis program together with Kurucz's stellar atmosphere models. The analysis was classical, using 1D stellar models and spectral synthesis under the assumption of local thermodynamic equilibrium. We confirm that HD 123396 is a metal-deficient barium star ([Fe/H] = -1.05), with A(C) = 7.88, A...

  2. Ultra-low temperature processing of barium tellurate dielectrics

    Science.gov (United States)

    Kwon, Do-Kyun

    Ceramics, metals and polymers have unique electrical properties that are combined for electronic devices and systems. It necessitates lower processing temperatures for ceramics to be compatible with metal and polymer systems. In this thesis, the synthesis, crystal structure, and dielectric properties of barium tellurate are studied for temperatures between 500 and 900°C. Barium tellurate dielectric ceramics (BaTe4O9, BaTe 2O5, BaTe2O6, BaTeO3, BaTeO 4, and Ba2TeO5) are extensively investigated as new LTCC (Low-Temperature Cofired Ceramics) dielectric systems integrated with low resistivity metal electrodes such as silver and aluminum for microwave application. Studies on the phase formation and crystal structure through thermal analyses (Differential Scanning Calorimetry and Thermogravimetric Analysis, DSC-TGA) and X-ray diffraction phase analysis attest that barium tellurates are formed in the temperature range of 500 ˜ 900°C, through the sequential phase formations from Te-rich to Ba-rich phases. The oxygen coordination of the tellurium ion progresses from TeO4 to TeO6 via TeO 3+1 and TeO3 with increasing barium content as confirmed by structural analysis using infrared spectroscopy. High density barium tellurate ceramics are achieved at temperatures as low as 550°C, which provides the potential to be co-fired with low-melting aluminum metal electrodes in LTCC processing. Dielectric permittivity, loss, and temperature stability of barium tellurate dielectric ceramics were measured from 100 Hz to 13 GHz. Barium tellurate ceramics exhibit excellent microwave dielectric properties with intermediate dielectric permittivities and high quality factors (Q). The dielectric properties at microwave frequencies are epsilonr = 17.5, Qxf = 54700 GHz, TCf = -90 ppm/°C for BaTe4O9, epsilonr = 21, Qxf = 50300 GHz, TCf = -51 ppm/°C for BaTe2O6, epsilonr = 10, Qxf = 34000 GHz, TCf = -54 ppm/°C for BaTeO3, and epsilonr = 17, Qx f = 49600 GHz, TCf = -124 ppm/°C for Ba 2TeO5

  3. Transfer of 137Cs into mother's milk

    International Nuclear Information System (INIS)

    The concern of nursing mothers about the contamination of foodstuffs after Chernobyl prompted this investigation of radiocaesium transfer to mother's milk. Between May 1987 and December 1988, duplicates of daily food intakes, as well as the corresponding mothers' milk samples, were collected from 12 nursing mothers for two to four weeks in order to measure the 137Cs activity. Once during the collection period, the total-body activity of each of the mothers involved was measured. Based on our results, 137Cs is transferred into mother's milk not only directly from food intake but also from the accumulated body burden. Approximately 19% of the 137Cs activity from the daily food intake and about 13% of the specific 137Cs body activity of the mother are transferred into 1 litre of mother's milk. (author)

  4. Cesium-137 levels detected in Georgia otters

    International Nuclear Information System (INIS)

    Beginning in the 1940's and continuing through the 50's and early 60's, nuclear devices were tested by aerial detonation in the United States and other countries around the world. Cesium-137 (137Cs) is one of the most important radionuclide by-products due to its abundance and slow decay (30-year half-life). The uptake of 137Cs in animal tissue is the result of its similarity to potassium. The somatic and genetic effects of 137Cs, along with its effect on reproductive cells, can pose great hazards to wildlife species. A reported buildup of 137Cs in white-tailed deer in the lower coastal plain of Georgia during the 1960's was followed by a gradual decline during the 1970's. Although numerous studies have involved terrestrial mammals of Georgia, few have involved aquatic mammals such as the river otter. With continued atmospheric testing by some foreign countries and the increased use of nuclear power as an energy source, there is a need for continued monitoring of radionuclides in wildlife to ascertain the quality of the environment. This study was initiated as part of an overall study of environmental pollutants in the river otter of Georgia and deals with analysis of the 137Cs accumulations in this species

  5. Experimental Parametric Study of Large-Scale Co60, Na24, and Cs137 Slab Irradiators

    International Nuclear Information System (INIS)

    There are several important parameters in the design of slab irradiators. Target parameters include capacity (energy input per unit mass per unit time), residence time, minimum dose required, maximum dose variation permitted, target dimensions, and target density and composition. Source parameters include source composition (photon energy, source density, and atomic number), total activity (curies), average specific activity, activity distribution, source dimensions, and source-to-target geometry. Large-scale slab sources of low activity level of Co60, Na24, and Cs137 were assembled. The Co60 was in the form of cobalt metal, sg 8.9, the Na24 was in the form of a dilute aqueous solution of Na2C03, sg 1 and the Cs137 was in the form of a compressed solid composed of a homogenous mixture of Cs137 CI and BaS04, sg 2.7. Several static finite slab targets of paraffin wax were used in all experiments. Measurements were made with calibrated instruments of the exposure dose at many points in the target delivered over known periods of time. The specific activity and total activity of the source materials were determined by radiochemical analysis. Source and target parameters, including source dimensions, source activity distribution, and source-to-target geometry, were varied in such a way as to obtain information on specific dose rate and dose distribution in the target. Various absorbers between source and target were also studied. For calculation purposes, the finite source was divided into a number of line elements. Using the uncollided flux equation with the NDA-NBS build-up factor modified for finite media, the contribution of each element to various points in the target was calculated. The conformity of the experimental data to the theoretical is discussed. The data were applied to a set of specifications and for a particular design a comparison is made between available Co60, Na24, and Cs137 sources. (author)

  6. Functional expression of CD137 (4-1BB) on T helper follicular cells

    Science.gov (United States)

    Alfaro, Carlos; Echeveste, Jose I; Rodriguez-Ruiz, Maria E; Solorzano, Jose L; Perez-Gracia, Jose L; Idoate, Miguel A; Lopez-Picazo, Jose M; Sanchez-Paulete, Alfonso R; Labiano, Sara; Rouzaut, Ana; Oñate, Carmen; Aznar, Angela; Lozano, Maria D; Melero, Ignacio

    2015-01-01

    CD137 (4-1BB) is a surface protein initially discovered to mark activated T lymphocytes. However, its broader expression pattern also encompasses activated NK cells, B cells and myeloid cells, including mature dendritic cells. In this study, we have immunostained for CD137 on paraffin-embedded lymphoid tissues including tonsils, lymph nodes, ectopic tertiary lymphoid tissue in Hashimoto thyroiditis and cancer. Surprisingly, immunostaining mainly decorated intrafollicular lymphocytes in the tissues analyzed, with only scattered staining in interfollicular areas. Moreover, pathologic lymphoid follicles in follicular lymphoma and tertiary lymphoid tissue associated with non-small cell lung cancer showed a similar pattern of immunostaining. Multispectral fluorescence cytometry demonstrated that CD137 expression was restricted to CD4+ CXCR5+ follicular T helper lymphocytes (TFH cells) in tonsils and lymph nodes. Short-term culture of lymph node cell suspensions in the presence of either an agonistic anti-CD137 monoclonal antibody (mAb) or CD137-ligand stimulated the functional upregulation of TFH cells in 3 out of 6 cases, as indicated by CD40L surface expression and cytokine production. As a consequence, immunostimulatory monoclonal antibodies targeting CD137 (such as urelumab and PF-05082566) should be expected to primarily act on this lymphocyte subset, thus modifying ongoing humoral immune responses in patients with autoimmune disease and cancer. PMID:26587331

  7. miR-137 Modulates a Tumor Suppressor Network-Inducing Senescence in Pancreatic Cancer Cells

    Directory of Open Access Journals (Sweden)

    Mathieu Neault

    2016-03-01

    Full Text Available Activating K-Ras mutations occurs frequently in pancreatic cancers and is implicated in their development. Cancer-initiating events, such as oncogenic Ras activation, lead to the induction of cellular senescence, a tumor suppressor response. During senescence, the decreased levels of KDM4A lysine demethylase contribute to p53 activation, however, the mechanism by which KDM4A is downregulated is unknown. We show that miR-137 targets KDM4A mRNA during Ras-induced senescence and activates both p53 and retinoblastoma (pRb tumor suppressor pathways. Restoring the KDM4A expression contributed to bypass of miR-137-induced senescence and inhibition of endogenous miR-137 with an miRNA sponge-compromised Ras-induced senescence. miR-137 levels are significantly reduced in human pancreatic tumors, consistent with previous studies revealing a defective senescence response in this cancer type. Restoration of miR-137 expression inhibited proliferation and promoted senescence of pancreatic cancer cells. These results suggest that modulating levels of miR-137 may be important for triggering tumor suppressor networks in pancreatic cancer.

  8. 21 CFR 137.225 - Whole durum flour.

    Science.gov (United States)

    2010-04-01

    ... Flours and Related Products § 137.225 Whole durum flour. Whole durum wheat flour conforms to the..., prescribed for whole wheat flour by § 137.200, except that cleaned durum wheat, instead of cleaned wheat... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Whole durum flour. 137.225 Section 137.225...

  9. 21 CFR 137.205 - Bromated whole wheat flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bromated whole wheat flour. 137.205 Section 137... Cereal Flours and Related Products § 137.205 Bromated whole wheat flour. Bromated whole wheat flour... of ingredients, prescribed for whole wheat flour by § 137.200, except that potassium bromate is...

  10. Surface studies of barium and barium oxide on tungsten and its application to understanding the mechanism of operation of an impregnated tungsten cathode

    Science.gov (United States)

    Forman, R.

    1976-01-01

    Surface studies have been made of multilayer and monolayer films of barium and barium oxide on a tungsten substrate. The purpose of the investigation was to synthesize the surface conditions that exist on an activated impregnated tungsten cathode and obtain a better understanding of the mechanism of operation of such cathodes. The techniques employed in these measurements were Auger spectroscopy and work-function measurements. The results of this study show that the surface of an impregnated cathode is identical to that observed for a synthesized monolayer or partial monolayer of barium on oxidized tungsten by evaluating Auger spectra and work-function measurements. Data obtained from desorption studies of barium monolayers on a tungsten substrate in conjunction with Auger and work-function results have been interpreted to show that throughout most of its life an impreganated cathode has a partial monolayer, rather than a monolayer, of barium on its surface.

  11. Design, testing, fabrication and launch support of a liquid chemical barium release payload (utilizing the liquid fluorine-barium salt/hydrazine system)

    Science.gov (United States)

    Stokes, C. S.; Smith, E. W.; Murphy, W. J.

    1972-01-01

    A payload was designed which included a cryogenic oxidizer tank, a fuel tank, and burner section. Release of 30 lb of chemicals was planned to occur in 2 seconds at the optimum oxidizer to fuel ratio. The chemicals consisted of 17 lb of liquid fluorine oxidizer and 13 lb of hydrazine-barium salt fuel mixture. The fuel mixture was 17% barium chloride, 16% barium nitrate, and 67% hydrazine, and contained 2.6 lb of available barium. Two significant problem areas were resolved during the program: explosive valve development and burner operation. The release payload was flight tested, from Wallops Island, Virginia. The release took place at an altitude of approximately 260 km. The release produced a luminous cloud which expanded very rapidly, disappearing to the human eye in about 20 seconds. Barium ion concentration slowly increased over a wide area of sky until measurements were discontinued at sunrise (about 30 minutes).

  12. Cesium-137 and Iodine-131 in drinking water in Sweden after Chernobyl

    International Nuclear Information System (INIS)

    Following the Chernobyl accident an extensive program of tests and measurements was started in Sweden. The purpose of the program was to track the fallout of radioactive nuclides over Sweden. The program included aerial surveys throughout the entire country, monitoring of air activity and measurements of radioactive nuclides in milk and other foodstuffs. The program also included measurements of different radioactive nuclides in drinking water. Samples were taken from public surface water plants and private wells from those parts of the country where the fallout had been most extensive. The test sites were chosen in collaboration with the local health authorities. Initially the drinking water program included 16 private wells and 12 public water plants. In 1987 it was cut down to 10 wells and 6 water plants. The main body of this report presents measurements of cesium-137 in water samples from these sites from the beginning of May 1986 to December 1989. Also included are measurements from the first weeks after the accident of iodine-131 an some other radioactive nuclides with relatively short half-lives such as rutenium-103, tellurium-132 and barium-140. Some of the surface water plants had concentrations of 10-15 Bq/l of cesium-137 in the beginning of May 1986. In 1989 some water plants still had concentrations of about 1 Bq/l. In the private wells the concentrations of cesium-137 have been low all the time, except for one sample where surface water had leaked into the well during the snow melting period. (authors)

  13. Radiological protection and calibration of an activity meter with cesium and barium sources in a nuclear medicine center; Proteccion radiologica y calibracion de un activimetro con fuentes de cesio y bario en un centro de medicina nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Morales L, M.E. [IPEN INEN Centro de Medicina Nuclear, Av. Aviacion 3799, Lima 34 (Peru)

    2005-07-01

    Presently work is shown the results when gauging a team Deluxe Isotope (Caliper 11) with some sources of Cesium 137 and Barium 133, in a Center of Medicine Nuclear that operates from the anus 1983 in a modern building inside the one Institute of Illnesses Neoplasia (Inn). This Center was equipped initially with teams donated by the International Organism of Atomic Energy (Oa) with those that it develops assistance, educational works and of investigation, giving services to patient of the Inn and other public and private medical centers. (Author)

  14. Electromagnetic properties of photodefinable barium ferrite polymer composites

    Directory of Open Access Journals (Sweden)

    Olusegun Sholiyi

    2014-07-01

    Full Text Available This article reports the magnetic and microwave properties of a Barium ferrite powder suspended in a polymer matrix. The sizes for Barium hexaferrite powder are 3–6 μm for coarse and 0.8–1.0 μm for the fine powder. Ratios 1:1 and 3:1 (by mass of ferrite to SU8 samples were characterized and analyzed for predicting the necessary combinations of these powders with SU8 2000 Negative photoresist. The magnetization properties of these materials were equally determined and were analyzed using Vibrating Sample Magnetometer (VSM. The Thru, Reflect, Line (TRL calibration technique was employed in determining complex relative permittivity and permeability of the powders and composites with SU8 between 26.5 and 40 GHz.

  15. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine

    Science.gov (United States)

    Graziana Genchi, Giada; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni

    2016-06-01

    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these ‘smart’ nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation.

  16. HYBRID AND CHARACTERISTIC OF POLYANILINE- BARIUM TITANATE NANOCOMPOSITE PARTICLES

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Polyaniline-barium titanate (PAn-BaTiO3) ultrafine composite particles were prepared by the oxidative polymerization of aniline with H2O2 while barium titanate nanoparticles were synthesized with a sol-gel method. The infrared spectrogram shows that the polymerization of PAn in the hybrid process of PAn-BaTiO3 is similar with the polymeric process of pure aniline, and there is interaction of PAn and BaTiO3 in the PAn-BaTiO3. SEM and TEM results show that the average diameter of the composite particles is 1.50 μm and the diameters of BaTiO3 nanoparticles are 5-15 nm in the composite particle. The electrical conductivity of the ultrafine composite particles is transformable from 100 to 10-11S/cm by equilibrium doping or dedoping method using various concentration of HCl or NaOH solutions.

  17. Thermophysical properties of americium-containing barium plutonate

    International Nuclear Information System (INIS)

    Polycrystalline specimens of americium-containing barium plutonate have been prepared by mixing the appropriate amounts of (Pu0.91Am0.09)O2 and BaCO3 powders followed by reacting and sintering at 1600 K under the flowing gas atmosphere of dry-air. The sintered specimens had a single phase of orthorhombic perovskite structure and were crack-free. Elastic moduli were determined from longitudinal and shear sound velocities. Debye temperature was also determined from sound velocities and lattice parameter measurements. Thermal conductivity was calculated from measured density at room temperature, literature values of heat capacity and thermal diffusivity measured by laser flash method in vacuum. Thermal conductivity of americium-containing barium plutonate was roughly independent of temperature and registered almost the same magnitude as that of BaPuO3 and BaUO3. (author)

  18. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine.

    Science.gov (United States)

    Genchi, Giada Graziana; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni

    2016-06-10

    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these 'smart' nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation. PMID:27145888

  19. Barium ferrite powders prepared by milling and annealing

    Directory of Open Access Journals (Sweden)

    R. Nowosielski

    2007-05-01

    Full Text Available Purpose: Microstructure and magnetic properties analysis of barium ferrite powder obtained by milling and heat treatment.Design/methodology/approach: The milling process was carried out in a vibratory mill, which generated vibrations of the balls and milled material inside the container during which their collisions occur. After milling process the powders were annealed in electric chamber furnace. The X-ray diffraction methods were used for qualitative phase analysis of studied powder samples. The distribution of powder particles was determined by a laser particle analyzer. The magnetic hysteresis loops of examined powder material were measured by resonance vibrating sample magnetometer (R-VSM.Findings: The milling process of iron oxide and barium carbonate mixture causes decrease of the crystallite size of involved phases. The X-ray investigations of tested mixture milled for 30 hours and annealed at 950 °C enabled the identification of hard magnetic BaFe12O19 phase and also the presence of Fe2O3 phase in examined material. The Fe2O3 phase is a rest of BaCO3 dissociation in the presence of Fe2O3, which forms a compound of BaFe12O19. The best coercive force (HC for mixture of powders annealed at 950 °C for 10, 20 and 30 hours is 349 kA/m, 366 kA/m and 364 kA/m, respectively. The arithmetic mean of diameter of Fe2O3 and BaCO3 mixture powders after 30 hours of milling is about 6.0 μm.Practical implications: The barium ferrite powder obtained by milling and annealing can be suitable components to produce sintered and elastic magnets with polymer matrix.Originality/value: The results of tested barium ferrite investigations by different methods confirm their utility in the microstructure and magnetic properties analysis of powder materials.

  20. Barium borohydride chlorides: synthesis, crystal structures and thermal properties.

    Science.gov (United States)

    Grube, Elisabeth; Olesen, Cathrine H; Ravnsbæk, Dorthe B; Jensen, Torben R

    2016-05-10

    Here we report the synthesis, mechanism of formation, characterization and thermal decomposition of new barium borohydride chlorides prepared by mechanochemistry and thermal treatment of MBH4-BaCl2, M = Li, Na or K in ratios 1 : 1 and 1 : 2. Initially, orthorhombic barium chloride, o-BaCl2 transforms into o-Ba(BH4)xCl2-x, x ∼ 0.15. Excess LiBH4 leads to continued anion substitution and a phase transformation into hexagonal barium borohydride chloride h-Ba(BH4)xCl2-x, which accommodates higher amounts of borohydride, possibly x ∼ 0.85 and resembles h-BaCl2. Thus, two solid solutions are in equilibrium during mechano-chemical treatment of LiBH4-BaCl2 (1 : 1) whereas LiBH4-BaCl2 (2 : 1) converts to h-Ba(BH4)0.85Cl1.15. Upon thermal treatment at T > ∼200 °C, h-Ba(BH4)0.85Cl1.15 transforms into another orthorhombic barium borohydride chloride compound, o-Ba(BH4)0.85Cl1.15, which is structurally similar to o-BaBr2. The samples with M = Na and K have lower reactivity and form o-Ba(BH4)xCl2-x, x ∼ 0.1 and a solid solution of sodium chloride dissolved in solid sodium borohydride, Na(BH4)1-xClx, x = 0.07. The new compounds and reaction mechanisms are investigated by in situ synchrotron radiation powder X-ray diffraction (SR-PXD), Fourier transform infrared spectroscopy (FT-IR) and simultaneous thermogravimetric analysis (TGA), differential scanning calorimetry (DSC), mass spectroscopy (MS) and temperature programmed photographic analysis (TPPA). PMID:27109871

  1. Thermoelectric power of barium up to 8 GPa

    Energy Technology Data Exchange (ETDEWEB)

    Ramani, G.; Divakar, C.; Singh, A.K.

    1987-01-15

    The present measurements indicate that the thermoelectric power (TEP) of barium at room temperature and pressure is 15 ..mu..V K/sup -1/, and decreases with increasing pressure, reaching about 4 ..mu..V K/sup -1/ just before the bcc..-->..hcp transition. The TEP shows a discontinuous increase at the bcc..-->..hcp transition beyond which it continues to decrease with increasing pressure.

  2. Effect of Silver Coating on Barium Titanium Oxide Nanoparticle Toxicity

    OpenAIRE

    Obregon, Isidro D.; Betts-Obregon, Brandi S.; Yust, Brian; Pedraza, Francisco; Ortiz, Alexandra; Sardar, Dhiraj; Tsin, Andrew T.

    2013-01-01

    Nanoparticles are presently being studied for optical and biomedical applications such as medical imaging and drug delivery. Nanoparticles impact the cellular environment due to many variables such as size, shape, and composition. How these factors affect cell viability is not fully understood. The purpose of this study is to test the toxicity effects of silver coating (Ag@) Barium Titanium Oxide (BaTiO3) nanoparticles on Rhesus Monkey Retinal Endothelial cells (RhREC’s) in culture. The addit...

  3. Microstructure and magnetic properties of commercial barium ferrite powders

    Directory of Open Access Journals (Sweden)

    R. Nowosielski

    2007-01-01

    Full Text Available Purpose: Microstructural and magnetic properties analysis of commercial barium ferrite powder BaFe12O19.Design/methodology/approach: The X-ray diffraction methods were utilized not only for qualitative andquantitative phase analysis of studied powder sample, but also for the determination of lattice parameters, crystallitesize and the lattice distortion. The Rietveld method was used in the verification of the qualitative phase compositionand in the determination of phase abundance. Hill and Howard procedure was applied for quantitative phaseanalysis. The parameters of the individual diffraction line profiles were determined by PRO-FIT Toraya procedure.The morphology of barium ferrite powders was analyzed using the scanning electron miroscopy (SEM method.The distribution of powder particles was determined by a laser particle analyzer. Moreover, the magnetic hysteresisloop of examined powder material were measured by resonance vibrating sample magnetometer (R-VSM.Findings: The X-ray diffraction analysis revealed the presence of hexagonal BaFe12O19 and rhombohedralFe2O3 phases in examined powder samples. The barium ferrite phase appeared to be the main component of thesamples (97.8 wt.%. The crystallite size of BaFe12O19 phase is above 100 nm. The size of studied powders isin the range from 0.2 μm to 40.5 μm. The arithmetic mean diameter of BaFe12O19 powders population is 10.335μm. The SEM images showed irregular shape and size of powder particles. The coercive force (HC obtainedfrom hysteresis loop has a value about 159 kA/m.Practical implications: Structure analysis of commercial barium ferrite powder is helpful to prepare thismaterial by laboratory methods.Originality/value: The obtained results of investigations by different methods of structure characterizationconfirm their utility in the microstructure analysis of powder materials.

  4. Dielectric Properties of Barium Titanate Prepared by Spark Plasma Sintering

    Czech Academy of Sciences Publication Activity Database

    Ctibor, Pavel; Sedláček, J.; Dopita, M.; Pala, Zdeněk

    Bratislava: Slovak Expert Group of Solid State Chemistry and Physics , 2011 - (Koman, M.; Mikloš, D.), s. 68-69 ISBN 978-80-8134-002-4. [Joint Seminar – Development of materials science in research and education (DMRSE)/21.th./. Kežmarské Žlaby (SK), 29.08.2011-02.09.2011] Institutional research plan: CEZ:AV0Z20430508 Keywords : spark plasma sintering * barium titanate * dielectric properties Subject RIV: JK - Corrosion ; Surface Treatment of Materials

  5. Preparation and Characterization of Nano-particle Substituted Barium Hexaferrite

    OpenAIRE

    Atassi, Yomen; Darwich, Iyad Seyd; Tally, Mohammad

    2014-01-01

    High density magnetic recording requires high coercivity magnetic media and small particle size. Barium hexaferrite has been considered as a leading candidate material because of its chemical stability, fairly large crystal anisotropy and suitable magnetic characteristics. In this work, we present the preparation of the hexagonal ferrite BaFe12O19 and one of its derivative; the Zn-Sn substituted hexaferrite by the chemical co-precipitation method. The main advantage of this method on the conv...

  6. Distribution of cesium-137 in reindeer

    Directory of Open Access Journals (Sweden)

    Kristina Rissanen

    1990-08-01

    Full Text Available The influence of the Chernobyl accident in 1986 on the Finnish reindeer herding area was much smaller than the effects of the nuclear bomb tests in the 1960s. Only in one small area somewhat more Cs-137 was deposited than in the rest of the reindeer herding area. From that area 20 reindeer were chosen for investigation of the distribution of Cs-137. All tissues, organs, the skeleton, digestive tract, hide, head and hooves were sampled quantitatively. Three reindeer were pregnant and also the foetuses were studied. The Cs-137 amounts were determined by gammaspectrometric measurements. The results showed that the differences in the Cs-137 concentrations between muscle tissue from different parts of an individual reindeer were not more than 10 percent. Thus it is not essential from which part of the reindeer meat samples for surveillance purposes are taken. The concentration of Cs-137 in edible tissues other than muscle was lower except in the kidneys and scapula cartilage.

  7. Microwave-hydrothermal synthesis of barium strontium titanate nanoparticles

    International Nuclear Information System (INIS)

    Research highlights: → Barium strontium titanate nanoparticles were obtained by the Hydrothemal microwave technique (HTMW) → This is a genuine technique to obtain nanoparticles at low temperature and short times → Barium strontium titanate free of carbonates with tetragonal structure was grown at 130 oC. - Abstract: Hydrothermal-microwave method (HTMW) was used to synthesize crystalline barium strontium titanate (Ba0.8Sr0.2TiO3) nanoparticles (BST) in the temperature range of 100-130 oC. The crystallization of BST with tetragonal structure was reached at all the synthesis temperatures along with the formation of BaCO3 as a minor impurity at lower syntheses temperatures. Typical FT-IR spectra for tetragonal (BST) nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH- groups, commonly found in materials obtained by HTMW process. FE/SEM revealed that lower syntheses temperatures led to a morphology that consisted of uniform grains while higher syntheses temperature consisted of big grains isolated and embedded in a matrix of small grains. TEM has shown BST nanoparticles with diameters between 40 and 80 nm. These results show that the HTMW synthesis route is rapid, cost effective, and could serve as an alternative to obtain BST nanoparticles.

  8. Preparation of Nanoparticles of Barium Ferrite from Precipitation in Microemulsions

    International Nuclear Information System (INIS)

    Magnetic nanoparticles of barium ferrite (BaFe12O19) have been synthesized using a microemulsion mediated process. The aqueous cores of water-in-oil microemulsions were used as constrained microreactors for the precipitation of precursor carbonate and hydroxide particles. These precursors were then calcined at 925 deg. C for 12 h, during which time they were transformed to the hexagonal ferrite. The pH of reaction was varied between 5 and 12, and it was found that the fraction of non-magnetic hematite (α-Fe2O3) in the particles varied with the pH of reaction, thus affecting the magnetic properties of the particles. The same precursor particles were also prepared by bulk co-precipitation reaction for comparison. It was found that the microemulsion derived nanoparticles of barium ferrite had both higher intrinsic coercivity (Hc) and saturation magnetization (σs) than the particles derived from bulk co-precipitation. Particles were analyzed by electron microscopy, X-ray diffraction, differential thermal analysis (DTA), thermogravimetric analysis (TGA) and vibrating sample magnetometry (VSM). The best barium ferrite particles produced by the microemulsion synthesis method yielded an intrinsic coercivity of 4310 Oe and a saturation magnetization of 60.48 emu/g

  9. Role of hexadecapole interaction in proton rich barium isotopes

    International Nuclear Information System (INIS)

    From the systematic analysis of the experimental data on proton rich barium isotopes, it is observed that nuclei in the region z ≥ 50 and N≤82 are the transitional nuclei as they show a shape transition from spherical to deformed shape. An interesting feature of the observed yrast spectra in barium isotopic mass chain is the systematic variation of E2+, E4+ and E6+ excitation energy states from 120Ba to 136Ba. It is observed that these states follow a systematic decreasing trend as move away from 136Ba towards 120Ba. The isotopes 120-128Ba can be taken to be quasi-deformed nuclei having E4+/E2+ ratio larger than 2.7. Based on the systematics of low-lying states and the experimental data of quadrupole moments and B(E2) transition probabilities, the stable barium isotopes range from the approximately spherical 138Ba to l30Ba which is close to the deformed 120-128Ba isotopes. The purpose of the paper is to determine the importance of octupole-octupole and hexadecapole- hexadecapole parts of the two body interaction in reproducing the observed nuclear structure properties of 120-136Ba isotopes

  10. CT and barium features of gastrointestinal and peritoneal tuberculosis

    Directory of Open Access Journals (Sweden)

    Makanjuola Dorothy

    1997-01-01

    Full Text Available The radiological features in barium gastrointestinal studies and computed tomographic (CT examinations of 22 consecutive cases of proven peritoneal and/or intestinal tuberculosis were analyzed in order to highlight the radiological features which could provide ready identification of the disease. There were 15 cases of intestinal tuberculosis and 7 cases of peritoneal tuberculosis and 3 patients had both. The commonest location of intestinal tuberculosis was the ileocecal region (N=10 which occurred in association with colonic or ilea] disease. Bowel wall thickening in CT was largely asymmetrical but minimal and symmetrical wall thickening occurred with peritonitis. Luminal narrowing with or without mucosal tethering were seen in both CT and Barium studies. Peritoneal TB had either high density ascites with smudge or nodular omental surface with a thickened omental lining. Also detected was fibrinous dry peritonitis with thickened mesenteric tissue. Lymphadenopathy in the peripancreatic, mesenteric or paracaval were common to both intestinal or peritoneal tuberculosis (21 out of 22. Fifty percent of the patients showed some lymph nodes with necrotic centers. The differential diagnosis included malignant peritonitis and intestinal or mesenteric carcinoid. The study shows that a combination of barium gastrointestinal study and computed tomography can provide distinct features which could strongly suggest the diagnosis of intestinal or peritoneal tuberculosis.

  11. Scanning electron and tunneling microscopy of palladium-barium emitters

    International Nuclear Information System (INIS)

    The results of study of metal-alloyed palladium-barium emitters' of modern very high frequency high-powered electronic vacuum tubes by scanning electron microscopy (SEM) and scanning tunneling microscopy/spectroscopy (STM/STS) are presented. Since the Pd/Ba foil surface is fairly smooth and is not oxidized in air STM/STS investigations are carried out in air in normal laboratory environment. SEM and STM images show that the emitter surface has a complex porous structure. The cathode surface study by STS in tunneling gap modulation mode allowed to take a map of phase distribution with various work function values and high lateral resolution. Obtained images demonstrate the presence of three phases on the Pd/Ba emitter surface, viz. barium-oxygen compounds, intermetallic, and palladium. As it is seen from presented STS image the phase with a low work function value (barium oxides) is concentrated along boundaries of the substance inclusions with work function corresponding to the intemetallic compound Pd5Ba. This supports the model of low work function areas obtained via Ba segregation from the intermetallic compound and oxidation. The presented methods may be used in the Pd/Ba cathode manufacturing process for increasing the yield of electronic devices in microwave tube production and optimize the emitters' characteristics

  12. Early colon cancer : findings on double contrast barium enema

    International Nuclear Information System (INIS)

    The purpose of this study is to describe the radiologic findings of early colon cancer on double-contrast barium enema. We retrospectively reviewed the double-contrast barium enemas of eight patients (M:F = 6:2; mean age : 67 yrs; range : 48-77 yrs) who were pathologically proven to be early colon cancer. The location, size and gross morphology of lesions was evaluated using double-contrast barium enema, while depth of invasion, degree of differentiation, precancerous lesions and lymph node metastasis were evaluated histopathologically. Early colon cancer was found in the rectum (n=4), sigmoid colon (n=3) and ascending colon (n=1). The size of mass ranged from 2.3 ∼ 8.3 (mean, 4.6) cm. And the polypoid type was most common (n=7); this was subdivided into sessile (Is, n=5), semipedunculated (Isp, n=1) and pedunculated type (Ip, n=1). Another mass was a sessile polypoid combined with a flat depressed lesion. In eight cases, four cancers were confined to the mucosa, while the remaining four had infiltrated the submucosa. Most cancers arose from villous and villotubular adenoma. All cases were well-differentiated adenocarcinoma and no metastasis to lymph nodes had occurred. In early colon cancer, lesions were mainly polypoid and large. Most arose from villous and villotubular adenoma. (author). 19 refs., 1 tab., 3 figs

  13. Progress on indium and barium single ion optical frequency standards

    CERN Document Server

    Sherman, J A; Metz, S; Nagourney, W; Fortson, N; Sherman, Jeff A.; Trimble, William; Metz, Steven; Nagourney, Warren; Fortson, Norval

    2005-01-01

    We report progress on 115In+ and 137Ba+ single ion optical frequency standards using all solid-state sources. Both are free from quadrupole field shifts and together enable a search for drift in fundamental constants.

  14. Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium

    International Nuclear Information System (INIS)

    Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation

  15. The Y137H mutation of VvCYP51 gene confers the reduced sensitivity to tebuconazole in Villosiclava virens

    OpenAIRE

    Fei Wang; Yang Lin; Wei-Xiao Yin; You-Liang Peng; Guido Schnabel; Jun-Bin Huang; Chao-Xi Luo

    2015-01-01

    Management of rice false smut disease caused by Villosiclava virens is dependent on demethylation inhibitor (DMI) fungicides. Investigation of molecular mechanisms of resistance is therefore of upmost importance. In this study the gene encoding the target protein for DMI fungicides (VvCYP51) was cloned and investigated. The VvCYP51 gene in the resistant mutant revealed both a change from tyrosine to histidine at position 137 (Y137H) and elevated gene expression compared to the parental isolat...

  16. Spatial 137Cs distribution in forest soil

    International Nuclear Information System (INIS)

    This work presents the distribution of radioactive caesium in several types of forest soil originating from the Lesisko reserve (Opole Province, Poland). Vertical distribution of 137Cs isotope was determined in the profiles related to physicochemical properties of different types of soils and their location. Thickness of emerging genetic horizons, structure and morphology of soil profiles were determined. The highest 137Cs activities were found in Of and A horizons. At the same time, there was a sudden drop of 137Cs activity in mineral horizons of soil profiles. By analysis of caesium radioisotope content and its distribution in soil profiles significant correlations were observed between certain physicochemical properties (e.g. pH value, hydrolytic acidity, granulometric composition) of soils in selected forest habitats. (author)

  17. 13.7.Gallbladder and bile duct

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    950323 CT in predicting the efficacy of oralcholelitholysis with bile acids.FU Xianbo (傅贤波),et al.Dept Surg,3rd Teach Hosp,BeijingMed Univ,Beijing,100083.Natl Med J China1993;73(2):81—83.The efficacy of oral cholelitholytic therapywith chenodeoxycholic acid (CDCA) and ur-sodeoxycholic acid (UDCA) in 137 patients withgallstones was compared with their CT pat-terns.The best dissolving results were obtainedfrom patients with the stones in isodense andfaint category (<50Hu) on CT.All the stoneswith high density or heterogeneous calcificationon CT were insoluble.Therefore,they were con-traindicated for oral cholelitholytie therapy.Ac-cording to the abovr,criteria,the rates for disso-lution ranged from 27.7%(38/137).to 66.7%(38/57),and those for complete dissolutionranged from 9.49%(13/137) to 40.7%(11/

  18. Radiochemical determination of 137Cs in foods

    International Nuclear Information System (INIS)

    A determination of radionuclides in food samples is important in commodities in order to attend to regulatory requirements for international trade. As a long-lived radioisotope of cesium, 137Cs is produced as a result of human nuclear activities and than its contamination level evaluation among others radionuclides in foods is necessary. A methodology for the determination of 137Cs in foods, pork and fish, is described. The procedures covered homogenization and freeze-drying of the samples. The 137Cs was measured by gamma spectrometry using Canberra 50% HPGe detector. The counting was carried out with Monte Carlo software for detection conditions optimization including geometry and chemical data information. A certified sample, SRM IAEA-375, was analyzed in order to evaluate the reliability of the method, and the results showed good agreement between the measured and certified values. (author)

  19. Barium and Tc-poor S stars: Binary masqueraders among carbon stars

    OpenAIRE

    Jorissen, A; Van Eck, S.

    1997-01-01

    The current understanding of the origin of barium and S stars is reviewed, based on new orbital elements and binary frequencies. The following questions are addressed: (i) Is binarity a necessary condition to produce a barium star? (ii) What is the mass transfer mode (wind accretion or RLOF?) responsible for their formation? (iii) Do barium stars form as dwarfs or as giants? (iv) Do barium stars evolve into Tc-poor S stars? (v) What is the relative frequency of Tc-rich and Tc-poor S stars?

  20. Mechanism of action of barium ion on rat aortic smooth muscle.

    Science.gov (United States)

    Hansen, T R; Dineen, D X; Petrak, R

    1984-03-01

    The mechanism of action of barium ion on the aortic smooth muscle of the normal rat was investigated using in vitro calcium-depleted aortic strips. Aortic strips were depleted of calcium by repeated exposure to norepinephrine in a calcium-free bathing solution. Although calcium depletion abrogated the response of strips to catecholamines and depolarizing agents, the response to barium chloride remained quantitatively intact. The calcium influx blocker D 600 prevented the contractile response to barium but not to catecholamines, whereas phentolamine prevented the response to catecholamines but not barium. The strip response to barium was depressed by a twofold increase in extracellular magnesium concentration whether the strip was intact or calcium depleted. Although increased concentrations of calcium in the extracellular medium inhibited the contractile response to potassium ion, increases in barium merely potentiated the potassium contracture. These findings indicate that barium produces its contractile effect on vascular smooth muscle by a direct intracellular interaction with the contractile or regulatory proteins. Barium enters these cells via calcium influx channels and is probably not sequestered in a physiologically releasable pool. Unlike calcium, barium does not stabilize the smooth muscle sarcolemma when present in high concentration. PMID:6703038

  1. Barium can replace calcium in calmodulin-dependent contractions of skinned renal arteries of the rabbit.

    Science.gov (United States)

    Kreye, V A; Hofmann, F; Mühleisen, M

    1986-03-01

    Renal arteries of the rabbit were chemically skinned using Triton X-100. In EGTA-buffered solutions containing calmodulin and ATP, small strips of the skinned preparations were found to develop contractile force which was dependent on the concentrations of either free calcium or of free barium. However, a 220 times greater concentration of barium than of calcium was necessary for comparable effects. Quantitatively, the response to barium was dependent on the concentration of calmodulin added to the test solutions. The contractile effect of barium was partly antagonized by the calmodulin antagonist, trifluoperazine. PMID:3960707

  2. High Resolution Computed Tomography Appearences of late sequelae of Barium Aspiration in an asymptomatic young child

    International Nuclear Information System (INIS)

    Barium aspiration is a well-known complication of upper gastro-intestinal studies. Consequences of aspiration are generally insignificant and leave no permanent changes in the lung parenchyma. However, large quantities of high density barium, if aspirated, lead to silent interstitial changes and fibrosis. High-resolution computed tomography HRCT appearances of lung changes have been demonstrated in adults; few such reports are available in the pediatric literature. We report a case of a child who aspirated barium 3 months before this presentation. The HRCT appearances of barium aspiration are presented with a review of the literature. (author)

  3. Solubility and stability of barium arsenate and barium hydrogen arsenate at 25oC

    International Nuclear Information System (INIS)

    The inconsistency among current thermodynamic data of Ba3(AsO4)2(c) and BaHAsO4.H2O(c) led the authors to obtain independent solubility data of barium arsenate by both precipitation and dissolution experiments. Low and neutral pH (3.63-7.43) favored the formation of BaHAsO4.H2O(c). Both BaHAsO4.H2O(c) and Ba3(AsO4)2(c) formed at the neutral pH conditions (7.47, 7.66), whereas Ba3(AsO4)2(c) was the only solid phase precipitated at high pH (13.03, 13.10). The Ba3(AsO4)2(c) precipitate acquired at 50oC appeared as small leafy crystal, while the Ba3(AsO4)2(c) solid precipitated at 25oC comprised granular aggregate with some smaller crystal clusters. XRD and SEM analyses of Ba3(AsO4)2(c) and BaHAsO4.H2O(c) indicated that the solids were indistinguishable before and after the dissolution experiments. In the present work, the solubility products (Ksp) for Ba3(AsO4)2(c) and BaHAsO4.H2O(c) were determined to be 10-23.53(10-23.01 to 10-24.00) and 10-5.60(10-5.23 to 10-5.89), respectively. ΔGfo for Ba3(AsO4)2(c) and BaHAsO4.H2O(c) were calculated to be -3113.40 and -1544.47kJ/mol, respectively. There was no difference between the solubility products of the leafy and the granular Ba3(AsO4)2(c) solids

  4. Effects of radionuclides (uranium et cesium 137) on the metabolism of vitamin D in rat

    International Nuclear Information System (INIS)

    Uranium and Cesium 137 (137Cs) are both radionuclides found in the environment as a result of their accidental dispersion and/or natural presence. Consequently, some human populations are exposed to these radioelements mainly through chronic ingestion. Chemical and/or radiological toxicity of uranium and 137Cs has been reported in kidney, liver and brain that play key-roles in vitamin D metabolism. Beside, alterations of both bone and phospho-calcium homeostasis have been reported after an acute or chronic contamination with uranium or 137Cs. However, vitamin D, the major regulator of mineral homeostasis has never been studied up to now. The aim of this work was to investigate in vivo the effects of depleted (DU) or enriched uranium (EU) and of 137Cs on vitamin D3 biosynthetic pathway in liver, kidney and brain. An experimental animal model was used for the first time to demonstrate that chronic exposure with environmental doses of 137Cs and uranium could decrease the vitamin D active form level (1,25(OH)2D3) and lead to molecular modifications of cytochromes P450 (CYPs) enzymes involved in this metabolism and associated nuclear receptors. We demonstrated that both UA and UE contamination affected VDR (vitamin D receptor) and RXRa (retinoid X receptor alpha) expression, and consequently could modulate the expression of vitamin D target genes involved in calcium homeostasis in kidney. These results suggest that these effects could be due to the chemical toxicity of uranium. On the contrary, the main molecular targets of 137Cs are CYPs involved in Vitamin D3 biosynthesis (CYP2R1, CYP27B1) in liver and brain. In this adult rat model such perturbations were not associated with a dys-regulation of mineral homeostasis. Conversely, chronic exposure with 137Cs during postnatal development induce alterations of vitamin D metabolism associated with modifications of bone and phospho-calcium homeostasis, suggesting a greater susceptibility of the growing organism to 137Cs

  5. Hypoxia-induced soluble CD137 in malignant cells blocks CD137L-costimulation as an immune escape mechanism

    Science.gov (United States)

    Labiano, Sara; Palazón, Asis; Bolaños, Elixabet; Azpilikueta, Arantza; Sánchez-Paulete, Alfonso R.; Morales-Kastresana, Aizea; Quetglas, Jose I.; Perez-Gracia, José L.; Gúrpide, Alfonso; Rodriguez-Ruiz, Maria; Aznar, M. Angela; Jure-Kunkel, Maria; Berraondo, Pedro; Melero, Ignacio

    2016-01-01

    ABSTRACT Hypoxia is a common feature in solid tumors that has been implicated in immune evasion. Previous studies from our group have shown that hypoxia upregulates the co-stimulatory receptor CD137 on activated T lymphocytes and on vascular endothelial cells. In this study, we show that exposure of mouse and human tumor cell lines to hypoxic conditions (1% O2) promotes CD137 transcription. However, the resulting mRNA is predominantly an alternatively spliced form that encodes for a soluble variant, lacking the transmembrane domain. Accordingly, soluble CD137 (sCD137) is detectable by ELISA in the supernatant of hypoxia-exposed cell lines and in the serum of tumor-bearing mice. sCD137, as secreted by tumor cells, is able to bind to CD137-Ligand (CD137L). Our studies on primed T lymphocytes in co-culture with stable transfectants for CD137L demonstrate that tumor-secreted sCD137 prevents co-stimulation of T lymphocytes. Such an effect results from preventing the interaction of CD137L with the transmembrane forms of CD137 expressed on T lymphocytes undergoing activation. Indeed, silencing CD137 with shRNA renders more immunogenic tumor-cell variants upon inoculation to immunocompetent mice but which readily grafted on immunodeficient or CD8+ T-cell-depleted mice. These mechanisms are interpreted as a molecular strategy deployed by tumors to repress lymphocyte co-stimulation via CD137/CD137L. PMID:26942078

  6. Chronic contamination with 137Cesium affects Vitamin D3 metabolism in rats

    International Nuclear Information System (INIS)

    Twenty years after Chernobyl disaster, many people are still chronically exposed to low dose of 137Cs, mainly through the food consumption. A large variety of diseases have been described in highly exposed people with 137Cs, which include bone disorders. The aim of this work was to investigate the biological effects of a chronic exposure to 137Cs on Vitamin D3 metabolism, a hormone essential in bone homeostasis. Rats were exposed to 137Cs in their drinking water for 3 months at a dose of 6500 Bq/l (approximately 150 Bq/rat/day), a similar concentration ingested by the population living in contaminated territories in the former USSR countries. Cytochromes P450 enzymes involved in Vitamin D3 metabolism, related nuclear receptors and Vitamin D3 target genes were assessed by real time PCR in liver, kidney and brain. Vitamin D, PTH, calcium and phosphate levels were measured in plasma. An increase in the expression level of cyp2r1 (40%, p 137Cs-exposed rats. However a significant decrease of Vitamin D (1,25(OH)D3) plasma level (53%, p = 0.02) was observed. In brain, cyp2r1 mRNA level was decreased by 20% (p 137Cs contamination. In conclusion, this study showed for the first time that chronic exposure with post-accidental doses of 137Cs affects Vitamin D3 active form level and induces molecular modifications of CYPs enzymes involved its metabolism in liver and brain, without leading to mineral homeostasis disorders

  7. 21 CFR 137.305 - Enriched farina.

    Science.gov (United States)

    2010-04-01

    ... identity prescribed for farina by § 137.300, except that: (1) It contains in each pound not less than 2.0... a part of a trademark or brand, then other written, printed, or graphic matter that is also a part of the trademark or brand may so intervene, if such statement is in such juxtaposition with...

  8. Cs-137 in milk and in humans

    International Nuclear Information System (INIS)

    In 1984, whole body counters were used on 12 people to detect incorporated Cs-137. The measured concentrations were 1540 mBq/kg on average and reached a maximum of 5440 mBq/kg. These values from Bremen are surprisingly high in comparison with the average values stated by the Federal Board of Health in 1979 and by the KfK in 1981. The author believes this is due to the fact that some of the people examined drink a lot of milk. This opinion - or at least this tendency - was confirmed by using a retention function. The Cs-137 concentrations in milk samples taken purposefully were up to 1320 mBq/l. The results allow the conclusion that person drinking 1 to 1.5 l milk a day take in up to 5 times the quantity of Cs-137 of an average eater. With the people examined in Bremen this lead to a maximum whole body dose of about 10 μSv/a from Cs-137. (orig./HP)

  9. 7 CFR 1150.137 - Procedure.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM Dairy Promotion and Research Order National Dairy Promotion and Research Board § 1150.137 Procedure. (a) A majority of the...

  10. 137Cs metabolism in pregnant women

    International Nuclear Information System (INIS)

    Data from two pregnant women contaminated with 137Cs, body burdens of 0.2 and 300 MBq, respectively at the time of the Goiania accident, were compared. The first one, with lower body burden was exposed during the fourth month of pregnancy, while the second became pregnant three years and eight months after 137Cs intake. For the first woman 137Cs concentrations were equal for the mother, infant and placenta, indicating an easy and homogeneous transport of 137Cs from mother to foetus. The whole body monitoring data from the second woman, who became pregnant four years after intake, did not show a reduction in biological half-life during the pregnancy. Cs concentration in the mother was found to be 13 times higher than in the infant. One possible reason for this result is that four years after intake, Cs is supposed to be concentrated mainly in skeletal muscle tissue. During the pregnancy the blood flux becomes higher in most of the organs and tissues except brain, liver and skeletal muscle tissue. (author)

  11. 42 CFR 137.280 - Construction Definitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Construction Construction Definitions § 137... environmental assessment nor an environmental impact statement is required. Any procedures under this section... environmental effect. CEQ means Council on Environmental Quality in the Office of the President....

  12. 14 CFR 137.11 - Certificate required.

    Science.gov (United States)

    2010-01-01

    ... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS AGRICULTURAL AIRCRAFT OPERATIONS Certification Rules § 137.11 Certificate required. (a) Except as provided in paragraphs (c) and (d) of this... dispensing of water on forest fires by rotorcraft external-load means, need not comply with this subpart....

  13. Tungsten and barium transport in the internal plasma of hollow cathodes

    Science.gov (United States)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.

    2009-06-01

    The effect of tungsten erosion, transport, and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from 8200 h and 30 352 h ion engine wear tests. Erosion and subsequent redeposition of tungsten in the electron emission zone at the downstream end of the insert reduce the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  14. Distribution of Cs-137 in lake sediment

    International Nuclear Information System (INIS)

    This study on Cs-137 from the Chernobyl accident was conducted in Lake Raaksjoen, an oligotrophic, mesohumic lake in central Sweden. The purpose was to determine the areal as well as the vertical distribution of Cs-137 in lake sediment and to see if the results could be explained by parameters such as morphometry of the lake, wind exposure, currents, wave action etc. Sediments cores were taken on 19 sites in March 1992 when the lake still was ice covered and these sampling-sites were spread all over the lake. The sediment cores were taken to the laboratory and sliced into 0.5-1 cm increments down to a sediment depth of 10 cm. The sediment increments were analysed on physical parameters such as density and water content and chemical parameters like C, N, Fe, Mn and Ca together with a measure of Cs-137 concentrations using a sodium iodine detector. The average concentration of cesium-137 in the sediment in Lake Raaksjoen was 30-35 kBq/m2, which coincide with the amount deposited on the lake (30-40 kBq/m2). There was a clear tendency for the concentration to increase with water depth, as a result of sediment focusing. The vertical distribution of Cs-137 was quite uniform for all sampling-sites with a peak about a centimeter down in the sediment and then decreasing concentrations downwards to a negligible value not affected by the Chernobyl accident at a sediment depth of 10 cm. There were no connections found between cesium content and other substances analysed

  15. CD137 signaling suppresses the suppressive function of treg cells of peripheral blood from breast cancer patients

    International Nuclear Information System (INIS)

    Objective: To explore the biological effect of CD137 and its molecular mechanism on CD4+ CD25+ Treg cells. Methods: Anti-CD137 mAb was added to stimulate the T cells that isolated from peripheral blood of breast cancer patients and activated by PHA. T cell proliferation was determined by cell counting or by 3H-TdR incorporation assessing at the 3rd. The phenotype of cells was determined by FACS, and Foxp3 analysis was performed after fixation and intracellular staining. Cytokine in the supernatant was quantified with ELISA. Results: CD137 expressed on CD4+ CD25+ Treg cells. Triggering CD137 signaling of CD4+ CD25+ Treg cells by anti-CD137 mAb could promote the proliferation of T cells form PBMCs of breast cancer patients and decrease the ratio of Foxp3+ Treg population and reduce Foxp3 expression of Treg cells, as well as the production of TGF-β1 and IL-10, and suppress the ability of Treg cells to inhibit proliferation of CD4+ CD25-T cells. Conclusion: CD137 signaling could suppress the suppressive function of Treg cells, and CD137 might be a potential molecular target for the immunological interference. (authors)

  16. Anion and cation diffusion in barium titanate and strontium titanate

    International Nuclear Information System (INIS)

    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO3 single crystals has been studied by means of 18O2/16O2 isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial pressure and temperature. The data

  17. Standardization of 137mCs+137mBa by Liquid Scintillation

    International Nuclear Information System (INIS)

    A procedure for the preparation of a stable, homogeneous solution of 137Cs+''137mBa, for use in liquid scintillation measurements, is described. Its count rate stability and spectral time evolution has been followed for several weeks. The solution has been standardised by the CIEMAT/NIST method in both Ultima-Gold and Insta-Gel, to a combined uncertainty lower than 0,51 % (k=l). (Author) 5 refs

  18. Microstructure of polymer composite with barium ferrite powder

    Directory of Open Access Journals (Sweden)

    R. Nowosielski

    2008-12-01

    Full Text Available Purpose: The aim of the paper is the microstructure characterization of commercial BaFe12O19 powder and its composite material in polymer matrix; XRD (X-Ray Diffraction and SEM (Scanning Electron Microscopy methods were applied.Design/methodology/approach: The Rietveld method appeared to be very useful in the verification of the qualitative phase composition and in the determination of phase abundance. Hill and Howard procedure was applied for quantitative phase analysis. The parameters of the individual diffraction line profiles were determined by PRO-FIT Toraya procedure. The morphology of barium ferrite powders and a fracture surface of the examined composite material was analyzed using the scanning electron microscope.Findings: The X-ray diffraction analysis enabled the identification of BaFe12O19 and Fe2O3 phases in examined material. Basing on Rietveld and Toraya methods the determination of lattice parameters, crystallite size and the lattice distortion was performed. Distribution of powders of barium ferrite in polymer matrix is irregular and powder particles are of irregular shapes and different sizes.Research limitations/implications: Maked researches are limited only to characterization the microstructure of commercial material, because obtained results will be helpful to prepare barium ferrite powders by mechanical alloying and subsequent annealing in the future. As prepared BaFe12O19 powders will be used as the starting material for magnets bonded with polymer material.Originality/value: The obtained results of investigations by different methods of structure analysis confirm their useful in the microstructure analysis of powder materials.

  19. Dicty_cDB: SHG137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHG137 (Link to dictyBase) - - - Contig-U16411-1 SHG137P (Link to Original ... EISPNSLFLQVLRSAARHQKNNGDSHLAVDHLILGLLDDRDILSVLGDAG ATK --- ---TEAVRRRPYSVVLFDEVEKAHQQVWNVLLQVLDEGRLTDGQGRT ... EISPNSLFLQVLRSAARHQKNNGDSHLAVDHLILGLLDDRDILSVLGDAG ATK --- ---*lkpseedhtv*yclmklkklinkfgmfsykywmkvvlpmvkve ...

  20. Dicty_cDB: VSA137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA137 (Link to dictyBase) - - - Contig-U13981-1 VSA137Z (Link to Original ... i*qeyqiycyn*fyfilsnfqfilksnslf*tnnykqslikslrwqpsy *epf *ittflvvvttyir*kthfqlvwskfqeihnlvvfqkhflhhh*rklmfhl ...

  1. Influence of magnetic field on laser-produced barium plasmas: Spectral and dynamic behaviour of neutral and ionic species

    International Nuclear Information System (INIS)

    The expansion dynamics and spectral behaviour of plasma produced by a Nd:YAG laser (λ = 1.064 μm, pulse width: 8 ns) from barium target and expanding in 0.45 T transverse magnetic field in vacuum (10−5 Torr pressure) are investigated using time-of-flight optical emission spectroscopy. The experiments are carried out at various laser fluences from 12 to 31 J/cm2. The temporal profiles of neutral (Ba I 553.5 and 577.7 nm) lines are temporally broadened, while that of ionic (Ba II 413.0 and 455.4 nm) lines show strong confinement in the presence of a magnetic field. In the absence of magnetic field, the temporal profile of Ba I 553.5 nm is exactly reproduced by fitting with two Shifted Maxwell Boltzmann (SMB) Distribution components, while in the presence of a magnetic field the profile could only be fitted with three components. The field enhanced and field induced SMB components of neutral profile are correlated with populations of ground state, metastable states, and long-lived Rydberg states present in the barium plasma, while SMB components of ionic lines are explained on the basis of the presence of super-elastic collisions among the excited species in the plasma. The spatial variation of electron temperature and temporal variation of electron density are deduced and correlated to the different collisional processes in the barium plasma. The ionic profiles show efficient confinement in the presence of a magnetic field at higher fluences.

  2. Nuclear magnetic resonance studies of the nuclei 17O, 63Cu, 65Cu, 135Ba, 137Ba, 138La and 139La

    International Nuclear Information System (INIS)

    A systematic nuclear magnetic resonance study has been performed for the nuclei 17O, 63Cu, 65Cu, 135Ba, 137Ba, 138La, and 139La. The larmor-frequency ratio of these isotopic pairs as well as the larmor-frequency ratio of one isotope and a reference nucleus have been measured. The experimental accuracy could be increased appreciably compared with previous measurements. Furthermore the chemical shift of the resonance lines has been determined as a function of concentration and as a function of the type of salt. Based on these measurements, the nuclear magnetic dipole moment of oxygen, barium and lanthanum could be determined for a relatively simple and definite environment. From the experimental nuclear gsub(I)-factor ratios of the copper, barium, and lanthanum isotopes and known A-factor ratios, the hyperfine structure anomaly of some atomic states could be deduced. In the case of lanthanum, a H2O-D2O solvent isotopic effect has been observed, confirming an assumed unordinary behaviour of this effect within the group III a of the periodic table. Furthermore, the solvent isotopic effect of 17O has been studied systematically with water of different 2H-concentrations. Studying the behaviour of the copper, barium, and lanthanum resonance line widths as a function of different parameters, the ratio of the nuclear quadrupolar moments can be obtained. In the case of barium, this nuclear quadrupolar moment ratio has been compared with a measurement of the nuclear quadrupole resonance frequency ratio, performed in this work. In the case of copper an indirect spin-spin coupling between copper and phosphorus nuclei has been observed. Investigations could be performed in organic solvents for a series of substances, thus demonstrating the advantages of nuclear magnetic resonance also for this transition element. (orig./HSI)

  3. 75 FR 36629 - Barium Chloride From the People's Republic of China: Continuation of Antidumping Duty Order

    Science.gov (United States)

    2010-06-28

    ... Barium Chloride From China, 75 FR 33824 (June 15, 2010), and Barium Chloride from China (Inv. No. 731-TA... Five-year (``Sunset'') Review, 74 FR 31412 (July 1, 2009). As a result of its review, the Department... China: Final Results of Expedited Third Sunset Review of Antidumping Duty Order, 74 FR 55814 (October...

  4. New efficient catalyst for ammonia synthesis: barium-promoted cobalt on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus; Jacobsen, Claus J.H.; Teunissen, Herman T; Ståhl, Kenny; Chorkendorff, Ib

    2002-01-01

    Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia......Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia...

  5. LACK OF EFFECT OF DRINKING WATER BARIUM ON CARDIOVASCULAR RISK FACTORS

    Science.gov (United States)

    Higher cardiovascular mortality has been associated in a single epidemiological study with higher levels of barium in drinking water. he purpose of this study was to determine whether drinking water barium at levels found in some U.S. communities alters the known risk factors for...

  6. Acute respiratory failure caused by aspiration of high density barium: A case report

    International Nuclear Information System (INIS)

    Accidental aspiration of barium contrast medium during the upper gastrointestinal study can occur in patients with swallowing disorder, especially in the elderly patients. We experienced a case of respiratory failure followed by death within a few hours in 85 year-old patient after barium aspiration

  7. 137Cs in forest ecosystems in Estonia

    International Nuclear Information System (INIS)

    Full text: In the recently published 'Europe's Environment' (1995) one can find the map on 137Cs cumulative deposition in Europe after the Chernobyl accident (source: De Corte et al., 1990). On this map most of the Eastern Europe including Baltic Sea region is practically uncovered. In this reason we decided to present data on accumulation of 137Cs in the forest ecosystems in Estonia. Field sampling for current study has been conducted in 1986 - 1994. 137Cs concentrations were measured in different compartments of model trees, ground vegetation layers, debris and topsoil. The amount of 137Cs varied from 1.9 kBq/m2 in continental Estonia to 28.8 kBq/m2 in north-eastern Ne part of Estonia. The results obtained correspond to data presented in Wahlstroem et al., (1992) for Finland. According to the 'Europe's Environment' criteria northeastern Estonia belongs to the third cumulative deposition zone (10 to 32 kBq/m2). In Estonia the total deposition of 137Cs varies in the range from practically zero to 3.9 kBq/m2 . The calculations of Realo et al. (1994) back to May 1, 1986 gave figures from 0 to 21 kBq/m2. In macro lichens Cetraria, Cladina, Cladonia the rapid changes in 137Cs concentrations were observed: 0.06 - 0.18 kBq/kg in 1982-85, 0.93 - 6.23 kBq/kg in 1986-87, 0.27 -4.26 kBq/kg in 1988-89, 0.05 - 1.46 kBq/kg in 1990-91 and, finally, 0.03 - 0.46 kBq/kg in 1993-94. At the end of the observation period average value of the 137Cs concentrations was the same as maximum before the CRA and decline of the concentrations was 4 times during six years. Average concentrations of 137Cs in two common forest mosses Pleurozium shreberi and Hylocomium splendens was 0.43 kBq/kg of dry matter and in forest debris 0.38 kBq/kg. In 1986 the highest concentration in mushrooms - 16.6 kBq/kg was found in Lactarius sp. (Martin, L., et al., 1991). In 1991 samples of 41 different mushroom species from 63 sample sites mostly in Scots pine stands were analyzed. The highest concentration of

  8. Medical radiation shielding effect by composition of barium compounds

    International Nuclear Information System (INIS)

    Highlight: ► Radiation shielding sheet was manufactured using BaSO4 and a combination of tourmaline, tungsten, silicon and rubber polymer. ► The particle packing of barium tends to be related to the tensile strength. ► The tensile strength was most excellent in the sheets containing rubber. ► The shielding ability of the tungsten and silicon combination with BaSO4 was the same as that of a 0.3 mm lead equivalent. - Abstract: Shielding aprons were manufactured from barium sulfate as a potential substitute for the lead aprons used most commonly for medical radiation shielding. Six types of radiation shielding sheets made from a combination of tungsten, molybdenum, rubber and silicon with a barium sulfate base were manufactured, and their transmission doses were compared with those of a lead standard. In the process of producing the radiation shielding sheets, the particle packing and porosity of the materials, appropriate weight-average molecular weight to number-average molecular weight ratio and tensile strength were investigated to determine the optimal mixing process. The transmission dose was measured by applying a lead equivalent test method () of X-ray protective supplies in the Korea Industrial Standard. The transmission doses of the lead standard with a thickness of 0.05, 0.1, 0.15, 0.2, 0.25, 0.3 and 0.35 mm, as well as the six types of radiation shielding sheet were obtained at a tube voltage of 50, 80, 100, 120 and 150 kVp. According to the results, the combination of barium, tungsten, molybdenum and silicon recorded a dose of a 0.3 mm lead equivalent and its particle packing and porosity were 28–36% and 12–22%, respectively. Nevertheless, satisfactory shielding ability could be obtained with a porosity >20% and particle packing of 30%. Therefore, it is a potential replacement for lead sheet and can be considered a proper medical radiation shielding sheet with good economic feasibility.

  9. Enhanced flexoelectricity through residual ferroelectricity in barium strontium titanate

    International Nuclear Information System (INIS)

    Residual ferroelectricity is observed in barium strontium titanate ceramics over 30 °C above the global phase transition temperature, in the same temperature range in which anomalously large flexoelectric coefficients are reported. The application of a strain gradient leads to strain gradient-induced poling or flexoelectric poling. This was observed by the development of a remanent polarization in flexoelectric measurements, an induced d33 piezoelectric response even after the strain gradient was removed, and the production of an internal bias of 9 kV m−1. It is concluded that residual ferroelectric response considerably enhances the observed flexoelectric response

  10. Strain engineered barium strontium titanate for tunable thin film resonators

    Energy Technology Data Exchange (ETDEWEB)

    Khassaf, H.; Khakpash, N. [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Sun, F. [Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States); Sbrockey, N. M.; Tompa, G. S. [Structured Materials Industries, Inc., Piscataway, New Jersey 08854 (United States); Kalkur, T. S. [Department of Electrical and Computer Engineering, University of Colorado at Colorado Springs, Colorado Springs, Colorado 80918 (United States); Alpay, S. P., E-mail: p.alpay@ims.uconn.edu [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States)

    2014-05-19

    Piezoelectric properties of epitaxial (001) barium strontium titanate (BST) films are computed as functions of composition, misfit strain, and temperature using a non-linear thermodynamic model. Results show that through adjusting in-plane strains, a highly adaptive rhombohedral ferroelectric phase can be stabilized at room temperature with outstanding piezoelectric response exceeding those of lead based piezoceramics. Furthermore, by adjusting the composition and the in-plane misfit, an electrically tunable piezoelectric response can be obtained in the paraelectric state. These findings indicate that strain engineered BST films can be utilized in the development of electrically tunable and switchable surface and bulk acoustic wave resonators.

  11. Heterometallic β-diketonates containing barium and rare earth elements

    International Nuclear Information System (INIS)

    Potentiality of formation of heterobimetallic complexes of the composition Ba[LnLn] (Ln = La, Er; L - hexafluoroacetylacetonate, pivaloyltrifluoroacetonate-(Pta), dipivaloylmethanate-anion, is studied by mass spectrometry (MALDI-MS) method. The compounds prepared are characterized by the methods of element analysis. IR spectroscopy of gaseous phase, thermal analysis in vacuum. Compound Ba[La(Pta)5] features increased thermal stability compared with Ba(Pta)2 and La(Pta)3 and it can be offered for practical use as barium and lanthanum source in preparation of oxide films

  12. Barium strontium titanate powders prepared by spray pyrolysis

    International Nuclear Information System (INIS)

    Ultasonic spray pyrolysis (SP) has been investigated for the production of the barium strontium titanate (BST) powders from the polymeric precursors. The processing parameters, such as flux of aerosol and temperature profile inside the furnace, were optimized to obtain single phase BST. The powders were characterized by the methods of X-ray diffraction analysis, SEM, EDS and TEM. The obtained powders were submicronic, consisting of spherical, polycrystalline particles, with internal nanocrystalline structure. Crystallite size of 10 nm, calculated using Rietveld refinement, is in a good agreement with results of HRTEM

  13. Mechanism of thermoluminescence in europium-doped barium fluorochloride

    International Nuclear Information System (INIS)

    The paper concerns the optical properties of europium-doped barium fluorochloride. Thermoluminescence (TL) and emission studies have been carried out with this material and the results are reported. The irradiation was by γ-rays from a 60Co source, the dose rate being 5000rad min-1. Glow curves of γ-irradiated BaFCl:Eu2+ are presented, along with the glow curves resolved into component peaks. TL emission spectra of BaFCl:Eu2+ at room temperature, 345K, 395K and 500K are also described. (U.K.)

  14. The Kerr nonlinearity of the beta-barium borate crystal

    OpenAIRE

    Bache, Morten; Guo, Hairun; Zhou, Binbin; Zeng, Xianglong

    2013-01-01

    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e...

  15. K-shell fluorescence yields of barium and lanthanum

    International Nuclear Information System (INIS)

    K-shell fluorescence yields for barium and lanthanum have been measured adopting simple 2π geometrical configuration and employing a weak 57Co radioactive source. A scintillation spectrometer with an NaI(Tl) detector of dimensions 44.5 mm diameterx50 mm thickness was employed for the detection and measurement of radiation. The results obtained are in good agreement with the best-fitted values of and also with the other experimental values, indicating that our simple method can be extended to determine fluorescence parameters of high Z materials.

  16. Colloidal stability of aqueous suspensions of barium zirconate

    OpenAIRE

    Boschini, Frédéric; Rulmont, André; Cloots, Rudi; Moreno, R.

    2005-01-01

    In this article, the colloidal behaviour of aqueous suspensions of barium zirconate is investigated. The variation of zeta-potential as a consequence of changing the pH and the concentration of an anionic polyelectrolyte is studied, the isoelectric point occurring at pH 5.3. The IEP shifts down on calcining the powder and also when anionic polyelectrolytes are added. Rheological studies have been made on suspensions prepared to a solids loading of 27 vol.% (72 wt.%). Optimum dispersing condit...

  17. Experiences with Cascara-Salax preparating children for barium enema

    International Nuclear Information System (INIS)

    30 children prepared for barium enema using Cascara-Salax are reported on. The results are: 1. A satisfactory preparation is possible in out-patient children older than ten years. 2. For children aged 6 to 10 years only the half dose early in the afternoon before the X-ray examination is necessary. 3. In most cases the colon is completely clear, if not, the X-ray study is generally not influenced by rests of stool. 4. It should be considered that other - and often unreliable - cleaning manoevers aren't necessary, the Cascara-Salax - method ist time - saving and side-effects are not of value. (orig.)

  18. Bis(chlorido)(dimethyl­sulfoxide-κO)barium(II)

    OpenAIRE

    Gschwind, Fabienne; Jansen, Martin

    2012-01-01

    The title compound, [BaCl2(C2H6SO)], forms a Ba6Cl9 cluster in which the BaCl2 units are connected via dimethyl­sulfoxide (DMSO) and chloride bridges. The central Cl atom of the Ba6Cl9 cluster is located on a threefold inversion axis and is coordinated octa­hedrally to six barium cations. In the crystal, the clusters are arranged in rows, which are inter­connected by the DMSO mol­ecules, forming a three-dimensional network.

  19. Magnetic and structural investigations on barium hexaferrite ferrofluids

    Science.gov (United States)

    Müller, R.; Hiergeist, R.; Gawalek, W.; Hoell, A.; Wiedenmann, A.

    2002-11-01

    Barium hexaferrite BaFe 12-2 xTi xCo xO 19 ferrofluids have been prepared using oleic acid as surfactant and Isopar M ® or dodecane as carrier liquid. The ferrite particles were prepared by glass crystallization. Hysteresis parameters, the initial susceptibility versus temperature and the magnetic particle size were obtained by VSM. Ferrofluids with a partly deuterated carrier liquid were investigated by small angle neutron scattering (SANS). SANS curves lead to a bimodal size distribution consisting of single magnetic particles with an organic shell and aggregated particles with an incomplete organic layer.

  20. Radium and barium in the Amazon River system

    International Nuclear Information System (INIS)

    Data for 226Ra and 228Ra in the Amazon River system show that the activity of each radium isotope is strongly correlated with barium concentrations. Two trends are apparent, one for rivers which drain shield areas and another for all other rivers. These data suggest that there has been extensive fractionation of U, Th, and Ba during weathering in the Amazon basin. The 226Ra data fit a flux model for the major ions indicating that 226Ra behaves conservatively along the main channel of the Amazon River

  1. Biological effects of 137Cs, incorporated into organism of rats

    International Nuclear Information System (INIS)

    Results of investigating mutagenous and hemotoxic effects of 137Cs on blood lymphocytes of rats are presented. 137Cs was orally administrated into organism of rats as 270 kBq/g chloride solution. 137Cs mutagenous effect was studied on metaphase plates of rat blood lymphocytes in course of rats lifetime experiment. It is stated that 137Cs inducing severe disturbances of genetic material in a great quantity of blood lymphocytes, causes their total killing

  2. A comparison study between diagnostic value of sonography and Barium swallow in gasteroesophageal reflux in pediatrics

    Directory of Open Access Journals (Sweden)

    Fallahi G

    2001-10-01

    Full Text Available One of the common problems in children and specially in infants is gasteroesophageal reflux (G.E.R. Present study was performed to compare diagnostic value of lower esophageal sonography with barium swallow. This study was conducted on 50 patients 1 month to 15 years age in center of pediatric clinic of Tehran, during the years 1999-2000. Patients suspected to have G.E.R studied with lower esophageal sonography and barium swallow and at the end, their results were compared with esophageal PH monitoring as a standard test. In this study sensevity of sonography was 90 percent against 50 percent for barium swallow but specifity of two test was the same 35 percent. We can concluded that sonography is a non invasive, low cost, with less side effects than barium swallow. We recommend sonography in place of barium swallow in diagnosis of G.E.R.

  3. A Comparison between the Diagnostic Value of Sonography vs. Barium Swallow In Gastroesdophageal Reflux in Children

    Directory of Open Access Journals (Sweden)

    F. Zandie

    2003-06-01

    Full Text Available Background: One of the common problems in children, especially infants, is gastroesophageal reflux (GER. Objectives:This study was performed to compare the diagnostic value of lower esophageal sonography with that of barium swallow. Patients and method: Our trial was a triple-blind, performed on 50 patients of 1 month to 15 years of age. The patients suspicious of having GER were evaluated by sonography and barium swallow. Esophageal pH monitoring was the standard test, and both the ultrasound and barium swallow were compared to it. Results: The results showed that sonography was 90% sensitive, vs. 50% for barium swallow. Both tests had the same specificity equal to 35%. Conclusion: We concluded that sonography was a better test than barium swallows, for evaluation of suspected patients with GER, and screening of the infants.

  4. Barium sulfate suspension as a negative oral contrast agent for MR imaging

    International Nuclear Information System (INIS)

    Proton spectroscopy with linewidth measurements and MR imaging were performed on various commercially available barium sulfate suspensions as well as inorganic sulfates and barium salts. Approximately 500 mL of 20%, 40%, 60%, and 70% wt/wt single-contrast oral barium sulfate suspensions were administered to four normal volunteers, and MR imaging was performed with both a 1.5-T and a 0.15-T MR imager. As much as 80% of the small bowel and the entire colon were well visualized with the 60% or 70% wt/wt single-contrast barium sulfate suspensions. The authors conclude that barium sulfate suspensions are useful as oral MR contrast agents

  5. Anion and cation diffusion in barium titanate and strontium titanate; Anionen- und Kationendiffusion in Barium- und Strontiumtitanat

    Energy Technology Data Exchange (ETDEWEB)

    Kessel, Markus Franz

    2012-12-19

    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO{sub 3} single crystals has been studied by means of {sup 18}O{sub 2}/{sup 16}O{sub 2} isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial

  6. 21 CFR 137.200 - Whole wheat flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Whole wheat flour. 137.200 Section 137.200 Food... Flours and Related Products § 137.200 Whole wheat flour. (a) Whole wheat flour, graham flour, entire wheat flour is the food prepared by so grinding cleaned wheat, other than durum wheat and red...

  7. 25 CFR 137.2 - Availability of water.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Availability of water. 137.2 Section 137.2 Indians BUREAU... COSTS, SAN CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.2 Availability of water. Pursuant to section... notice to announce when water is actually available for lands in private ownership under the project...

  8. 47 CFR 87.137 - Types of emission.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Types of emission. 87.137 Section 87.137... Technical Requirements § 87.137 Types of emission. (a) The assignable emissions, corresponding emission designators and authorized bandwidths are as follows: Class of emission Emission designator...

  9. Quantitative Model for Estimating Soil Erosion Rates Using 137Cs

    Institute of Scientific and Technical Information of China (English)

    YANGHAO; GHANGQING; 等

    1998-01-01

    A quantitative model was developed to relate the amount of 137Cs loss from the soil profile to the rate of soil erosion,According th mass balance model,the depth distribution pattern of 137Cs in the soil profile ,the radioactive decay of 137Cs,sampling year and the difference of 137Cs fallout amount among years were taken into consideration.By introducing typical depth distribution functions of 137Cs into the model ,detailed equations for the model were got for different soil,The model shows that the rate of soil erosion is mainly controlled by the depth distrbution pattern of 137Cs ,the year of sampling,and the percentage reduction in total 137Cs,The relationship between the rate of soil loss and 137Cs depletion i neither linear nor logarithmic,The depth distribution pattern of 137Cs is a major factor for estimating the rate of soil loss,Soil erosion rate is directly related with the fraction of 137Cs content near the soil surface. The influences of the radioactive decay of 137Cs,sampling year and 137Cs input fraction are not large compared with others.

  10. Dicty_cDB: SHC137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHC137 (Link to dictyBase) - - - - SHC137P (Link to Original site) SHC137F ... -05 S23571( S23571 ;S19851) hypothetical protein - fungus ... (Cladosporiu... 52 5e-05 AC007203_3( AC007203 |pid ...

  11. Tungsten and Barium Transport in the Internal Plasma of Hollow Cathodes

    Science.gov (United States)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.

    2008-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushedback to the emitter surface by the electric field and drag from the xenon ion flow. Thisbarium ion flux is sufficient to maintain a barium surface coverage at the downstream endgreater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length,so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollowcathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  12. Strontium-90 and cesium-137 in milk

    International Nuclear Information System (INIS)

    The milk samples have been collected from 30 prefectures by prefectural public health laboratories and institutes (raw milk: 4 times per year for the report to WHO, and raw and city milk: 2 times per year), and analysed for strontium-90 and cesium-137 content at Japan Chemical Analysis Center. Collected samples were the raw milk and the city ones for the producing districts and the consuming ones, respectively. Three liters of fresh milk were carbonized in each prefectural public health laboratories and institutes, and then it was asked at Japan Chemical Analysis Center. The ask to which both some carriers and hydrochloric acid were added, was destroyed under heating. The nuclides was dissolved into hydrochloric acid and filtrated, after it was added with nitric acid and heated to dryness. The filtrate was radiochemically analysed for strontium-90 and cesium-137 using the method recommended by Science and Technology Agency. (author)

  13. 90Sr and 137Cs in milk

    International Nuclear Information System (INIS)

    Under the commission of Science and Technology Agency, Japan Chemical Analysis Center has measured the levels of strontium-90 and cesium-137 in milk samples collected in 29 prefectures throughout Japan. Collected samples were the raw milk and the city ones for the producing districts and the consuming districts, respectively. These samples have been collected 2 times a year (for the report to WHO, 4 times of raw milk a year). Three liters of fresh milk were carbonated in each prefectural public health laboratory and institute, and the carbonated samples were collected to Japan Chemical Analysis Center. At Japan Chemical Analysis Center, these collected samples analyzed radiochemically for strontium-90 and cesium-137 using the method applied for the analysis of total diet. (author)

  14. Ruthenium and hafnium abundances in giant and dwarf barium stars

    CERN Document Server

    Allen, D M

    2007-01-01

    We present abundances for Ru and Hf, compare them to abundances of other heavy elements, and discuss the problems found in determining Ru and Hf abundances with laboratory gf-values in the spectra of barium stars. We determined Ru and Hf abundances in a sample of giant and dwarf barium stars, by the spectral synthesis of two RuI (4080.574A and 4757.856A) and two HfII (4080.437A and 4093.155A) transitions. The stellar spectra were observed with FEROS/ESO, and the stellar atmospheric parameters lie in the range 4300 < Teff/K < 6500, -1.2 < [Fe/H] <= 0 and 1.4 <= log g < 4.6. The HfII 4080A and the RuI 4758A observed transitions result in a unreasonably high solar abundance, given certain known uncertainties, when fitted with laboratory gf-values. For these two transitions we determined empirical gf-values by fitting the observed line profiles of the spectra of the Sun and Arcturus. For the sample stars, this procedure resulted in a good agreement of Ru and Hf abundances given by the two availa...

  15. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.

    2009-01-01

    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  16. Materials Synthesis Of Barium Hexa ferrite Used Local Natural Resources

    International Nuclear Information System (INIS)

    The magnetic materials of barium hexa ferrites, Ba O.6Fe2O3 successfully synthesized by powder metallurgy method used local natural resources from materials waste of steel fabrication (HSM, CRM), waste of polymer fabrication (LK) as well as iron sands (PBA). These waste as well as iron sands were the main resources of iron oxide, Fe2O3. The barium oxide used in this experiments are from BaCO3 product of Merck, and BaCO4 which is commercially available in the market as barite. Phase identification by x-ray diffraction technique show the synthesized magnetic materials are agreed with the available commercial product, (SUMI). The energy product maximum (BH)max measured by vibrating sample magnetometer (VSM) for the samples used HSM-, CRM- and BaCO3 as basic materials are 1.141 MGOe and 1.136 MGOe while SUMI is 1.142 MGOe. However for the samples made from LK-, PBA- used of BaCO3 or CRM- with barite, the energy product maximum (BH)max are relatively lower than commercial product

  17. Brillouin function characteristics for La-Co substituted barium hexaferrites

    International Nuclear Information System (INIS)

    La-Co substituted barium hexaferrites with the chemical formula of Ba1−xLaxFe12−xCoxO19 (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f1, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ωbf2, ωkf1, ωaf1, ωkf2, and ωbk of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f1, 4f2, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ωbf2 and ωaf1 decrease constantly, while the molecular-field coefficients ωkf1, ωkf2, and ωbk show a slight change

  18. Thermal expansion behaviour of barium and strontium zirconium phosphates

    Indian Academy of Sciences (India)

    P Srikari Tantri; K Geetha; A M Umarji; Sheela K Ramasesha

    2000-12-01

    Ba1.5–SrZr4P5SiO24 compounds with = 0, 0.25, 0.5, 0.75, 1.0, 1.25 and 1.5, belonging to the low thermal expansion NZP family were synthesized by the solid state reaction method. The XRD pattern could be completely indexed with respect to R$\\bar{3}$ space group indicating the ordering of vacancy at the divalent cation octahedral sites. The microstructure and bulk thermal expansion coefficient from room temperature to 800°C of the sintered samples have been studied. All the samples show very low coefficient of thermal expansion (CTE), with = 0 samples showing negative expansion. A small substitution of strontium in the pure barium compound changes the sign of CTE. Similarly, = 1.5 sample (pure strontium) shows a positive CTE and a small substitution of barium changes its sign. = 1.0 and 1.25 samples have almost constant CTE over the entire temperature range. The low thermal expansion of these samples can be attributed to the ordering of the ions in the crystal structure of these materials.

  19. Microstructure of composite material with powders of barium ferrite

    Directory of Open Access Journals (Sweden)

    R. Nowosielski

    2006-04-01

    Full Text Available Purpose: The aim of the present work is the microstructure characterization of commercial powder BaFe12O19 (as-prepared and composite material with BaFe12O19 powders and polymer matrix, using XRD (X-Ray Diffraction and SEM (Scanning Electron Microscopy methods.Design/methodology/approach: The morphology of barium ferrite powders and a fracture surface of the examined composite material was realized by using the scanning electron microscope. The methods of X-ray diffraction were used for the qualitative phase analysis. The parameters of diffraction line profiles were determined by PRO-FIT Toraya procedure.Findings: The X-ray diffraction analysis permitted on identification the BaFe12O19 and Fe2O3 phases in an examined material. Basing on Toraya method is determination of: lattice parameters, crystallite size (D and the lattice distortion (. Distribution of powders of barium ferrite in polymer matrix is irregular and powder particles have irregular shapes and dimensions.Research limitations/implications: For future research the X-ray analysis should be performed by the Rietveld method, which allows to characterization the microstructure of tested material and verification of its qualitative phase composition.Originality/value: The applied Toraya method of structure analysis appeared to be very useful in the microstructure analysis.

  20. Redox processes in highly yttrium-doped barium titanate

    International Nuclear Information System (INIS)

    The changes of microstructure occurring during oxidation of the reduced form of yttrium-doped barium titanate (Ba1-xYx?Ti1-x4+Tix3+O3) have been studied. Samples were sintered under reduction conditions at PO2=10-4Pa and oxidized by annealing at high temperatures (1150 and 1350 deg. C) in air. Depending on yttrium concentration, the oxidation of the reduced form of the yttrium-doped BaTiO3 caused precipitation of the phase Ba6Ti17O40 or the phases Ba6Ti17O40 and Y2Ti2O7. The precipitates had well-defined orientational relationships with the perovskite matrix. Oxidation of the reduced form of doped barium titanate results in formation of the phase Ba1-xYx?Ti1-x/44+(VTi-bar )x/4O3 responsible for increase in the resistance of outer grain layers, which lie between grain boundaries and grain

  1. The Kerr nonlinearity of the beta-barium borate crystal

    DEFF Research Database (Denmark)

    Bache, Morten; Guo, Hairun; Zhou, Binbin;

    2013-01-01

    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond experime......A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond...... experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e. generate a self-defocusing Kerr-like nonlinearity. However, the material Kerr nonlinearity nI 2......, Kerr is self-focusing and competes with the cascading nonlinearity. Therefore, precise knowledge of its strength is crucial. We perform an experiment measuring the main c ü tensor component, and together with literature experimental data [1], we propose a cu value composed of 14 different data points...

  2. Remediation of soils contaminated by Cs 137

    International Nuclear Information System (INIS)

    After the accident at A-1 reactor in Jaslovske Bohunice NPP (Slovakia) large quantities of soil were also contaminated by cesium-137 after leaks from the liquid waste tanks. This soil was later excavated and is now stored in dedicated radioactive waste depots. Various decontamination methods were tested for the remediation of the samples of this soil. In this paper the electrochemical procedure, electrokinetic mobilisation and thermodesorption procedure were tested

  3. Real-time tracking and targeting computations and rocket-vehicle aeroballistics for the PLACES ionospheric-plasma test series

    International Nuclear Information System (INIS)

    The PLACES (Position Location and Communication Effects Simulations) test program, conducted in December 1980 at Eglin Gulf Test Range, involved a series of ionospheric releases of barium/barium-nitrate vapor. The Defense Nuclear Agency sponsored program investigated effects of a structured ionospheric plasma (similar to that produced by a high-altitude nuclear explosion) on satellite navigation systems and provided in situ measurement of plasma structure. Terrier-Tomahawk rocket systems boosted the barium payloads, beacon payloads (plasma occultation experiment), and probe payloads (plasma in situ measurement). Drifting plasma tracking procedures, beacon-and probe-vehicle targeting procedures, and vehicle flight test results are presented

  4. The liquid scintillation counting efficiency for 137mCs+137mBa and ''129 I

    International Nuclear Information System (INIS)

    We compute the liquid scintillation counting efficiency for 137Cs+137mBa and ''129 I taking into account the scintillator chemical composition. We consider the beta transition shape factors for the for bidden beta transitions of these nuclides, and the effects of 137mBa and 129mXe half-lives on the total counting efficiency. (Author) 8 refs

  5. Reactive barriers for 137Cs retention

    International Nuclear Information System (INIS)

    137Cs was dispersed globally by cold war activities and, more recently, by the Chernobyl accident. Engineered extraction of 137Cs from soils and groundwaters is exceedingly difficult. Because the half life of 137Cs is only 30.2 years, remediation might be more effective (and less costly) if 137Cs bioavailability could be demonstrably limited for even a few decades by use of a reactive barrier. Essentially permanent isolation must be demonstrated in those few settings where high nuclear level wastes contaminated the environment with 135Cs (half life 2.3x106 years) in addition to 137Cs. Clays are potentially a low-cost barrier to Cs movement, though their long-term effectiveness remains untested. To identify optimal clays for Cs retention Cs resorption was measured for five common clays: Wyoming Montmorillonite (SWy-1), Georgia Kaolinites (KGa-1 and KGa-2), Fithian Illite (F-Ill), and K-Metabentonite (K-Mbt). Exchange sites were pre-saturated with 0.16 M CsCl for 14 days and readily exchangeable Cs was removed by a series of LiNO3 and LiCl washes. Washed clay were then placed into dialysis bags and the Cs release to the deionized water outside the bags measured. Release rates from 75 to 139 days for SWy-1, K-Mbt and F- 111 were similar; 0.017 to 0.021% sorbed Cs released per day. Both kaolinites released Cs more rapidly (0.12 to 0.05% of the sorbed Cs per day). In a second set of experiments, clays were doped for 110 days and subjected to an extreme and prolonged rinsing process. All the clays exhibited some capacity for irreversible Cs uptake so most soils have some limited ability to act as a natural barrier to Cs migration. However, the residual loading was greatest on K-Mbt (∼ 0.33 wt% Cs). Thus, this clay would be the optimal material for constructing artificial reactive barriers

  6. Fractionation of 137Cs and Pu in natural peatland

    International Nuclear Information System (INIS)

    High Cs-137 concentrations in plants growing on peatland inspired us to investigate the quantity of its bioavailable fraction in natural peat. Our investigation aims to: a) estimate the quantity of bioavailable Cs-137 and Pu present in peat, b) verify the similarity of Cs-137 and K-40 behaviours, and c) perform a quantification of Cs-137 and Pu transfer from peat to plants. We analysed the vertical distribution of Cs-137 and Pu isotopes in the peat and their concentrations in plants growing on these places. Bioavailability of radionuclides was investigated by sequential extraction. Sequential analyses revealed that it was the upper layer which contained the majority of Cs-137 in an available form while deeper layers retained Cs-137 in immobile fractions. We can conclude that 18% of all Cs-137 in the peat is still bioavailable. Despite of the low quantity of bioavailable fraction of Cs-137 its transfer factor reached extremely high values. In the case of Pu, 64% of its total amount was associated with fulvic/humic acids which resulted in the high transfer factor from peat to plants. 27 years after the Chernobyl nuclear accident, the significant part of radionuclides deposited in peatland is still bioavailable. - Highlights: • Decrease of exchangeable 137Cs and its increase in residual fraction with depth. • High 137Cs transfer factor contrary to its low quantity in bioavailable fractions. • Fulvic/humic acids are a more effective carrier for Pu than for Cs

  7. Research on fabricating technique of Ba-Al-S:Eu sputtering target

    Institute of Scientific and Technical Information of China (English)

    DING Zhao; YU Zhinong; ZHANG Dongpu; XUE Wei; WANG Wuyu

    2009-01-01

    Ba-Al-S-Eu sputtering target for blue emitting phosphors was prepared by powder sintering method. XRD patterns showed that the main components of the target were barium tetra aluminum sulfide (BaAl4S7), bariutm sulfide (BaS), and europium sulfide (EuS). In the samples, part of the barium and aluminum are formed into barium aluminum oxide (BaAl2O4) with the impurity element of oxygen. The PL characteristic spectra of the target showed the 470 nm blue emission obviously, and the Ba-Al-S thin films also transmitted a purple-blue emission at the position of 440 nm.The results indicated that this method was suitable for the fabrication of the Ba-Al-S:Eu sputtering target.

  8. An Integrated Hydrologic Modeling Approach to Cesium-137 Transport in Forested Fukushima Watersheds

    Science.gov (United States)

    Siirila-Woodburn, E. R.; Steefel, C. I.; Williams, K. H.; Birkholzer, J. T.

    2015-12-01

    The 2011 Fukushima Daiichi Nuclear Power Plant (FDNPP) accident in Japan resulted in a significant dissemination of cesium-137 (Cs-137) over a wide area west of the plant, including the contamination of many watersheds and the subsequent evacuation of many communities. Today approximately 90% of on-land Cs-137 fallout following the accident resides in the upper 5 cm of forest soils. While this can be partially attributed to the forested composition of the prefecture (70%), there is also difficulty in cleanup efforts in these regions due to a lack of understanding and predictive capability of radioisotopes transport at the catchment to watershed scale. Subsequently, there is an uncertain, but likely long-term impact on local communities with implications for the use of nuclear energy use worldwide. Due to the complex nature of forest eco-hydrology, sophisticated modeling tools to accurately predict Cs-137 fluxes across different spatial and temporal scales are required. High fidelity, high resolution numerical modeling techniques in conjunction with parallel high performance computing is required to accurately determine transport and feedbacks in these complex systems. To better understand the fundamental transport of Cs-137, a watershed near the FDNPP is modeled with an integrated hydrologic model that includes variably saturated groundwater and overland flow in addition to atmospheric and vegetative processes via a coupled land surface model. Of specific interest is the impact of land cover type on hydrologic flow in the area, which will likely play an important role in erosion patterns and the consequent transport of Cs-137 strongly sorbed to surface soils. Risk management practices (for example, passive remediation versus active remediation such as targeted logging) for two principal tree types (evergreen and deciduous) are informed given the simulated responses to flow patterns assuming different quantities and spatial distribution patterns of each tree type.

  9. 137Cs and 210Po in Pacific Walrus and Bearded Seal from St. Lawrence Island, Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, T F; Seagars, D J; Jokela, T; Layton, D

    2005-02-02

    The activity concentration of Cesium-137 ({sup 137}Cs) and naturally-occurring Polonium-210 ({sup 210}Po) were measured in the muscle tissue, kidney and liver of Pacific walrus (Odobenus rosmarus divergens) and bearded seal (Erignathus barbatus) collected by native hunters from the Bering Sea. The mean {sup 137}Cs concentrations in muscle, liver and kidney of Pacific walrus were 0.07, 0.09 and 0.07 Bq kg{sup -1} (N= 5, wet weight), respectively, and 0.17, 0.10, and 0.17 Bq kg{sup -1} (N=2, wet weight), respectively, in bearded seal. In general, {sup 137}Cs tissue concentrations are significantly lower than those previously reported for mammals from other regions. By comparison, {sup 210}Po activity concentrations appear to be higher than those reported elsewhere but a larger variation. The mean {sup 210}Po concentration in the muscle tissue, liver and kidney of Pacific walrus (N=5, wet weight) were 28.7, 189, and 174 Bq kg{sup -1}, respectively. This compares with {sup 210}Po concentration values (N=2, wet weight) of 27, 207, and 68 Bq kg{sup -1} measured in the muscle tissue, liver and kidney, of bearded seal, respectively. Estimated bioaccumulation factors--as defined by the radionuclide concentration ratio between the target tissue to that in sea water--were two to three orders of magnitude higher for {sup 210}Po that those of {sup 137}Cs. We conclude from radiological dose estimates that ingestion of {sup 137}Cs in foods derived from walrus and seal will pose no threat to human health. This work has important implications for assessing health risks to Alaskan coastal communities concerned about the dumping of nuclear waste in the Russia Arctic.

  10. 137Cs and 210Po in Pacific walrus and bearded seal from St. Lawrence Island, Alaska

    International Nuclear Information System (INIS)

    The activity concentration of Cesium-137 (137Cs) and naturally-occurring Polonium-210 (210Po) were measured in the muscle tissue, kidney and liver of Pacific walrus (Odobenus rosmarus divergens) and bearded seal (Erignathus barbatus) collected by native hunters from the Bering Sea during May 1996. The mean 137Cs concentrations in muscle, liver and kidney of Pacific walrus were 0.07, 0.09 and 0.07 Bq kg-1 (n = 5, wet weight), respectively, and 0.17, 0.10, and 0.17 Bq kg-1 (n = 2, wet weight), respectively, in bearded seal. In general, 137Cs tissue concentrations are significantly lower than those previously reported for mammals from other regions. By comparison, 210Po activity concentrations are more variable and appear to be higher level compared with mammal data from other regions. The mean 210Po concentration in the muscle tissue, liver and kidney of Pacific walrus (n = 5, wet weight) were 28.7, 189, and 174 Bq kg-1, respectively. This compares with 210Po concentration values (n = 2, wet weight) of 27, 207 and 68 Bq kg-1 measured in the muscle tissue, liver and kidney, of bearded seal, respectively. Estimated concentration factors-as defined by the radionuclide concentration ratio between the target tissue to that in sea water-were two to three orders of magnitude higher for 210Po that those of 137Cs. We conclude from radiological dose estimates that ingestion of 137Cs in foods derived from walrus and seal will pose no threat to human health. This work has important implications for assessment of risks of Alaskan coastal communities concerned about the dumping of nuclear waste in the Russia Arctic

  11. 137Cs and 210Po in Pacific Walrus and Bearded Seal from St. Lawrence Island, Alaska

    International Nuclear Information System (INIS)

    The activity concentration of Cesium-137 (137Cs) and naturally-occurring Polonium-210 (210Po) were measured in the muscle tissue, kidney and liver of Pacific walrus (Odobenus rosmarus divergens) and bearded seal (Erignathus barbatus) collected by native hunters from the Bering Sea. The mean 137Cs concentrations in muscle, liver and kidney of Pacific walrus were 0.07, 0.09 and 0.07 Bq kg-1 (N= 5, wet weight), respectively, and 0.17, 0.10, and 0.17 Bq kg-1 (N=2, wet weight), respectively, in bearded seal. In general, 137Cs tissue concentrations are significantly lower than those previously reported for mammals from other regions. By comparison, 210Po activity concentrations appear to be higher than those reported elsewhere but a larger variation. The mean 210Po concentration in the muscle tissue, liver and kidney of Pacific walrus (N=5, wet weight) were 28.7, 189, and 174 Bq kg-1, respectively. This compares with 210Po concentration values (N=2, wet weight) of 27, 207, and 68 Bq kg-1 measured in the muscle tissue, liver and kidney, of bearded seal, respectively. Estimated bioaccumulation factors--as defined by the radionuclide concentration ratio between the target tissue to that in sea water--were two to three orders of magnitude higher for 210Po that those of 137Cs. We conclude from radiological dose estimates that ingestion of 137Cs in foods derived from walrus and seal will pose no threat to human health. This work has important implications for assessing health risks to Alaskan coastal communities concerned about the dumping of nuclear waste in the Russia Arctic

  12. Preparation and properties of yttria doped tetragonal zirconia polycrystal/Sr-doped barium hexaferrite ceramic composites

    International Nuclear Information System (INIS)

    Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m1/2. - Abstract: The effects of substitution of Ba2+ by Sr2+ on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba1−xSrxFe12O19, x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m1/2 for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase

  13. Bio-based barium alginate film: Preparation, flame retardancy and thermal degradation behavior.

    Science.gov (United States)

    Liu, Yun; Zhang, Chuan-Jie; Zhao, Jin-Chao; Guo, Yi; Zhu, Ping; Wang, De-Yi

    2016-03-30

    A bio-based barium alginate film was prepared via a facile ionic exchange and casting approach. Its flammability, thermal degradation and pyrolysis behaviors, thermal degradation mechanism were studied systemically by limiting oxygen index (LOI), vertical burning (UL-94), microscale combustion calorimetry (MCC), thermogravimetric analysis (TGA) coupled with Fourier transform infrared analysis (FTIR) and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS). It showed that barium alginate film had much higher LOI value (52.0%) than that of sodium alginate film (24.5%). Moreover, barium alginate film passed the UL-94 V-0 rating, while the sodium alginate film showed no classification. Importantly, peak of heat release rate (PHRR) of barium alginate film in MCC test was much lower than that of sodium alginate film, suggested that introduction of barium ion into alginate film significantly decreased release of combustible gases. TG-FTIR and Py-GC-MS results indicated that barium alginate produced much less flammable products than that of sodium alginate in whole thermal degradation procedure. Finally, a possible degradation mechanism of barium alginate had been proposed. PMID:26794953

  14. Barium titanate core – gold shell nanoparticles for hyperthermia treatments

    Directory of Open Access Journals (Sweden)

    FarrokhTakin E

    2013-06-01

    Full Text Available Elmira FarrokhTakin,1,2 Gianni Ciofani,1 Gian Luigi Puleo,1 Giuseppe de Vito,3,4 Carlo Filippeschi,1 Barbara Mazzolai,1 Vincenzo Piazza,3 Virgilio Mattoli1 1Center for Micro-BioRobotics @SSSA, Fondazione Istituto Italiano di Tecnologia, Pontedera, Pisa, Italy; 2The Biorobotics Institute, Scuola Superiore Sant'Anna, Pontedera, Pisa, Italy; 3Center for Nanotechnology Innovation @NEST, Fondazione Istituto Italiano di Tecnologia, Pisa, Italy; 4NEST, Scuola Normale Superiore, Pisa, Italy Abstract: The development of new tools and devices to aid in treating cancer is a hot topic in biomedical research. The practice of using heat (hyperthermia to treat cancerous lesions has a long history dating back to ancient Greece. With deeper knowledge of the factors that cause cancer and the transmissive window of cells and tissues in the near-infrared region of the electromagnetic spectrum, hyperthermia applications have been able to incorporate the use of lasers. Photothermal therapy has been introduced as a selective and noninvasive treatment for cancer, in which exogenous photothermal agents are exploited to achieve the selective destruction of cancer cells. In this manuscript, we propose applications of barium titanate core–gold shell nanoparticles for hyperthermia treatment against cancer cells. We explored the effect of increasing concentrations of these nanoshells (0–100 µg/mL on human neuroblastoma SH-SY5Y cells, testing the internalization and intrinsic toxicity and validating the hyperthermic functionality of the particles through near infrared (NIR laser-induced thermoablation experiments. No significant changes were observed in cell viability up to nanoparticle concentrations of 50 µg/mL. Experiments upon stimulation with an NIR laser revealed the ability of the nanoshells to destroy human neuroblastoma cells. On the basis of these findings, barium titanate core–gold shell nanoparticles resulted in being suitable for hyperthermia treatment

  15. Wideband and enhanced microwave absorption performance of doped barium ferrite

    International Nuclear Information System (INIS)

    To achieve stronger microwave attenuation and larger bandwidth in electromagnetic absorber, the nickel ions (Ni2+) and manganese ions (Mn2+) were employed to partially replace the cobalt ions (Co2+) in BaCoTiFe10O19, and the doped barium hexaferrite (Ba(MnNi)0.2Co0.6TiFe10O19 and Ba(MnNi)0.25Co0.5TiFe10O19) powders were synthesized via the sol–gel combustion method. Subsequently, the microwave absorbing composites were prepared by mixing the ferrite powders with the paraffin. The X-ray diffraction (XRD) patterns of the doped ferrites confirmed the formation of the M-type barium ferrite, and no other types of barium ferrite could be found. Based on the electromagnetic parameters measured by the vector net-analyzer, it was found that the composite (Ba(MnNi)0.2Co0.6TiFe10O19) possessed a minimum reflection loss of −52.8 dB at 13.4 GHz with a matching thickness of 1.8 mm and the bandwidth below −15 dB was 5.8 GHz. Moreover, the maximum attenuation of Ba(MnNi)0.25Co0.5TiFe10O19 could reach −69 dB when its thickness was 1.8 mm, and also the bandwidth less than −20 dB was ranging from 13.2 GHz to 18 GHz. Thus, Ba(MnNi)0.2Co0.6TiFe10O19 and Ba(MnNi)0.25Co0.5TiFe10O19 could be the good microwave absorbers, which have great potentials to be applied in the high frequency fields of the microwave absorbing materials. - Highlights: • The Co was first time substituted by Mn–Ni in ferrites. • The substituted ferrites had good microwave absorption. • The doped ferrites had broad bandwidth and low reflection loss

  16. Wideband and enhanced microwave absorption performance of doped barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Pingyuan; Xiong, Kun [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Ju, Kui [Guizhou Institute of Metallurgy and Chemical Engineering, Guiyang 550002 (China); Li, Shengnan [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Xu, Guangliang, E-mail: xuguangliang@swust.edu.cn [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China)

    2015-07-01

    To achieve stronger microwave attenuation and larger bandwidth in electromagnetic absorber, the nickel ions (Ni{sup 2+}) and manganese ions (Mn{sup 2+}) were employed to partially replace the cobalt ions (Co{sup 2+}) in BaCoTiFe{sub 10}O{sub 19}, and the doped barium hexaferrite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19}) powders were synthesized via the sol–gel combustion method. Subsequently, the microwave absorbing composites were prepared by mixing the ferrite powders with the paraffin. The X-ray diffraction (XRD) patterns of the doped ferrites confirmed the formation of the M-type barium ferrite, and no other types of barium ferrite could be found. Based on the electromagnetic parameters measured by the vector net-analyzer, it was found that the composite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19}) possessed a minimum reflection loss of −52.8 dB at 13.4 GHz with a matching thickness of 1.8 mm and the bandwidth below −15 dB was 5.8 GHz. Moreover, the maximum attenuation of Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could reach −69 dB when its thickness was 1.8 mm, and also the bandwidth less than −20 dB was ranging from 13.2 GHz to 18 GHz. Thus, Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could be the good microwave absorbers, which have great potentials to be applied in the high frequency fields of the microwave absorbing materials. - Highlights: • The Co was first time substituted by Mn–Ni in ferrites. • The substituted ferrites had good microwave absorption. • The doped ferrites had broad bandwidth and low reflection loss.

  17. Synthesis and Characterization of Barium-Vanadium Oxide Nanocomposite Using a Facile thermolysis Approach

    OpenAIRE

    Niloufar Akbarzadeh-T; Leila Amiri-O

    2015-01-01

    In this investigation, we report synthesis of new cationic-anionic Barium-Vanadium complex with 2, 6- pyridinedicarboxylic acid ligand. This compound [Ba(H2O)8][VO2(dipic)]2(1) has been characterized using elemental analyses, FT-IR, UV–Vis and Cyclic voltammetry (CV) techniques. Also in this study we report facile synthesis of Barium-Vanadium Oxide nanoparticle under thermal decomposition, using precursor complex (1). Characterization of Barium-Vanadium Oxide nanocomposites was carried out by...

  18. Barium ferrite nanoparticles prepared by self-propagating low-temperature combustion method and its characterization

    Indian Academy of Sciences (India)

    P M Prithviraj Swamy; S Basavaraja; Vijayanand Havanoor; N V Srinivas Rao; R Nijagunappa; A Venkataraman

    2011-12-01

    The barium ferrite particles were prepared using a self-propagating low-temperature combustion method using polyethylene glycol (PEG) as a fuel. The process was investigated with simultaneous thermogravimetric-differential thermal analysis (TG–DTA). The crystalline structure, morphology and the magnetic properties of the barium ferrite particles were studied by means of X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM) and SQUID susceptometer. The results show that the ignition temperature of PEG is lower compared with other combustion methods and gives nanocrystalline barium ferrite.

  19. A Comparative Study on Magnetostructural Properties of Barium Hexaferrite Powders Prepared by Polyethylene Glycol

    Directory of Open Access Journals (Sweden)

    Zehra Durmus

    2014-01-01

    Full Text Available Nanocrystalline particles of barium hexaferrite were synthesized by a sol-gel combustion route using nitrate-citrate gels prepared from metal nitrates and citric acid solutions with Fe/Ba molar ratio 12. The present paper aims to study the effect of addition of polyethylene glycol (PEG solutions with different molecular weights (MW: 400, 2000, and 10.000 g/mol on magnetostructural properties of barium hexaferrite. The formation of the barium hexaferrite was inspected using X-ray diffraction (XRD analysis, Fourier transform infrared (FT-IR analysis, thermogravimetric (TGA analysis, scanning electron microscopy (SEM analysis and vibrating sample magnetometer (VSM analysis for magnetic measurements.

  20. Microscopic insight into nuclear structure properties of proton-rich barium isotopes

    International Nuclear Information System (INIS)

    Variation after projection (VAP) calculations with Hartree-Bogoliubov (HB) Ansatz have been carried out for A=120-136 barium isotopes. In this framework, the yrast spectra with Jmaxπ=10+, B(E2) transition probabilities, quadrupole (β2) and hexadecapole (β4) deformation parameters for even-even barium isotopes have been obtained. The results of the calculation give an indication that it is important to include the hexadecapole-hexadecapole component of the two-body interaction for obtaining various nuclear structure quantities in these barium isotopes. (author)

  1. Orbital elements of barium stars formed through a wind accretion scenario

    CERN Document Server

    Liu, J H; Liang, Y C; Peng, Q H

    2000-01-01

    Taking the total angular momentum conservation in place of the tangential momentum conservation, and considering the square and higher power terms of orbital eccentricity e, the changes of orbital elements of binaries are calculated for wind accretion scenario. These new equations are used to quantitatively explain the observed (e,logP) properties of normal G, K giants and barium stars. Our results reflect the evolution from G, K giant binaries to barium binaries, moreover, the barium stars with longer orbital periods P>1600 days may be formed by accreting part of the ejecta from the intrinsic AGB stars through wind accretion scenario.

  2. The high-temperature sulphation behavior of barium-based sorbents during coal combustion

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, J.; Li, N.; Zhou, J.; Cao, X.; Liu, J.; Zhao, X.; Cen, K.

    2000-07-01

    In order to promote the sulfur removal efficiency during coal combustion, the high-temperature sulfation behavior of barium-based sorbents was studied. The sulfation product BaSO{sub 4} which did not decompose until 1,580 C had much better thermal stability than CaSO{sub 4} which rapidly decomposed at about 1,300 C. The desulfurization effect of barium salt Ba{sup 2+} was much better than calcium salt Ca{sup 2+} during coal combustion at about 1,200{approximately}1,300 C. The sulfur removal efficiency of barium-based sorbents could achieve 35.5% in industrial grate furnace.

  3. Application of barium fluoride for sulfur selective extraction at X-ray spectroscopic analysis of steel

    International Nuclear Information System (INIS)

    In order to increase the sensitivity of X-ray spectroscopic identification of sulphur in steels the application of barium fluoride for selective extraction of sulphate ions was proposed by authors of present work. The influence of concentration of sulphate ions, iron, nickel, chromium and titanium cations as well as acidity of solutions on the coefficient of distribution of sulphate ions in the system barium fluoride-water was studied. The distribution coefficients were calculated, the completeness of extraction was calculated as well. It is defined that sulphate ions from solutions containing cations of heavy metals and other anions can be extracted by means of barium fluoride.

  4. Solvothermal synthesis and Curie temperature of monodispersed barium titanate nanoparticles

    International Nuclear Information System (INIS)

    Barium titanate (BaTiO3) nanoparticles with various particle sizes were prepared by a solvothermal method. X-ray powder diffraction (XRPD) patterns show that the as-prepared powders are of pure perovskite BaTiO3. Scanning electron microscopy (SEM) reveals that all the particles of BaTiO3 with different sizes are dispersed homogenously and have uniform size. The room temperature and in situ high temperature XRD analyses indicate that both the proportion of the tetragonal phase and the Curie temperature of BaTiO3 increase with increasing particles size. The effects of the reaction parameters, such as the concentration of reactants, the polarity of solvent, the reaction temperature and the amount of surfactant, on the size, morphology and uniformity of BaTiO3 nanoparticles are studied in detail.

  5. Infrared Spectroscopic Characterization of Calcium and Barium Hydrazone Complexes

    Directory of Open Access Journals (Sweden)

    *A. Adeniyi

    2013-06-01

    Full Text Available Hydrazones have attracted considerable interest on account of their biological activities. Introduction of calcium and barium metal ions into m- and p-nitrobenzoic hydrazones is expected to modify these biological properties for enhanced activity and versatility. The ligands were synthesized from the parent acids. The complexes have been characterized using C, H and N microanalyses and IR spectrometry. The IR spectral data of the ligands and complexes revealed bonding via the C=O and C=N groups. The suggested metal to ligand stoichiometries are: [M (m-NBHx]Cl2.yH2O, x, y = 1 and 4 for M = Ca; x, y = 2 and 3 for M = Ba respectively. [M(p-NBHx]Cl2.yH2O, x, y = 1 and 12 for M = Ca; x, y = 1 and 3 for M = Ba respectively. The structural deductions are tentative pending future X-ray structural studies.

  6. Preparation and Characterization of Nano-particle Substituted Barium Hexaferrite

    CERN Document Server

    Atassi, Yomen; Tally, Mohammad

    2014-01-01

    High density magnetic recording requires high coercivity magnetic media and small particle size. Barium hexaferrite has been considered as a leading candidate material because of its chemical stability, fairly large crystal anisotropy and suitable magnetic characteristics. In this work, we present the preparation of the hexagonal ferrite BaFe12O19 and one of its derivative; the Zn-Sn substituted hexaferrite by the chemical co-precipitation method. The main advantage of this method on the conventional glass-ceramic one, resides in providing a small enough particle size for magnetic recording. We demonstrate using the X-ray diffraction patterns that the particle size decreases when substituting the hexaferrite by the Zn-Sn combination. This may improve the magnetic properties of the hexaferrite as a medium for HD magnetic recording

  7. Synthesis and optical study of barium magnesium aluminate blue phosphors

    International Nuclear Information System (INIS)

    Europium doped barium magnesium aluminate (BaMgAl10O17:Eu2+) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl10O17(JCPDS 26-0163) along with an additional phase BaAl2O4(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f6 5d → 4f7 transition of Eu2+ which lies in the blue region of the visible spectrum

  8. Conoscopic study of strontium-barium niobate single crystals

    International Nuclear Information System (INIS)

    Optically transparent single crystals of strontium-barium niobate, SrxBa1-xNb2O6, of different compositions (x = 0.26...0.7) were examined with the aid of conoscopic light interference figures. A regular change of the isochrome concentric ring number and diameters consistent with the temperature variation of the value of birefringence is demonstrated by direct observations of polar cuts of optically uniaxial samples. Anomalous violations of the conventional (uniaxial) interference patterns occur occasionaly in some samples being indicative of the existence of biaxial trait in their behaviour even though no voltage is applied. These features may depend on annealing treatments at elevated temperatures. The results of the study show that conoscopic images may serve as a sensitive indicator of the structural state of SBN crystals related to the effects of stress–induced change of optical anisotropy and temperature dependent birefringence parameters

  9. Pulsating aurora induced by upper atmospheric barium releases

    Science.gov (United States)

    Deehr, C.; Romick, G.

    1977-01-01

    The paper reports the apparent generation of pulsating aurora by explosive releases of barium vapor near 250 km altitude. This effect occurred only when the explosions were in the path of precipitating electrons associated with the visible aurora. Each explosive charge was a standard 1.5 kg thermite mixture of Ba and CuO with an excess of Ba metal which was vaporized and dispersed by the thermite explosion. Traces of Sr, Na, and Li were added to some of the charges, and monitoring was achieved by ground-based spectrophotometric observations. On March 28, 1976, an increase in emission at 5577 A and at 4278 A was observed in association with the first two bursts, these emissions pulsating with roughly a 10 sec period for approximately 60 to 100 sec after the burst.

  10. Behaviour of barium and strontium oxides in liquid nitrogen tetroxide

    International Nuclear Information System (INIS)

    Chemical transformations of barium and strontium oxides (MeO, MeO2) in liquid nitrogen tetroxide are considered in the temperature range of 290-493 K. The data on IR and Raman spectra of the reaction products in the region of 2500-600 cm-1 are presented. No formation of nitrosonium complexes of the type NO[Me(NOsub(3))sub(n)]sub(m) and adducts of the type Me(NO3)2xmN2O4 is detected. It has been established that MeO2 possess a higher reactivity in liquid nitrogen tetroxide than MeO. Using the methods of vibrational spectroscopy the bands, characteristic of MeO2 are signled out in MeO samples being in contact with nitrogen tetroxide

  11. Stark effect in Rydberg states of helium and barium

    International Nuclear Information System (INIS)

    This thesis, which deals with the effect of an electric field up to moderate field strengths on atoms with two valence electrons outside closed shells, in casu helium and barium, contains chapter in which the linear Stark effect in the 1 snp 1,3p Rydberg states of helium (n around 40) has been studied in a CW laser-atomic beam experiment. The evolution of the angular momentum manifolds into the n-mixing regime was followed and avoided level crossings were observed. Stark manifolds were also calculated by diagonalization of the complete energy matrix in the presence of an electric field. It turned out to be necessary to include up to five n-values in the calculations already at moderate values of the field to reproduce the data within the experimental accuracy (a few MHz), especially in the regime of the avoided crossings. (author). 147 refs.; 30 figs.; 8 tabs

  12. Small polarons and point defects in barium cerate

    Science.gov (United States)

    Swift, Michael; Janotti, Anderson; Van de Walle, Chris G.

    2015-12-01

    Barium cerate (BaCeO3) is a well-known ionic conductor of both hydrogen and oxygen. In applications, it is frequently doped (for instance with Y) to increase stability and promote diffusion. However, the effects of doping and native defects are not fully understood. Computational studies have been stymied by the nature of the conduction band, which is made up of cerium 4 f states. These states present a challenge to ab initio techniques based on density functional theory within the standard approximations for exchange and correlation. Using a hybrid functional, we investigate the effects of hydrogen impurities and native defects on the electrical and optical properties of BaCeO3. We discuss the tendency of excess electrons or holes to localize in the form of small polarons. We also explore the interactions of polarons with hydrogen impurities and oxygen vacancies, and their impact on luminescence properties.

  13. Nonlinear optical properties of calcium barium niobate epitaxial thin films.

    Science.gov (United States)

    Bancelin, Stéphane; Vigne, Sébastien; Hossain, Nadir; Chaker, Mohammed; Légaré, François

    2016-07-25

    We investigate the potential of epitaxial calcium barium niobate (CBN) thin film grown by pulsed laser deposition for optical frequency conversion. Using second harmonic generation (SHG), we analyze the polarization response of the generated signal to determine the ratios d15 / d32 and d33 / d32 of the three independent components of the second-order nonlinear susceptibility tensor in CBN thin film. In addition, a detailed comparison to the signal intensity obtained in a y-cut quartz allows us to measure the absolute value of these components in CBN thin film: d15 = 5 ± 2 pm / V, d32 = 3.1 ± 0.6 pm / V and d33 = 9 ± 2 pm / V. PMID:27464195

  14. Barium titanate nanocomposite capacitor FY09 year end report.

    Energy Technology Data Exchange (ETDEWEB)

    Stevens, Tyler E.; DiAntonio, Christopher Brian; Yang, Pin; Chavez, Tom P.; Winter, Michael R.; Monson, Todd C.; Roesler, Alexander William; Fellows, Benjamin D.

    2009-11-01

    This late start RTBF project started the development of barium titanate (BTO)/glass nanocomposite capacitors for future and emerging energy storage applications. The long term goal of this work is to decrease the size, weight, and cost of ceramic capacitors while increasing their reliability. Ceramic-based nanocomposites have the potential to yield materials with enhanced permittivity, breakdown strength (BDS), and reduced strain, which can increase the energy density of capacitors and increase their shot life. Composites of BTO in glass will limit grain growth during device fabrication (preserving nanoparticle grain size and enhanced properties), resulting in devices with improved density, permittivity, BDS, and shot life. BTO will eliminate the issues associated with Pb toxicity and volatility as well as the variation in energy storage vs. temperature of PZT based devices. During the last six months of FY09 this work focused on developing syntheses for BTO nanoparticles and firing profiles for sintering BTO/glass composite capacitors.

  15. Ultrasonic de-agglomeration of barium titanate powder.

    Science.gov (United States)

    Marković, S; Mitrić, M; Starcević, G; Uskoković, D

    2008-01-01

    BaTiO3 (BT) powder, with average particle size of 1.4 microm, was synthesized by solid-state reaction. A high-intensity ultrasound irradiation (ultrasonication) was used to de-agglomerate micro-sized powder to nano-sized one. The crystal structure, crystallite size, morphology, particle size, particle size distribution, and specific surface area of the BT powder de-agglomerated for different ultrasonication times (0, 10, 60, and 180 min) were determined. It was found that the particles size of the BT powder was influenced by ultrasonic treatment, while its tetragonal structure was maintained. Therefore, ultrasonic irradiation can be proposed as an environmental-friendly, economical, and effective tool for the de-agglomeration of barium titanate powders. PMID:17845864

  16. Synthesis and optical study of barium magnesium aluminate blue phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Jeet, Suninder, E-mail: suninder.jeet@thapar.edu; Pandey, O. P., E-mail: oppandey@thapar.edu [School of Physics and Materials Science, Thapar University, Patiala (147003), Punjab (India); Sharma, Manoj, E-mail: manojnarad@sggswu.org [Department of Nanotechnology, Sri Guru Granth Sahib World University, Fatehgarh Sahib(146406), Punjab (India)

    2015-05-15

    Europium doped barium magnesium aluminate (BaMgAl{sub 10}O{sub 17}:Eu{sup 2+}) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl{sub 10}O{sub 17}(JCPDS 26-0163) along with an additional phase BaAl{sub 2}O{sub 4}(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f{sup 6} 5d → 4f{sup 7} transition of Eu{sup 2+} which lies in the blue region of the visible spectrum.

  17. Bronchography in dogs. Comparative study with two barium sulphate solutions

    International Nuclear Information System (INIS)

    Two solutions of barium sulphate, 60 and 30% w/v, were compared with the ''overflow'' Bronchographic method. Two groups of eight healthy adult does of both sexes, weighing 7 to 18 kg were used for the study. The dogs were anaesthetised with thiopentone sodium 2% (20 mg/kg iv). After intubation, each dog received contrast medium by a catheter connected to a syringe, in a 9 mi dose. Two series of two x-rays plates were taken in left lateral recumbent, 3 and 6 min after administering the contrast medium and in ventrodorsal projection, 30 sec. later. The x-ray plates obtained were analysed and compared intra and inter group considering the advance speed of the contrast medium, the radiographic density and outlines. Adverse reactions were controlled

  18. Barium depletion study on impregnated cathodes and lifetime prediction

    Science.gov (United States)

    Roquais, J. M.; Poret, F.; le Doze, R.; Ricaud, J. L.; Monterrin, A.; Steinbrunn, A.

    2003-06-01

    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK).

  19. Barium depletion study on impregnated cathodes and lifetime prediction

    International Nuclear Information System (INIS)

    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK)

  20. Structural and functional characterization of barium zirconium titanate / epoxy composites

    Directory of Open Access Journals (Sweden)

    Filiberto González Garcia

    2011-12-01

    Full Text Available The dielectric behavior of composite materials (barium zirconium titanate / epoxy system was analyzed as a function of ceramic concentration. Structure and morphologic behavior of the composites was investigated by X-ray Diffraction (XRD, Fourier transformed infrared spectroscopy (FT-IR, Raman spectroscopy, field emission scanning electron microscopy (FE-SEM and transmission electron microscopy (TEM analyses. Composites were prepared by mixing the components and pouring them into suitable moulds. It was demonstrated that the amount of inorganic phase affects the morphology of the presented composites. XRD revealed the presence of a single phase while Raman scattering confirmed structural transitions as a function of ceramic concentration. Changes in the ceramic concentration affected Raman modes and the distribution of particles along into in epoxy matrix. Dielectric permittivity and dielectric losses were influenced by filler concentration.

  1. Gamma radiation induced darkening in barium gallo-germanate glass.

    Science.gov (United States)

    Chen, Xiaodong; Heng, Xiaobo; Tang, Guowu; Zhu, Tingting; Sun, Min; Shan, Xiujie; Wen, Xin; Guo, Jingyuan; Qian, Qi; Yang, Zhongmin

    2016-05-01

    Barium gallo-germanate (BGG) glass is an important glass matrix material used for mid-infrared transmission and mid-infrared fiber laser. In this study, we investigated the γ-ray irradiation induced darkening effect of BGG glass. Optical transmittance spectra, electron paramagnetic resonance (EPR) and thermoluminescence (TL) spectra were employed to investigate the γ-ray irradiation induced defects. Two kinds of Ge-related defects in the irradiated BGG glass, named Ge-related non-bridging oxygen hole center (Ge-NBOHC) and Ge-related electron centers (GEC), were verified. In addition, the absorption bands of the two defects have been separated and the peak absorptivity of Ge-NBOHC and GEC defects is at 375 nm and 315 nm, respectively. PMID:27137531

  2. Effect of Nb on barium titanate prepared from citrate solutions

    Directory of Open Access Journals (Sweden)

    Stojanović Biljana D.

    2002-01-01

    Full Text Available The influence of the addition of dopants on the microstructure development and electrical properties of BaTiO3 doped with 0.2, 0.4, 0.6, 0.8 mol% of Nb and 0.01 mol% of Mn based compounds was studied. Doped barium titanate was prepared using the polymeric precursor method from citrate solutions. The powders calcined at 700°C for 4 hours were analysed by infrared (IR spectroscopy to verify the presence of carbonates, and by X-ray diffraction (XRD for phase formation. The phase composition, microstructure and dielectric properties show a strong dependence on the amount of added niobium.

  3. Ionoluminescence of trivalent rare-earth-doped strontium barium niobate

    Energy Technology Data Exchange (ETDEWEB)

    Calvo del Castillo, H. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain); Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Ruvalcaba, J.L. [Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Bettinelli, M.; Speghini, A. [Dipartimento Scientifico e Tecnologico, Universita di Verona and INSTM, UdR Verona, Ca Vignal, Strada Le Grazie 15, I-37134 Verona (Italy); Barboza Flores, M. [Centro de Investigacion en Fisica, Universidad de Sonora, Hermosillo, Sonora (Mexico); Calderon, T. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain)], E-mail: tomas.calderon@uam.es; Jaque, D.; Garcia Sole, J. [Departamento de Fisica de Materiales, Universidad Autonoma de Madrid, 28049 Cantoblanco, Madrid (Spain)

    2008-05-15

    Ionoluminescence spectra for different rare-earth ion (Pr{sup 3+} and Eu{sup 3+})-activated Sr{sub x}Ba{sub 1-x}Nb{sub 2}O{sub 6} strontium barium niobate crystals (x=0.33 and 0.60) have been induced with a 3 MeV proton beam for a variety of beam current intensities (45, 40 and 20 nA). The proton-beam induced luminescent spectra have shown features associated with the presence of the rare-earth ion and some spectral features mostly related to the host crystal, which appear only for high beam current intensities. We have compared the ionoluminescence results to those obtained under UV light excitation (photoluminescence technique) where a direct excitation of the band gap would occur.

  4. Microwave absorption properties of barium titanate/epoxide resin composites

    International Nuclear Information System (INIS)

    Nano-barium titanate (BT) was prepared by a sol-gel method. The prepared powders were characterized by x-ray powder diffraction and transmission electron microscopy. The complex relative dielectric permittivity (ε = ε' - jε-prime) and magnetic permeability (μ = μ' - jμ-prime) of the BT powders were measured in the frequency range 8 ∼ 18 GHz. The BT/epoxide resin (EP) composite with different volume contents was investigated. The effects of thickness on the BT/EP composite were studied. It was found that an optimum thickness and contents of the absorber can yield the maximum reflection loss which could be obtained over a broad frequency region in the X and Ku bands. Our results indicate that BT could be a promising microwave absorption material

  5. Study on a flexoelectric microphone using barium strontium titanate

    Science.gov (United States)

    Kwon, S. R.; Huang, W. B.; Zhang, S. J.; Yuan, F. G.; Jiang, X. N.

    2016-04-01

    In this study, a flexoelectric microphone was, for the first time, designed and fabricated in a bridge structure using barium strontium titanate (Ba0.65Sr0.35TiO3) ceramic and tested afterwards. The prototyped flexoelectric microphone consists of a 1.5 mm  ×  768 μm  ×  50 μm BST bridge structure and a silicon substrate with a cavity. The sensitivity and resonance frequency were designed to be 0.92 pC/Pa and 98.67 kHz, respectively. The signal to noise ratio was measured to be 74 dB. The results demonstrate that the flexoelectric microphone possesses high sensitivity and a wide working frequency range simultaneously, suggesting that flexoelectricity could be an excellent alternative sensing mechanism for microphone applications.

  6. CD137-mediated immunotherapy for allergic asthma

    OpenAIRE

    Polte, Tobias; Foell, Juergen; Werner, Christoph; Hoymann, Heinz-Gerd; Braun, Armin; Burdach, Stefan; Mittler, Robert S.; Hansen, Gesine

    2006-01-01

    The prevalence of asthma continues to increase. Asthma is caused by a Th2 cell–driven immune response. Its optimal treatment remains a challenge, and a sufficient immunotherapeutic approach to treating asthma has yet to be found. Using a murine asthma model, we show that a single injection of an anti-CD137 (4-1BB) mAb prevents the development of airway hyperreactivity, eosinophilic airway inflammation, excessive mucus production, and elevated IgE during the observation period of 7 weeks. Most...

  7. Separation of 137Cs from nuclear waste

    International Nuclear Information System (INIS)

    Sodium zirconate is one member of a family of new inorganic ion exchange materials which have high affinity for all actinides and fission product cations except for Cs+. A combination of cold, tracer and high level liquid waste experiments with sodium zirconate has shown that 70 to 80 and 80 to 100% of the Cs+ in high level liquid waste remains in solution following batch or column equilibration, respectively. The fact that 137Cs can be obtained in relatively pure form permits subsequent conversion directly to an insoluble radiation source. This is of prime importance in areas such as sewage sludge sterilization via γ-ray irradiation. (author)

  8. Caesium-137 Chloride Retention following Accidental Ingestion

    International Nuclear Information System (INIS)

    Four men became contaminated with caesium-137 chloride due to leaks in a 100 c source. The source was believed to be completely leak proof, since the caesium chloride was contained in a welded stainless-steel capsule which was covered with an outer steel jacket of standard Oak Ridge design. Most of the contamination occurred while the men were cleaning the components of a pneumatic device used to move the source. The most heavily- contaminated individual placed his mouth over the end of a transport tube and attempted to blow some ''dust'' out of the tube. The other men handled various parts of the transport mechanism and wiped ''dust'' out of holes with their fingers. None of the men washed their hands before eating lunch. When radioactive contamination was discovered on the following day, immediate efforts were made to decontaminate the men. Arrangements for whole-body counts were also made and, on the fifth day following contamination, the men reported to the Radiation Exposure Evaluation laboratory. The body burdens on the fifth day ranged from 35 - 970 nc of caesium-137. During the next five to six days the burdens dropped rapidly and on the eleventh day ranged from 28- 780 nc. After the eleventh day the body burdens of caesium-137 changed much more slowly. Whole-body counts made between the 11th and 160th day yielded biological half-lives of 76, 95 and 126 d for the three most heavily-contaminated individuals. During the period of rapid excretion all urine and faeces were collected and counted. These counts indicated a considerable superficial contamination prior to the eleventh day since only a portion of the removed caesium-137 was found in the urine and stool specimens. The body burdens of the four men are compared with normals of the same size, build, age and diet habits. A short discussion of normal burdens is included. A brief description of the counting system, data handling techniques and calibration procedures is also included. (author)

  9. Enthalpy of formation of (In, Gd)-doped barium cerate

    International Nuclear Information System (INIS)

    Highlights: • BaCe0.7Gd0.2In0.1O2.85 was prepared by solid-state reaction. • The standard formation enthalpy was determined. • The stabilization energy (ΔstH°) was calculated. • ΔstH° of BaCe0.7Gd0.2In0.1O2.85 is higher than BaCe0.7Nd0.2In0.1O2.85 and BaCeO3. - Abstract: Solution enthalpies of barium cerate doped by gadolinium and indium and a mixture of BaCl2 + 0.7CeCl3 + 2GdCl3 + 0.1InCl3 have been measured in 1 mol dm−3 HCl with 0.1 mol dm−3 KI. For the first time the standard molar formation enthalpy of BaCe0.7Gd0.2In0.1O2.85 has been determined by solution calorimetry as follows: ΔfH° (298.15 K) = −1615.84 ± 9.01 kJ mol−1. The stabilization energy for above-mentioned compound has been calculated as well. It has been shown that barium cerate doped gadolinium and indium has higher stabilization energy than BaCe0.7Nd0.2In0.1O2.85 and BaCeO3. The reaction enthalpy with CO2 interaction has been calculated for BaCe0.7Gd0.2In0.1O2.85

  10. Brillouin function characteristics for La-Co substituted barium hexaferrites

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Chuanjian, E-mail: wcjuestc2005@gmail.com, E-mail: ksun@uestc.edu.cn; Yu, Zhong; Sun, Ke, E-mail: wcjuestc2005@gmail.com, E-mail: ksun@uestc.edu.cn; Guo, Rongdi; Jiang, Xiaona; Lan, Zhongwen [State Key Laboratory of Electronic Thin Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Yang, Yan [Department of Communication and Engineering, Chengdu Technological University, Chengdu 611730 (China)

    2015-09-14

    La-Co substituted barium hexaferrites with the chemical formula of Ba{sub 1−x}La{sub x}Fe{sub 12−x}Co{sub x}O{sub 19} (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f{sub 1}, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ω{sub bf2}, ω{sub kf1}, ω{sub af1}, ω{sub kf2}, and ω{sub bk} of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f{sub 1}, 4f{sub 2}, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ω{sub bf2} and ω{sub af1} decrease constantly, while the molecular-field coefficients ω{sub kf1}, ω{sub kf2}, and ω{sub bk} show a slight change.

  11. X-ray emission from a 650-fs laser-produced barium plasma

    International Nuclear Information System (INIS)

    We have used x rays in the 9--15-A band emitted from a solid target of BaF2 irradiated by ∼120 mJ of 248-nm radiation in a 650-fs full width at half maximum Gaussian laser pulse to characterize spectroscopically the resulting ultrashort-pulse laser-produced plasma. The emission was spectrally resolved but space and time integrated. By comparing the spectrum with unresolved-transition-array calculations and measurements of plasma emission from longer-pulse experiments, it is clear that ions as highly stripped as titaniumlike barium are present. We have successfully modeled the observed spectrum by assuming an optically thin source in local thermodynamic equilibrium (LTE) and using the super-transition-array theory [A. Bar-Shalom et al., Phys. Rev. A 40, 3183 (1989)] for emission from a hot, dense plasma. The model indicates that the emitting region is at comparatively low temperature (200--300 eV) and high electron density (1023--1024 cm-3). The degree of agreement between the model and the measured spectrum also suggests that the emitting plasma is near LTE. We conclude that the emission in this band arises from a solid-density plasma formed early in time, and is thus localized in both space and time. This interpretation is reinforced by LASNEX [G. B. Zimmerman and W. L. Kruer, Comments Plasma Phys. Controlled Fusion 11, 51 (1975)] simulations that indicate that emission in this band closely tracks the laser pulse

  12. Screening of plant species for phytoremediation of uranium, thorium, barium, nickel, strontium and lead contaminated soils from a uranium mill tailings repository in South China.

    Science.gov (United States)

    Li, Guang-yue; Hu, Nan; Ding, De-xin; Zheng, Ji-fang; Liu, Yu-long; Wang, Yong-dong; Nie, Xiao-qin

    2011-06-01

    The concentrations of uranium, thorium, barium, nickel, strontium and lead in the samples of the tailings and plant species collected from a uranium mill tailings repository in South China were analyzed. Then, the removal capability of a plant for a target element was assessed. It was found that Phragmites australis had the greatest removal capabilities for uranium (820 μg), thorium (103 μg) and lead (1,870 μg). Miscanthus floridulus had the greatest removal capabilities for barium (3,730 μg) and nickel (667 μg), and Parthenocissus quinquefolia had the greatest removal capability for strontium (3,920 μg). In this study, a novel coefficient, termed as phytoremediation factor (PF), was proposed, for the first time, to assess the potential of a plant to be used in phytoremediation of a target element contaminated soil. Phragmites australis has the highest PFs for uranium (16.6), thorium (8.68), barium (10.0) and lead (10.5). Miscanthus floridulus has the highest PF for Ni (25.0). Broussonetia papyrifera and Parthenocissus quinquefolia have the relatively high PFs for strontium (28.1 and 25.4, respectively). On the basis of the definition for a hyperaccumulator, only Cyperus iria and Parthenocissus quinquefolia satisfied the criteria for hyperaccumulator of uranium (36.4 μg/g) and strontium (190 μg/g), and could be the candidates for phytoremediation of uranium and strontium contaminated soils. The results show that the PF has advantage over the hyperaccumulator in reflecting the removal capabilities of a plant for a target element, and is more adequate for assessing the potential of a plant to be used in phytoremediation than conventional method. PMID:21523506

  13. Cesium-137 contamination in Arctic Ocean ice

    International Nuclear Information System (INIS)

    Sea ice and ice-borne sediment samples were collected across the western Arctic basin on the joint US/Canada Arctic Ocean Section during August 1994. Samples were processed on board and returned at the completion of the cruise to Oak Ridge National Laboratory for analysis. Sediment was observed on the surface and in the ice from the southern ice limit in the Chukchi Sea to the North Pole. Preliminary results on the ice-borne sediment samples show widespread elevated concentrations of 137Cs, ranging from 4.9 to 73 mBq g dry weight-1. An analysis of the measurements indicate that sea ice is primary transport mechanism by which contaminated sediments are redistributed throughout the Arctic Ocean and possibly exported into the Greenland Sea and North Atlantic through Fram Strait. The wide variability in the ice-borne sediment concentrations of 137Cs measured along the transect argues that contaminants incorporated on the Siberian shelves can follow much more variable trajectories than is suggested by mean ice drift calculations. 2 figs

  14. Accumulation of cesium-137 by useful mollusca

    International Nuclear Information System (INIS)

    There are few data available on the radioactive contamination of marine mollusca, especially cephalopoda. Therefore, in this paper, data obtained on the radioactive contamination of cephalopoda were compared with those on pelecypoda and gastropoda. The uptake and elimination experiments were carried out by means of radioisotope tracer methods, and the concentration factors of 137Cs due to radioactive fallout were estimated. The contamination of cephalopoda was also compared with those of other marine organisms in terms of concentration factor. The activity ratios in the organs or tissues of octopus were in the range of 3.5 and 12.8 on the 14th day after the beginning of exposure and those of squid were in the range of 8.8 and 10.9 on the 6th day after the commencement of the experiment. The biological half time was 90 days for octopus from the observation over 75 days, while it was 31 days for clam from the results of 75 days' experiment. The concentration factors of 137Cs due to radioactive fallout were in the range of 3 and 23 for cephalopoda, 7 and 28 for pelecypoda and 24 and 30 for gastropoda, respectively. It was concluded that no difference in the concentration factors was clearly observable among the classes of mollusca, but the values were substantially similar to those of crustaceans and slightly lower than those of marine fish. (auth.)

  15. Sensitivity of single contrast barium enema with regard to colorectal disease as diagnosed by colonoscopy

    International Nuclear Information System (INIS)

    The results of single contrast barium enema were retrospectively correlated with colonoscopically diagnosed colorectal disease in 54 patients (75 lesions). Altogether 66 lesions (88%) were correctly diagnosed. The sensitivity of barium enema for polyps was 81% (26/32). There were three perceptive errors and three polyps 5 mm or less in size were not demonstrated by barium enema. Twenty-nine cases of inflammatory disorders were all correctly diagnosed. One of 12 malignancies was missed by perceptive error. In two cases with vascular malformations the barium enema was normal. 4/9 (44%) of missed lesions were perceptive errors and could have been probably avoided by a second independent reading of films. (orig.)

  16. How changes in a radiologist's technique can reduce patient dose in barium enema studies

    International Nuclear Information System (INIS)

    Changes in a radiologist's technique, especially utilising digital technology, can lead to substantial dose savings in barium enema examinations. Data will be provided showing a 20% saving with only minimal change in technique. (author)

  17. 21 CFR 137.180 - Self-rising flour.

    Science.gov (United States)

    2010-04-01

    ... Flours and Related Products § 137.180 Self-rising flour. (a) Self-rising flour, self-rising white flour, self-rising wheat flour, is an intimate mixture of flour, sodium bicarbonate, and one or more of the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Self-rising flour. 137.180 Section 137.180...

  18. Murine immunization by cesium-137 irradiation attenuated Schistosoma mansoni cercariae

    International Nuclear Information System (INIS)

    Cesium-137, becoming a more readily available ionizing gamma radiation source for laboratory use, was shown to effectively attenuate Schistosoma mansoni cercariae for vaccine production. In parallel comparison studies with the murine model, cesium-137 attenuated cercariae consistently afforded better protection than did the cobalt-60 prepared vaccine. Dose-response data indicated that the optimal total irradiation with cesium-137 was between 45 and 50 Krad

  19. Murine immunization by cesium-137 irradiation attenuated Schistosoma mansoni cercariae

    Energy Technology Data Exchange (ETDEWEB)

    Stek, M. Jr.; Minard, P.; Cruess, D.F.

    1984-06-01

    Cesium-137, becoming a more readily available ionizing gamma radiation source for laboratory use, was shown to effectively attenuate Schistosoma mansoni cercariae for vaccine production. In parallel comparison studies with the murine model, cesium-137 attenuated cercariae consistently afforded better protection than did the cobalt-60 prepared vaccine. Dose-response data indicated that the optimal total irradiation with cesium-137 was between 45 and 50 Krad.

  20. Fallout 137Cs in soils from North Western Libya

    International Nuclear Information System (INIS)

    Fallout levels of 137Cs in surface soil from North Western Libya have been measured using gamma-ray spectrometry. The activity concentrations of 137Cs in soil ranged from 975 to 1720 mBq x kg-1. The areal activity concentrations ranged from 1300 to 2250 mBq x m-2, and were highly correlated with annual precipitation. The effective dose from external exposure to 137Cs is found to be 3 nSv x y-1. (author)

  1. 21 CFR 146.137 - Frozen orange juice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen orange juice. 146.137 Section 146.137 Food... Beverages § 146.137 Frozen orange juice. (a) Frozen orange juice is orange juice as defined in § 146.135, except that it is frozen. (b) The name of the food is “Frozen orange juice”. Such name may be preceded...

  2. Barium isotopes in Allende meteorite - Evidence against an extinct superheavy element

    Science.gov (United States)

    Lewis, R. S.; Anders, E.; Shimamura, T.; Lugmair, G. W.

    1983-01-01

    Carbon and chromite fractions from the Allende meteorite that contain isotopically anomalous xenon-131 to xenon-136 (carbonaceous chondrite fission or CCF xenon) at up to 5 x 10 to the 11th atoms per gram show no detectable isotopic anomalies in barium-130 to barium-138. This rules out the possibility that the CCF xenon was formed by in situ fission of an extinct superheavy element. Apparently the CCF xenon and its carbonaceous carrier are relics from stellar nucleosynthesis.

  3. Calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid

    International Nuclear Information System (INIS)

    Present article is devoted to calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid. The calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid was carried out in order to determine the thermal effects of reactions. The results of interaction of Ba(OH)4·8H2O with 5, 10, and 20% solution of hydrofluoric acid were considered.

  4. Comparison of barium swallow and ultrasound in diagnosis of gastro-oesophageal reflux in children.

    OpenAIRE

    Naik, D R; Bolia, A; Moore, D. J.

    1985-01-01

    Fifty one infants and older children with suspected gastro-oesophageal reflux entered a study comparing the diagnostic accuracy of a standard barium swallow examination with that of ultrasound scanning. All children were examined by both techniques. In 40 cases there was unequivocal agreement between the examinations. Of the remaining patients, four had definite reflux by ultrasonic criteria but showed no evidence of reflux on barium swallow examination, four had positive findings on ultrasou...

  5. Whipple's disease demonstrated by double contrast small bowel enema with barium and methylcellulose

    International Nuclear Information System (INIS)

    The radiologic findings on small bowel enema examination using barium and methylcellulose (SBE+Ba+MC) in a patient with Whipple's disease before and after treatment are described. The changes on SBE+Ba+MC corresponded well to the clinical and morphologic picture. The advantages of this double contrast technique compared to the enteroclysis with barium alone are demonstrated. The SBE+Ba+MC is a good method to demonstrate the manifestations of Whipple's disease involving the small bowel and the mesentery. (orig.)

  6. Impact of Biofield Treatment on Atomic and Structural Characteristics of Barium Titanate Powder

    OpenAIRE

    Trivedi, Mahendra; Nayak, Gopal

    2015-01-01

    Barium titanate, perovskite structure is known for its high dielectric constant and piezoelectric properties, which makes it interesting material for fabricating capacitors, transducer, actuator, and sensors. The perovskite crystal structure and lattice vibrations play a crucial role in its piezoelectric and ferroelectric behavior. In the present study, the barium titanate powder was subjected to biofield treatment. Further, the control and treated samples were characterized using X-ray diffr...

  7. Kinetics of barium sulphate reaction crystallization in crystallizers with internal circulation

    OpenAIRE

    Koralewska, J.; Piotrowski, K; B. Wierzbowska; A. Matynia

    2008-01-01

    Kinetic calculation results describing the observed nucleation and growth rates of barium sulphate crystals precipitated in an integrated reaction-crystallization process in a barium sulphate-ammonium chloride-water system are presented and analyzed. The scope of experiments included two continuous model DTM-type crystallizers (Draft Tube Magma) with internal circulation of the suspension forced by a liquid jet-pump device responsible for stable and intensive enough ascending/descending flow ...

  8. Putative bioindicator of 137Cs in Perna viridis

    International Nuclear Information System (INIS)

    Green lipid mussels (Perna viridis L.) are utilized as bioindicators and bioconcentrators not only for marine radionuclide contamination but also for heavy metal bioaccumulation. Depurated P. viridis were incubated in 137Cs-spiked aquarium for 4 days. Soluble protein fractions of soft tissue obtained were electrophoresed (SDS-PAGE) to determine the exposure effects of 137Cs on P. viridis. Results showed the presence of a 154-kDa protein in 137Cs-spiked samples which could be a potential bioindicator of 137Cs in P. viridis. Other differences involving two more proteins (∼94-kDa and∼61 KDa) are reported. (Author)

  9. Fractionation of (137)Cs and Pu in natural peatland.

    Science.gov (United States)

    Mihalík, Ján; Bartusková, Miluše; Hölgye, Zoltán; Ježková, Tereza; Henych, Ondřej

    2014-08-01

    High Cs-137 concentrations in plants growing on peatland inspired us to investigate the quantity of its bioavailable fraction in natural peat. Our investigation aims to: a) estimate the quantity of bioavailable Cs-137 and Pu present in peat, b) verify the similarity of Cs-137 and K-40 behaviours, and c) perform a quantification of Cs-137 and Pu transfer from peat to plants. We analysed the vertical distribution of Cs-137 and Pu isotopes in the peat and their concentrations in plants growing on these places. Bioavailability of radionuclides was investigated by sequential extraction. Sequential analyses revealed that it was the upper layer which contained the majority of Cs-137 in an available form while deeper layers retained Cs-137 in immobile fractions. We can conclude that 18% of all Cs-137 in the peat is still bioavailable. Despite of the low quantity of bioavailable fraction of Cs-137 its transfer factor reached extremely high values. In the case of Pu, 64% of its total amount was associated with fulvic/humic acids which resulted in the high transfer factor from peat to plants. 27 years after the Chernobyl nuclear accident, the significant part of radionuclides deposited in peatland is still bioavailable. PMID:24631917

  10. Speciation of 137Cs in the Baltic sea water

    International Nuclear Information System (INIS)

    A possibility of application of Filtrac 391 and Nuclepore filters, Ky-2-8-C exchanger and the Mtilon-T fiber impregnated with Fe, Co, Ni ferrocyanides for separation of particulate and ionic 137Cs in the sea water was investigated. Physico-chemical forms of 137Cs were investigated in the Baltic Sea water during 1995-1997. It was determined that 137Cs was mainly present in ionic form (62-93 %) both in the near-shore and open waters. Concentration of particulate 137Cs ranged from 255 to 625 Bq/kg (dry weight).The distribution coefficient (Kd) of radiocaesium reached values of 2100-9700. (author)

  11. Surface erosion assessment in New Zealand using caesium-137

    International Nuclear Information System (INIS)

    The 137Cs technique has provided the first quantitative, medium-term data on rates of soil redistribution by surface erosion on both cropland and rangeland in New Zealand. Research has also provided data on natural short-range variability of 137Cs in uneroded soils, and a technique for independently estimating 137Cs input values from rainfall. The greatest research need remains the development of robust, accurate calibration procedures for converting 137Cs measurements to rates of erosion. Emphasis has been on application of the technique to provide field-based data on erosion rates, with limited research to further develop the technique. This paper summarises recent research in these two areas

  12. The impact of digital imaging on patient doses during barium studies

    International Nuclear Information System (INIS)

    Barium studies performed on 10 digital and four non-digital fluoroscopic systems were monitored with dose-area product meters as part of a Regional Patient Dosimetry Audit programme. The data have been collected using a computer to read and reset the dose-area product meter and also to collect patient and examination details. A comparison of dose-area product measurements from digital and non-digital fluoroscopy units on over 10 000 barium studies is presented. The data have been corrected according to patient size. The mean size corrected dose-area product for a barium meal examination was found to be 7.62 Gy cm-2 for a digital set compared with 15.45 Gy cm-2 for a non-digital set with 2462 and 1308 patients included in each measurement series, respectively. Dose-area products were also a factor of approximately two lower for barium enema, barium swallow and barium follow-through examinations performed on digital systems. (author)

  13. Preparation of porous nano barium ferrite and its adsorption properties on uranium

    International Nuclear Information System (INIS)

    The porous nano barium ferrite was made of Fe(NO3)3 and Ba(NO3)2 as raw materials, CTAB as surfactant by method of sol-gel and self-propagating combustion. The composition, morphology and magnetic properties of nano-rod barium ferrite were characterized by XRD, SEM and vibrating sample magnetometer. The adsorption properties of porous nano barium ferrite on uranium were studied with static adsorption and the effects of pH, adsorption temperature and oscillation time on adsorption properties were discussed. The results indicate that the average particle size of porous nano barium ferrite is 45-65 nm, the saturation magnetization and coercivity are 62.83 emu/g and 5481.0 Oe, respectively. Under the condition of the porous nano barium ferrite amount of 0.02 g, pH of 6, adsorption temperature of 25℃ and oscillation time of 30 min, the adsorption capacity of uranium on the porous nano barium ferrite reaches 921 μg/g. (authors)

  14. Comparison of Calcium and Barium Microcapsules as Scaffolds in the Development of Artificial Dermal Papillae.

    Science.gov (United States)

    Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu

    2016-01-01

    This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and calcium microcapsules maintained xenogenic dermal papilla cells in an immunoisolated environment and induced the formation of hair follicle structures. Calcium microcapsules showed better biocompatibility, permeability, and cell viability in comparison with barium microcapsules. Before 18 weeks, calcium microcapsules gathered together, with no substantial immune response. After 32 weeks, some microcapsules were near inflammatory cells and wrapped with fiber. A few large hair follicles were found. Control samples showed no marked changes at the implantation site. Barium microcapsules were superior to calcium microcapsules in structural and mechanical stability. The cells encapsulated in hydrogel barium microcapsules exhibited higher short-term viability. This study established a model to culture DPCs in 3D culture conditions. Barium microcapsules may be useful in short-term transplantation study. Calcium microcapsules may provide an effective scaffold for the development of artificial dermal papilla. PMID:27123456

  15. Virtual colonoscopy with electron beam CT: correlation with barium enema, colonoscopy and pathology

    International Nuclear Information System (INIS)

    To perform virtual colonoscopy using electron beam tomography(EBT) in patients in whom a colonic mass was present, and to compare the results with those obtained using barium enema, colonoscopy and gross pathologic specimens. Materials and Methods : Ten patients in whom colonic masses were diagnosed by either barium enema or colonoscopy were involved in this study. There were nine cases of adenocarcinoma and one of tubulovillous adenoma. Using EBT preoperative abdominopelvic CT scans were performed. Axial scans were then three-dimensionally reconstructed to produce virtual colonoscopic images and were compared with barium enema, colonoscopy and gross pathologic specimens. Virtual colonoscopic images of the masses were classified as either 1)polyploid, 2)sessile,3)fungating, or 4)annular constrictive. We also determined whether ulcers were present within the lesions and whether there was obstruction. Results : After virtual colonoscopy, two lesions were classified as polyploid, one as sessile, five as fungating and two as annular constrictive. Virtual colonoscopic images showed good correlation with the findings of barium enema, colonoscopy and gross pathologic specimens. Three of six ulcerative lesions were observed on colonoscopy; in seven adenocarcinomas with partial or total luminal obstruction, virtual colonoscopy visualized the colon beyond the obstructed sites. In one case, barium contrast failed to pass through the obstructed portion and in six cases, the colonoscope similarly failed. Conclusion : Virtual colonoscopies correlated well with barium enema, colonoscopy and gross pathologic specimens. They provide three dimensional images of colonic masses and are helpful for the evaluation of obstructive lesions

  16. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough

    Directory of Open Access Journals (Sweden)

    Carlos Shuler Nin

    2013-12-01

    Full Text Available OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons.RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6% of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6% of the patients, whereas the treatment was ineffective in 1 (8.4%. We observed no complications related to barium swallow, such as contrast aspiration.CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.

  17. Genomic analyses reveal broad impact of miR-137 on genes associated with malignant transformation and neuronal differentiation in glioblastoma cells.

    Science.gov (United States)

    Tamim, Saleh; Vo, Dat T; Uren, Philip J; Qiao, Mei; Bindewald, Eckart; Kasprzak, Wojciech K; Shapiro, Bruce A; Nakaya, Helder I; Burns, Suzanne C; Araujo, Patricia R; Nakano, Ichiro; Radek, Agnes J; Kuersten, Scott; Smith, Andrew D; Penalva, Luiz O F

    2014-01-01

    miR-137 plays critical roles in the nervous system and tumor development; an increase in its expression is required for neuronal differentiation while its reduction is implicated in gliomagenesis. To evaluate the potential of miR-137 in glioblastoma therapy, we conducted genome-wide target mapping in glioblastoma cells by measuring the level of association between PABP and mRNAs in cells transfected with miR-137 mimics vs. controls via RIPSeq. Impact on mRNA levels was also measured by RNASeq. By combining the results of both experimental approaches, 1468 genes were found to be negatively impacted by miR-137--among them, 595 (40%) contain miR-137 predicted sites. The most relevant targets include oncogenic proteins and key players in neurogenesis like c-KIT, YBX1, AKT2, CDC42, CDK6 and TGFβ2. Interestingly, we observed that several identified miR-137 targets are also predicted to be regulated by miR-124, miR-128 and miR-7, which are equally implicated in neuronal differentiation and gliomagenesis. We suggest that the concomitant increase of these four miRNAs in neuronal stem cells or their repression in tumor cells could produce a robust regulatory effect with major consequences to neuronal differentiation and tumorigenesis. PMID:24465609

  18. Excess Barium as a Paleoproductivity Proxy: A Reevaluation

    Science.gov (United States)

    Eagle, M.; Paytan, A.

    2001-12-01

    Marine barite may serve as a proxy to reconstruct past export production (Dymond, 1992). In most studies sedimentary barite accumulation is not measured directly, instead a parameter termed excess barium (Baexs), also referred to as biogenic barium, is used to estimate the barite content. Baexs is defined as the total Ba concentration in the sediment minus the Ba associated with terrigenous material. Baexs is calculated by normalization to a constant Ba/Al ratio, typically the average shale ratio. This application assumes that (1) all the Ba besides the fraction associated with terrigenous Al is in the form of barite (the phase related to productivity) (2) the Ba/Alshale is constant in space and time (3) all of the Al is associated with terrigenous matter. If these assumptions are invalidated however, this approach lead to significant errors in calculating export production rates. To test the validity of the use of Baexs as a proxy for barite we compared the Baexs in a wide range of core top sediments from different oceanic settings to the barite content in the same cores. We found that Baexs frequently overestimated the Ba fraction associated with barite and in several cases significant Baexs was measured in the cores where no barite was observed. We have also used a sequential leaching protocol (Collier and Edmond 1984) to determine Ba association with organic matter, carbonates, Fe-Mn hydroxides and silicates. While terrigenous Ba remains an important fraction, in our samples 25-95% of non-barite Ba was derived from other fractions, with Fe-Mn oxides contributing the most Ba. In addition we found that the Ba/Al ratio in the silicate fraction of our samples varied considerably from site to site. The above results suggest that at least two of the underlying assumptions for employing Baexs to reconstruct paleoproductivity are not always valid and previously published data from (Murray and Leinen 1993) indicate that the third assumption may also not hold in every

  19. Mechanisms of 137Cs migration in coniferous forest soils

    International Nuclear Information System (INIS)

    Field and laboratory studies demonstrate two processes involved in 137Cs migration in coniferous forest soil. The data illustrate that the effects of leaching and litter accumulation combine, over the time interval since deposition, to achieve the observed distribution of 137Cs in the soil profile. Today, under normal field conditions the rate of 137Cs leaching from forest humus is low and even extreme environmental conditions do not increase greatly the extent of 137Cs mobilisation by leaching. A three-phase model of 137Cs migration in the organic horizons of coniferous forest soils is proposed. The phases are discrete but at any point in time the behaviour of some portion of deposited 137Cs will be characteristic of one of the three phases. In the first phase 137Cs intercepted by the canopy is washed to the forest floor where a proportion (20-40% is reported) rapidly percolates through the organic horizons reaching the underlying soil; the remainder is retained in the organic horizons. In the second phase, which our study estimates to last about 5 years, the 137Cs contained within the Ol and Of horizons moves to the Oh horizon. Accumulation of relatively uncontaminated litter on top of the Ol horizon contributes to this migration, while 137Cs mobilised from the Ol and Of horizons by decomposition is leached to the Oh horizon. The 137Cs which reaches the Oh horizon, either by leaching or by decomposition and burial, enters the third phase in which the pace of migration is greatly reduced. Decomposition is slowest in the Oh horizon and the accumulation and turnover of Oh material is also very slow. At the site investigated in this study the bulk of the deposited 137Cs is in this third phase and we suggest that this phase will persist for many years to come

  20. Monte Carlo estimation for pediatric barium meal procedures

    International Nuclear Information System (INIS)

    Fluoroscopic barium meal (BM) series involve an X-ray examination of the esophagus, stomach, and duodenum, by the use of a contrast media – the barium sulfate (BaSO4). They are widely used to observe digestive functions or to diagnose abnormalities such as ulcers; tumors; inflammation of the esophagus, stomach, and duodenum; malrotations; vascular rings; and gastroesophageal reflux disease (a common ailment in children). However, this procedure uses long fluoroscopy times and multiple radiographies, resulting in high effective doses to pediatric patients, whose radiosensitivity and life expectancy are higher than in adults. Based on those data, the aims of the current study are to: determine the PK,A (kerma-area product) values, on the patient chest area, and the effective doses to 5 and 10 years old children. Thirty-seven different pediatric patients were studied and stratified into two group sizes: 5 and 10 years old. For each procedure, the following data was recorded: sex, age and upper chest thickness, from the patients; technical parameters of the procedure (kV, fluoroscopy time and number of radiographies); distances (focus-detector and focus-table) and field size on the examination table. Three pairs of LiF:Mg,Ti thermoluminescent dosimeters were positioned at the center of the child´s sternum. After that, upper chest thickness was subtracted from focus-table distance, so focus-patient distance was obtained. Using the field size on the table and applying similar triangles concepts, the field size on the patient was measured, which was multiplied by the mean kerma (from the dosimeters), so that PK,A could be determined. To estimate the effective dose, PK,A and technical parameters of the procedure (kV, total filtration, focus-detector distance and field size on the patient) were written in a Monte Carlo software simulation. The results of PK,A and effective doses were higher than studies used for comparison, which shows the importance of an optimization

  1. Study of soil erosion using environmental isotope cesium-137 (137Cs)

    International Nuclear Information System (INIS)

    The environmental tracer hay a potential to be used to trace sediment movement. Caesium (Cs), a radionuclide released from nuclear weapon tests is strongly absorbed on clay. The '1'3'7 Cs content in soil profile has been used to estimate soil loss due to water erosion in agricultural land. Soil samples were collected at the study and reference sites using a sampling frame with dimensions of 20 cm x 50 cm x 24 cm. In each depth-incremental soil sampling, the plate was placed on the soil surface and hammered into the soil, a scrapper plate was used to slice off soil in 2 cm increment to a depth of 40 cm. The '1'3'7 Cs content in an undisturbed site accumulated in the upper portion of the soil profile whereas in the disturbed sites the contents are nearly mixed within the plough layer. The eroded soil contained less '1'3'7 Cs compared to the uneroded sites. An empirical model is used to quantify the soil loss. The estimated erosion rates on slopes located at D, E, F are found to be 0. 54 ± 0. 03 tonne/hectare/year, 1.42 ± 0.12 tonne/hectare/year and 0.060 ± 0.009 tonne/hectare/year giving the average of 0.069 ± 0.08 tonne/hectare/year. This result suggest '1'3'7 Cs have the considerable value in data collection for long term-erosion studies. (author)

  2. 14 CFR 137.39 - Economic poison dispensing.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Economic poison dispensing. 137.39 Section... AIRCRAFT OPERATIONS Operating Rules § 137.39 Economic poison dispensing. (a) Except as provided in... economic poison that is registered with the U.S. Department of Agriculture under the Federal...

  3. 10 CFR 26.137 - Quality assurance and quality control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Quality assurance and quality control. 26.137 Section 26....137 Quality assurance and quality control. (a) Quality assurance program. Each licensee testing facility shall have a quality assurance program that encompasses all aspects of the testing...

  4. Correlation of erosion measurements and soil caesium-137 content

    International Nuclear Information System (INIS)

    This paper reports a calibration between measured soil loss from small plots and measured soil 137Cs content (expressed as a percentage loss relative to the 137Cs content of a local stable reference soil). The regression represents a simple and rapid tool for the estimation of net soil loss from sites which have a uniform and continuous history of land-use. (author)

  5. Accumulation and distribution 137Сs in predators’ organism

    Directory of Open Access Journals (Sweden)

    A. V. Gulakov

    2007-10-01

    Full Text Available Data of the long-term research of accumulation and distribution 137Cs radionuclide in organisms of predatory wild animals from the alienation zone of the Chernobyl nuclear power station are presented. Essential fluctuations of the 137Cs contents in muscular tissue are noted. The results have large practical value for management of the hunting facilities on the radioactively polluted territories.

  6. 14 CFR 21.137 - Location of manufacturing facilities.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Location of manufacturing facilities. 21.137 Section 21.137 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... manufacturing facilities. The Administrator does not issue a production certificate if the...

  7. 21 CFR 133.137 - Washed curd cheese for manufacturing.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Washed curd cheese for manufacturing. 133.137... Standardized Cheese and Related Products § 133.137 Washed curd cheese for manufacturing. Washed curd cheese for manufacturing conforms to the definition and standard of identity prescribed for washed curd cheese by §...

  8. Cumulative deposition of 137Cs in the soil of Korea

    International Nuclear Information System (INIS)

    The cumulative deposition of 137Cs in the soil of Korea has been studied. Using γ-ray spectrometry, the concentrations of 137Cs were determined for the soil samples collected to a depth of 20 cm. The average accumulated depositions of 137Cs were estimated roughly to be 2,501 ±499 Bq m-2 in the forest and 1,058 ±322 Bq m-2 in the hill. The inventory value of 137Cs in the forest is about two times higher than that in the hill. Except for some cases, the concentrations of 137Cs in the undisturbed soils decreased exponentially with increasing the soil depth. The influences of rainfall, organic matter content, clay content and pH on the deposition of 137Cs were studied using the field method. Among these factors, the organic matter content played the most important role in the retention and relative mobility of 137Cs in the soil. The other factors such as rainfall, clay content and pH showed weak correlation with the deposition of 137Cs in the soil

  9. 36 CFR 223.137 - Causes for debarment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Causes for debarment. 223.137... DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Suspension and Debarment of Timber Purchasers § 223.137 Causes for debarment. The debarring official may debar a purchaser for any of the following causes:...

  10. 14 CFR 137.51 - Operation over congested areas: General.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Operation over congested areas: General. 137.51 Section 137.51 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS AGRICULTURAL AIRCRAFT OPERATIONS Operating Rules...

  11. 49 CFR 229.137 - Sanitation, general requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Sanitation, general requirements. 229.137 Section... Cab Equipment § 229.137 Sanitation, general requirements. (a) Sanitation compartment. Except as provided in paragraph (b) of this section, all lead locomotives in use shall be equipped with a...

  12. 34 CFR 300.137 - Equitable services determined.

    Science.gov (United States)

    2010-07-01

    ... Private Schools § 300.137 Equitable services determined. (a) No individual right to special education and related services. No parentally-placed private school child with a disability has an individual right to... 34 Education 2 2010-07-01 2010-07-01 false Equitable services determined. 300.137 Section...

  13. Sediment environmental capacity of 137Cs in Daya Bay

    Institute of Scientific and Technical Information of China (English)

    ZHANG Junli; CHEN Jiajun; XU Jialin; LI Yuanxin; HUANG Naiming

    2007-01-01

    Sediment environmental capacity of pollutants is very important for marine environmental management.Based on the methodology of a study on water,soil environmental capacity,and mass conservation theory in a system,the concept and model on sediment environmental capacity for 137Cs in Daya Bay were developed.The static capacity for 137Cs in the upper sediment near the shore at a shallow area was calculated,and the annual dynamic capacity and total dynamic capacity were also calculated through determination of the typical biomass in the sediment.The results showed that the estimated environmental capacity for 137Cs in sediments was approximately equal to the current input of 137Cs into the sediments.Controlling the input of 137Cs in the sediments within the environmental capacity guarantees the sustainability of the current situation of the Daya Bay ecosystem and avoidance of a significant degradation of the system.

  14. {sup 137}Cs accumulation in coastal sediments in Sweden

    Energy Technology Data Exchange (ETDEWEB)

    Pettersson, H.B.L.; Salih, I. [Linkoeping Univ. (Sweden). Dept. of Radiation Physics; Herrmann, J. [Federal Maritime and Hydrographic Agency, Hamburg (Germany)

    2005-09-15

    Seabed sediment samples were collected in 1998, 2000 and 2001 at 20 sites located in the Baltic Sea and 4 sites in the Skagerrak. The objectives of the sampling campaigns were (i) to establish the coastal sediment distribution of {sup 137}Cs, (ii) to evaluate the vertical core distribution of {sup 137}Cs, (iii) to study the sediment accumulation rates, and (iv) to assess the sediment inventories of {sup 137}Cs. The results show a very high variation in {sup 137}Cs concentrations and an almost 100-fold difference in inventories, showing predominance of Chernobyl derived {sup 137}Cs in the Baltic Proper compared to the western Baltic and the Skagerrak areas. Sediment accumulation rates were highly dependent on sediment types and ranged from 0.05 to 1.8 cm/y.

  15. Barium oxide, calcium oxide, magnesia, and alkali oxide free glass

    Science.gov (United States)

    Lu, Peizhen Kathy; Mahapatra, Manoj Kumar

    2013-09-24

    A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.

  16. Abundance analysis of s-process enhanced barium stars

    Science.gov (United States)

    Mahanta, Upakul; Karinkuzhi, Drisya; Goswami, Aruna; Duorah, Kalpana

    2016-08-01

    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ˜42000) of these objects spanning a wavelength range from 4000 to 6800 Å, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature Teff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] ≥ 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars with [Ba/Fe] ˜ 0.4. The derived abundances of the elements are interpreted on the basis of existing theories for understanding their origin and evolution.

  17. Structural and magnetic properties of barium-gadolinium hexaferrites

    Energy Technology Data Exchange (ETDEWEB)

    Litsardakis, G. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)]. E-mail: Lits@eng.auth.gr; Manolakis, I. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Serletis, C. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Efthimiadis, K.G. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)

    2007-03-15

    A series of Gd-substituted M-type barium hexaferrites has been prepared by the ceramic route, according to the formula (Ba{sub 1-x}Gd{sub x})O.5.25Fe{sub 2}O{sub 3} (x=0-0.30). XRD analysis revealed that all the samples present primarily an M-type structure. Samples x=0 and x=0.05 are single-phase. Hematite (Fe{sub 2}O{sub 3}) and GdFeO{sub 3} were detected in the remaining samples. Coercivity (H{sub c}) shows remarkably high values, {approx}293kA/m for x=0.20 and 0.30 with a maximum of 322kA/m for x=0.25. Specific saturation magnetization ({sigma}{sub sat}) of the samples presents a small increase up to x=0.10. The microstructure examination indicates that Gd may act as a grain growth inhibitor.

  18. On-line ultrasonic characterisation of barium doped lanthanum perovskites

    International Nuclear Information System (INIS)

    Perovskite manganite samples La1−xBaxMnO3 with the composition of x=0.30, 0.33 and 0.36 were prepared by employing solid state reaction technique. The X-ray diffraction (XRD) patterns confirmed the rhombhedral structure with R3c space group of the samples. The obtained energy dispersive analysis X-rays (EDX) spectra of the samples have confirmed the elemental composition of the samples. The scanning electron microscope (SEM) images of the samples were used to find out the size of the particles. In-situ ultrasonic measurements were carried out on the samples by through transmission method. The temperature dependence of the ultrasonic parameters revealed interesting features of the samples. The observed ultrasonic velocities and attenuation both in longitudinal and shear mode are related to the paramagnetic (PM) to ferromagnetic (FM) phase transition in the prepared samples. The results confirmed that an increase in the barium content in the sample leads to an increase in the phase transition temperature TC

  19. Properties of barium strontium titanate at millimeter wave frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Osman, Nurul [Department of Physics, Universiti Putra Malaysia (Malaysia); Free, Charles [Department of Engineering and Design, University of Sussex (United Kingdom)

    2015-04-24

    The trend towards using higher millimetre-wave frequencies for communication systems has created a need for accurate characterization of materials to be used at these frequencies. Barium Strontium Titanate (BST) is a ferroelectric material whose permittivity is known to change as a function of applied electric field and have found varieties of application in electronic and communication field. In this work, new data on the properties of BST characterize using the free space technique at frequencies between 145 GHz and 155 GHz for both thick film and bulk samples are presented. The measurement data provided useful information on effective permittivity and loss tangent for all the BST samples. Data on the material transmission, reflection properties as well as loss will also be presented. The outcome of the work shows through practical measurement, that BST has a high permittivity with moderate losses and the results also shows that BST has suitable properties to be used as RAM for high frequency application.

  20. Properties of barium strontium titanate at millimeter wave frequencies

    International Nuclear Information System (INIS)

    The trend towards using higher millimetre-wave frequencies for communication systems has created a need for accurate characterization of materials to be used at these frequencies. Barium Strontium Titanate (BST) is a ferroelectric material whose permittivity is known to change as a function of applied electric field and have found varieties of application in electronic and communication field. In this work, new data on the properties of BST characterize using the free space technique at frequencies between 145 GHz and 155 GHz for both thick film and bulk samples are presented. The measurement data provided useful information on effective permittivity and loss tangent for all the BST samples. Data on the material transmission, reflection properties as well as loss will also be presented. The outcome of the work shows through practical measurement, that BST has a high permittivity with moderate losses and the results also shows that BST has suitable properties to be used as RAM for high frequency application

  1. Radiochemical studies of the sorption behavior of strontium and barium

    International Nuclear Information System (INIS)

    The sorption behavior strontium and barium on kaolinite, bentonite and chlorite-illite mixed clay was studied by radioanalytical techniques using the batch method. 90Sr(29.1 y) and 133Ba(10.5y) were used as radiotracers. Characterization of the solid matrices was done by FTIR and XRD spectrometers and specific surface area measurements. Synthetic groundwater was used as the aqueous phase. The variation of the distribution ratio Rd, as a function of metal ion loading was examined. The sorption isotherms were fitted to various iso term models. The sorption energies were calculated to be in the range of 8-10kJ/mol suggesting an ion exchange type of sorption mechanism. In detailed experiments, chlorite-illite mixed clay was first presatured with K+, Sr2+, Ca2+ and Al 3= ions, respectively, prior to sorption studies with Ba2+ ions. The results of Ca2+ pretreated chlorite-illite were very similar to those of natural chlorite-illite, suggesting that the Ba2+ ion exchanges primarily with the Ca2+ ion on the clay minerals. (author). 15 refs., 3 figs., 5 tabs

  2. Removal of uranyl ions from aqueous solutions using barium titanate

    International Nuclear Information System (INIS)

    Remediation of water sources contaminated with radioactive waste products is a major environmental issue that demands new and more efficient technologies. For this purpose, we report a highly efficient ion-exchange material for the removal of radioactive nuclides from aqueous solutions. The kinetic characteristics of adsorption of uranyl ions on the surface of barium titanate were investigated using a spectrophotometric method under a wide range of conditions. By controlling the pH it was possible to exert fine control over the speciation of uranium, and by optimizing the temperature and grain size of the exchanger, almost total removal was achieved in a matter of just hours. The highest efficiency (>90 % removal) was realized at high temperature (80 deg C). Moreover, the effect of competitive ion adsorption from a range of different cations and anions was quantified. Adsorption was found to follow first-order kinetics and both Freundlich and Langmuir isotherms could be applied to this system. The results of a mathematical treatment of the kinetic data combined with the observation that adsorption was independent of stirring speed and dependent on the ion-exchanger grain size, indicate that the dominant mechanism influencing adsorption is particle spreading. The adsorption behavior was not influenced by exposure to high-intensity gamma radiation, indicating potential for use of this ion-exchanger in systems containing radioactive material. These results will be of use in the development of uranium extraction systems for contaminated water sources. (author)

  3. Colonic diverticulosis: evaluation with double contrast barium enema

    International Nuclear Information System (INIS)

    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west

  4. Colonic diverticulosis: evaluation with double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja [Korea Veterans Hospital, Seoul (Korea, Republic of)

    1997-02-01

    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west.

  5. Barium in landscape components of the western Transbaikal region

    Science.gov (United States)

    Kashin, V. K.

    2015-10-01

    Barium concentrations in parent materials, soils, and plants of the forest-steppe, steppe, and dry steppe landscapes of the Transbaikal region have been studied. The average concentration of this element in rocks and soils of this region exceeds its clarke by 1.8-2.1 times. A positive correlation between the contents of Ba in soils, soil-forming rocks, and plants has been found. The concentration of Ba in soils does not correlate with the soil pH and humus content. Distribution patterns of Ba in the soil profiles have been characterized. With respect to the coefficient of the biological uptake by plants, Ba is assigned to the group of low accumulation (0.55-0.65) for mineral soils and of strong accumulation (6.0) for alluvial bog soils. Average concentrations of Ba in the steppe, meadow, and cultivated vegetation of the region are 1.9-2.3 times higher in comparison with the average concentration of this element in plants of the continents. The biological migration of Ba is most active in meadow landscapes, whereas steppe landscapes are characterized by the least active biological migration of this element.

  6. Abundance analysis of s-process enhanced barium stars

    CERN Document Server

    Mahanta, Upakul; Goswami, Aruna; Duorah, Kalpana

    2016-01-01

    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ~ 42000) of these objects spanning a wavelength range from 4000 to 6800 A, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature T_eff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] > 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars wit...

  7. On-line ultrasonic characterisation of barium doped lanthanum perovskites

    Energy Technology Data Exchange (ETDEWEB)

    Thamilmaran, P.; Arunachalam, M. [Department of Physics, Sri SRNM College, Sattur 626203, Tamil Nadu (India); Research scholars in Physics, Manonmanium Sundaranar University, Tirunelveli 627012 Tamil Nadu (India); Sankarrajan, S. [Department of Physics, Unnamalai Institute of Technology, Kovilpatti 628503, Tamil Nadu (India); Sakthipandi, K., E-mail: sakthipandi@gmail.com [Department of Physics, Sethu Institute of Technology, Kariapatti 626115, Tamil Nadu (India)

    2015-06-15

    Perovskite manganite samples La{sub 1−x}Ba{sub x}MnO{sub 3} with the composition of x=0.30, 0.33 and 0.36 were prepared by employing solid state reaction technique. The X-ray diffraction (XRD) patterns confirmed the rhombhedral structure with R3c space group of the samples. The obtained energy dispersive analysis X-rays (EDX) spectra of the samples have confirmed the elemental composition of the samples. The scanning electron microscope (SEM) images of the samples were used to find out the size of the particles. In-situ ultrasonic measurements were carried out on the samples by through transmission method. The temperature dependence of the ultrasonic parameters revealed interesting features of the samples. The observed ultrasonic velocities and attenuation both in longitudinal and shear mode are related to the paramagnetic (PM) to ferromagnetic (FM) phase transition in the prepared samples. The results confirmed that an increase in the barium content in the sample leads to an increase in the phase transition temperature T{sub C}.

  8. The thermophysical properties of calcium and barium zirconium phosphate

    Energy Technology Data Exchange (ETDEWEB)

    Gregg, Daniel J., E-mail: daniel.gregg@ansto.gov.au; Karatchevtseva, Inna; Triani, Gerry; Lumpkin, Gregory R.; Vance, Eric R.

    2013-10-15

    The thermophysical and structural properties of calcium and barium zirconium phosphate ceramics (CZP and BZP) have been investigated for their potential candidacy as actinide hosts for inert matrix fuels (IMF) in nuclear reactors. These phosphate ceramics, which can accommodate minor actinides as well as the resulting fission products, are found to be thermally stable to 1600 °C in air, however they begin to decompose in an inert atmosphere above approximately 1400 °C. The heat capacity, thermal conductivity and bulk thermal-expansion were measured from room temperature up to 1200 °C. Structural changes in this temperature region as well as the anisotropic thermal-expansion behaviour were studied using high-temperature X-ray diffraction. A phase change from R-3 to R-3c was identified for Ba{sub 0.5}Zr{sub 2}(PO{sub 4}){sub 3} near 880 °C. The thermal conductivity for these ceramics at 1000 °C was found to be 1.0 W m{sup −1} K{sup −1}, a relatively low thermal conductivity that was increased to 5.0 W m{sup −1} K{sup −1} at 1000 °C for BZP:Ni (25:75 mass ratio) cermet composites.

  9. Preparation and properties of yttria doped tetragonal zirconia polycrystal/Sr-doped barium hexaferrite ceramic composites

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Shanshan; Zhang, Chao; Guo, Ruisong, E-mail: rsguo@tju.edu.cn; Liu, Lan; Yang, Yuexia; Li, Kehang

    2015-03-15

    Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m{sup 1/2}. - Abstract: The effects of substitution of Ba{sup 2+} by Sr{sup 2+} on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba{sub 1−x}Sr{sub x}Fe{sub 12}O{sub 19}, x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m{sup 1/2} for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase.

  10. Skylab-barium alpha and beta L = 6 field-line tracing experiments

    International Nuclear Information System (INIS)

    Events SKYLAB-BARIUM ALPHA (27 November 1973) and BETA (4 December 1973) were shaped-charge barium field-line tracing experiments near L approximately equal to 6, conducted jointly by the Los Alamos Scientific Laboratory and the University of Alaska Geophysical Institute. Image-orthicon and pulsed intensified auroral cameras provided data for triangulating the fast ion streaks. Using the POGO 10-68, epoch 1965.0, field-line model with Mead-Fairfield corrections for the outer field, the triangulated positions of the fast ion streak were projected down to the 100 km altitude northern conjugate surface. The projected positions moved toward magnetic east with a velocity of 725 m/sec for both SKYLAB-BARIUM ALPHA and BETA. Assuming only an E x B/B2 force, this drift velocity is consistent with an electric field toward magnetic south of 39 mV/m. Radiometric analysis of the filtered, intensified auroral camera records gave observed peak radiance values of about 2 x 10-11 watts/cm2-Sr in the 455.4 nm line of Ba+. The barium in the portion of the ion streak for which radiometric data were obtained had initial injection velocities of 9.5 to 13.5 km/sec in both events. This portion of the ion streak for both SKYLAB-BARIUM ALPHA and BETA contained approximately 4 x 1023 ions compared to the 6.4 x 1024 atoms contained in the barium liner. Ion inventory estimates are based on a solution of the statistical equilibrium equations. Corrections have been made in the ion inventory calculations for Doppler shifts of the solar spectrum as received in the rest frame of the high-velocity barium ions

  11. An 8-year review of barium studies in the diagnosis of gastroparesis

    International Nuclear Information System (INIS)

    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings

  12. Obtaining of a barium compound by combustion chemistry and their evaluation as Co adsorbent

    International Nuclear Information System (INIS)

    In this work, barium carbonate synthesized by chemical combustion method using a chemical precursor prepared by the combination of barium nitrate and urea as a fuel, with a 1:1 molar ratio in aqueous solution, the chemical precursor was heated to evaporate excess water, producing a homogeneous viscous liquid, that when heated to 900 centi grades for 5 minutes an exothermic reaction was produced very quickly and abruptly, forming a white powder final product, fine porous, little spongy, dry and crystalline ready to be used as material adsorbent. Additionally, the effect of water on the synthesis by chemical combustion was studied. Simultaneously, and with the purpose of comparing the advantages and disadvantages of the method by chemical combustion, barium carbonate was synthesized by precipitation method using barium nitrate salts and sodium carbonate. Synthesized barium carbonate, was characterized by X-ray diffraction, thermal gravimetric analysis, infrared spectrometry and scanning electron microscopy. We studied the adsorption capacity of Co present in aqueous solution by static tests on materials synthesized at room temperature using the neutron activation analysis. It was found that the synthesis by chemical combustion provides an interesting alternative compared to the synthesis by precipitation because it offers simplicity of synthesis and speed to have a good adsorbent material. It was found that the barium carbonate synthesized by the chemical combustion method using in their synthesis 1.0 ml of water, was the one who achieved the maximum adsorption capacity of 95.6% compared with the barium carbonate prepared by precipitation, which reached a capacity adsorption of 51.48%. (Author)

  13. Accelerating the transit time of barium sulphate suspensions in small bowel examinations

    International Nuclear Information System (INIS)

    Purpose: To determine whether hyperosmolar and effervescent agents proven individually to accelerate transit time in the barium small bowel examination have an additive effect when combined, surpassing that of either agent alone. Materials and methods: One hundred and forty-nine patients were randomised to four groups. Three hundred milliliters of barium sulphate alone was given to the first group. Fifteen milliliters of iodinated hyperosmolar contrast agent (Gastrografin, meglumine/sodium diatrizoate, Schering) was given in addition to barium sulphate to the second group while six packets of effervescent granules (Carbex, Ferring) were added for the third group. The final group was given a combination of both additives and barium sulphate. The time taken following ingestion for the contrast column to reach the caecum, as assessed by frequent interval fluoroscopy, was recorded. A subgroup of 32 patients were selected randomly from the four groups, 8 from each and assessed for quality of examination. Statistical assessments were made using Kruskal-Wallis and Mann-Whitney tests. Results: One hundred and nineteen patients were analysed after exclusions. The addition of accelerant to barium sulphate, both individually and in combination significantly reduced the small bowel transit time (p < 0.001). No significant difference existed between the additives when used with barium alone. The combined group had significantly faster transit times compared to the hyperosmolar group (p = 0.02). Differences between combined and effervescent groups tended towards significance (p = 0.09). No significant difference existed between groups when examination quality was assessed. Conclusion: These results suggest that the addition of combined effervescent and hyperosmolar agents to the barium suspension may significantly shorten the small bowel transit time without adversely affecting examination quality. This has implications for patient acceptability of the examination as well as

  14. An 8-year review of barium studies in the diagnosis of gastroparesis

    Energy Technology Data Exchange (ETDEWEB)

    Levin, A.A. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States); Levine, M.S. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)], E-mail: marc.levine@uphs.upenn.edu; Rubesin, S.E.; Laufer, I. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)

    2008-04-15

    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings.

  15. Thick-target yields of radioactive targets deduced from inverse kinematics

    CERN Document Server

    Aikawa, Masayuki; Imai, Shotaro

    2014-01-01

    The thick-target yield (TTY) of long-lived fission products (LLFP) is an essential quantity and represents basic data for transmutation. In order to evaluate TTY on radioactive targets including LLFP, we suggest a conversion method from inverse kinematics corresponding to the reaction of radioactive beams on stable targets. We demonstrate the method to deduce the TTY from inverse kinematics derived from the theoretical definition. This method is highly applicable in reactions at the energy per nucleon \\epsilon > 20 MeV/A as practically confirmed by the simulation of the SRIM2008 code. In this paper, we apply the method to the natCu(12C,X)24Na reaction to confirm availability. In addition, it is applied to the 137Cs + 12C reaction to reduce 137Cs and to suggest a TTY measurement of the 137Cs induced reaction on a thick 12C target.

  16. Weather-dependent change of cesium, strontium, barium and tellurium contamination deposited as aerosols on various cultures

    International Nuclear Information System (INIS)

    Various types of plants (wheat, bean, lettuce, radish and grass) were contaminated by dry deposition of radioactive aerosols (137Cs, 85Sr, 133Ba and 123mTe) in order to supplement the radioecological data necessary for operational post-accidental codes. A few days after deposition, rainfalls were applied to these cultures to evaluate the influence of some characteristics of the rain on the contamination of the culture over time. On the other hand, for wheat and bean, the influence of the humidity condition of the foliage at the contamination time was considered. For a given plant species at a given vegetative stage, the four radionuclides were intercepted in an identical way. The interception varied from 30% for bean (young sprout) to 80% for lettuce (near maturity). The global transfer factor values were dependent on both the radionuclides and the plant species; nevertheless, a higher value was obtained for cesium, regardless of the plant and the rainfall (from 0.006 m2 kgfresh-1 for wheat-grains - contaminated at the shooting stage - or for bean-pods - contaminated at the pre-flowering stage - to 0.1 m2 kgfresh-1 for a whole lettuce). The analysis of the results allowed us on the one hand, to extract parameter values of the foliar transfer directly usable in operational codes, in particular those relating to barium and tellurium, unknown until then, and on the other hand, to lay the foundations of a future, more mechanistic model, taking into account the foliar processes in a finer way

  17. Evaluating gully erosion using 137Cs and 210Pb/137Cs ratio in a reservoir catchment

    International Nuclear Information System (INIS)

    Water erosion in the hilly areas of west China is the main process contributing to the overall sediment of the Yellow River and the Yangtze River. The impact of gully erosion in total sediment output has been mostly neglected. Our objective was to assess the sediment production and sediment sources at both the hillslope and catchment scales in the Yangjuangou reservoir catchment of the Chinese Loess Plateau, northwest China. Distribution patterns in sediment production caused by water erosion on hills and gully slopes under different land use types were assessed using the fallout 137Cs technique. The total sediment production from the catchment was estimated by using the sediment record in a reservoir. Sediment sources and dominant water erosion processes were determined by comparing 137Cs activities and 210Pb/137Cs ratios in surface soils and sub-surface soils with those of sediment deposits from the reservoir at the outlet of the catchment. Results indicated that landscape location had the most significant impact on sediment production for cultivated hillslopes, followed by the terraced hillslope, and the least for the vegetated hillslope. Sediment production increased in the following order: top>upper>lower>middle for the cultivated hillslope, and top>lower>upper>middle for the terraced hillslope. The mean value of sediment production declined by 49% for the terraced hillslope and by 80% for the vegetated hillslope compared with the cultivated hillslope. Vegetated gully slope reduced the sediment production by 38% compared with the cultivated gully slope. These data demonstrate the effectiveness of terracing and perennial vegetation cover in controlling sediment delivery at a hillslope scale. Averaged 137Cs activities and 210Pb/137Cs ratios in the 0-5 cm surface soil (2.22-4.70 Bq kg-1 and 20.70-22.07, respectively) and in the 5-30 cm subsoil (2.60 Bq kg-1 and 28.57, respectively) on the cultivated hills and gully slopes were close to those of the deposited

  18. 137Cs in the western South Pacific Ocean

    International Nuclear Information System (INIS)

    The 137Cs activities were determined for seawater samples from the East Caroline, Coral Sea, New Hebrides, South Fiji and Tasman Sea (two stations) Basins of the western South Pacific Ocean by γ spectrometry using a low background Ge detector. The 137Cs activities ranged from 1.4 to 2.3 Bq m-3 over the depth interval 0-250 m and decreased exponentially from the subsurface to 1000 m depth. The distribution profiles of 137Cs activity at these six western South Pacific Ocean stations did not differ from each other significantly. There was a remarkable difference for the vertical profiles of 137Cs activity between the East Caroline Basin station in this study and the GEOSECS (Geochemical Ocean Sections Study) station at the same latitude in the Equatorial Pacific Ocean; the 137Cs inventory over the depth interval 100-1000 m increased from 400 ± 30 Bq m-2 to 560 ± 30 Bq m-2 during the period from 1973 to 1992. The total 137Cs inventories in the western South Pacific Ocean ranged from 850 ± 70 Bq m-2 in the Coral Sea Basin to 1270 ± 90 Bq m-2 in the South Fiji Basin. Higher 137Cs inventories were observed at middle latitude stations in the subtropical gyre than at low latitude stations. The 137Cs inventories were 1.9-4.5 times (2.9 ± 0.7 on average) and 1.7-4.3 times (3.1 ± 0.7 on average) higher than that of the expected deposition density of atmospheric global fallout at the same latitude and that of the estimated 137Cs deposition density in 10o latitude by 10 deg. longitude grid data obtained by Aoyama et al. [Aoyama M, Hirose K, Igarashi Y. Re-construction and updating our understanding on the global weapons tests 137Cs fallout. J Environ Monit 2006;8:431-438], respectively. The possible processes for higher 137Cs inventories in the western South Pacific Ocean than that of the expected deposition density of atmospheric global fallout may be attributable to the inter-hemisphere dispersion of the atmospheric nuclear weapons testing 137Cs from the northern

  19. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, N.G. [University of Otago, Department of Radiology, Christchurch (New Zealand); Butler, A.P. [University of Otago, Department of Radiology, Christchurch (New Zealand); University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Scott, N.J.A. [University of Otago, Department of Medicine, Christchurch (New Zealand); Cook, N.J. [Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Butzer, J.S. [Karlsruhe Institute of Technology, Physics Department, Karlsruhe (Germany); Schleich, N. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Firsching, M. [Friedrich Alexander University, Physics Department, Erlangen (Germany); Grasset, R.; Ruiter, N. de [University of Canterbury, Hitlab NZ, Christchurch (New Zealand); Campbell, M. [European Organisation for Nuclear Research, Physics Section, Geneva (Switzerland); Butler, P.H. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand)

    2010-09-15

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 {mu}A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 {mu}m isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)

  20. High pressure–low temperature phase diagram of barium: Simplicity versus complexity

    International Nuclear Information System (INIS)

    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations

  1. Radiologic diagnosis of gastro-oesophageal reflux. Comparison of barium and low-density contrast medium

    Energy Technology Data Exchange (ETDEWEB)

    Fransson, S.G.; Soekjer, H.; Johansson, K.E.; Tibbling, L.

    It has been proposed that the high density of ordinary barium suspension may complicate the radiologic diagnosis of gastro-oesophageal reflux. For this reason P-contrast was developed (Ferring AB); a contrast medium with the same density as water (1 g/cm/sup 3/). A comparison of P-contrast and barium (Mixobar Ventrikel 400 mg/ml) was performed in 82 patients. All patients were examined with both contrast media and the findings were compared with those at reflux test at manometry, endoscopy and 24-hour pH monitoring. Another 40 patients and 15 symptom-free controls were examined with two different amounts of barium, 100 ml and 200 ml, to study if the radiologic diagnosis of reflux varied with the volume of contrast medium administered. P-contrast was found to have no advantages over barium for the diagnosis of gastro-oesophageal reflux. The outcome of the radiologic examination was not influenced by the different volumes of barium used.

  2. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    International Nuclear Information System (INIS)

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 μA). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 μm isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)

  3. High pressure–low temperature phase diagram of barium: Simplicity versus complexity

    Energy Technology Data Exchange (ETDEWEB)

    Desgreniers, Serge [Laboratoire de Physique des Solides Denses, Université d' Ottawa, Ottawa, Ontario K1N 6N5 (Canada); Tse, John S., E-mail: John.Tse@usask.ca [Department of Physics and Engineering Physics, University of Saskatchewan, Saskatoon, Saskatchewan S7N 5B2 (Canada); State Key Laboratory of Superhard Materials, Jilin University, 130012 Changchun (China); Matsuoka, Takahiro [SPring-8/JASRI, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); Department of Electrical, Electronic and Computer Engineering, Gifu University, 1-1 Yanagido, Gifu 501-1193 (Japan); Ohishi, Yasuo [SPring-8/JASRI, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); Li, Quan; Ma, Yanming [State Key Laboratory of Superhard Materials, Jilin University, 130012 Changchun (China)

    2015-11-30

    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations.

  4. High pressure-low temperature phase diagram of barium: Simplicity versus complexity

    Science.gov (United States)

    Desgreniers, Serge; Tse, John S.; Matsuoka, Takahiro; Ohishi, Yasuo; Li, Quan; Ma, Yanming

    2015-11-01

    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations.

  5. Benefits of Barium Enema in Patients with Incomplete Colonoscopy. Prospective Study of 45 Cases

    International Nuclear Information System (INIS)

    To evaluate the usefulness of barium enema in patients with incomplete colonoscopy. There was carried out a prospective 10-month study of 45 patients with incomplete colonoscopy (27 men and 18 women), who were later examined by means of barium enema (33 conventional, 12 double-contrast) in order to check for additional pathology in portions of the colon not visualized by colonoscopy. Barium enema diagnosed six possible additional lesions (13.3%) in portions of the colon not visualized by incomplete colonoscopy (four neoplasia and two non-neoplasia). Regarding the neoplasia two were true positives and two false positives. Both true positives were adenocarcinomas (one synchronous caecum, and another in splenic angle). The two false positives corresponded to fecal matter stuck to the intestinal wall. Regarding the non-neoplasia, multiple stenosis was detected in a patient with Crohn's disease and an enterocolic fistula was found in a patient with sigmoid colon neoplasia. The diagnostic yield of barium enema in the detection of additional pathology in colon portions not visualized by colonoscopy was of 9%. Barium enema following incomplete colonoscopy permits a complete colon evaluation in most cases, and it offers additional diagnostic information. (Author) 21 refs

  6. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    International Nuclear Information System (INIS)

    Barium can be found in waters up to 1 mg L-1 and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L-1 and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  7. Hydro-MRI with fast sequences in Crohn's disease: Comparison with barium studies

    International Nuclear Information System (INIS)

    Purpose: To compare the value of hydro-MRI with that of barium studies in patients with Crohn's disease. Materials and methods: After an oral bowel opacification using 1000 ml of a 2.5% mannitol solution, axial and coronal breathhold sequences (T2W HASTE±FS, contrast-enhanced T1W FLASH FS) were acquired in 46 patients with Crohn's disease at 1,0 T. The findings of hydro-MRI were compared with those of barium studies. Results: In the stomach and the small bowel, hydro-MRI and barium studies demonstrated similar numbers of Crohn's involvements (39 vs. 36); in the colon, hydro-MRI showed clearly more affections (23 vs. 10). Hydro-MRI showed 12.7 cm of inflamed bowel per patient, on average (barium studies: 10,4 cm; p=0,004). There was a good agreement between the two methods regarding the assessment of the extent of Crohn's disease and the severity of bowel stenoses (r=0.89 and 0.88, respectively). Conclusions: For the assessment of Crohn's disease, hydro-MRI is preferable to the barium study because of the superior imaging quality and the lack of radiation exposure. (orig.)

  8. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    Energy Technology Data Exchange (ETDEWEB)

    Matoso, Erika, E-mail: ematoso@hotmail.com [Centro Tecnologico da Marinha em Sao Paulo (CEA/CTMS), Ipero, SP (Brazil). Centro Experimental Aramar; Cadore, Solange, E-mail: cadore@iqm.unicamp.br [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Quimica. Departamento de Quimica Analica

    2015-07-01

    Barium can be found in waters up to 1 mg L{sup -1} and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L{sup -1} and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  9. Distribution of 137Cs in water leachates of forest humus

    International Nuclear Information System (INIS)

    The distribution of 137Cs in water extracts of organic layers of forest soils was investigated using an ultrafiltration method. Samples were taken from two sites in the Bavarian Alps. The different horizons of the organic layers were extracted by column elution with water and 50 mmol/litre CsCl solution. Water extracts were fractionated using membranes with the molecular weight cutoff of 500, 1000 and 3000 Dalton to determine the molecular weight distribution of dissolved organic carbon (DOC). The activity of 137Cs associated with the different DOC-fractions was measured by direct gammaspectrometry. Cesium-137 in the fraction smaller than 500 Dalton was defined as 'ionic'. The results indicated a change of the binding sites depending on the degree of decomposition and humification in the profile. Organic bound 137Cs was identified in all extracts. High mobilities of DOC and 137Cs were observed in the same horizons, fractionation showed then low-molecular-weight DOC and 137Cs mainly in ionic form. In horizons with high-molecular-weight DOC the portion of organic bound 137Cs ranged up to 40%. (author)

  10. Spatial variability and Cesium-137 inventories in native forest

    International Nuclear Information System (INIS)

    With the nuclear fission discovery and development of nuclear weapons in 1940s, artificial radioisotopes were introduced in the environment. This contamination is due to worldwide fallout by superficial nuclear tests realized from early 1950s to late 1970s by USA, former URSS, UK, France and China. One of theses radioisotopes that have been very studied is cesium-137. Cesium-137 has a half-life of 30.2 years and its biological behavior is similar to the potassium. The behavior in soil matrix, depth distribution, spatial variability and inventories values of cesium-137 has been determinate for several regions of the world. In Brazil, some research groups have worked on this subject, but there are few works published about theses properties of cesium-137. The aim of this paper was study the depth distribution, spatial variability, and inventory of cesium-137 in native forest. Two native forests (Mata 1 and Mata UEL) were sampling in region of Londrina, PR. The results shows that there is a spatial variability of 40% for Mata 1 and 42% for Mata UEL. The depth distribution of cesium-137 for two forests presented a exponential form, characteristic to undisturbed soil. Cesium-137 inventory determinate for Mata 1 was 358 Bq m-2 and for Mata UEL was 320 Bq m-2. (author)

  11. Measurement of Caesium-137 in the Normal Person

    International Nuclear Information System (INIS)

    During the period June 1959 to October 1963 the Landstuhl whole-body counter has measured the caesium-137 content of more than 15 000 normal persons. The monthly averages of these measurements indicate a steady increase In the caesium-137 content since June 1962. This increase has become more rapid during the period June 1963 to October 1963. A further evaluation of the monthly averages since June 1962 indicates a mean biologic half-life of caesium-137 of 140 d for persons older than 22 yr. A comparison of the mean caesium-137 content of persons between 8 and 17 yr of age with those older than 22 appears to indicate that the biologic half-life of caesium-137 is shorter in the younger people. This is in agreement with earlier data from this counter concerning measurements of caesium-137 content between June 1959 and December 1960: these data showed a lower caesium-137 content in children than in adults. Another evaluation of recent data from this unit concerns the standard deviation (sigma) of the caesium-137 content in a large population. From this population the sigma of measured caesium/g body potassium values is 33%. This is more than twice the sigma of the body potassium content of this same population. By comparing a group of persons who have undergone several repeat assays over an extended period of time with the monthly means of the total population measured, it has been found that the large sigma of caesium-137 content cannot be caused solely by the varying diets of the population measured. (author)

  12. FIRST DIRECT EVIDENCE THAT BARIUM DWARFS HAVE WHITE DWARF COMPANIONS

    International Nuclear Information System (INIS)

    Barium II (Ba) stars are chemically peculiar F-, G-, and K-type objects that show enhanced abundances of s-process elements. Since s-process nucleosynthesis is unlikely to take place in stars prior to the advanced asymptotic giant branch (AGB) stage, the prevailing hypothesis is that each present Ba star was contaminated by an AGB companion which is now a white dwarf (WD). Unless the initial mass ratio of such a binary was fairly close to unity, the receiving star is thus at least as likely to be a dwarf as a giant. So although most known Ba stars appear to be giants, the hypothesis requires that Ba dwarfs be comparably plentiful and moreover that they should all have WD companions. However, despite dedicated searches with the IUE satellite, no WD companions have been directly detected to date among the classical Ba dwarfs, even though some 90% of those stars are spectroscopic binaries, so the contamination hypothesis is therefore presently in some jeopardy. In this paper, we analyze recent deep, near-UV and far-UV Galaxy Evolution Explorer (GALEX) exposures of four of the brightest of the class (HD 2454, 15360, 26367, and 221531), together with archived GALEX data for two newly recognized Ba dwarfs: HD 34654 and HD 114520 (which also prove to be spectroscopic binaries). The GALEX observations of the Ba dwarfs as a group show a significant far-UV excess compared to a control sample of normal F-type dwarfs. We suggest that this ensemble far-UV excess constitutes the first direct evidence that Ba dwarfs have WD companions.

  13. Electrical properties of niobium doped barium bismuth-titanate ceramics

    International Nuclear Information System (INIS)

    Highlights: ► Pure and doped BaBi4Ti4O15 were prepared via the solid-state reaction method. ► The grain size was suppressed in Nb-doped samples. ► The diffuseness of the dielectric peak increased with dopant concentration. ► Niobium affected on relaxor behavior of barium bismuth titanate ceramics. ► The conductivity change was noticed in doped samples. -- Abstract: BaBi4Ti4–5/4xNbxO15 (BBNTx, x = 0, 0.05, 0.15, 0.30) ceramics have been prepared by solid state method. XRD data indicate the formation of single-phase-layered perovskites for all compositions. SEM micrographs suggest that the grain size decreases with Nb doping. The effect of niobium doping on the dielectric and relaxor behavior of BaBi4Ti4O15 ceramics was investigated in a wide range of temperatures (20–777 °C) and frequencies (1.21 kHz to 1 MHz). Nb doping influences Tc decrease as well as the decrease of dielectric permittivity at Curie temperature. At room temperature, undoped BaBi4Ti4O15 exhibits dielectric constant of ∼204 at 100 kHz, that slightly increases with Nb doping. The conductivity of BBNT5 ceramics is found to be lower than that of other investigated compositions. The value of activation energy of σDC was found to be 0.89 eV, 1.01 eV, 0.93 eV and 0.71 eV for BBT, BBNT5, BBNT15 and BBNT30, respectively.

  14. Electrical properties of niobium doped barium bismuth-titanate ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Bobić, J.D., E-mail: jelenabobic@yahoo.com [Institute for Multidisciplinary Researches, Belgrade University, Kneza Viseslava 1, Belgrade (Serbia); Vijatović Petrović, M.M. [Institute for Multidisciplinary Researches, Belgrade University, Kneza Viseslava 1, Belgrade (Serbia); Banys, J. [Faculty of Physics, Vilnius University, 9 Sauletekio Str., Vilnius (Lithuania); Stojanović, B.D. [Institute for Multidisciplinary Researches, Belgrade University, Kneza Viseslava 1, Belgrade (Serbia)

    2012-08-15

    Highlights: ► Pure and doped BaBi{sub 4}Ti{sub 4}O{sub 15} were prepared via the solid-state reaction method. ► The grain size was suppressed in Nb-doped samples. ► The diffuseness of the dielectric peak increased with dopant concentration. ► Niobium affected on relaxor behavior of barium bismuth titanate ceramics. ► The conductivity change was noticed in doped samples. -- Abstract: BaBi{sub 4}Ti{sub 4–5/4x}Nb{sub x}O{sub 15} (BBNTx, x = 0, 0.05, 0.15, 0.30) ceramics have been prepared by solid state method. XRD data indicate the formation of single-phase-layered perovskites for all compositions. SEM micrographs suggest that the grain size decreases with Nb doping. The effect of niobium doping on the dielectric and relaxor behavior of BaBi{sub 4}Ti{sub 4}O{sub 15} ceramics was investigated in a wide range of temperatures (20–777 °C) and frequencies (1.21 kHz to 1 MHz). Nb doping influences T{sub c} decrease as well as the decrease of dielectric permittivity at Curie temperature. At room temperature, undoped BaBi{sub 4}Ti{sub 4}O{sub 15} exhibits dielectric constant of ∼204 at 100 kHz, that slightly increases with Nb doping. The conductivity of BBNT5 ceramics is found to be lower than that of other investigated compositions. The value of activation energy of σ{sub DC} was found to be 0.89 eV, 1.01 eV, 0.93 eV and 0.71 eV for BBT, BBNT5, BBNT15 and BBNT30, respectively.

  15. EPR dosimetric properties of nano-barium sulfate

    International Nuclear Information System (INIS)

    Nano/micro BaSO4 were prepared through the co-precipitation method to measure ionizing radiation doses using electron paramagnetic resonance (EPR). The nano-BaSO4 sample was characterized using X-ray diffraction (XRD), and transmission electron microscopy (TEM) techniques. The dose response and fading properties of nano- and micro-phase BaSO4 were compared in EPR spectra. The prepared nano- and micro-BaSO4 samples have the same hole and electron centers, which may be attributed to SO4− and SO3−, respectively. The dosimetric signals for prepared nano- and micro-BaSO4 have spectroscopic splitting factor (g) with values 2.0025±0.0006 and 2.0027±0.0006, respectively. The nanocrystalline sample has a linear γ-ray dose response over the range 0.4 Gy–1 kGy. The performance parameters which including detection limit and critical level calculated from weighted and unweighted least-squares fitting. The sensitivity of nano-BaSO4 to γ-ray is one and a half times more than alanine. The lifetime and activation energy for nano-BaSO4 were estimated by conducting a thermal stability study, and were 5.7±1.1×104 years and 0.73±0.14 eV, respectively. The combined and expanded uncertainties accompanying measurements were ±3.89% and ±7.78%, respectively. - Highlights: • Preparation of nano-BaSO4 using the co-precipitation method. • Study of the dosimetric properties of nano-barium sulfate using the EPR technique. • Comparison between a new EPR dosimeter using nano-materials and standard alanine. • Calculation of the uncertainty budget for nano-BaSO4

  16. Radiation doses to children during modified barium swallow studies

    Energy Technology Data Exchange (ETDEWEB)

    Weir, Kelly A. [University of Queensland, Discipline of Paediatrics and Child Health, School of Medicine, Herston, Queensland (Australia); McMahon, Sandra M. [SpeechNet Speech Pathology Services, Brisbane (Australia); Long, Gillian; Bunch, Judith A. [Royal Children' s Hospital, Department of Medical Imaging, Herston (Australia); Pandeya, Nirmala [Queensland Institute of Medical Research, Herston (Australia); Coakley, Kerry S. [Biomedical Technology Services, Royal Brisbane and Women' s Hospital, Herston (Australia); Chang, Anne B. [Royal Children' s Hospital, Department of Respiratory Medicine, Herston (Australia)

    2007-03-15

    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 {+-} 0.0544 mSv, screening time 2.48 {+-} 0.81 min, and DAP 28.79 {+-} 41.72 cGy cm{sup 2}. Significant differences were found across three age groups ({<=}1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P = 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)

  17. Radiation doses to children during modified barium swallow studies

    International Nuclear Information System (INIS)

    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 ± 0.0544 mSv, screening time 2.48 ± 0.81 min, and DAP 28.79 ± 41.72 cGy cm2. Significant differences were found across three age groups (≤1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)

  18. TWO BARIUM STARS IN THE OPEN CLUSTER NGC 5822

    International Nuclear Information System (INIS)

    Open clusters are very useful examples to explain the constraint of the nucleosynthesis process with the luminosities of stars because the distances of the clusters are better known than those of field stars. We carried out a detailed spectroscopic analysis to derive the chemical composition of two red giants in the young open cluster NGC 5822, NGC 5822-2, and NGC 5822-201. We obtained abundances of C, N, O, Na, Mg, Al, Ca, Si, Ti, Ni, Cr, Y, Zr, La, Ce, and Nd. The atmospheric parameters of the studied stars and their chemical abundances were determined using high-resolution optical spectroscopy. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. The abundances of the light elements were derived using the spectral synthesis technique. We found that NGC 5822-2 and -201 have, respectively, a mean overabundance of the elements created by the s-process, ''s'', with the notation [s/Fe] of 0.77 ± 0.12 and 0.83 ± 0.05. These values are higher than those for field giants of similar metallicity. We also found that NGC 5822-2 and -201 have, respectively, luminosities of 140 L☉ and 76 L☉, which are much lower than the luminosity of an asymptotic giant branch star. We conclude that NGC 5822-2 and NGC 5822-201 are two new barium stars first identified in the open cluster NGC 5822. The mass transfer hypothesis is the best scenario to explain the observed overabundances

  19. Synthesis and thermionic properties of tungsten–barium titanate composites

    International Nuclear Information System (INIS)

    Highlights: • W–BaTiO3 composites were readily synthesized using standard sintering methods. • Compositions in the range 20–80% by mass were studied. • The microstructure of the composites comprises W, BaTiO3, Ba4Ti12O27 and BaW04. • The Richardson work function was reduced from 4.5 eV for W to as little as 2.67 eV. • Post-emission surfaces were coated in a thin layer of Ba4Ti12O27 and BaW04. - Abstract: The potential of novel tungsten–barium titanate composites as thermionic emitters is explored. Composites ranging from 20% to 80% tungsten by mass were prepared by sintering in an Ar–H2 atmosphere. XRD and SEM studies indicate four major micro-constituents; W, BaTiO3, Ba4(Ti,Fe)12O27 and BaWO4. Richardson work functions (φR) and Richardson constants (AR) were determined using a Schottky diode arrangement at temperatures ranging from 1223 to 1473 K. Work functions ranged from 2.67 eV to 3.32 eV with a shallow minimum at 40% by mass W and were relatively constant (∼2.7–2.8 eV) in the range 30–70% by mass W. The decrease in work function was accompanied by a strong decrease in AR from 39.3 A cm−2 K−2 to 0.02 A cm−2 K−2 over the range 20–70% by mass W. The reduction in both φR and AR was associated with the major conversion of the surface to BaWO4 and Ba4Ti12O27 during the activation treatment before emission testing

  20. TWO BARIUM STARS IN THE OPEN CLUSTER NGC 5822

    Energy Technology Data Exchange (ETDEWEB)

    Katime Santrich, O. J.; Pereira, C. B.; De Castro, D. B., E-mail: osantrich@on.br, E-mail: claudio@on.br, E-mail: denise@on.br [Observatorio Nacional/MCT, Rua Gen. Jose Cristino, 77, 20921-400 Rio de Janeiro (Brazil)

    2013-08-01

    Open clusters are very useful examples to explain the constraint of the nucleosynthesis process with the luminosities of stars because the distances of the clusters are better known than those of field stars. We carried out a detailed spectroscopic analysis to derive the chemical composition of two red giants in the young open cluster NGC 5822, NGC 5822-2, and NGC 5822-201. We obtained abundances of C, N, O, Na, Mg, Al, Ca, Si, Ti, Ni, Cr, Y, Zr, La, Ce, and Nd. The atmospheric parameters of the studied stars and their chemical abundances were determined using high-resolution optical spectroscopy. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. The abundances of the light elements were derived using the spectral synthesis technique. We found that NGC 5822-2 and -201 have, respectively, a mean overabundance of the elements created by the s-process, ''s'', with the notation [s/Fe] of 0.77 {+-} 0.12 and 0.83 {+-} 0.05. These values are higher than those for field giants of similar metallicity. We also found that NGC 5822-2 and -201 have, respectively, luminosities of 140 L{sub Sun} and 76 L{sub Sun }, which are much lower than the luminosity of an asymptotic giant branch star. We conclude that NGC 5822-2 and NGC 5822-201 are two new barium stars first identified in the open cluster NGC 5822. The mass transfer hypothesis is the best scenario to explain the observed overabundances.

  1. Pollution of drug-technical materials by cesium-137

    International Nuclear Information System (INIS)

    Drug-technical raw materials are medicinal plants (flowers, folium, grasses, mushrooms, roots, fruits, berry, kidney, cortex), used in pharmacy. To limit receipt cesium-137 in people body in 1993 in the Republic of Belarus were created 'Temporary permission levels of the cesium-137 radionuclides contents in drug-technical raw materials' were created (TPL-1993). The permission levels of cesium-137 are following: for drug-technical raw material (flowers, folium, grass, mushrooms, roots and other plants parts) - 1850 Bq/kg, for dried up fruits and berries - 2590 Bq/kg. (Author)

  2. The β decay of tellurium 135 and 137

    International Nuclear Information System (INIS)

    Tellurium 135 and 137 nuclei were produced in thermal neutron fission of 235U separated by on-line isotope separator and deposited on a movable tape. Gamma ray singles, γ-γ, β-γ coincidences and time sequenced γ spectra were collected using Ge(Li) detectors and scintillator (NE 102 A) telescope. The half-lives and mass excesses of 135Te and 137Te were measured and level schemes of 135I and 137I have been established. The level scheme of 135I has been compared to different shell model calculations

  3. 137Cs contaminated waste disposal in cement factory: Environmental problems

    International Nuclear Information System (INIS)

    In the course of utilization (May-June '91) of aluminum slags polluted by 137Cs at the cement factory Presacementi in Robilante (Cuneo, Italy) and during the following months, samples were taken in particular points of the plant, at fixed frequencies. Samples were analyzed to determine 137Cs concentration. Collected data were used to study the behaviour of the element throughout the process. Emissions and ground level air concentrations were estimated from the available data. Contamination of the manufactured cement were monitored until negligible values of 137Cs concentration were attained

  4. Cesium-137 seasonal balance in the Nemuna River, Lithuania

    International Nuclear Information System (INIS)

    Seasonal variations of 137Cs outflow to the Curonian Gulf from the Nemunas-Neris waters were studied under the non-typical climate conditions of 1996. 137Cs accumulation dominated in the total annual balance of this nuclide in the Nemunas-Neris water system, since high concentrations were characteristic only in the spring flood season. The removal of 137Cs from the Nemunas-Neris River bed was the main process in autumn and winter. Presented data indicate the main inputs and outputs of radioactive pollution in the main water system of Lithuania and show that radionuclide input to Lithuania from Belarus is still important. (author)

  5. Study of precipitation processes of strontium and barium nitrates in mixtures of water-with dimethylformamide and dimethylsulfoxide

    International Nuclear Information System (INIS)

    The investigation into phase equilibriums diagrams in the barium (strontium) nitrate-water-dimethylsulfoxide and barium nitrate-water dimethylformamide systems has been pursued at 298, 15 K for the estimation of outlook for use of mixed aqua-organic solvents during the production of mixture form high temperature superconductors by means of coprecipitation or crystallization. 4 refs., 3 figs., 2 tabs

  6. Chlorides retention of barium and chromium in two mangrove species Avicennia germinans and Rhizophora mangrove, developed in waters of the oil industry production, by means of the technique of hydroponics cultivation

    International Nuclear Information System (INIS)

    The objective of the present study was to determine the phytoremediation mechanism (phytoextraction y/o rhizofiltration) given by the mangroves Rhizophora mangle and Avicennia germinans, when exposed to waters from an oil production field applying the hidroponia technique like system for growing the species. Determination of chlorides, barium and chromium bioaccumulation in tissues of mangrove species under study was compared with content of these elements in an inert substrate without mangroves. Bioaccumulation of the targeted elements was measured after 308 days exposure of the mangroves to production waters with initial barium and chromium contents of 1.25 g.m-3 and 0.002 g.m-3 respectively, and salinity in the range of 2,000 to 3,000 mg.kg-1. Bioaccumulation of the studied elements (chlorides, barium and chromium) in tissues of both species was correlated to the increment in biomass of each species, as well as to the general physical condition of the plants. Survival rates higher than 95% of the exposed plants to production water during the time of study, increment in biomass of up to 5.88 g.day-1, and concentrations of chlorides in tissues in the 0 - 170,000 mg.kg-1 during the considered period were observed. No significant difference between the two mangrove species was obtained. Bioaccumulation in tissues does not cause symptoms of deficiency in growing rates in the studied plants compared to natural rate indexes. Similarly, the analyses of inert substrate around the mangrove roots showed chloride and barium concentrations, contrary to the results of the targeted elements in the inert substrate when mangroves are not present. Both phytoremediation mechanisms were observed for the two mangrove species

  7. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    CERN Document Server

    Mong, B; Walton, T; Chambers, C; Craycraft, A; Benitez-Medina, C; Hall, K; Fairbank, W; Albert, J B; Auty, D J; Barbeau, P S; Basque, V; Beck, D; Breidenbach, M; Brunner, T; Cao, G F; Cleveland, B; Coon, M; Daniels, T; Daugherty, S J; DeVoe, R; Didberidze, T; Dilling, J; Dolinski, M J; Dunford, M; Fabris, L; Farine, J; Feldmeier, W; Fierlinger, P; Fudenberg, D; Giroux, G; Gornea, R; Graham, K; Gratta, G; Heffner, M; Hughes, M; Jiang, X S; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krucken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Moore, D; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Retiere, F; Rowson, P C; Rozo, M P; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Twelker, K; Vuilleumier, J -L; Walton, J; Weber, M; Wen, L J; Wichoski, U; Yang, L; Yen, Y -R; Zhao, Y B

    2014-01-01

    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fluorescence quantum efficiency of the principal Ba emission transition are reported. Under current conditions, an image of $\\le10^4$ Ba atoms can be obtained. Prospects for imaging single Ba atoms in solid xenon are discussed.

  8. Synthesis and Characterization of Barium-Vanadium Oxide Nanocomposite Using a Facile thermolysis Approach

    Directory of Open Access Journals (Sweden)

    Niloufar Akbarzadeh-T

    2015-12-01

    Full Text Available In this investigation, we report synthesis of new cationic-anionic Barium-Vanadium complex with 2, 6- pyridinedicarboxylic acid ligand. This compound [Ba(H2O8][VO2(dipic]2(1 has been characterized using elemental analyses, FT-IR, UV–Vis and Cyclic voltammetry (CV techniques. Also in this study we report facile synthesis of Barium-Vanadium Oxide nanoparticle under thermal decomposition, using precursor complex (1. Characterization of Barium-Vanadium Oxide nanocomposites was carried out by scanning electron microscopy (SEM, energy dispersive X-ray analysis (EDX, X-ray powder diffraction (XRD and Fourier transform infrared (FT-IR spectroscopy. The X-ray diffraction pattern at room temperature revealed that, highly pure and crystallized Ba3(VO42 with rhombohedral structure.

  9. CuO and Ag2O effect on electrical properties of barium vanadate glasses

    International Nuclear Information System (INIS)

    Effect of CuO on barium vanadate glass (BVG) conductivity on direct and alternating currents in the frequency range (102-104)Hz has been studied. Effect of Ag2O has been also studied for comparison, as Ag and Cu have idendical structure of external electron shells (d10, S1). CuO introduction to binary barium vanadate glasses as a modificator results in the conductivity improvement on direct and alternating currents conditioned with reducing activation energy of small radius polaron jump, apparently, owing to exchange (ferromagnetic) interaction between V(IV) and Cu(II). Jump activation energy in barium vanadate glasses with Ag2O increases and conductivity drops due to the distance increase between vanadium atoms

  10. The review of various synthesis methods of barium titanate with the enhanced dielectric properties

    Science.gov (United States)

    More, S. P.; Topare, R. J.

    2016-05-01

    The Barium Titanate is a very well known dielectric ceramic belongs to perovskite structure. It has very wide applications in the field of electronic, electro ceramic, electromechanical and electro-optical applications. Barium Titanate has very high dielectric constant as well as low dielectric loss. Substituted dielectrics are one of the most important technological compounds in modern electro ceramics. Its electrical properties can be tuned flexibly by a simple substitution technique. This has encouraged researchers to select a typical cation to be substituted at cationic sites. In the present paper, the review of various synthesis methods of Barium Titanate compound with the effect of different dopants, the grain size on the dielectric properties at various temperatures is discussed.

  11. Plasma irregularities caused by cycloid bunching of the CRRES G-2 barium release

    Science.gov (United States)

    Bernhardt, P. A.; Huba, J. D.; Pongratz, M. B.; Simons, D. J.; Wolcott, J. H.

    1993-01-01

    The Combined Release and Radiation Effects Satellite (CRRES) spacecraft carried a number of barium thermite canisters for release into the upper atmosphere. The barium release labeled G-2 showed evidence of curved irregularities not aligned with the ambient magnetic field B. The newly discovered curved structures can be explained by a process called cycloid bunching. Cycloid bunching occurs when plasma is created by photoionization of a neutral cloud injected at high velocity perpendicular to B. If the injection velocity is much larger than the expansion speed of the cloud, the ion trail will form a cycloid that has irregularities spaced by the product of the perpendicular injection speed and the ion gyroperiod, Images of the solar-illuminated barium ions are compared with the results of a three-dimensional kinetic simulation. Cycloid bunching is shown to be responsible for the rapid generation of both curved and field-aligned irregularities in the CRRES G-2 experiment.

  12. Highly aligned arrays of high aspect ratio barium titanate nanowires via hydrothermal synthesis

    International Nuclear Information System (INIS)

    We report on the development of a hydrothermal synthesis procedure that results in the growth of highly aligned arrays of high aspect ratio barium titanate nanowires. Using a multiple step, scalable hydrothermal reaction, a textured titanium dioxide film is deposited on titanium foil upon which highly aligned nanowires are grown via homoepitaxy and converted to barium titanate. Scanning electron microscope images clearly illustrate the effect the textured film has on the degree of orientation of the nanowires. The alignment of nanowires is quantified by calculating the Herman's Orientation Factor, which reveals a 58% improvement in orientation as compared to growth in the absence of the textured film. The ferroelectric properties of barium titanate combined with the development of this scalable growth procedure provide a powerful route towards increasing the efficiency and performance of nanowire-based devices in future real-world applications such as sensing and power harvesting

  13. TiO2 ceramic varistor modified with tantalum and barium

    International Nuclear Information System (INIS)

    The non-linear current (I)-voltage (V) characteristics of titanium dioxide doped with small quantities of tantalum and barium (99.9 TiO2 + 0.1 Ta and 99.4 TiO2 + 0.1 Ta + 0.5 Ba, all are in at.%) were investigated. These samples have the non-linear coefficient (α) values of (20-30) with high breakdown voltages (E B ∼ 400-700 V mm-1). The pentavalent tantalum acts as donor and increases the electronic conductivity. The higher electrical conductivity and decrease in the breakdown field strength with barium addition is attributed to higher density. The acceptor like surface states formed by barium ions segregate to grain boundaries due size misfit to thereby modifying the electrical barrier characteristics of grain boundaries

  14. Prompt ionization in the CRIT II barium releases. [Critical Ionization Tests

    Science.gov (United States)

    Torbert, R. B.; Kletzing, C. A.; Liou, K.; Rau, D.

    1992-01-01

    Observations of electron and ion distributions inside a fast neutral barium jet in the ionosphere show significant fluxes within 4 km of release, presumably related to beam plasma instability processes involved in the Critical Ionization Velocity (CIV) effect. Electron fluxes exceeding 5 x 10 exp 12/sq cm-str-sec-keV were responsible for ionizing both the streaming barium and ambient oxygen. Resulting ion fluxes seem to be consistent with 1-2 percent ionization of the fast barium, as reported by optical observations, although the extended spatial distribution of the optically observed ions is difficult to reconcile with the in situ observations. When the perpendicular velocity of the neutrals falls below critical values, these processes shut off. Although these observations resemble the earlier Porcupine experimental results (Haerendel, 1982), theoretical understanding of the differences between these data and that of earlier negative experiments is still lacking.

  15. Unexpected finding of barium sulphate on the surface of a microspinal catheter

    International Nuclear Information System (INIS)

    During a study with a scanning electron microscope to evaluate the structure of microspinal catheter after its removal from subarachnoid space, we found an unusual case. The observation with the microscope of the tip of a catheter removed at the end of an operation for hip replacement in a old female showed the presence of grounded particles with a crystal shape covering the outer surface. Further analysis of this material with an Energy-Dispersive Spectrometer (EDS) showed that it was barium. The patient performed a large bowel barium enema 8 months earlier for a painful syndrome to the lower abdomen. Authors rule out the contamination from the skin and suggest two possible mechanisms of passage of barium from blood to cerebrospinal fluid (CSF) and so to the surface of the catheter

  16. Barium sulphate preparations for use in double contrast examination of the upper gastrointestinal tract

    International Nuclear Information System (INIS)

    Physical properties relevant to upper gastrointestinal radiology have been compared for five barium sulphate preparations and related to radiographic results. Evaluation of particles (size and stability) and whole suspension (dispersibility and fluidity) resulted in ranking of the preparations generally in accord with that based on radiological experience in double contrast examinations of the stomach. Experiments with extirpated pig stomach revealed a tendency for large particles in a low viscosity barium sulphate suspension to settle in mucosal grooves. This is believed to contribute to good radiographic definition of both the areae gastricae and small lesions. Particle size is therefore important and susceptibility to flocculation, a possible cause of random change in size during use, was assessed by measuring particle electrophoretic mobility under varying conditions; quantitative differences in suspension flow and dispersibility were also demonstrated. Fluidity and dispersibility together with rapid sedimentation of suitably sized particles resistant to flocculation underlie the successful use of low viscosity high density barium sulphate suspensions. (U.K.)

  17. Barium and strontium sulfate solid solution formation in relation to North Sea scaling problems

    International Nuclear Information System (INIS)

    This paper presents the results of laboratory experiments carried out to investigate barium sulphate and strontium sulphate solid solution formation in multi-pressure tapped cores. Two brines, one barium and strontium rich and the other sulphate rich, were mixed in a core plug. Pressure differentials were measured and the changing permeability distribution along the length of the core calculated. The morphology and chemical analysis of scaling crystals are presented based on Scanning electron Microsocpy (SEM) and Energy Dispersive X-ray Analysis (EDAX). The results show the large extent of permeability damage caused by (Ba, SR) SO/sub 4/ solid solution depositing on the rock pore surface. The rock permeability decline and morphology and size of the scaling crystals indicate the influence of the supersaturations of BaSO/sub 4/ and SrSO/sub 4/ as well as the concentration ratio of barium ions to strontium ions

  18. Use of the barium enema in the diagnosis of necrotizing enterocolitis

    Energy Technology Data Exchange (ETDEWEB)

    Uken, P.; Smith, W.; Franken, E.A.; Frey, E.; Sato, Y.; Ellerbroek, C.

    1988-01-01

    Necrotizing enterocolitis (NEC) is associated with considerable morbidity and mortality in infants. The diagnosis relies heavily upon radiographic and clinical features. Failure to accurately diagnose NEC is associated with a risk of complications and death, however overdiagnosis also causes both morbidity and mortality as well as excessive medical costs. This report documents the use of barium enema to evaluate suspected clinical or radiographic NEC in 31 premature infants with ambiguous clinical and radiographic signs. The enema was normal in 26 infants and no treatment for NEC was given. Only one of these infants developed signs of NEC subsequent to the examination. Five infants had radiographic evidence of colitis including small ulcerations, spasm, intramural extravasation of barium and mucosal irregularity. Two of the five positive cases are pathologically documented. The barium enema can represent a significant improvement in the specificity of the diagnosis of NEC. Its greatest value is in the exclusion of NEC in ambiguous cases.

  19. Preparation and characterization of ZnSn-substituted barium ferrite thin films

    International Nuclear Information System (INIS)

    The preparation of ZnSn-substituted barium ferrite films by sputtering deposition was studied. The as-sputtered films were amorphous, and annealing at a minimum of 750 oC was required to crystallize the films, based on the X-ray diffraction analysis and the magnetic measurements. Scanning electron microscopy combined with energy-dispersive X-ray spectroscopic microanalysis confirmed that the films were single phase with the composition BaZnxSnxFe12-2xO19, x=0.2-0.3, and their thicknesses were 0.4-1.0 μm when annealed at 750-900 oC. Atomic and magnetic force microscopy studies showed no significant grain growth upon annealing and that the films consisted of single-domain grains forming interaction-cluster-type domains. The natural ferromagnetic resonance frequency was determined at around 4 GHz, together with substantial magnetic losses that make these films promising candidates for microwave absorbers. - Research highlights: → ZnSn-substituted barium ferrite films can be prepared with a sputtering-deposition followed by annealing at 750-900 oC. → The ZnSn-substituted barium ferrite films consist from magnetically coupled single-domain grains. → The ZnSn-substitution in barium ferrite films reduces the ferromagnetic resonance from 48 to 4 GHz. → The ZnSn-substituted barium ferrite films show large magnetic losses at 7-15 GHz. → The ZnSn-substituted barium ferrite films are suitable for microwave absorbers.

  20. 1-3-7 minute intravenous urography

    Energy Technology Data Exchange (ETDEWEB)

    Bahk, Yong Whee; Yoon, Sei Chul; Lee, Myung Hee [Catholic Medical College, Seoul (Korea, Republic of)

    1980-12-15

    Intravenous urography (IVU) as it is used widely today was probably started in early 1950's after the introduction of triiodobenzoic acid compounds as contrast media. This long cherished traditional method consists of taking radiograms at 5, 15 and 25 minutes after the injection of contrast medium. There are a few modifications of this standard urographic examination such as five minute IVU (Woodruff, 1959), minute-sequence pyelogram (Maxwell et al., 1964), drip infusion pyelography (Schencker, 1964) and nephrotomography (Evans et al., 1955). The present study has been undertaken to test if the conventional standard IVU can be more rapidly performed without losing essential informational contents of urograms. In this new clinical trial, urograms were taken at the end of 1, 3 and 7 minutes instead of 5, 15 and 25 minutes after the intravenous injection of contrast medium. We injected 40 ml of meglumine diatrizoate solution within 30 seconds using an 18G iv needle. (The amount of injected contrast medium has been reduced recently to ordinary single dose of 20 ml for subjects weighing less than 8 kg). Upon viewing the 7 minute film in front of an automatic processor, the examination was terminated after obtaining an upright view unless any further radiogram was indicated. As shown in Tables and Figures, our new 1-3-7 minute method has been proven to provide us with as much essential and useful information as conventional 5-15-25 minute urography. Thus, we were able to finish one examination within 10 minutes without losing any necessary diagnostic information. In some of patients with obstructive uropathy such as stone the examination was extended as long as it was desired. Side reactions were occasional nausea, flushing and rare mild vomiting which never prevented the examination.

  1. Barium hydrogen phosphate/gelatin composites versus gelatin-free barium hydrogen phosphate: synthesis and characterization of properties.

    Science.gov (United States)

    Gashti, Mazeyar Parvinzadeh; Burgener, Matthias; Stir, Manuela; Hulliger, Jürg

    2014-10-01

    Recently, attention has been spent on crystal growth of phosphate compounds in gels for studying the mechanism of in vitro crystallization processes. Here, we present a gel-based approach for the synthesis of barium hydrogen phosphate (BHP) crystals using single and double diffusion techniques in gelatin. The composite crystals were compared with analytical grade BHP powder, single and polycrystalline BHP materials using Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), scanning pyroelectric microscopy (SPEM), optical microscopy (OM), thermal gravimetric analysis (TGA) and X-ray diffraction (XRD). FTIR spectra showed surface adsorption of gelatin molecules by using BHP stacked sheets due to CH2 stretching, CH2 bending and amide I vibrations are found in a gelatin content of about 2% determined by dissolution. SEM shows various crystal morphologies of the BHP/gelatin composites forming bundled micro-flakes to irregular bundled needles and spheres different from gel-free crystals. The variety in morphology depends on the ion concentration, pH of gel as well as the method of crystal growth. SPEM investigation of BHP/gelatin aggregates revealed polar domains showing alteration of the polarization. Moreover, BHP/gelatin composite crystals showed a higher thermal stability in comparison with analytical grade BHP or/and BHP single crystals due to strong interactions between gelatin and BHP. The XRD diffraction analysis demonstrated that the single and double diffusion techniques in gelatin led to the formation of orthorhombic BHP. This study demonstrates that gelatin is a useful high molecular weight biomacromolecule for controlling the crystallization of a composite material by producing a variety of morphological forms. PMID:24996024

  2. Magnetic properties of barium ferrite dispersed within polystyrene-butadiene-styrene block copolymers.

    Science.gov (United States)

    Chipara, M; Skomski, R; Ali, N; Hui, D; Sellmyer, D J

    2009-06-01

    Magnetic properties of nanocomposite materials obtained by dispersing barium ferrite nanoparticles within polystyrene-butadiene-styrene block copolymer, in the temperature range, 300 to 500 K are reported. The temperature dependence of the magnetization at saturation, averaged uniaxial magnetocrystalline anisotropy, and coercive field of thick films are analyzed. A "matrix effect" was noticed within the glass transition range of the hard component (polystyrene) of the polymeric matrix. The reported modifications of the magnetic properties were assigned to the competition between the magnetic and mechanical reorientation of nanoparticles within the polymeric matrix. Such modifications were not observed in barium ferrite dispersed in cement. PMID:19504902

  3. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate

    Indian Academy of Sciences (India)

    P Sarah; S V Suryanarayana

    2003-12-01

    Piezoelectric 3–0 composite ceramics are prepared from a mixture of barium titanate and lithium ferrite phase constituents. Dielectric properties of composites are affected by a number of parameters that include electrical properties, size, shape and amount of constituent phases. The frequency dependent measurements can provide additional insight into mechanisms controlling electrical response. Frequency dependence of dielectric constant plots of lithium ferrite/barium titanate composites will be given and the relevance of trends seen in them will be discussed. Connectivity in composites developed is studied.

  4. The structural properties of barium cobalt hexaferrite powder prepared by a simple heat treatment method

    Science.gov (United States)

    Chauhan, Chetna; Jotania, Rajshree

    2016-05-01

    The W-type barium hexaferrite was prepared using a simple heat treatment method. The precursor was calcinated at 650°C for 3 hours and then slowly cooled to room temperature in order to obtain barium cobalt hexaferrite powder. The prepared powder was characterised by different experimental techniques like XRD, FTIR and SEM. The X-ray diffractogram of the sample shows W-and M phases. The particle size calculated by Debye Scherrer formula. The FTIR spectra of the sample was taken at room temperature by using KBr pallet method which confirms the formation of hexaferrite phase. The morphological study on the hexaferrite powder was carried out by SEM analysis.

  5. Growth conditions effect on growth strips in barium-strontium niobate crystals

    International Nuclear Information System (INIS)

    The growth bands appeared due to a change of the instantaneous growth rate are studied in the crystals of solid solution of barium and strontium niobates obtained by the method of Chokhral'skii. Instability of thermal conditions in the crystallization front leading to a change of the instantaneous growth rate is caused by several factors: insufficient accuracy in keeping the operating temperature, the presence of convection, displacement of crystallization front in an inhomogeneous thermal field, for instance when crystal rotates. Considered are the ways of diminiching the temperature vibrations in a melt and found are the conditions for obtaining optically homogeneous monocrystals of barium-strontium niobate

  6. Barium meal examination of infants under four months of age presenting with vomiting

    International Nuclear Information System (INIS)

    One hundred barium meal examinations performed on infants of less than 4 months of age are reviewed. All the infants presented with vomiting as a major symptom and the diagnosis remained in doubt following the initial clinical assessment. Fifty seven per cent of the examinations showed an abnormality of which 45% were throught to be significant. Hypertrophic pyloric stenosis was demonstrated in 23 infants. Other abnormalities included hiatus hernia, gastrooesophageal reflux, and duodenal abnormalities. The value of barium meal examinations in this group of infants is emphasised. (orig.)

  7. Barium meal examination of infants under four months of age presenting with vomiting

    Energy Technology Data Exchange (ETDEWEB)

    Arthur, R.J.; Ziervogel, M.A.; Azmy, A.F.

    1984-02-01

    One hundred barium meal examinations performed on infants of less than 4 months of age are reviewed. All the infants presented with vomiting as a major symptom and the diagnosis remained in doubt following the initial clinical assessment. Fifty seven per cent of the examinations showed an abnormality of which 45% were throught to be significant. Hypertrophic pyloric stenosis was demonstrated in 23 infants. Other abnormalities included hiatus hernia, gastrooesophageal reflux, and duodenal abnormalities. The value of barium meal examinations in this group of infants is emphasised.

  8. Temperature-Dependent Raman Spectra and Microstructure of Barium Metaborate Crystals and Its Melts

    Institute of Scientific and Technical Information of China (English)

    尤静林; 蒋国昌; 侯怀宇; 吴永全; 陈辉; 徐匡迪

    2002-01-01

    We have measured the Raman spectra of β- and α-barium metaborate in crystal and liquid states from room temperature to 1873K, with a semiconductor laser as the laser source, coupled with a time-resolved detection system to eliminate the dense thermal emission background when temperature was considerably high.Temperature-dependent Raman spectra can clearly indicate that the phase transformation from β- to α-barium metaborate has been completed during 1273 - 1300 K. Variations of different kinds of microstructure units with temperature are identified and discussed.

  9. Calcium barium niobate as a functional material for broadband optical frequency conversion.

    Science.gov (United States)

    Sheng, Yan; Chen, Xin; Lukasiewicz, Tadeusz; Swirkowicz, Marek; Koynov, Kaloian; Krolikowski, Wieslaw

    2014-03-15

    We demonstrate the application of as-grown calcium barium niobate (CBN) crystal with random-sized ferroelectric domains as a broadband frequency converter. The frequency conversion process is similar to broadband harmonic generation in commonly used strontium barium niobate (SBN) crystal, but results in higher conversion efficiency reflecting a larger effective nonlinear coefficient of the CBN crystal. We also analyzed the polarization properties of the emitted radiation and determined the ratio of d32 and d33 components of the second-order susceptibility tensor of the CBN crystal. PMID:24690779

  10. Chemical composition of nanomodified composite binder with nano- and microsized barium silicate

    Directory of Open Access Journals (Sweden)

    KOROLEV Evgenij Valerjevich

    2014-08-01

    Full Text Available There are several possibilities to improve cement-based binders. In particular, many properties of cement stone can be enhanced by means of micro- and nanoscale modification. In a number of previous works we had shown that application of barium hydrosilicates leads to such improvement. The present article is devoted to the investigation of the chemical composition of the cement stone which is modified by means of addition of barium hydrosilicates. The modification was performed on different scales: micro- and nanoscale; the results of simultaneous multi-scale modification are also presented. The examination was carried out with help of different modern research techniques – FT IR spectroscopy, differential thermal analysis and X-ray phase analysis. Identification of the new phases and comparative quantitative assessment of their content are performed. It is found that the use of nano- and micro-sized barium hydrosilicates as additives leads to reduction of portlandite by 27...28%; by means of multi-scale modification it is possible to reduce the content of portlandite much more (by 83.3%. Due to addition of nano- and micro-sized barium-based modifiers both the amount of calcium hydrosilicates in reaction products is enlarged, and structure of the mentioned hydrosilicates is changed (the formation of a fine-grained structure of hydration products takes place. Micro-sized barium hydrosilicates are chemically active additives and promote the formation of an additional quantity of calcium hydrosilicates of type CSH (I. The use of nanoscale barium hydrosilicates promotes the formation of CSH (I and CSH (II calcium hydrosilicates, and also both riversidite and xonotlite. As a result of simultaneous application of nano- and micro-sized barium hydrosilicates the content of CSH (II increases. This can be confirmed by means of differential thermal and X-ray analysis. The amount of CSH (I, riversidite and various tobermorites is also increases. It is

  11. Effects of oleic acid on the high threshold barium current in seabass Dicentrarchus labrax ventricular myocytes

    OpenAIRE

    Chatelier, Aurelien; Imbert, Nathalie; Zambonino, Jose-luis; McKenzie, David; Bois, P.

    2006-01-01

    The present study employed a patch clamp technique in isolated seabass ventricular myocytes to investigate the hypothesis that oleic acid (OA), a mono-unsaturated fatty acid, can exert direct effects upon whole-cell barium currents. Acute application of free OA caused a dose-dependent depression of the whole-cell barium current that was evoked by a voltage step to 0 mV from a holding potential of -80 mV. The derived 50% inhibitory concentration (IC50) was 12.49 +/- 0.27 mu mol l(-1). At a con...

  12. Synthesis, characterization and thermostability of barium β-diketonate with tetraethylenepentamine ligand

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    The metal-organic chemical vapor deposition (MOCVD) technique is a promising process for high-temperature superconductor YBa2Cu3O7-δ(YBCO) preparation. In this technique, it is a challenge to obtain barium precursors with high volatility. In addition, the purity, evaporation characteristics and thermostability of adopted precursors in the whole process would decide the quality and reproducible results of YBCO film. In the present report, the barium precursor containing 2,2,6,6-tetramethylheptane-3,5-dionate...

  13. The structural and magnetic properties of barium ferrite powders prepared by the sol-gel method

    Institute of Scientific and Technical Information of China (English)

    Li Jie; Zhang Huai-Wu; Li Yuan-Xun; Liu Ying-Li; Ma Yan-Bing

    2012-01-01

    In this paper,M-type hexagonal barium ferrite powders are synthesized using the sol-gel method.A dried precursor heated in air is analyzed in the temperature range from 50 to 1200 ℃ using thermo-gravimetric analysis and differential scanning calorimetry. The effects of the additives and the cacinating temperature on the magnetic properties are investigated,and the results show that single-phase barium ferrite powders can be formed. After heat-treating at 950 ℃ for 4h with 3 wt% additive,the coercivity and saturation magnetization are found to be 440 Oe and 57.9 emu/g,respectively.

  14. Features of Raman amplification in KGW and barium nitrate crystals at excitation by femtosecond pulses

    International Nuclear Information System (INIS)

    Measurements of Raman amplification in KGd(WO4)2 (KGW) and barium nitrate crystals at femtosecond excitation demonstrate spectral transformation of amplification band with change of pump parameters. The half-height amplification bandwidth of up to 45 nm (650 cm-1) what is 5 times larger than the pumping pulse spectral band 8.5 nm (130 cm-1) was observed for KGW crystal. Implementation of impulsive excitation for the low-frequency vibrations allows estimations of the dephasing times and linewidths for the 87 and 83 cm-1 Raman lines in KGW and barium nitrate

  15. Study of positive parity bands in 137Pr

    International Nuclear Information System (INIS)

    In this paper the analysis and interpretation of the positive parity states in 137Pr have been reported. The detailed interpretation with configuration assignments and the calculations for the bands will be reported

  16. Patterns of cesium-137 distribution across two disparate floodplains

    International Nuclear Information System (INIS)

    Soil 137Cs concentration was studied across upstream and downstream floodplain sites of Lower Three Runs Creek, an Upper Coastal Plain stream draining a portion of the Savannah River Plant. Soil samples were collected laterally and vertically at each floodplain location and analyzed for several edaphic characteristics. The results showed that these floodplains were differentiable by their edaphic characteristics both between sites and between depths within a site. The surface distribution of 137Cs was related to microtopographic variation at each site, but predictive relationships for estimating surface-soil 137Cs content from edaphic parameters were not as well defined. A difference in upstream to downstream 137Cs cycling was explained on the basis of the change from direct to indirect nutrient cycling pathways in a downstream direction. This change was coincident with higher sedimentation, greater cation adsorptive capacity, and higher potassium concentrations found downstream

  17. Accumulation of 137Cs in puddle sediments within urban ecosystem

    International Nuclear Information System (INIS)

    The role of puddle sediments as a final depot of 137Cs horizontal migration within the urban landscape is studied using the example of Ekaterinburg city, Russia. Radioactive contamination in the city appeared due to fallout after atmospheric testing of nuclear weapons and nuclear accidents. Contamination density of 137Cs in the region was assessed from archive data to be about 5.1 kBq/m2, of which the maximum activity concentration (137Cs activity concentration in puddle sediments of 80 Bq/kg, with a maximum value of 540 Bq/kg. It is estimated that horizontal migration has led to about a fourfold concentration of 137Cs in puddle sediments.

  18. Long-term behaviour of 137Cs in Finnish lakes

    International Nuclear Information System (INIS)

    Deposition of 137Cs from Chernobyl accident was unevenly distributed in Finland. This caused large variation to contents of 137Cs in freshwater fish in Finnish lakes. In the course of time environmental processes like runoff, water flow, hydrological cycling, sedimentation and chemical parameters as e.g., K of lake water, topography of the catchment affect the transfer of 137Cs in water sheds. Most of the Finnish lakes are deficient in nutrients and hence the accumulation of 137Cs into fishes is high. High amount of humic substances is also typical of Finnish lakes. About 6000 freshwater fish samples from 350 Finnish lakes have been analysed for 137Cs in 1986-2003. Sampling was focused on the central parts of Finland with highest deposition of 137Cs, but samples from other areas were also analysed. Large lakes, most important for freshwater fishing in Finland, and small oligotrophic lakes, in which the highest contents of 137Cs were expected to be found, were included in the study. Variation range of 137Cs in fish was still in 2003 large, from 5 Bq/kg to 5000 Bq/kg (fresh weight). Water samples from about 30 lakes were taken in 1998 and 2002 and analysed for 137Cs. Contents of 137Cs in lake waters varied then from 4 to 330 Bq/m3. During the first years after the deposition in 1986, the amount of the deposited 137Cs in the lake was the dominant factor on the distribution of 137Cs in fish and surface water. Later study on regional behaviour of 137Cs in fish revealed differences in decrease rates in the large drainage areas [2]. Temporal changes of 137Cs in water and especially in fish in individual lakes of various types, even in those located close to each other, differ still much. Transfer coefficients of 137Cs from the deposition to water, TFw (Bq/m3 in water/kBq/m2 deposited) of the lakes included in this study varied from 0,40 to 8,7 in 1998. Transfer factors from the deposition to various species of fish from various lakes, TFf (Bq/kg in fish / Bq/m2), varied

  19. {sup 137}Cs and {sup 210}Po in Pacific walrus and bearded seal from St. Lawrence Island, Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, Terry [Environmental Science Division, Lawrence Livermore National Laboratory, P.O. Box 808, Livermore, CA 94550-0808 (United States)], E-mail: hamilton18@llnl.gov; Seagars, Dana [US Fish and Wildlife Service, Marine Mammals Management Field Office, 1011 East Tudor Road, Anchorage, AK 99503 (United States); Jokela, Terry; Layton, David [Environmental Science Division, Lawrence Livermore National Laboratory, P.O. Box 808, Livermore, CA 94550-0808 (United States)

    2008-06-15

    The activity concentration of Cesium-137 ({sup 137}Cs) and naturally-occurring Polonium-210 ({sup 210}Po) were measured in the muscle tissue, kidney and liver of Pacific walrus (Odobenus rosmarus divergens) and bearded seal (Erignathus barbatus) collected by native hunters from the Bering Sea during May 1996. The mean {sup 137}Cs concentrations in muscle, liver and kidney of Pacific walrus were 0.07, 0.09 and 0.07 Bq kg{sup -1} (n = 5, wet weight), respectively, and 0.17, 0.10, and 0.17 Bq kg{sup -1} (n = 2, wet weight), respectively, in bearded seal. In general, {sup 137}Cs tissue concentrations are significantly lower than those previously reported for mammals from other regions. By comparison, {sup 210}Po activity concentrations are more variable and appear to be higher level compared with mammal data from other regions. The mean {sup 210}Po concentration in the muscle tissue, liver and kidney of Pacific walrus (n = 5, wet weight) were 28.7, 189, and 174 Bq kg{sup -1}, respectively. This compares with {sup 210}Po concentration values (n = 2, wet weight) of 27, 207 and 68 Bq kg{sup -1} measured in the muscle tissue, liver and kidney, of bearded seal, respectively. Estimated concentration factors-as defined by the radionuclide concentration ratio between the target tissue to that in sea water-were two to three orders of magnitude higher for {sup 210}Po that those of {sup 137}Cs. We conclude from radiological dose estimates that ingestion of {sup 137}Cs in foods derived from walrus and seal will pose no threat to human health. This work has important implications for assessment of risks of Alaskan coastal communities concerned about the dumping of nuclear waste in the Russia Arctic.

  20. Obsah Cs-137 v houbách

    OpenAIRE

    Čadová, Michaela

    2015-01-01

    The aim of this work is to compare the presence of Cs-137 in different kinds of mushrooms in selected locations using semiconductor gamma-ray spectrometry. Research question was determined: Does Cs-137 content amount vary depending on the fungal species? The first part deals with basic knowledge of ionizing radiation, which is important for the complex understanding of thematic problems. This concerns basic radiobiological terms such as radioactivity, ionizing radiation, its biological effect...

  1. /sup 137/Cs radioactive dating of Lake Ontario sediment cores

    Energy Technology Data Exchange (ETDEWEB)

    Ward, T.E.; Breeden, J.; Komisarcik, K.; Porter, R.; Czuczwa, J.; Kaminski, R.; McVeety, B.D.

    1987-12-01

    The distribution of /sup 137/Cs in sediment cores from Lake Ontario provides estimates of the sediment accumulation rates. Geochronology with /sup 210/Pb dating and distribution of Ambrosia (ragweed) pollen compare well with /sup 137/Cs dating. These methods can determine with precision, changes in sedimentation occurring over the past 100 years or so. Typical sedimentation rates of 0.18-0.36 cm/yr were measured. 16 refs., 3 figs., 2 tabs.

  2. 137Cs radioactive dating of Lake Ontario sediment cores

    International Nuclear Information System (INIS)

    The distribution of 137Cs in sediment cores from Lake Ontario provides estimates of the sediment accumulation rates. Geochronology with 210Pb dating and distribution of Ambrosia (ragweed) pollen compare well with 137Cs dating. These methods can determine with precision, changes in sedimentation occurring over the past 100 years or so. Typical sedimentation rates of 0.18-0.36 cm/yr were measured. 16 refs., 3 figs., 2 tabs

  3. Measurement of soil erosion from fallout of 137Cs

    International Nuclear Information System (INIS)

    The measurement of relative caesium-137 content in soil is a powerful tool for the estimation of contemporary erosion rates, especially on soils with consistent land use. Data from runoff plots gave the relationship Y = 0.419 Xsup(0.646), where Y is the diminution in caesium-137 content expressed as a percentage of local input and X is the average soil loss in kg ha-1 y-1

  4. Migratory capacity of 137Cs in water-containing rocks

    International Nuclear Information System (INIS)

    The effects of a number of physicochemical and hydrogeologic factors (sorption capacity of rocks, mechanisms of cesium absorption by these, chemical composition of underground waters) on 137 Cs migration in the case of radioactive contamination of underground water in areas of location of atomic power stations have been studied. Approximate equations of ion-exchange sorption may be applied for predicting 137 Cs migration in rocks within the aeration zone and in water-bearing horizons

  5. Dicty_cDB: CFG137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFG137 (Link to dictyBase) - - - Contig-U15057-1 CFG137E (Link to Original ... complete sequence. 38 0.70 3 AF489932 |AF489932.1 Dengue ... Virus Type 2 strain BR64022, complete genome. 46 1 ... .2 1 AF100466 |AF100466.2 Dengue ... virus type 2 strain Mara4 polyprotein gene, comple ...

  6. Strontium-90 and cesium-137 in tea (Japanese tea)

    International Nuclear Information System (INIS)

    Sr-90 and Cs-137 in Japanese tea were determined using radiochemical analysis. Five hundred grams of manufactured green tea was collected from six sampling locations in June 1984, carbonized and ashed in a stainless steel pan or a porcelain dish. The maximum value of Sr-90 was 88+-3.7 pCi/kg in tea collected from Kyoto; the maximum value of Cs-137 was 99.0+-3.60 pCi/kg collected from Kagoshima. (Namekawa, K.)

  7. Estimation of erosion rate using natural isotop 137Cs

    International Nuclear Information System (INIS)

    The investigation of erosion rate using natural isotope 137Cs had been done in hilliness area at GOULBURN-NWS-Australia. The presentation of 137Cs in natural was as a result of nuclear weapon testing in the middle of 1950's. Fallout of 137Cs input, when it reached the ground, it rapidly adsorbed at the soil. 137Cs bind very strong at the fine soil, so it can be used as tracer in the study of soil movement. Soil samples were taken using coring device (di=10 cm, h=20 cm), and were brought to laboratorium for short commun analysis. The preparation are drying, weighing, crushing and sieving. The 137Cs content of fine samples that pass the 1 mm sieve were analyzed using gamma-spectrometer. The total erosion rate was calculate by ploting the 137Cs values in the topography map of study area. The result showed that erosion was very low, and total erosion rate is 130 kg/ha.y. (authors)

  8. Transfer of 137Cs through the food chain to man

    International Nuclear Information System (INIS)

    Deposition, concentrations in diet, and body burdens of 137Cs have been measured since 1954 at various sites throughout the world. This report is a compilation and updating of various fallout 137Cs measurements and an interpretation of transfer properties of 137Cs from deposition to diet and from diet to man. An empirical model is used to correlate deposition and diet data. Direct foliar contamination, stored food supplies, and uptake from soil contribute to the dietary levels of 137Cs. The accumulation of 137Cs by man is described by a single exponential model. The inferred biological half-times, 200 to 400 days, are somewhat greater than the half-time of about 100 days obtained from shorter term studies. Differences in body burdens due to sex, age, and weight are discussed. During the period 1954 to 1974, the internal dose from fallout 137Cs, based on average body burdens, is estimated to be 4 to 5 percent of the 21 year radiation dose from 40K

  9. Transfer of cesium-137 from pasture to milk after Chernobyl

    International Nuclear Information System (INIS)

    During 1986, the year of the Chernobyl accident, the Cs-137 activity concentration in the milk and pasture of some dairy farms in the northern part of the county of Uppsala was studied. In 1987, the transfer of Cs-137 from fodder to milk was investigated on 11 dairy farms in the northern part of the county during the first month on pasture. These farms had been studied also during a previous period when the cows were kept in the stable. In 1988, the transfer of Cs-137 from fodder to milk was followed intensively on 5 dairy farms in the same area during the first month on pasture. The Cs-137 activity concentration was measured continuously in feeds and milk during the study periods in 1987 and 1988. All feedstuffs fed in the stable were weighed twice a week, and the amount of forage grazed was calculated from the cows requirements of nutrients. Samples of all feed were taken for Cs-137 determination and chemical analyses. The transfer coefficient for 10 of the 11 dairy farms during the first month on pasture in 1987 was, on average, 0.005 d kg-1. The Cs-137 activity concentration was significantly lower in the milk of the farms studied during the first month on pasture in 1988 than during the same period in 1987. The mean transfer coefficient for 4 of the 5 dairy farms studied during the first month on pasture in 1988 was 0.007 d kg-1. (au) (27 refs.)

  10. Determination of erosion and accretion rates using caesium-137

    International Nuclear Information System (INIS)

    Within drainage basins, soil erosion status may be indicated by levels of absorbed 137Cs within the soil. Further refinements of the relationship between soil loss and 137Cs loss for various soil types, geographic locations for soils experiencing severe erosion will enable more accurate predictions of net soil loss rates to be made. For a long time quantification of sediment sources within catchments has been a difficulty for hydrogeomorphologists interpreting sediment outputs, and the 137Cs technique holds much promise for its resolution. Storage, another major component of the sediment budget, may also be quantified by 137Cs, provided careful sampling and interpretation are practised. Caesium-137 as a dating-tool is less useful at sites with low rates of sediment accumulation, ostensibly those unaffected by human activity in the catchment. The tracer 137Cs has become a well-established tool in sediment research in several countries. The provision of adequate detector facilities will ensure the further development of the technique in Australia, thus helping hydrogeomorphologists achieve the goal of predicting sediment delivery ratios and drainage basin sediment budgets with some certainty

  11. Cs-137 and Sr-90 level in diary products

    Science.gov (United States)

    Petukhov, V. L.; Gorb, T. S.; Petukhov, I. V.; Dukhanov, Yu. A.; Sevryuk, I. Z.; Patrashkov, S. A.; Korotkevich, O. S.

    2003-05-01

    About 70% of radioactive substances fell on the territory of the Byelorussia Republic after the Chernobyl Atom Power Station Disaster. Cs-137 and Sr-90 accumulation dynamics was studied in milk of the cows from the highest polluted Braginsky area. 408 milk samples of Black and White cows were investigated. In 1995 average Cs-137 and Sr-90 levels were 61.00 and 3.73 Bk/dm^3 respectively. Cs-137 and Sr-90 levels exceeded Byelorussia Republic upperlimits RDU 96 in 10 and 50% of milk samples respectively. After 5 years (by 2000) Cs-137 and Sr-90 levels had become almost 3 and 2 times less (21.70 Bk/dm^3 and 1.72 Bk/dm^3 respectively). Cs-137 and Sr-90 levels exceeded RDU 96 in 1.5 and 5.5% of milk samples respectively. In the same periods Cs-137 and Sr-90 levels were 7 and 2 times higher than the similar indexes in the relatively clean Novosibirsk area. Thus, radioactive element levels in milk of Black and White cows of the Byelorussia Republic decreased significantly for the past years.

  12. Specific activity 137Cs at fishes of Ukraine current state

    International Nuclear Information System (INIS)

    Specific activity of 137Cs at fishes of reservoirs of 30 kilometers ChNPP zone (Pripyat river and its bays, lakes, cool-ing-pond of ChNPP, etc.), water basins of Dneprovsky cascade, Shatsky lakes and Black sea near town Sudak is investigated during 2010 - 2012. Levels of specific activity of 137Cs at fishes in many respects are defined by flowage of the reservoir. Normally, the flowage of the reservoir is more, the levels of specific activity of 137Cs at fishes are less. The greatest specific activity of 137Cs at fishes was registered in the north of Ukraine in closed and half-closed reservoirs of 30 kilometers ChNPP zone - to 32000 Bqk/kg. In the southern direction activity of 137Cs at fishes decreases from 4,8 to 78,5 Bq/kg in Kyiv water basin to 1 - 6 Bq/kg, in the Kahovsky water basin and to 0,6 - 1,9 Bq/kg in the Black sea. In large reservoirs the greatest specific activity of 137Cs, as a rule, is registered in fishes of the higher trophic levels

  13. Growth rate controlled barium partitioning in calcite and aragonite

    Science.gov (United States)

    Goetschl, Katja Elisabeth; Mavromatis, Vasileios; Baldermann, Andre; Purgstaller, Bettina; Dietzel, Martin

    2016-04-01

    The barium (Ba) content and the Ba/Ca molar ratios in biogenic and abiotic carbonates have been widely used from the scientific community as a geochemical proxy especially in marine and early diagenetic settings. The Ba content of carbonate minerals has been earlier associated to changes in oceanic circulation that may have been caused by upwelling, changes in weathering regimes and river-runoff as well as melt water discharge. The physicochemical controls of Ba ion incorporation in the two most abundant CaCO3 polymorphs found in Earth's surface environments, i.e. calcite and aragonite, have adequately been studied only for calcite. These earlier studies (i.e. [1]) suggest that at increasing growth rate, Ba partitioning in calcite is increasing as well. In contrast, to date the effect of growth rate on the partitioning of Ba in aragonite remains questionable, despite the fact that this mineral phase is the predominant carbonate-forming polymorph in shallow marine environments. To shed light on the mechanisms controlling Ba ion uptake in carbonates in this study we performed steady-state Ba co-precipitation experiments with calcite and aragonite at 25°C. The obtained results for the partitioning of Ba in calcite are in good agreement with those reported earlier by [1], whereas those for aragonite indicate a reduction of Ba partitioning at elevated aragonite growth rates, with the partitioning coefficient value between solid and fluid to be approaching the unity. This finding is good agreement with the formation of a solid solution in the aragonite-witherite system, owing to the isostructural crystallography of the two mineral phases. Moreover, our data set provides new insights that are required for reconstructing the evolution of the Ba content of pristine marine versus diagenetically altered carbonate minerals commonly occurring in marine subfloor settings, as the thermodynamically less stable aragonite will transform to calcite enriched in Ba, whilst affecting

  14. Preventing or reducing the Cs-137 burden in children

    International Nuclear Information System (INIS)

    Full text: The Helsinki Agreements impose intervention when a diagnosed disease can be cured or prevented. Since 1998 members of IPPNW Switzerland study health related problems due to the Chernobyl Fallout in the Ukraine and Belarus. The organisation furthermore finances diagnostic and radiometric activities, as measuring the Cs-137 burden in the organism. Also preventive measures are supported in cooperation with the french NGO 'Children of Chernobyl Belarus'. The Clinical Research Institute of Radiation Medicine and Endocrinology and the Gomel' State Med. Institute found correlations between chronic excess of Cs-137 and genetic, congenital, endocrine, immunological, cardiovascular, gastrointestinal, ophthalmologic anomalies and cancer. For etiological assessment the correlation between pathology and internal irradiation requires repeated measuring of Cs-137 burden. Anthropo-Gammametry measures of the mean Cs-137 load of the organism, which can be done in a few minutes. These values, however, cannot be used to directly calculate the dose to a given organ, as cesium concentrations may vary from 1 to 100 in the same child. Very low values of Cs-137 are found in skin and fatty tissue; in small children the highest concentrations are found in endocrine glands, pancreas, thymus and heart. Cs-137 is a gamma and beta emitting isotope. Whereas in the environment gamma emissions are important, once ingested beta emissions within millimeter distance are more damaging for cellular structures than gamma rays. Neurons of given brain structures localized in the left hemisphere (in right handed persons) also seem to be susceptible to ionizing radiations. There appear to be correlations with certain mental diseases and disorders, including schizophrenia and chronic fatigue syndrome. As regards to practical radiation protection, unfortunately families in rural areas rely on their own foodstuffs and milk and poor families frequently consume highly contaminated natural products. In

  15. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage.

    Science.gov (United States)

    Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J

    2012-01-01

    Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3). PMID:22233912

  16. MIR137HG risk variant rs1625579 genotype is related to corpus callosum volume in schizophrenia

    NARCIS (Netherlands)

    Patel, V.S.; Kelly, S.; Wright, C.; Gupta, C.N.; Arias Vasquez, A.; Perrone-Bizzozero, N.; Ehrlich, S.; Wang, L.; Bustillo, J.R.; Morris, D.; Corvin, A.; Cannon, D.M.; McDonald, C.; Donohoe, G.; Calhoun, V.D.; Turner, J.A.

    2015-01-01

    Genome-wide association studies implicate the MIR137HG risk variant rs1625579 (MIR137HGrv) within the host gene for microRNA-137 as a potential regulator of schizophrenia susceptibility. We examined the influence of MIR137HGrv genotype on 17 subcortical and callosal volumes in a large sample of indi

  17. Barium and neodymium isotopic anomalies in the Allende meteorite

    Science.gov (United States)

    Mcculloch, M. T.; Wasserburg, G. J.

    1978-01-01

    The discovery of Ba and Nd isotopic anomalies in two inclusions from the Allende meteorite is reported. The inclusions are Ca-Al-rich objects typical of the type considered as high-temperature condensation products in the solar nebula and contain distinctive Mg and O isotopic anomalies of the FUN (mass Fractionation, Unknown Nuclear processes) type. Mass-spectrometry results are discussed which show that inclusion C1 has anomalies in Ba at masses 134 and 136, while inclusion EK1-4-1 exhibits large marked negative anomalies at 130, 132, 134, and 136, as well as a positive anomaly at 137. It is also found that inclusion EK1-4-1 shows marked negative anomalies in Nd at masses 142, 146, 148, and 150, in addition to a positive anomaly at 145. These isotopic shifts are attributed to addition of r-process nuclei rather than mass fractionation. It is suggested that an onion-shell supernova explosion followed by injection into the solar nebula is the most likely generic model that may explain the observations.

  18. Clinical analysis of intestinal colostomy closure operation in 137 cases%肠造口还纳手术137例临床分析

    Institute of Scientific and Technical Information of China (English)

    张军

    2014-01-01

    Objective To investigate the operation time and operation mode of colostomy closure,and the prevention and treatment of complications occurred. Methods The clinical data of 137 patients with colostomy closure operation were retrospec-tively analyzed,and the colostomy stoma reason and method,closured time,postoperative complications and preventive treatment was statistical analyzed. Results Stoma causes including low rectal cancer low anastomosis proximal protective stoma in 57 ca-ses,63 cases of colon injury,9 cases of anastomotic leakage,8 cases of Crohn′s disease and familial polyposis. The average time was 162. 3 days;preoperative examination of colonoscopy in 117 cases and barium enema in 20 cases;Stapler anastomosis in 122 cases and manual reduction in 15 cases. Side-to-side anastomosis in 106 cases,end-to-end anastomosis in 21 cases,end to side anastomosis in 10 cases. Complications occurred in 13 patients(9. 5%),including 2 cases of anastomotic leakage,re-ileostomy in 1 case;wound infection in 4 cases,intestinal obstruction in 2 cases,abdominal cavity infection in 2 cases,anastomotic bleed-ing in 1 case,partial abdominal wall hematoma in 1 case. Postoperative average time was 12. 7 days. Conclusion Before colos-tomy closure operation,the distal bowel stenosis,the recurrence of the tumor,unhealed injury and the underlying disease should be excluded and controlled,and the closure operation can be given after 3-6 months of colostomy operation.%目的:探讨肠造口还纳手术时机、手术方式及并发症发生的预防、处理。方法回顾性分析137例肠造口还纳手术的患者,统计分析其造口原因、造口方法、还纳时间、术后并发症及预防处理方法等。结果造口原因包括低位直肠癌低位吻合近侧保护性造口57例,结直肠损伤63例,吻合口漏9例,克罗恩病、家族性息肉病等8例;还纳平均时间162.3 d;术前检查肠镜117例,钡剂灌肠20例;吻合器吻合122

  19. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    CERN Document Server

    Anderson, NG; Firsching, M; de Ruiter, N; Schleich, N; Butzer, J S; Cook, N J; Grasset, R; Campbell, M; Scott, N J A; Anderson, N G

    2010-01-01

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 A mu A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct f...

  20. The Precipitation Process of Liquid Wastes Containing Contaminant Am withBarium Sulfate

    International Nuclear Information System (INIS)

    The investigated of the reduction volume liquid wastes containing ofAmericium nuclide contaminant has been done. The reduction volume was done byadding barium sulfate coagulant. The experimental procedure that has beendone by adding regent of barium nitrate and natrium sulfate to the wasteswith its preadjusted pH, then by utilizing the jar test equipment was carriedout the fast stirring speed for 5 minutes and the gentle agitation for 30minutes, therefor its floc and supernatant will be formed. The resultedbarium sulfate floc will trap radionuclide in the wastes. The Variableinvestigated were: the concentration of barium sulfate, pH of the wastes, theflash mixing rate, the gentle agitation rate. The investigated barium sulfateconcentration variable was started from 100 ppm up to 800 ppm. Theinvestigated pH variable was started from pH 7 up to pH 13. The investigatedflash mixing rate were 75, 100, 125, 150, 175, 200, 225, 250 rpm. Theinvestigated gentle agitation variable were 20, 30, 40, 50 rpm. The bestresult which was represented by decontaminating factor (DF) was found frombarium sulfate concentration of 300 ppm and pH 11, and the flash mixing rateof 200 rpm and the gentle agitation rate of 20 rpm, with the separationefficiency = 97.2 %. (author)