WorldWideScience

Sample records for barium 137 target

  1. Solid state (47,49)Ti, (87)Sr and (137)Ba NMR characterisation of mixed barium/strontium titanate perovskites.

    Science.gov (United States)

    Gervais, Christel; Veautier, Delphine; Smith, Mark E; Babonneau, Florence; Belleville, Philippe; Sanchez, Clément

    2004-01-01

    Solid state (47,49)Ti, (137)Ba, (87)Sr NMR spectra have been recorded on BaxSrl-xTiO3 (0 strontium) in the coordination second sphere of the probed titanium site: substitution of strontium by barium induces the broadening of the peaks, due to quadrupolar effects, while the isotropic chemical shift increases. (137)Ba NMR spectra exhibit a distribution of the quadrupolar interaction, that could be tentatively quantified, CQ increasing with the amount of strontium. Preliminary results were also obtained on (87)Sr NMR showing behaviour comparable to (137)Ba NMR, i.e. a broadening of the peaks due to an increasing quadrupolar interaction with the amount of barium distorting the environment of the strontium sites.

  2. Metabolism of {sup 137}cesium, {sup 137}barium in the rat. Therapeutics of the contamination; Metabolisme du {sup 137}cesium, {sup 137}baryum chez le rat. Therapeutique de la contamination

    Energy Technology Data Exchange (ETDEWEB)

    Remy, J.; Philippon, A.; Lafuma, J.; Walter, C. [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires. Departement de la Protection Sanitaire, Laboratoire de Radiopathologie

    1967-07-01

    The authors carry out research into the distribution kinetics, the metabolism and the excretion of {sup 137}Cs - {sup 137}Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors) [French] Les auteurs etudient experimentalement la cinetique de distribution, le metabolisme et l

  3. Immunotherapy of melanoma with the immune costimulatory monoclonal antibodies targeting CD137

    Directory of Open Access Journals (Sweden)

    Li SY

    2013-09-01

    Full Text Available Shi-Yan Li, Yizhen Liu Cancer Research Institute, Scott and White Healthcare, Temple, TX, USA Abstract: Knowledge of how the immune system recognizes and attempts to control cancer growth and development has improved dramatically. The advent of immunotherapies for cancer has resulted in robust clinical responses and confirmed that the immune system can significantly inhibit tumor progression. Until recently, metastatic melanoma was a disease with limited treatment options and a poor prognosis. CD137 (also known as 4-1BB a member of the tumor necrosis factor (TNF receptor superfamily, is an activation-induced T cell costimulator molecule. Growing evidence indicates that anti-CD137 monoclonal antibodies possess strong antitumor properties, the result of their powerful capability to activate CD8+ T cells, to produce interferon (IFN-γ, and to induce cytolytic markers. Combination therapy of anti-CD137 with other anticancer agents, such as radiation, has robust tumor-regressing abilities against nonimmunogenic or poorly immunogenic tumors. Of importance, targeting CD137 eliminates established tumors, and the fact that anti-CD137 therapy acts in concert with other anticancer agents and/or radiation therapy to eradicate nonimmunogenic and weakly immunogenic tumors is an additional benefit. Currently, BMS-663513, a humanized anti-CD137 antibody, is in clinical trials in patients with solid tumors, including melanoma, renal carcinoma, ovarian cancer, and B-cell malignancies. In this review, we discuss the basis of the therapeutic potential of targeting CD137 in cancer treatment, focusing in particular, on BMS-663513 as an immune costimulatory monoclonal antibody for melanoma immunotherapy. Keywords: anti-CD137 monoclonal antibodies, immune costimulator molecule, BMS-663513

  4. Potential impact of miR-137 and its targets in schizophrenia

    Directory of Open Access Journals (Sweden)

    Carrie eWright

    2013-04-01

    Full Text Available The significant impact of microRNAs (miRNAs on disease pathology is becoming increasingly evident. These small non-coding RNAs have the ability to post-transcriptionally silence the expression of thousands of genes. Therefore, dysregulation of even a single miRNA could confer a large polygenic effect. Schizophrenia is a genetically complex illness thought to involve multiple genes each contributing a small risk. Large genome-wide association studies identified miR-137, a miRNA shown to be involved in neuronal maturation, as one of the top risk genes. To assess the potential mechanism of impact of miR-137 in this disorder and identify its targets, we used a combination of literature searches, Ingenuity Pathway Analysis (IPA, and freely accessible bioinformatics resources. Using TargetScan and the Schizophrenia Gene Resource (SZGR database, we found that in addition to CSMD1, C10orf26, CACNA1C, TCF4, and ZNF804A, five schizophrenia risk genes whose transcripts are also validated miR-137 targets, there are other schizophrenia-associated genes that may be targets of miR-137, including ERBB4, GABRA1, GRIN2A, GRM5, GSK3B, NRG2 and HTR2C. IPA analyses of all the potential targets identified several nervous system functions as the top canonical pathways including synaptic long-term potentiation, a process implicated in learning and memory mechanisms and recently shown to be altered in patients with schizophrenia. Among the subset of targets involved in nervous system development and function, the top scoring pathways were ephrin receptor signaling and axonal guidance, processes that are critical for proper circuitry formation and were shown to be disrupted in schizophrenia. These results suggest that miR-137 may indeed play a substantial role in the genetic etiology of schizophrenia by regulating networks involved in neural development and brain function.

  5. miR-137, a new target for post-stroke depression?

    Institute of Scientific and Technical Information of China (English)

    Lixia Zhao; Huazi Li; Ruiyou Guo; Teng Ma; Rongyao Hou; Xiaowei Ma; Yifeng Du

    2013-01-01

    Expression of miR-137 is downregulated in brain tissue from patients with depression and suicidal behavior, and is also downregulated in peripheral blood from stroke patients. However, it is not yet known if miR-137 acts as a bridge between stroke and depression. To test this, we used middle cerebral artery occlusion and chronic mild stress to establish a post-stroke depression model in rats. Compared with controls, we found significantly lower miR-137 levels in the brain and peripheral blood from post-stroke depression rats. Injection of a miR-137 antagonist into the brain ventricles upregulated miR-137 levels, and improved behavioral changes in post-stroke depression rats. Lu-ciferase assays showed miR-137 bound to the 3′UTR of Grin2A, regulating Grin2A expression in a neuronal cel line. Grin2A gene overexpression in the brain of post-stroke depression rats, noticea-bly suppressed the inhibitory effect of miR-137 on post-stroke depression. Overal , our results show that miR-137 suppresses Grin2A protein expression through binding to Grin2A mRNA, thereby ex-erting an inhibitory effect on post-stroke depression. Our results offer a new therapeutic direction for post-stroke depression.

  6. Induction of miR-137 by Isorhapontigenin (ISO) Directly Targets Sp1 Protein Translation and Mediates Its Anticancer Activity Both In Vitro and In Vivo.

    Science.gov (United States)

    Zeng, Xingruo; Xu, Zhou; Gu, Jiayan; Huang, Haishan; Gao, Guangxun; Zhang, Xiaoru; Li, Jingxia; Jin, Honglei; Jiang, Guosong; Sun, Hong; Huang, Chuanshu

    2016-03-01

    Our recent studies found that isorhapontigenin (ISO) showed a significant inhibitory effect on human bladder cancer cell growth, accompanied with cell-cycle G0-G1 arrest as well as downregulation of Cyclin D1 expression at transcriptional level via inhibition of Sp1 transactivation in bladder cancer cells. In the current study, the potential ISO inhibition of bladder tumor formation has been explored in a xenograft nude mouse model, and the molecular mechanisms underlying ISO inhibition of Sp1 expression and anticancer activities have been elucidated both in vitro and in vivo. Moreover, the studies demonstrated that ISO treatment induced the expression of miR-137, which in turn suppressed Sp1 protein translation by directly targeting Sp1 mRNA 3'-untranslated region (UTR). Similar to ISO treatment, ectopic expression of miR-137 alone led to G0-G1 cell growth arrest and inhibition of anchorage-independent growth in human bladder cancer cells, which could be completely reversed by overexpression of GFP-Sp1. The inhibition of miR-137 expression attenuated ISO-induced inhibition of Sp1/Cyclin D1 expression, induction of G0-G1 cell growth arrest, and suppression of cell anchorage-independent growth. Taken together, our studies have demonstrated that miR-137 induction by ISO targets Sp1 mRNA 3'-UTR and inhibits Sp1 protein translation, which consequently results in reduction of Cyclin D1 expression, induction of G0-G1 growth arrest, and inhibition of anchorage-independent growth in vitro and in vivo. Our results have provided novel insights into understanding the anticancer activity of ISO in the therapy of human bladder cancer.

  7. Concomitant targeting of programmed death-1 (PD-1) and CD137 improves the efficacy of radiotherapy in a mouse model of human BRAFV600-mutant melanoma.

    Science.gov (United States)

    Kroon, Paula; Gadiot, Jules; Peeters, Marlies; Gasparini, Alessia; Deken, Marcel A; Yagita, Hideo; Verheij, Marcel; Borst, Jannie; Blank, Christian U; Verbrugge, Inge

    2016-06-01

    T cell checkpoint blockade with antibodies targeting programmed cell death (ligand)-1 (PD-1/PD-L1) and/or cytotoxic T lymphocyte-antigen 4 (CTLA-4) has improved therapy outcome in melanoma patients. However, a considerable proportion of patients does not benefit even from combined α-CTLA-4 and α-PD-1 therapy. We therefore examined to which extent T cell (co)stimulation and/or stereotactic body radiation therapy (SBRT) could further enhance the therapeutic efficacy of T cell checkpoint blockade in a genetically engineered mouse melanoma model that is driven by PTEN-deficiency, and BRAFV600 mutation, as in human, but lacks the sporadic UV-induced mutations. Tumor-bearing mice were treated with different combinations of immunomodulatory antibodies (α-CTLA-4, α-PD-1, α-CD137) or interleukin-2 (IL-2) alone or in combination with SBRT. None of our immunotherapeutic approaches (alone or in combination) had any anti-tumor efficacy, while SBRT alone delayed melanoma outgrowth. However, α-CD137 combined with α-PD-1 antibodies significantly enhanced the anti-tumor effect of SBRT, while the anti-tumor effect of SBRT was not enhanced by interleukin-2, or the combination of α-CTLA-4 and α-PD-1. We conclude that α-CD137 and α-PD-1 antibodies were most effective in enhancing SBRT-induced tumor growth delay in this mouse melanoma model, outperforming the ability of IL-2, or the combination of α-CTLA-4 and α-PD-1 to synergize with SBRT. Given the high mutational load and increased immunogenicity of human melanoma with the same genotype, our findings encourage testing α-CD137 and α-PD-1 alone or in combination with SBRT clinically, particularly in patients refractory to α-CTLA-4 and/or α-PD-1 therapy.

  8. Barium periostitis: an intraoral complication following barium swallow.

    Science.gov (United States)

    Stanton, David C; Seeger, Douglas; Robinson, Brian T

    2007-05-01

    Barium is used with great frequency for various gastrointestinal radiographic studies. Complications arising from the use of barium are uncommon and can range from peritonitis, pneumonitis, vascular intravasation, allergic reactions, and even "barium appendicitis." We report a case of an unusual complication, periostitis, from the use of barium in a 46-year-old male.

  9. Evaluation of Transmutation of 137Cs(r,n) 136Cs Using Ultra-Intense Lasers in Solid Targets

    Institute of Scientific and Technical Information of China (English)

    R. Sadighi-Bonabi; O. Kokabee

    2006-01-01

    Relativistic electrons produced in ultra-intense laser-solid interaction generate highly collimated γ-ray beams through Bremsstrahlung that can be used to induce photonuclear reactions. Photonuclear transmutation (of (γ, n) type) of 137Cs, one of the hazardous nuclear wastes with half-life of 30.17 years which cannot be transmuted practically with neutron bombardment due to its very low neutron capture cross section, has been considered. Nuclear activity of produced 136Cs with half-life of 13.16 days has been evaluated analytically using available experimental data. With irradiating a 137Cs sample by p-polarized laser light of 1020 Wcm-2 and the repetition rate of 10 Hz for 30mm, the activity of 0.24 Bq is obtained. It is found that intensity has a large effect in yield around 1021 Wcm-2. For similar laser with intensity of 5×1021 Wcm-2, the activity increases with a factor of 105.

  10. Controlling barium sulfate

    Energy Technology Data Exchange (ETDEWEB)

    Greenley, R.

    Even though for several years success has been realized in controlling barium sulfate scale deposition in relatively shallow, low pressure oil wells--by squeezing an organic phosphonate scale inhibitor into the producing zone--barium sulfate scale depositon in deep, high pressure/high temperature wells usually meant an expensive workover operation. A case history of a deep (16,000 ft) well in St. Mary Parish, Louisiana, and the scale inhibitor squeeze operation are described. Based on the successful results obtained in treating this well, a generalized treating procedure for combating downhole scale deposition in high pressure/high temperature gas wells is presented. Formation squeezing with such an inhibitor represents a significant breakthrough for the oil and gas industry.

  11. Individual-specific transgenerational marking of fish populations based on a barium dual-isotope procedure.

    Science.gov (United States)

    Huelga-Suarez, Gonzalo; Moldovan, Mariella; Garcia-Valiente, America; Garcia-Vazquez, Eva; Alonso, J Ignacio Garcia

    2012-01-01

    The present study focuses on the development and evaluation of an individual-specific transgenerational marking procedure using two enriched barium isotopes, (135)Ba and (137)Ba, mixed at a given and selectable molar ratio. The method is based on the deconvolution of the isotope patterns found in the sample into four molar contribution factors: natural xenon (Xe nat), natural barium (Ba nat), Ba135, and Ba137. The ratio of molar contributions between Ba137 and Ba135 is constant and independent of the contribution of natural barium in the sample. This procedure was tested in brown trout ( Salmo trutta ) kept in captivity. Trout were injected with three different Ba137/Ba135 isotopic signatures ca. 7 months and 7 days before spawning to compare the efficiency of the marking procedure at long and short term, respectively. The barium isotopic profiles were measured in the offspring by means of inductively coupled plasma mass spectrometry. Each of the three different isotopic signatures was unequivocally identified in the offspring in both whole eggs and larvae. For 9 month old offspring, the characteristic barium isotope signatures could also be detected in the otoliths even in the presence of a high and variable amount of barium of natural isotope abundance. In conclusion, it can be stated that the proposed dual-isotope marking is inheritable and can be detected after both long-term and short-term marking. Furthermore, the dual-isotope marking can be made individual-specific, so that it allows identification of offspring from a single individual or a group of individuals within a given fish group.

  12. On barium oxide solubility in barium-containing chloride melts

    Energy Technology Data Exchange (ETDEWEB)

    Nikolaeva, Elena V.; Zakiryanova, Irina D.; Bovet, Andrey L.; Korzun, Iraida V. [Ural Federal Univ., Yekaterinburg (Russian Federation). Inst. of High Temperature Electrochemistry

    2016-11-01

    Oxide solubility in chloride melts depends on temperature and composition of molten solvent. The solubility of barium oxide in the solvents with barium chloride content is essentially higher than that in molten alkali chlorides. Spectral data demonstrate the existence of oxychloride ionic groupings in such melts. This work presents the results of the BaO solubility in two molten BaCl{sub 2}-NaCl systems with different barium chloride content. The received data together with earlier published results revealed the main regularities of BaO solubility in molten BaO-BaCl{sub 2}-MCl systems.

  13. MR Colonography with fecal tagging: Barium vs. barium ferumoxsil

    DEFF Research Database (Denmark)

    Achiam, M.P.; Chabanova, E.; Logager, V.B.;

    2008-01-01

    and Methods. Twenty patients referred to CC underwent dark lumen MRC prior to the colonoscopy. Two groups of patients received two different oral contrast agents (barium sulfate and barium sulfate/ferumoxsil) as a laxative-free fecal tagging prior to the MRC. After MRC, the contrast agent was rated...... qualitatively (with the standard method using contrast-to-wall ratio) and subjectively (using a visual analog scale [VAS]) by three different blinded observers. Results. Evaluated both qualitatively and subjectively, the tagging efficiency of barium sulfate/ferumoxsil was significantly better (P ... barium sulfate alone. The VAS method for evaluating the tagging efficiency of contrast agents showed a high correlation (observer 11, r = 0.91) to the standard method using contrast-to-wall ratio and also a high interclass correlation (observer 11 and III = 0.89/0.85). MRC found I of 22 (5%) polyps

  14. Doped barium titanate nanoparticles

    Indian Academy of Sciences (India)

    T K Kundu; A Jana; P Barik

    2008-06-01

    We have synthesized nickel (Ni) and iron (Fe) ion doped BaTiO3 nanoparticles through a chemical route using polyvinyl alcohol (PVA). The concentration of dopant varies from 0 to 2 mole% in the specimens. The results from X-ray diffractograms and transmission electron micrographs show that the particle diameters in the specimen lie in the range 24–40 nm. It is seen that the dielectric permittivity in doped specimens is enhanced by an order of magnitude compared to undoped barium titanate ceramics. The dielectric permittivity shows maxima at 0.3 mole% doping of Fe ion and 0.6 mole% of Ni ion. The unusual dielectric behaviour of the specimens is explained in terms of the change in crystalline structure of the specimens.

  15. Rationale for anti-CD137 cancer immunotherapy.

    Science.gov (United States)

    Makkouk, Amani; Chester, Cariad; Kohrt, Holbrook E

    2016-02-01

    The consideration of the complex interplay between the tumour microenvironment (TME) and the immune response is the key for designing effective immunotherapies. Therapeutic strategies that harness co-stimulatory receptors have recently gained momentum in the clinic. One such strategy with promising clinical applications is the targeting of CD137, a member of the tumour necrosis factor receptor superfamily. Its expression on both innate and adaptive immune cells, coupled with its unique ability to potentiate antitumour responses through modulating the TME and to ameliorate autoimmune responses, has established it as an appealing target. In this review, we will discuss the various CD137-targeted immunotherapeutics that have reached clinical development, with a focus on recent advances and novel modalities such as CD137 chimeric antigen receptors and CD137 bispecific antibodies. We will also highlight the effect of CD137 targeting on the TME and discuss the importance of probing TME changes for predicting and testing the efficacy of CD137-mediated immunotherapy.

  16. 75 FR 33824 - Barium Chloride From China

    Science.gov (United States)

    2010-06-15

    ... COMMISSION Barium Chloride From China Determination On the basis of the record\\1\\ developed in the subject... order on barium chloride from China would be likely to lead to continuation or recurrence of material... Barium Chloride from China: Investigation No. 731-TA-149 (Third Review). By order of the...

  17. Comparison of Barium and Arsenic Concentrations in Well Drinking Water and in Human Body Samples and a Novel Remediation System for These Elements in Well Drinking Water.

    Directory of Open Access Journals (Sweden)

    Masashi Kato

    Full Text Available Health risk for well drinking water is a worldwide problem. Our recent studies showed increased toxicity by exposure to barium alone (≤700 µg/L and coexposure to barium (137 µg/L and arsenic (225 µg/L. The present edition of WHO health-based guidelines for drinking water revised in 2011 has maintained the values of arsenic (10 µg/L and barium (700 µg/L, but not elements such as manganese, iron and zinc. Nevertheless, there have been very few studies on barium in drinking water and human samples. This study showed significant correlations between levels of arsenic and barium, but not its homologous elements (magnesium, calcium and strontium, in urine, toenail and hair samples obtained from residents of Jessore, Bangladesh. Significant correlation between levels of arsenic and barium in well drinking water and levels in human urine, toenail and hair samples were also observed. Based on these results, a high-performance and low-cost adsorbent composed of a hydrotalcite-like compound for barium and arsenic was developed. The adsorbent reduced levels of barium and arsenic from well water in Bangladesh and Vietnam to <7 µg/L within 1 min. Thus, we have showed levels of arsenic and barium in humans and propose a novel remediation system.

  18. Analysis of europium doped luminescent barium thioaluminate

    Institute of Scientific and Technical Information of China (English)

    张东璞; 喻志农; 薛唯; 章婷; 丁瞾; 王武育

    2010-01-01

    Europium-doped barium thioaluminate sputtering target was synthesized by powder sintering method and thin film was deposited by radio frequency(RF) sputtering.X-ray diffractometer(XRD) pattern indicated that the main compound of the target was BaAl4S7.Oxygen was the main impurity which led to the formation of BaAl2O4.It was shown that both BaAl4S7 and BaAl2S4 were contained in the as-grown thin films and a 471.7 nm emission peak in the PL spectra appeared due to a combination of BaAl4S7:Eu2+ and BaAl2S4:Eu2...

  19. Barium aspiration and alveolarisation of barium in an infant: A case report and review of management

    Directory of Open Access Journals (Sweden)

    Alan F. Isles

    2014-05-01

    Full Text Available We describe a case of bilateral inhalation and alveolarisation of barium in an infant following a barium swallow for investigation of dusky spells associated with feeds. A bronchoscopy subsequently revealed the presence of a mid-tracheal tracheo-oesophageal cleft. We review the literature on barium aspiration, its consequences and make recommendations for management.

  20. ONE CASE REPORT OF ACUTE POISONING BY BARIUM CARBONATE

    Institute of Scientific and Technical Information of China (English)

    GE Qin-min; BIAN Fan; WANG Shu-yun; SHEN Sheng-hui

    2009-01-01

    @@ Most barium poisoning cases were caused by oral intake by mistake. Recent years, barium carbonate poisoning has been rare to be reported. Here we reported a case of acute barium carbonate toxication taken orally on purpose.

  1. Processing science of barium titanate

    Science.gov (United States)

    Aygun, Seymen Murat

    Barium titanate and barium strontium titanate thin films were deposited on base metal foils via chemical solution deposition and radio frequency magnetron sputtering. The films were processed at elevated temperatures for densification and crystallization. Two unifying research goals underpin all experiments: (1) To improve our fundamental understanding of complex oxide processing science, and (2) to translate those improvements into materials with superior structural and electrical properties. The relationships linking dielectric response, grain size, and thermal budget for sputtered barium strontium titanate were illustrated. (Ba 0.6Sr0.4)TiO3 films were sputtered on nickel foils at temperatures ranging between 100-400°C. After the top electrode deposition, the films were co-fired at 900°C for densification and crystallization. The dielectric properties were observed to improve with increasing sputter temperature reaching a permittivity of 1800, a tunability of 10:1, and a loss tangent of less than 0.015 for the sample sputtered at 400°C. The data can be understood using a brick wall model incorporating a high permittivity grain interior with low permittivity grain boundary. However, this high permittivity value was achieved at a grain size of 80 nm, which is typically associated with strong suppression of the dielectric response. These results clearly show that conventional models that parameterize permittivity with crystal diameter or film thickness alone are insufficiently sophisticated. Better models are needed that incorporate the influence of microstructure and crystal structure. This thesis next explores the ability to tune microstructure and properties of chemically solution deposited BaTiO3 thin films by modulation of heat treatment thermal profiles and firing atmosphere composition. Barium titanate films were deposited on copper foils using hybrid-chelate chemistries. An in-situ gas analysis process was developed to probe the organic removal and the

  2. 75 FR 19657 - Barium Chloride From China

    Science.gov (United States)

    2010-04-15

    ... COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Notice of... chloride from China. SUMMARY: The Commission hereby gives notice that it will proceed with a full review... revocation of the antidumping duty order on barium chloride from China would be likely to lead...

  3. Laser cooling and trapping of barium

    NARCIS (Netherlands)

    De, Subhadeep

    2008-01-01

    Laser cooling and trapping of heavy alkaline-earth element barium have been demonstrated for the first time ever. For any possible cycling transition in barium that could provide strong cooling forces, the excited state has a very large branching probability to metastable states. Additional lasers a

  4. Barium Ions for Quantum Computation

    CERN Document Server

    Dietrich, M R; Bowler, R; Kurz, N; Salacka, J S; Shu, G; Blinov, B B

    2009-01-01

    Individually trapped 137Ba+ in an RF Paul trap is proposed as a qubit ca ndidate, and its various benefits are compared to other ionic qubits. We report the current experimental status of using this ion for quantum computation. Fut ure plans and prospects are discussed.

  5. CT-Guided Percutaneous Transthoracic Localization of Pulmonary Nodules Prior to Video-Assisted Thoracoscopic Surgery Using Barium Suspension

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Nyoung Keun; Park, Chang Min; Kang, Chang Hyun; Jeon, Yoon Kyung; Choo, Ji Yung; Lee, Hyun Ju; Goo, Jin Mo [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    2012-11-15

    To describe our initial experience with CT-guided percutaneous barium marking for the localization of small pulmonary nodules prior to video-assisted thoracoscopic surgery (VATS). From October 2010 to April 2011, 10 consecutive patients (4 men and 6 women; mean age, 60 years) underwent CT-guided percutaneous barium marking for the localization of 10 small pulmonary nodules (mean size, 7.6 mm; range, 3-14 mm): 6 pure ground-glass nodules, 3 part-solid nodules, and 1 solid nodule. A 140% barium sulfate suspension (mean amount, 0.2 mL; range, 0.15-0.25 mL) was injected around the nodules with a 21-gauge needle. The technical details, surgical findings and pathologic features associated with barium localizations were evaluated. All nodules were marked within 3 mm (mean distance, 1.1 mm; range, 0-3 mm) from the barium ball (mean diameter, 9.6 mm; range, 8-16 mm) formed by the injected barium suspension. Pneumothorax occurred in two cases, for which one needed aspiration. However, there were no other complications. All barium balls were palpable during VATS and visible on intraoperative fluoroscopy, and were completely resected. Both the whitish barium balls and target nodules were identifiable in the frozen specimens. Pathology revealed one invasive adenocarcinoma, five adenocarcinoma-in-situ, two atypical adenomatous hyperplasias, and two benign lesions. In all cases, there were acute inflammations around the barium balls which did not hamper the histological diagnosis of the nodules. CT-guided percutaneous barium marking can be an effective, convenient and safe pre-operative localization procedure prior to VATS, enabling accurate resection and diagnosis of small or faint pulmonary nodules.

  6. Barium thiolates and selenolates: syntheses and structural principles.

    Science.gov (United States)

    Ruhlandt-Senge, K; Englich, U

    2000-11-17

    The synthesis and structural characterization of a family of barium thiolates and selenolates is described. The thiolates were synthesized by metallation of thiols, the selenolates by reductive insertion of the metal into the selenium-selenium bond of diorganodiselenides. Both reaction sequences were carried out by using barium metal dissolved in ammonia; this afforded barium thiolates and selenolates in good yield and purity. The structural principles displayed in the target compounds span a wide range of solid-state formulations, including monomeric and dimeric species, and separated ion triples, namely [Ba(thf)4(SMes*)2] (1; Mes* = 2,4,6-tBU3C6H2), [Ba(thf)4(SeMes*)2] (2), [Ba([18]crown-6)(hmpa)2][(SeMes*)2] (3), the dimeric [(Ba(py)3(thf)(SeTrip)2)2] (4; py = pyridine, Trip = 2,4.6-iPr3C6H2), and [Ba([18]crown-6)(SeTrip)2] (5). The full range of association modes is completed by [Ba([18]crown-6)(hmpa)SMes*][SMes*] (6) communicated earlier by this group. In the solid state, this compound displays an intermediate ion coordination mode: one anion is bound to the metal, while the second one is unassociated. Together these compounds provide structural information about all three different association modes for alkaline earth metal derivatives. This collection of structural data allows important conclusions about the influence of solvation and ligation on structural trends.

  7. Magneto optical trapping of Barium

    CERN Document Server

    De, S; Jungmann, K; Willmann, L

    2008-01-01

    First laser cooling and trapping of the heavy alkaline earth element barium has been achieved based on the strong 6s$^2$ $^1$S$_0$ - 6s6p $^1$P$_1$ transition for the main cooling. Due to the large branching into metastable D-states several additional laser driven transitions are required to provide a closed cooling cycle. A total efficiency of $0.4(1) \\cdot 10^{-2}$ for slowing a thermal atomic beam and capturing atoms into a magneto optical trap was obtained. Trapping lifetimes of more than 1.5 s were observed. This lifetime is shortened at high laser intensities by photo ionization losses. The developed techniques will allow to extend significantly the number of elements that can be optically cooled and trapped.

  8. Radium/Barium Waste Project

    Energy Technology Data Exchange (ETDEWEB)

    McDowell, Allen K.; Ellefson, Mark D.; McDonald, Kent M.

    2015-06-25

    The treatment, shipping, and disposal of a highly radioactive radium/barium waste stream have presented a complex set of challenges requiring several years of effort. The project illustrates the difficulty and high cost of managing even small quantities of highly radioactive Resource Conservation and Recovery Act (RCRA)-regulated waste. Pacific Northwest National Laboratory (PNNL) research activities produced a Type B quantity of radium chloride low-level mixed waste (LLMW) in a number of small vials in a facility hot cell. The resulting waste management project involved a mock-up RCRA stabilization treatment, a failed in-cell treatment, a second, alternative RCRA treatment approach, coordinated regulatory variances and authorizations, alternative transportation authorizations, additional disposal facility approvals, and a final radiological stabilization process.

  9. Decorporation of cesium-137; Decorporation du cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)

    1997-12-31

    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  10. 75 FR 20625 - Barium Chloride From China

    Science.gov (United States)

    2010-04-20

    ... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Revised schedule for the subject review. DATES: Effective Date: April 9, 2010. FOR FURTHER INFORMATION CONTACT:...

  11. Neutral Barium Cloud Evolution at Different Altitudes

    Institute of Scientific and Technical Information of China (English)

    李磊; 徐荣栏

    2002-01-01

    Considering the joint effects of diffusion, collision, oxidation and photoionization, we study the evolution of the barium cloud at different altitudes in the space plasma active experiment. The results present the variation of the loss rate, number density distribution and brightness of the barium cloud over the range from 120 to 260km.This can be divided into oxidation, oxidation plus photoionization and photoionization regions.

  12. Small barium rail gun for plasma injection.

    Science.gov (United States)

    Kiwamoto, Y

    1980-03-01

    A small rail gun with a barium electrode can be operated at higher than one shot per second to produce more than 2x10(16) barium ions with energy 10-20 eV. The operation of the gun takes advantage of the external magnetic field for cross-field plasma injection into a trap. Up to 7 kG of the magnetic field examined, the gun performance improves with the increased magnetic field strength.

  13. Bacterial Reduction Of Barium Sulphate By Sulphate-Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Luptáková Alena

    2015-12-01

    Full Text Available Acid mine drainage (AMD is a worldwide problem leading to contamination of water sources. AMD are characterized by low pH and high content of heavy metals and sulphates. The barium salts application presents one of the methods for the sulphates removing from AMD. Barium chloride, barium hydroxide and barium sulphide are used for the sulphates precipitation in the form of barium sulphate. Because of high investment costs of barium salts, barium sulphide is recycled from barium sulphate precipitates. It can be recycled by thermic or bacterial reduction of barium sulphate. The aim of our study was to verify experimentally the possibility of the bacterial transformation of BaSO4 to BaS by sulphate-reducing bacteria. Applied BaSO4 came from experiments of sulphates removal from Smolnik AMD using BaCl2.

  14. Thermochemical hydrogen production via a cycle using barium and sulfur - Reaction between barium sulfide and water

    Science.gov (United States)

    Ota, K.; Conger, W. L.

    1977-01-01

    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653-866 C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. An expression was derived for the rate of hydrogen formation.

  15. Sulphate removal from sodium sulphate-rich brine and recovery of barium as a barium salt mixture.

    Science.gov (United States)

    Vadapalli, Viswanath R K; Zvimba, John N; Mulopo, Jean; Motaung, Solly

    2013-01-01

    Sulphate removal from sodium sulphate-rich brine using barium hydroxide and recovery of the barium salts has been investigated. The sodium sulphate-rich brine treated with different dosages of barium hydroxide to precipitate barium sulphate showed sulphate removal from 13.5 g/L to less than 400 mg/L over 60 min using a barium to sulphate molar ratio of 1.1. The thermal conversion of precipitated barium sulphate to barium sulphide achieved a conversion yield of 85% using coal as both a reducing agent and an energy source. The recovery of a pure mixture of barium salts from barium sulphide, which involved dissolution of barium sulphide and reaction with ammonium hydroxide resulted in recovery of a mixture of barium carbonate (62%) and barium hydroxide (38%), which is a critical input raw material for barium salts based acid mine drainage (AMD) desalination technologies. Under alkaline conditions of this barium salt mixture recovery process, ammonia gas is given off, while hydrogen sulfide is retained in solution as bisulfide species, and this provides basis for ammonium hydroxide separation and recovery for reuse, with hydrogen sulfide also recoverable for further industrial applications such as sulfur production by subsequent stripping.

  16. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮

    2001-01-01

    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  17. Abundance analysis of Barium stars

    Institute of Scientific and Technical Information of China (English)

    Guo-Qing Liu; Yan-Chun Liang; Li-Cai Deng

    2009-01-01

    We obtain the chemical abundances of six barium stars and two CH subgiant stars based on the high signal-to-noise ratio and high resolution Echelle spectra. The neu- tron capture process elements Y, Zr, Ba, La and Eu show obvious overabundances relative to the Sun, for example, their [Ba/Fe] values are from 0.45 to 1.27. Other elements, in- cluding Na, Mg, A1, Si, Ca, Sc, Ti, V, Cr, Mn and Ni, show comparable abundances to the Solar ones, and their [Fe/H] covers a range from -0.40 to 0.21, which means they belong to the Galactic disk. The predictions of the theoretical model of wind accretion for bi- nary systems can explain the observed abundance patterns of the neutron capture process elements in these stars, which means that their overabundant heavy-elements could be caused by accreting the ejecta of AGB stars, the progenitors of present-day white dwarf companions in binary systems.

  18. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    Energy Technology Data Exchange (ETDEWEB)

    Baştürka, Emre; Madakbaş, Seyfullah; Kahraman, Memet Vezir, E-mail: smadakbas@marmara.edu.tr [Department of Chemistry, Marmara University, Istanbul (Turkey)

    2016-03-15

    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  19. Coherent Dark Resonances in Atomic Barium

    CERN Document Server

    Dammalapati, U; Jungmann, K; Willmann, L

    2007-01-01

    The observation of dark-resonances in the two-electron atom barium and their influence on optical cooling is reported. In heavy alkali earth atoms, i.e. barium or radium, optical cooling can be achieved using n^1S_0-n^1P_1 transitions and optical repumping from the low lying n^1D_2 and n^3D_{1,2} states to which the atoms decay with a high branching ratio. The cooling and repumping transition have a common upper state. This leads to dark resonances and hence make optical cooling less inefficient. The experimental observations can be accurately modelled by the optical Bloch equations. Comparison with experimental results allows us to extract relevant parameters for effective laser cooling of barium.

  20. Improved spectrophotometric analysis of barium styphnate

    Energy Technology Data Exchange (ETDEWEB)

    Brown, N E; Blasi, J A

    1983-01-01

    A spectrophotometric procedure to determine the purity of barium styphnate monohydrate based upon the absorbance of the styphnate ion at 326 and 413.3 nm has been developed. The purity is determined by comparing the absorbance of the styphnate ion in barium styphnate and in styphnic acid. Our investigation has shown that the molar absorptivity and lambda maxima of the styphnate ion are quite pH dependent; therefore, the pH is buffered to 6.8 to 7.0 with ammonium acetate. Under these conditions the molar absorptivity is 1.6 x 10/sup 4/ L/mol-cm. Analyses following the procedure in the Navy specification WS13444A using water were found to give low molar absorptivities (1.3 x 10/sup 4/ L/mol-cm) for the styphnic acid calibration resulting in erroneous values for barium styphnate purity.

  1. Printed Barium Strontium Titanate capacitors on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Sette, Daniele [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg); Kovacova, Veronika [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Defay, Emmanuel, E-mail: emmanuel.defay@list.lu [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg)

    2015-08-31

    In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography.

  2. Electronic structure of nanograin barium titanate ceramics

    Institute of Scientific and Technical Information of China (English)

    DENG Xiangyun; WANG Xiaohui; LI Dejun; LI Longtu

    2007-01-01

    The density of states and band structure of 20 nm barium titanate(BaTiO3,BT)ceramics are investigated by first-principles calculation.The full potential linearized augmented plane wave(FLAPW)method is used and the exchange correlation effects are treated by the generalized gradient approximation(GGA).The results show that there is substantial hybridization between the Ti 3d and O 2p states in 20 nm BT ceramics and the interaction between barium and oxygen is typically ionic.

  3. Recovery and purification of 4.66 TBq(126 Ci) of {sup 137}Cs from a 20-year-old spent sealed source

    Energy Technology Data Exchange (ETDEWEB)

    Dash, Ashutosh, E-mail: adash@barc.gov.in [Radiopharmaceuticals Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Varma, R.N. [Radiopharmaceuticals Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Sastry, K.V.S.; Patil, B.N. [Board of Radiation and Isotope Technology (BRIT), Engineering Programme, Trombay, Mumbai 400085 (India); Ram, Ramu [Radiopharmaceuticals Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Nikam, Seema [Board of Radiation and Isotope Technology (BRIT), Engineering Programme, Trombay, Mumbai 400085 (India); Venkatesh, Meera [Radiopharmaceuticals Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)

    2009-09-15

    An attempt to recover and purify 4.66 TBq(126 Ci) of {sup 137}Cs as solution from a 20-year-old doubly encapsulated sealed source containing {sup 137}CsCl was made successfully. The primary capsule was first cut open to retrieve the secondary capsule. The top end of the secondary SS capsule was then cut to render it as an open cylinder and the {sup 137}CsCl pellet inside was dissolved in small aliquots of water. Each aliquot of the {sup 137}CsCl solution was dispensed into glass vials, sealed, assayed and stored. Barium formed during the radioactive decay of {sup 137}Cs was removed by carbonate precipitation. Chloride was removed by heating with HNO{sub 3} and evaporation. About 91.8% of the total activity could be recovered and used subsequently for making brachytherapy sources.

  4. Barium Ferrite Films Grown by Laser Ablation

    NARCIS (Netherlands)

    Lisfi, A.; Lodder, J.C.; Haan, de P.; Smithers, M.A.; Roesthuis, F.J.G.

    1998-01-01

    Pulsed laser ablation (PLA) has been used to grow barium ferrite films on Al2O3 single crystal substrates. When deposition occurs in an oxidising atmosphere at high temperatures, the films are single BaFe12O19 phase, very well oriented with (001) texture, and exhibit a large perpendicular magnetic a

  5. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, J.P. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Duarte, G.W. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Research Group in Technology and Information, Centro Universitário Barriga Verde (UNIBAVE), Santa Catarina, SC (Brazil); Caldart, C. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Kniess, C.T. [Post-Graduate Program in Professional Master in Management, Universidade Nove de Julho, São Paulo, SP (Brazil); Montedo, O.R.K.; Rocha, M.R. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Riella, H.G. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Fiori, M.A., E-mail: fiori@unochapeco.edu.br [Post-Graduate Program in Environmental Science, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil); Post-Graduate Program in Technology and Management of the Innovation, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil)

    2015-11-15

    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound.

  6. Cesium-137, a drama recounted; Cesio-137, um drama recontado

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Suzane de Alencar

    2013-01-15

    The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)

  7. A buffer gas cooled beam of barium monohydride

    Science.gov (United States)

    Iwata, Geoffrey; Tarallo, Marco; Zelevinsky, Tanya

    2016-05-01

    Significant advances in direct laser cooling of diatomic molecules have opened up a wide array of molecular species to precision studies spanning many-body physics, quantum collisions and ultracold dissociation. We present a cryogenic beam source of barium monohydride (BaH), and study laser ablation of solid precursor targets as well as helium buffer gas cooling dynamics. Additionally, we cover progress towards a molecular magneto-optical trap, with spectroscopic studies of relevant cooling transitions in the B2 Σ molecules, including resolution of hyperfine structure and precision measurements of the vibrational Frank-Condon factors. Finally, we examine the feasibility of photo dissociation of trapped BaH molecules to yield optically accessible samples of ultracold hydrogen.

  8. Liquid-Phase Processing of Barium Titanate Thin Films

    Science.gov (United States)

    Harris, David Thomas

    . Our system exhibits flux-film-substrate interactions that can lead to dramatic changes to the microstructure. This effect is especially pronounced onc -sapphire, with Al diffusion from the substrate leading to formation of an epitaxial BaAl2O4 second phase at the substrate-film interface. The formation of this second phase in the presence of a liquid phase seeds {111} twins that drive abnormal grain growth. The orientation of the sapphire substrate determines the BaAl2O 4 morphology, enabling control the abnormal grain growth behavior. CuO additions leads to significant grain growth at 900 °C, with average grain size approaching 500 nm. The orthorhombic-tetragonal phase transition is clearly observable in temperature dependent measurements and both linear and nonlinear dielectric properties are improved. All films containing CuO are susceptible to aging. A number of other systems were investigated for efficacy at temperatures below 900 °C. Pulsed laser deposition was used to study flux + BaTiO 3 targets, layered flux films, and in situ liquids. RF-magnetron sputtering using a dual-gun approach was used to explore integration on flexible foils with Ba1-xSrxTiO3. Many of these systems were based on the BaO-B2O3 system, which has proven effective in thin films, multilayer ceramic capacitors, and bulk ceramics. Modifiers allow tailoring of the microstructure at 900 °C, however no compositions were found, and no reports exist in the open literature, that provide significant grain growth or densification below 900 °C. Liquid phase fluxes offer a promising path forward for low temperature processing of barium titanate, with the ultimate goal of integration with metalized silicon substrates. This work demonstrates significant improvements to dielectric properties and the necessity of understanding interactions in the film-flux-substrate system.

  9. Chemical abundances and kinematics of barium stars

    CERN Document Server

    de Castro, D B; Roig, F; Jilinski, E; Drake, N A; Chavero, C; Silva, J V Sales

    2016-01-01

    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, $alpha$-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code {\\sc moog}. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of $alpha$-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heav...

  10. Analysis of 26 Barium Stars I. Abundances

    CERN Document Server

    Allen, D M; Allen, Dinah M.; Barbuy, Beatriz

    2006-01-01

    We present a detailed analysis of 26 barium stars, including dwarf barium stars, providing their atmospheric parameters (Teff, log g, [Fe/H], vt) and elemental abundances. We aim at deriving gravities and luminosity classes of the sample stars, in particular to confirm the existence of dwarf barium stars. Accurate abundances of chemical elements were derived. Abundance ratios between nucleosynthetic processes, by using Eu and Ba as representatives of the r- and s-processes are presented. High-resolution spectra with the FEROS spectrograph at the ESO-1.5m Telescope, and photometric data with Fotrap at the Zeiss telescope at the LNA were obtained. The atmospheric parameters were derived in an iterative way, with temperatures obtained from colour-temperature calibrations. The abundances were derived using spectrum synthesis for Li, Na, Al, alpha-, iron peak, s- and r-elements atomic lines, and C and N molecular lines. Atmospheric parameters in the range 4300 < Teff < 6500, -1.2 < [Fe/H] < 0.0 and 1.4...

  11. 21 CFR 137.350 - Enriched rice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched rice. 137.350 Section 137.350 Food and... Related Products § 137.350 Enriched rice. (a) The foods for which definitions and standards of identity are prescribed by this section are forms of milled rice (except rice coated with talc and glucose...

  12. 7 CFR 58.137 - Excluded milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Excluded milk. 58.137 Section 58.137 Agriculture... Milk § 58.137 Excluded milk. A plant shall not accept milk from a producer if: (a) The milk has been in...) Three of the last five milk samples have exceeded the maximum bacterial estimate of 500,000 per...

  13. 14 CFR 125.137 - Oil valves.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Oil valves. 125.137 Section 125.137....137 Oil valves. (a) Each oil valve must— (1) Comply with § 125.155; (2) Have positive stops or... the valve. (b) The closing of an oil shutoff means must not prevent feathering the propeller,...

  14. 49 CFR 213.137 - Frogs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Frogs. 213.137 Section 213.137 Transportation... TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.137 Frogs. (a) The flangeway depth measured from a plane across the wheel-bearing area of a frog on Class 1 track shall not be less than 13/8 inches,...

  15. 49 CFR 176.137 - Portable magazine.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Portable magazine. 176.137 Section 176.137... Requirements for Class 1 (Explosive) Materials Stowage § 176.137 Portable magazine. (a) Each portable magazine... wood, a portable magazine must be framed of nominal 5 cm × 10 cm (2×4 inch) lumber, and sheathed...

  16. 25 CFR 137.1 - Water supply.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Water supply. 137.1 Section 137.1 Indians BUREAU OF... CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.1 Water supply. The engineering report dealt with in... capacity of the San Carlos reservoir created by the Coolidge Dam and the water supply therefor over...

  17. 42 CFR 137.10 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Definitions. 137.10 Section 137.10 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Definitions § 137.10 Definitions. Unless...

  18. 21 CFR 137.190 - Cracked wheat.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cracked wheat. 137.190 Section 137.190 Food and... Related Products § 137.190 Cracked wheat. Cracked wheat is the food prepared by so cracking or cutting into angular fragments cleaned wheat other than durum wheat and red durum wheat that, when tested...

  19. 21 CFR 137.195 - Crushed wheat.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Crushed wheat. 137.195 Section 137.195 Food and... Related Products § 137.195 Crushed wheat. Crushed wheat, coarse ground wheat, is the food prepared by so crushing cleaned wheat other than durum wheat and red durum wheat that, when tested by the...

  20. 46 CFR 45.137 - Cargo ports.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Cargo ports. 45.137 Section 45.137 Shipping COAST GUARD....137 Cargo ports. (a) Unless otherwise authorized by the Commandant, the lower edge of any opening for cargo, personnel, machinery access, or similar opening in the side of a ship must be above a line...

  1. 29 CFR 452.137 - Effective dates.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Effective dates. 452.137 Section 452.137 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR LABOR-MANAGEMENT STANDARDS... OF 1959 Dates and Scope of Application § 452.137 Effective dates. (a) Section 404 states when...

  2. 25 CFR 137.6 - Power development.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Power development. 137.6 Section 137.6 Indians BUREAU OF... CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.6 Power development. The cost of the power development at... power development shall be disposed of as required by the terms and conditions of the act of March...

  3. Lanthanide doped strontium-barium cesium halide scintillators

    Science.gov (United States)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew

    2015-06-09

    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  4. History and challenges of barium titanate: Part I

    Directory of Open Access Journals (Sweden)

    Vijatović M.M.

    2008-01-01

    Full Text Available Barium titanate is the first ferroelectric ceramics and a good candidate for a variety of applications due to its excellent dielectric, ferroelectric and piezoelectric properties. Barium titanate is a member of a large family of compounds with the general formula ABO3 called perovskites. Barium titanate can be prepared using different methods. The synthesis method depends on the desired characteristics for the end application. The used method has a significant influence on the structure and properties of barium titanate materials. In this review paper, Part I contains a study of the BaTiO3 structure and frequently used synthesis methods.

  5. Thermochemical hydrogen production via a cycle using barium and sulfur: reaction between barium sulfide and water

    Energy Technology Data Exchange (ETDEWEB)

    Ota, K.; Conger, W.L.

    1977-01-01

    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653 to 866/sup 0/C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. The rate of formation of hydrogen can be expressed as: RH2 = 1.07 x 10/sup -2/ exp (-3180/RT) (mol H/sub 2//mol BaS s). Hydrogen sulfide was produced during the initial period of reaction and the quantity of hydrogen sulfide formed during this period decreased as the temperature of reaction was increased.

  6. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department`s mission as stated in that document. ``The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.``

  7. Mars at Ls 137o

    Science.gov (United States)

    2006-01-01

    13 November 2006 These images capture what Mars typically looks like in mid-afternoon at Ls 137o. In other words, with the exception of occasional differences in weather and polar frost patterns, this is what the red planet looks like this month (November 2006). Six views are shown, including the two polar regions. These are composites of 24-26 Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) daily global mapping images acquired at red and blue wavelengths. The 'hole' over the south pole is an area where no images were obtained, because this polar region is enveloped in wintertime darkness. Presently, it is summer in the northern hemisphere and winter in the southern hemisphere. Ls, solar longitude, is a measure of the time of year on Mars. Mars travels 360o around the Sun in 1 Mars year. The year begins at Ls 0o, the start of northern spring and southern autumn. Northern summer/southern winter begins at Ls 90o, northern autumn/southern spring start at Ls 180o, and northern winter/southern summer begin at Ls 270o. Ls 137o occurs in the middle of this month (November 2006). The pictures show how Mars appeared to the MOC wide angle cameras at a previous Ls 137o in March 2001. The six views are centered on the Tharsis region (upper left), Acidalia and Mare Eyrthraeum (upper right), Syrtis Major and Hellas (middle left), Elysium and Mare Cimmeria (middle right), the north pole (lower left), and the south pole (lower right).

  8. Determination of {sup 135}Cs and {sup 137}Cs in environmental samples: A review

    Energy Technology Data Exchange (ETDEWEB)

    Russell, B.C., E-mail: ben.russell@npl.co.uk [GAU-Radioanalytical, Ocean and Earth Science, University of Southampton, National Oceanography Centre, Southampton, SO14 3ZH (United Kingdom); National Physical Laboratory, Hampton Road, Teddington, Middlesex, TW11 0LW (United Kingdom); Croudace, Ian W.; Warwick, Phil E. [GAU-Radioanalytical, Ocean and Earth Science, University of Southampton, National Oceanography Centre, Southampton, SO14 3ZH (United Kingdom)

    2015-08-26

    Radionuclides of caesium are environmentally important since they are formed as significant high yield fission products ({sup 135}Cs and {sup 137}Cs) and activation products ({sup 134}Cs and {sup 136}Cs) during nuclear fission. They originate from a range of nuclear activities such as weapons testing, nuclear reprocessing and nuclear fuel cycle discharges and nuclear accidents. Whilst {sup 137}Cs, {sup 134}Cs and {sup 136}Cs are routinely measurable at high sensitivity by gamma spectrometry, routine detection of long-lived {sup 135}Cs by radiometric methods is challenging. This measurement is, however, important given its significance in long-term nuclear waste storage and disposal. Furthermore, the {sup 135}Cs/{sup 137}Cs ratio varies with reactor, weapon and fuel type, and accurate measurement of this ratio can therefore be used as a forensic tool in identifying the source(s) of nuclear contamination. The shorter-lived activation products {sup 134}Cs and {sup 136}Cs have a limited application but provide useful early information on fuel irradiation history and have importance in health physics. Detection of {sup 135}Cs (and {sup 137}Cs) is achievable by mass spectrometric techniques; most commonly inductively coupled plasma mass spectrometry (ICP-MS), as well as thermal ionisation (TIMS), accelerator (AMS) and resonance ionisation (RIMS) techniques. The critical issues affecting the accuracy and detection limits achievable by this technique are effective removal of barium to eliminate isobaric interferences arising from {sup 135}Ba and {sup 137}Ba, and elimination of peak tailing of stable {sup 133}Cs on {sup 135}Cs. Isobaric interferences can be removed by chemical separation, most commonly ion exchange chromatography, and/or instrumental separation using an ICP-MS equipped with a reaction cell. The removal of the peak tailing interference is dependent on the instrument used for final measurement. This review summarizes and compares the analytical procedures

  9. Barium enema findings of milk allergy in infants

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Gyoung Ju; Kim, Mi Jeong; Lee, Hee Jung [Keimyung University School of Medicine, Daegu (Korea, Republic of)

    2006-09-15

    We wanted to evaluate the barium enema findings of milk allergy in infants. Retrospective evaluation of the plain abdominal radiography and barium enema findings was performed in fifteen young infants suffering with milk allergy. The presence of gaseous distension, rectal gas, paralytic ileus and mechanical obstruction was evaluated on the plain radiography. The presence of spasm, a transitional zone, a reversed rectosigmoid index and mucosal irregularity was analyzed on the barium enema; the presence of barium retention was also evaluated on 24-hour-delayed plain radiography. Paralytic ileus was the most common finding on the plain radiography (93%). On the barium enema, continuous spasm of the colon, ranging from the rectum to the descending colon, was revealed in ten infants (67%). A transitional zone was observed in one infant and a reversed rectosigmoid index was revealed in four. Mucosal irregularity was observed in two infants. Barium retention was demonstrated in 11 of fifteen cases: throughout the entire colon (n = 3), from the rectum to the descending colon (n = 7), and up to the transverse colon (n = 1). The most common barium enema finding of milk allergy in infants was spasm of the distal colon. The other findings were a transitional zone, a reversed rectosigmoid index, mucosal irregularity and barium retention.

  10. [Silica, aluminum, iron, sulfur, and barium in a urinary calculus].

    Science.gov (United States)

    Rodríguez-Miñón Cifuentes, J L; Salvador, E; Bellanato, J; Medina, J A

    1994-05-01

    Presentation of the analytical results by Sweep Microscopy of a small papillary calculus spontaneously eliminated after a nephritic colic. The main component is monohydrate calcium oxalate. When the stone core was analyzed with EDAX, silica, aluminium, iron, sulphur and barium were detected. The origin of these elements is discussed and the presence of barium emphasized as exceptional.

  11. Scattering lengths of calcium and barium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Dammalapati, U.; Willmann, L.; Knoop, S. [Kernfysisch Versneller Instituut (KVI), University of Groningen, Zernikelaan 25, 9747 AA Groningen (Netherlands); LaserLaB Vrije Universiteit, De Boelelaan 1081, 1081 HV Amsterdam (Netherlands)

    2011-11-15

    We have calculated the s-wave scattering length of all the even isotopes of calcium (Ca) and barium (Ba) in order to investigate the prospect of Bose-Einstein condensation (BEC). For Ca we have used an accurate molecular potential based on detailed spectroscopic data. Our calculations show that Ca does not provide other isotopes alternative to the recently Bose condensed {sup 40}Ca that suffers strong losses because of a very large scattering length. For Ba we show by using a model potential that the even isotopes cover a broad range of scattering lengths, opening the possibility of BEC for at least one of the isotopes.

  12. Barium appendicitis: A single institution review in Japan

    Science.gov (United States)

    Katagiri, Hideki; Lefor, Alan Kawarai; Kubota, Tadao; Mizokami, Ken

    2016-01-01

    AIM To review clinical experience with barium appendicitis at a single institution. METHODS A retrospective review of patients admitted with a diagnosis of acute appendicitis, from January 1, 2013 to December 31, 2015 was performed. Age, gender, computed tomography (CT) scan findings if available, past history of barium studies, pathology, and the presence of perforation or the development of complications were reviewed. If the CT scan revealed high density material in the appendix, the maximum CT scan radiodensity of the material is measured in Hounsfield units (HU). Barium appendicitis is defined as: (1) patients diagnosed with acute appendicitis; (2) the patient has a history of a prior barium study; and (3) the CT scan shows high density material in the appendix. Patients who meet all three criteria are considered to have barium appendicitis. RESULTS In total, 396 patients were admitted with the diagnosis of acute appendicitis in the study period. Of these, 12 patients (3.0%) met the definition of barium appendicitis. Of these 12 patients, the median CT scan radiodensity of material in the appendix was 10000.8 HU, ranging from 3066 to 23423 HU (± 6288.2). In contrast, the median CT scan radiodensity of fecaliths in the appendix, excluding patients with barium appendicitis, was 393.1 HU, ranging from 98 to 2151 HU (± 382.0). The CT scan radiodensity of material in the appendices of patients with barium appendicitis was significantly higher than in patients with nonbarium fecaliths (P < 0.01). CONCLUSION Barium appendicitis is not rare in Japan. Measurement of the CT scan radiodensity of material in the appendix may differentiate barium appendicitis from routine appendicitis.

  13. The Novel Formation of Barium Titanate Nanodendrites

    Directory of Open Access Journals (Sweden)

    Chien-Jung Huang

    2014-01-01

    Full Text Available The barium titanate (BaTiO3 nanoparticles with novel dendrite-like structures have been successfully fabricated via a simple coprecipitation method, the so-called BaTiO3 nanodendrites (BTNDs. This method was remarkable, fast, simple, and scalable. The growth solution is prepared by barium chloride (BaCl2, titanium tetrachloride (TiCl4, and oxalic acid. The shape and size of BaTiO3 depend on the amount of added BaCl2 solvent. To investigate the influence of amount of BaCl2 on BTNDs, the amount of BaCl2 was varied in the range from 3 to 6 mL. The role of BaCl2 is found to have remarkable influence on the morphology, crystallite size, and formation of dendrite-like structures. The thickness and length of the central stem of BTND were ~300 nm and ~20 μm, respectively. The branchings were found to occur at irregular intervals along the main stem. Besides, the formation mechanism of BTND is proposed and discussed.

  14. NANOSCALE BARIUM HYDROSILICATES: CHOOSING THE SYNTHESIS TECHNOLOGY

    Directory of Open Access Journals (Sweden)

    GRISHINA Anna Nikolaevna

    2013-08-01

    Full Text Available Cement concretes are the most used materials in modern civil engineering. Due to that such materials draw great attention both in the Russian Federation and abroad. The possibility to enhance the manufacturability and operational properties of concretes results in significant reduction of overall operating costs. Many enhancement methods have been elaborated. Among them there is one based on introduction of calcium hydrosilicates into construction composition. The authors set up a hypothesis that similarity between properties and structures of different hydrosilicates (for example, alkaline earth metals and metals of the second group will provide similar increased operational characteristics. The specialists of Research and Educational Center «Nanotechnology» are developing cement composites nanomodification methods which include introduction of nanodimensional barium hydrosilicates particles. The synthesis of barium hydrosilicates particles can be done with the use of many technologies, different by energy consumption or performing complexity. Taking into account both these factors, one can assume that low-temperature sol-gel synthesis from diluted water solutions is the proper technology. The present paper shows that this assumption is correct. The selection of certain technology is made by the means of multiobjective optimization, which is in turn is performed by the means of linear scalarization. This method, while not always giving the Pareto optimal solutions, can be easily implemented. The particle size distribution is taken into consideration during selection of objectives and weights. It is shown that selected technology allows manufacturing nanoparticles with median size about 30 nm.

  15. Dicty_cDB: SLA137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA137 (Link to dictyBase) - - - Contig-U16449-1 SLA137Z (Link... to Original site) - - SLA137Z 491 - - - - Show SLA137 Library SL (Link to library) Clone ID SLA137 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA1-B/SLA137Q.Seq.d/ Representative seq. ID SLA13...7Z (Link to Original site) Representative DNA sequence >SLA137 (SLA137Q) /CSM/SL/SLA1-B/SLA137Q.Seq.d/ XXXXX...ATAAAAAAAAAAAAAAAA sequence update 1997. 5. 8 Translated Amino Acid sequence ---AWVDENGGGTMIPVSVSFEKALLDLSSD

  16. Dicty_cDB: VSI137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSI137 (Link to dictyBase) - - - - VSI137P (Link to Original site) VSI137F 60 VSI...dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI...1-B/VSI137Q.Seq.d/ Representative seq. ID VSI137P (Link to Original si...flsnhfkkk--- ---ymq Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VSI137 (VSI...137Z 12 VSI137P 72 - - Show VSI137 Library VS (Link to library) Clone ID VSI137 (Link to

  17. Strengthening mechanism of steels treated by barium-bearing alloys

    Institute of Scientific and Technical Information of China (English)

    Zhouhua Jiang; Yang Liu

    2008-01-01

    The deoxidation, desulfurization, dephosphorization, microstructure, and mechanical properties of steels treated by barium-bearing alloys were investigated in laboratory and by industrial tests. The results show that barium takes part in the deoxidation reaction at the beginning of the experiments, generating oxide and sulfide compound inclusions, which easily float up from the molten steel, leading to the rapid reduction of total oxygen content to a very low level. The desulfurization and dephosphorization capabilities of calcium-bearing alloys increase with the addition of barium. The results of OM and SEM observations and mechanical property tests show that the structure of the steel treated by barium-bearing alloys is refined remarkably, the iamellar thickness of pearlitic structure decreases, and the pearlitic morphology shows clustering distribution. Less barium exists in steel substrate and the enrichment of barium-bearing precipitated phase mostly occurs in grain boundary and phase boundary, which can prevent the movement of grain boundary and dislocation during the heat treatment and the deformation processes. Therefore, the strength and toughness of barium-treated steels are improved by the effect of grain-boundary strengthening and nail-prick dislocation.

  18. A direct molecular link between the autism candidate gene RORa and the schizophrenia candidate MIR137

    Science.gov (United States)

    Devanna, Paolo; Vernes, Sonja C.

    2014-02-01

    Retinoic acid-related orphan receptor alpha gene (RORa) and the microRNA MIR137 have both recently been identified as novel candidate genes for neuropsychiatric disorders. RORa encodes a ligand-dependent orphan nuclear receptor that acts as a transcriptional regulator and miR-137 is a brain enriched small non-coding RNA that interacts with gene transcripts to control protein levels. Given the mounting evidence for RORa in autism spectrum disorders (ASD) and MIR137 in schizophrenia and ASD, we investigated if there was a functional biological relationship between these two genes. Herein, we demonstrate that miR-137 targets the 3'UTR of RORa in a site specific manner. We also provide further support for MIR137 as an autism candidate by showing that a large number of previously implicated autism genes are also putatively targeted by miR-137. This work supports the role of MIR137 as an ASD candidate and demonstrates a direct biological link between these previously unrelated autism candidate genes.

  19. Barium concentration in grain of Aegilops and Triticum species

    Directory of Open Access Journals (Sweden)

    Denčić Srbislav S.

    2015-01-01

    Full Text Available The aim of this study was to evaluate the concentration of barium in grain of various Aegilops and Triticum species with different genomes. The studied species differed significantly with respect to the concentration of barium. The grain of wild diploid Aegilops speltoides, the donor of B genome, contained significantly higher Ba concentration than all other analyzed genotypes. Wild and cultivated tetraploid wheats (Triticum diciccoides, Triticum dicoccon, Triticum turgidum and Triticum durum had the lowest Ba concentration in grain. The modern cultivated hexaploid varieties presented substantial variation in grain concentration of barium. The highest Ba concentration (3.42 mg/kg occurred in Serbian winter wheat variety Panonnia.

  20. 7 CFR 4279.137 - Financial statements.

    Science.gov (United States)

    2010-01-01

    ... § 4279.137 Financial statements. (a) The lender will determine the type and frequency of submission of financial statements by the borrower. At a minimum, annual financial statements prepared by an accountant in... 7 Agriculture 15 2010-01-01 2010-01-01 false Financial statements. 4279.137 Section...

  1. 21 CFR 137.165 - Enriched flour.

    Science.gov (United States)

    2010-04-01

    ... riboflavin, 24 milligrams of niacin, 0.7 milligrams of folic acid, and 20 milligrams of iron. (b) It may... calcium or wheat germ is excluded in calculating ash content. (f) All ingredients from which the food is... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched flour. 137.165 Section 137.165 Food...

  2. Chemical abundance analysis of 19 barium stars

    CERN Document Server

    Yang, G C; Spite, M; Chen, Y Q; Zhao, G; Zhang, B; Liu, G Q; Liu, Y J; Liu, N; Deng, L C; Spite, F; Hill, V; Zhang, C X

    2016-01-01

    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures, surface gravities, metallicity and microturbulent velocity) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their light elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn and Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-ca...

  3. Dicty_cDB: SLE137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE137 (Link to dictyBase) - - - Contig-U15038-1 SLE137Z (Link... to Original site) - - SLE137Z 528 - - - - Show SLE137 Library SL (Link to library) Clone ID SLE137 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLE1-B/SLE137Q.Seq.d/ Representative seq. ID SLE13...7Z (Link to Original site) Representative DNA sequence >SLE137 (SLE137Q) /CSM/SL/SLE1-B/SLE137Q.Seq.d/ XXXXX...40 (VSA140Q) /CSM/VS/VSA1-B/VSA140Q.Seq.d/ 1001 0.0 SLE137 (SLE137Q) /CSM/SL/SLE1-B/SLE137Q.Seq.d/ 1001 0.0

  4. Dicty_cDB: VSD137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSD137 (Link to dictyBase) - - - Contig-U12366-1 VSD137P (Link to Original site) VSD1...37F 304 VSD137Z 282 VSD137P 586 - - Show VSD137 Library VS (Link to library) Clone ID VSD1... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSD1-B/VSD137Q.Seq.d/ Representative seq. ID VSD1...37P (Link to Original site) Representative DNA sequence >VSD137 (VSD137Q) /CSM/VS/VSD1-B/VSD1...-151 VSE776 (VSE776Q) /CSM/VS/VSE7-D/VSE776Q.Seq.d/ 535 e-151 VSD137 (VSD137Q) /CSM/VS/VSD1-B/VSD137Q.Seq.d/

  5. Dicty_cDB: CHS137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS137 (Link to dictyBase) - - - Contig-U16475-1 - (Link to Original site) - - CHS13...7Z 598 - - - - Show CHS137 Library CH (Link to library) Clone ID CHS137 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHS1-B/CHS137Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHS137 (CHS137Q) /CSM/CH/CHS1-B/CHS137Q.Seq.d/ XXXXXXXXXXATGTGTA... wall 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for CHS137 is cyt

  6. Experimental determination of barium isotope fractionation during diffusion and adsorption processes at low temperatures

    Science.gov (United States)

    van Zuilen, Kirsten; Müller, Thomas; Nägler, Thomas F.; Dietzel, Martin; Küsters, Tim

    2016-08-01

    Variations in barium (Ba) stable isotope abundances measured in low and high temperature environments have recently received increasing attention. The actual processes controlling Ba isotope fractionation, however, remain mostly elusive. In this study, we present the first experimental approach to quantify the contribution of diffusion and adsorption on mass-dependent Ba isotope fractionation during transport of aqueous Ba2+ ions through a porous medium. Experiments have been carried out in which a BaCl2 solution of known isotopic composition diffused through u-shaped glass tubes filled with silica hydrogel at 10 °C and 25 °C for up to 201 days. The diffused Ba was highly fractionated by up to -2.15‰ in δ137/134Ba, despite the low relative difference in atomic mass. The time-dependent isotope fractionation can be successfully reproduced by a diffusive transport model accounting for mass-dependent differences in the effective diffusivities of the Ba isotope species (D137Ba /D134Ba =(m134 /m137) β). Values of β extracted from the transport model were in the range of 0.010-0.011. Independently conducted batch experiments revealed that adsorption of Ba onto the surface of silica hydrogel favoured the heavier Ba isotopes (α = 1.00015 ± 0.00008). The contribution of adsorption on the overall isotope fractionation in the diffusion experiments, however, was found to be small. Our results contribute to the understanding of Ba isotope fractionation processes, which is crucial for interpreting natural isotope variations and the assessment of Ba isotope ratios as geochemical proxies.

  7. Upper gastrointestinal barium evaluation of duodenal pathology: A pictorial review

    Institute of Scientific and Technical Information of China (English)

    Pankaj; Gupta; Uma; Debi; Saroj; Kant; Sinha; Kaushal; Kishor

    2014-01-01

    Like other parts of the gastrointestinal tract(GIT), duodenum is subject to a variety of lesions both congenital and acquired. However, unlike other parts of the GIT viz. esophagus, rest of the small intestine and large intestine, barium evaluation of duodenal lesions is technically more challenging and hence not frequently reported. With significant advances in computed tomography technology, a thorough evaluation including intraluminal, mural and extramural is feasible in a single non-invasive examination. Notwithstanding, barium evaluation still remains the initial and sometimes the only imaging study in several parts of the world. Hence,a thorough acquaintance with the morphology of various duodenal lesions on upper gastrointestinal barium examination is essential in guiding further evaluation. We reviewed our experience with various common and uncommon barium findings in duodenal abnormalities.

  8. A NOVEL HYDROTHERMAL SYNTHESIS METHOD FOR BARIUM FERRITE

    Institute of Scientific and Technical Information of China (English)

    Kang Li; Hongchen Gu; Qun Wei

    2004-01-01

    In the present work, fine barium ferrite powder has been synthesized through a one-step hydrothermal process in an autoclave at [OH-]/[Cl-] ratio of 2:1 in the temperature range from 180 to 260 ℃ using barium chloride (BaCl2), ferrous chloride (FeCl2) and potassium nitrate (KNO3) as the starting materials. Both particle size and saturation magnetization (Ms) increase with increasing hydrothermal reaction temperature, while the intrinsic coercivity (iHc) peaks at 685 Oe at 230 ℃. Morphology progress from the barium ferrite precursor particles to the barium hexaferrite particles has been monitored with increasing hydrothermal reaction time at 230 ℃ in the autoclave.

  9. Peritonite por bário Barium peritonitis

    Directory of Open Access Journals (Sweden)

    Gerson Alves Pereira Júnior

    1999-10-01

    Full Text Available We report a case of a 49 years-old man who underwent a barium meal examination for an epigastric pain. A perforated gastric ulcer with barium extravasation into peritoneal cavity was seen on X-rays. During an emergency laparotomy, a perforated pyloric ulcer was noted, along with barium contamination in the peritoneal cavity. The ulcer was closed with an omental patch and an extensive peritoneal lavage with saline was performed. During the postoperative period, the patient developed signs of peritonitis and underwent a new laparotomy was at the 9th day showing a subfrenic abscess with a large barium contamination. The patient presented septic shock and multiple organ failure. dying on the 21th day.

  10. Crystallographic properties of magnetron sputtered barium ferrite films

    Energy Technology Data Exchange (ETDEWEB)

    Capraro, S. [Laboratoire DIOM, University of Saint-Etienne, 23 rue Michelon, 42023 Saint-Etienne Cedex (France)]. E-mail: stephane.capraro@univ-st-etienne.fr; Berre, M. Le [LPM, UMR 5511, INSA Lyon, 7 av. Jean Capelle, 69621 Villeurbanne Cedex (France); Chatelon, J.P. [Laboratoire DIOM, University of Saint-Etienne, 23 rue Michelon, 42023 Saint-Etienne Cedex (France); Bayard, B. [Laboratoire DIOM, University of Saint-Etienne, 23 rue Michelon, 42023 Saint-Etienne Cedex (France); Joisten, H. [CEA-LETI, 17 rue des martyrs, 38041 Grenoble Cedex (France); Canut, C. [LPMCN, University Lyon I, 43 Bvd. du 11 novembre 1918, 69622 Villerbanne, Cedex (France); Barbier, D. [LPM, UMR 5511, INSA Lyon, 7 av. Jean Capelle, 69621 Villeurbanne Cedex (France); Rousseau, J.J. [Laboratoire DIOM, University of Saint-Etienne, 23 rue Michelon, 42023 Saint-Etienne Cedex (France)

    2004-09-15

    The development of devices combining a ferrite with a semiconductor chip is a major focus of current research. Barium hexaferrite (BaFe{sub 12}O{sub 19} or BaM) thick films are deposited here using a RF magnetron sputtering system. Films are amorphous and non magnetic after deposition. Post-deposition thermal annealing is employed to make the films crystallize. The effects of the substrate, thermal annealing process, thickness, substrate temperature on crystallographic properties and stoichiometry are studied using a X-ray diffractometry (XRD) and Rutherford back-scattering (RBS). The in-depth homogeneity of Ba, Fe and O is evaluated by secondary ion mass spectroscopy (SIMS). The study shows a good crystallization of BaM films and there is a preferential orientation among the crystallographic planes (1 0 1), (2 0 0), (2 0 3), (1 0 2), (1 1 0) and (2 0 5) when BaM films are prepared at low RF power and when the substrate is heated. For several elaboration parameters, grains size is in the range of 25 and 40 nm and BaM films are stoichiometric with regard to the target stoichiometry.

  11. Synthesis, photoluminescence and magnetic properties of barium vanadate nanoflowers

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Jing [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Chongqing University of Science and Technology, Chongqing 401331 (China); Hu, Chenguo, E-mail: hucg@cqu.edu.cn [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Xi, Yi [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Peng, Chen [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Wan, Buyong; He, Xiaoshan [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China)

    2011-06-15

    Graphical abstract: The flower-shaped barium vanadate was obtained for the first time. The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. Research highlights: {yields} In the paper, the flower-shaped barium vanadate were obtained for the first time. The CHM method used here is new and simple for preparation of barium vanadate. {yields} The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. The strong bluish-green emission was observed. {yields} The ferromagnetic behavior of the barium vanadate nanoflowers was found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g. {yields} The mechanisms of PL and magnetic property of barium vanadate nanoflowers have been discussed. -- Abstract: The flower-shaped barium vanadate has been obtained by the composite hydroxide mediated (CHM) method from V{sub 2}O{sub 5} and BaCl{sub 2} at 200 {sup o}C for 13 h. XRD and XPS spectrum of the as-synthesized sample indicate it is hexagonal Ba{sub 3}V{sub 2}O{sub 8} with small amount of Ba{sub 3}VO{sub 4.8} coexistence. Scan electron microscope and transmission electron microscope display that the flower-shaped crystals are composed of nanosheets with thickness of {approx}20 nm. The UV-visible spectrum shows that the barium vanadate sample has two optical gaps (3.85 eV and 3.12 eV). Photoluminescence spectrum of the barium vanadate flowers exhibits a visible light emission centered at 492 and 525 nm which might be attributed to VO{sub 4} tetrahedron with T{sub d} symmetry in Ba{sub 3}V{sub 2}O{sub 8}. The ferromagnetic behavior of the barium vanadate nanoflowers has been found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g, which is mainly due to the presence of a non

  12. Solar eclipse sign of intussusception on barium enema.

    Science.gov (United States)

    Raveenthiran, V

    2002-01-01

    The colographic appearance of intussusception is variously described as a claw sign, pincer defect, shouldering effect, and coiled-spring pattern. This report adds a new radiographic sign to the list. An end-on view of an intussusception on barium enema shows a ring of contrast resembling a solar eclipse. Familiarity with this bizarre appearance is desirable, lest it may be mistaken for spillage of barium due to a colonic perforation.

  13. Potential value of Cs-137 capsules

    Energy Technology Data Exchange (ETDEWEB)

    Bloomster, C.H.; Brown, D.R.; Bruno, G.A.; Hazelton, R.F.; Hendrickson, P.L.; Lezberg, A.J.; Tingey, G.L.; Wilfert, G.L.

    1985-04-01

    We determined the value of Cs-137 compared to Co-60 as a source for the irradiation of fruit (apples and cherries), pork and medical supplies. Cs-137, in the WESF capsule form, had a value of approximately $0.40/Ci as a substitute for Co-60 priced at approximately $1.00/Ci. The comparison was based on the available curies emitted from the surface of each capsule. We developed preliminary designs for fourteen irradiation facilities; seven were based on Co-60 and seven were based on Cs-137. These designs provided the basis for estimating capital and operating costs which, in turn, provided the basis for determining the value of Cs-137 relative to Co-60 in these applications. We evaluated the effect of the size of the irradiation facility on the value of Cs-137. The cost of irradiation is low compared to the value of the product. Irradiation of apples for disinfestation costs $.01 to .02 per pound. Irradiation for trichina-safe pork costs $.02 per pound. Irradiation of medical supplies for sterilization costs $.07 to .12 per pound. The cost of the irradiation source, either Co-60 or Cs-137, contributed only a minor amount to the total cost of irradiation, about 5% for the fruit and hog cases and about 20% for the medical supply cases. We analyzed the sensitivity of the irradiation costs and Cs-137 value to several key assumptions.

  14. Electrorheological behavior of rare earth-doped barium titanate suspensions

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Doping Y, La, Ce into barium titanate is found to be able to improve its electrorheological (ER) effect in DC electrical field. The yield stress of a typical doped barium titanate/silicone oil suspension is approximately 3.2 -*7〗kPa at 3.5 -*7〗kV/mm, which is 10 times larger than that of pure barium titanate/silicone oil suspensions. The ER effect increases with the decrease of ionic radius of rare earth (RE) dopant when RE concentration remains constant, and the suspensions exhibit a relatively high shear stress when Y, La, Ce mole fractions are 15%, 10%~15%, and 5%, respectively. Dielectric measurements show that the suitable doping with RE element increases dielectric loss of barium titanate and causes very marked dielectric relaxation at low frequency. By measuring X-ray diffraction patterns of doped barium titanate, it is considered that the occurrence of lattice distortion or defects may be responsible for the change of dielectric properties which results in the improvement of ER effect of barium titanate in DC electrical field.

  15. Lifetime Measurement for 6snp Rydberg States of Barium

    Institute of Scientific and Technical Information of China (English)

    SHEN Li; WANG Lei; YANG Hai-Feng; LIU Xiao-Jun; LIU Hong-Ping

    2011-01-01

    @@ We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states.This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence.The lifetimes determined with our method for barium Rydberg 6snp(n=37-59)series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J.Phys.B 14(1981)4489, 29(1996)655]on experiments.%We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states. This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence. The lifetimes determined with our method for barium Rydberg 6snp (n=37-59) series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J. Phys. B 14 (1981) 4489, 29 (1996) 655] onexperiments.

  16. Study of the 137Cs Stabilizer Source

    Directory of Open Access Journals (Sweden)

    GAO Yan;WANG Yan-ling;XU Zhi-jian;XU Liang;REN Chun-xia;TAN Xiao-ming;CUI Hong-qi

    2014-02-01

    Full Text Available The attenuation laws of the Cesium -137 γ-ray penetrating the ceramic core、stainless steel and tungsten steel were studied. The radioactivity of the 137Cs stabilizer source was determined through the surface dose rate of 137Cs stabilizer sources. In addition, the adsorption properties of the ceramic core were studied to improve the stability of the output rate, and established a production line. The application results showed that the output rate of ray source was accurate and was of a good consistency. At present, the source had been used in logging lithology, and achieved the realization of domestic product.

  17. Standardization of 137mCs+137mBa by Liquid Scintillation; Calibracion de 137Cs+137mBa por Centelleo Liquido

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, L.; Los Arcos, J.M.; Grau, A.

    1995-07-01

    A procedure for the preparation of a stable, homogeneous solution of 137Cs+''137mBa, for use in liquid scintillation measurements, is described. Its count rate stability and spectral time evolution has been followed for several weeks. The solution has been standardised by the CIEMAT/NIST method in both Ultima-Gold and Insta-Gel, to a combined uncertainty lower than 0,51 % (k=l). (Author) 5 refs.

  18. High H- ionic conductivity in barium hydride

    Science.gov (United States)

    Verbraeken, Maarten C.; Cheung, Chaksum; Suard, Emmanuelle; Irvine, John T. S.

    2015-01-01

    With hydrogen being seen as a key renewable energy vector, the search for materials exhibiting fast hydrogen transport becomes ever more important. Not only do hydrogen storage materials require high mobility of hydrogen in the solid state, but the efficiency of electrochemical devices is also largely determined by fast ionic transport. Although the heavy alkaline-earth hydrides are of limited interest for their hydrogen storage potential, owing to low gravimetric densities, their ionic nature may prove useful in new electrochemical applications, especially as an ionically conducting electrolyte material. Here we show that barium hydride shows fast pure ionic transport of hydride ions (H-) in the high-temperature, high-symmetry phase. Although some conductivity studies have been reported on related materials previously, the nature of the charge carriers has not been determined. BaH2 gives rise to hydride ion conductivity of 0.2 S cm-1 at 630 °C. This is an order of magnitude larger than that of state-of-the-art proton-conducting perovskites or oxide ion conductors at this temperature. These results suggest that the alkaline-earth hydrides form an important new family of materials, with potential use in a number of applications, such as separation membranes, electrochemical reactors and so on.

  19. Thermal decomposition of barium valerate in argon

    DEFF Research Database (Denmark)

    Torres, P.; Norby, Poul; Grivel, Jean-Claude

    2015-01-01

    degrees C and evidence was found for the solidification of the melt at 380-440 degrees C, i.e. simultaneously with the onset of decomposition. Between 400 degrees C and 520 degrees C (Ba(C4H9CO2)(2) decomposes in two main steps, first into BaCO3 with release of C4H9COC4H9 (5-nonanone), whereas final......The thermal decomposition of barium valerate (Ba(C4H9CO2)(2)/Ba-pentanoate) was studied in argon by means of thermogravimetry, differential thermal analysis, IR-spectroscopy, X-ray diffraction and hot-stage optical microscopy. Melting takes place in two different steps, at 200 degrees C and 280...... conversion to BaO takes place with release of CO2. Elemental carbon that is left as a by-product is finally slowly burned by the residual oxygen present in the Ar atmosphere. (C) 2015 Elsevier B.V. All rights reserved....

  20. Chemical compositions of four barium stars

    CERN Document Server

    Liang, Y C; Chen, Y Q; Qiu, H M; Zhang, B

    2003-01-01

    Chemical compositions of four barium stars HD 26886, HD 27271, HD 50082 and HD 98839 are studied based on high resolution, high signal-to-noise Echelle spectra. Results show that all of them are disk stars. Their \\alpha and iron peak elements are similar to the solar abundances. The neutron-capture process elements are overabundant relative to the Solar. The heavy-element abundances of the strong Ba star HD 50082 are higher than those of other three mild Ba stars. Its mass is 1.32Msun (+0.28,-0.22Msun), and is consistent with the average mass of strong Ba stars (1.5Msun). For mild Ba star HD 27271 and HD 26886, the derived masses are 1.90Msun (+0.25,-0.20Msun) and 2.78Msun (+0.75,-0.78M_sun), respectively, which are consistent with the average mass of mild Ba stars. We also calculate the theoretical abundances of Ba stars by combining the AGB stars nucleosynthesis and wind accretion formation scenario of Ba binary systems. The comparisons between the observed abundance patterns of the sample stars with the th...

  1. Dicty_cDB: SLD137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLD137 (Link to dictyBase) - - - Contig-U16379-1 SLD137E (Link... to Original site) - - - - - - SLD137E 288 Show SLD137 Library SL (Link to library) Clone ID SLD137 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLD1-B/SLD137Q.Seq.d/ Representative seq. ID SLD13...7E (Link to Original site) Representative DNA sequence >SLD137 (SLD137Q) /CSM/SL/SLD1-B/SLD137Q.Seq.d/ AAAAA...ology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLD137 (SLD1

  2. Both barium and calcium activate neuronal potassium currents

    Energy Technology Data Exchange (ETDEWEB)

    Ribera, A.B.; Spitzer, N.C.

    1987-09-01

    Amphibian spinal neurons in culture possess both rapidly inactivating and sustained calcium-dependent potassium current components, similar to those described for other cells. Divalent cation-dependent whole-cell outward currents were isolated by subtracting the voltage-dependent potassium currents recorded from Xenopus laevis neurons in the presence of impermeant cadmium from the currents produced without cadmium but in the presence of permeant divalent cations. These concentrations of permeant ions were low enough to avoid contamination by macroscopic inward currents through calcium channels. Calcium-dependent potassium currents were reduced by 1 ..mu..M tetraethylammonium. These currents can also be activated by barium or strontium. Barium as well as calcium activated outward currents in young neurons (6-8 hr) and in relatively mature neurons (19-26 hr in vitro). However, barium influx appeared to suppress the sustained voltage-dependent potassium current in most cells. Barium also activated at least one class of potassium channels observed in excised membrane patches, whole blocking others. The blocking action may have masked and hindered detection of the stimulatory action of barium in other systems.

  3. 21 CFR 137.205 - Bromated whole wheat flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bromated whole wheat flour. 137.205 Section 137... Cereal Flours and Related Products § 137.205 Bromated whole wheat flour. Bromated whole wheat flour... of ingredients, prescribed for whole wheat flour by § 137.200, except that potassium bromate is...

  4. Sputtered Modified Barium Titanate for Thin-Film Capacitor Applications

    Directory of Open Access Journals (Sweden)

    Robert Mamazza

    2012-04-01

    Full Text Available New apparatus and a new process for the sputter deposition of modified barium titanate thin-films were developed. Films were deposited at temperatures up to 900 °C from a Ba0.96Ca0.04Ti0.82Zr0.18O3 (BCZTO target directly onto Si, Ni and Pt surfaces and characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray photoelectron spectroscopy (XPS. Film texture and crystallinity were found to depend on both deposition temperature and substrate: above 600 °C, the as-deposited films consisted of well-facetted crystallites with the cubic perovskite structure. A strongly textured Pt (111 underlayer enhanced the (001 orientation of BCZTO films deposited at 900 °C, 10 mtorr pressure and 10% oxygen in argon. Similar films deposited onto a Pt (111 textured film at 700 °C and directly onto (100 Si wafers showed relatively larger (011 and diminished intensity (00ℓ diffraction peaks. Sputter ambients containing oxygen caused the Ni underlayers to oxidize even at 700 °C: Raising the process temperature produced more diffraction peaks of NiO with increased intensities. Thin-film capacitors were fabricated using ~500 nm thick BCZTO dielectrics and both Pt and Ni top and bottom electrodes. Small signal capacitance measurements were carried out to determine capacitance and parallel resistance at low frequencies and from these data, the relative permittivity (er and resistivity (r of the dielectric films were calculated; values ranged from ~50 to >2,000, and from ~104 to ~1010 Ω∙cm, respectively.

  5. Distribution of cesium-137 in reindeer

    Directory of Open Access Journals (Sweden)

    Kristina Rissanen

    1990-08-01

    Full Text Available The influence of the Chernobyl accident in 1986 on the Finnish reindeer herding area was much smaller than the effects of the nuclear bomb tests in the 1960s. Only in one small area somewhat more Cs-137 was deposited than in the rest of the reindeer herding area. From that area 20 reindeer were chosen for investigation of the distribution of Cs-137. All tissues, organs, the skeleton, digestive tract, hide, head and hooves were sampled quantitatively. Three reindeer were pregnant and also the foetuses were studied. The Cs-137 amounts were determined by gammaspectrometric measurements. The results showed that the differences in the Cs-137 concentrations between muscle tissue from different parts of an individual reindeer were not more than 10 percent. Thus it is not essential from which part of the reindeer meat samples for surveillance purposes are taken. The concentration of Cs-137 in edible tissues other than muscle was lower except in the kidneys and scapula cartilage.

  6. Durability of Alite-calcium Barium Sulphoaluminate Cement

    Institute of Scientific and Technical Information of China (English)

    LU Lingchao; LU Zeye; LIU Shiquan; WANG Shoude; CHENG Xin

    2009-01-01

    The durability of the cement was mainly studied.Under 1.0 MPa of hydraulic pressure for 8 hours,water could penetrate completely through the sample made by portland cement,but could not penetrate through that by alite-barium sulphoaluminate cement.Under the condition of freezing and thawing cycle,the loss ratio of compressive strength of the cement was only about 17.3%at curing 28 d ages,but the loss of portland cement was as high as 29.5%.Alite-calcium bar-ium sulphoaluminate cement also has an excellent resistance to sulfate attack.The coefficients of resistance to sulfate attack of the cement exceeded 1.0.Meanwhile,the composition and microstructure of the hardened paste of alite-calcium barium sulphoaluminate cement were analyzed by XRD and SEM.

  7. Barium titanate thick films prepared by screen printing technique

    Directory of Open Access Journals (Sweden)

    Mirjana M. Vijatović

    2010-06-01

    Full Text Available The barium titanate (BaTiO3 thick films were prepared by screen printing technique using powders obtained by soft chemical route, modified Pechini process. Three different barium titanate powders were prepared: i pure, ii doped with lanthanum and iii doped with antimony. Pastes for screen printing were prepared using previously obtained powders. The thick films were deposited onto Al2O3 substrates and fired at 850°C together with electrode material (silver/palladium in the moving belt furnace in the air atmosphere. Measurements of thickness and roughness of barium titanate thick films were performed. The electrical properties of thick films such as dielectric constant, dielectric losses, Curie temperature, hysteresis loop were reported. The influence of different factors on electrical properties values was analyzed.

  8. Deoxidation Behavior of Alloys Bearing Barium in Molten Steel

    Institute of Scientific and Technical Information of China (English)

    LI Yang; JIANG Zhou-hua; JIANG Mao-fa; WANG Jun-wen; GU Wen-bing

    2003-01-01

    The deoxidation behaviors of alloys bearing barium in pipe steel were researched with MgO crucible under argon atmosphere in MoSi2 furnace at 1 873 K. The total oxygen contents of molten steel, the distribution, size and morphology of deoxidation products in the steel were surveyed. The metamorphic mechanism for deoxidation products of alloy bearing barium was also discussed. The results show that applying alloy bearing barium to the pipe steel, very low total oxygen contents can be obtained, and deoxidation products, which easily float up from molten steel, can be changed into globular shape and uniformly distributed in steel. The equilibrium time of total oxygen is about 25 min, and the terminal total oxygen contents range from 0.002 0 % to 0.002 2 % after treating with SiCa wire. The best deoxidizers are SiAlBaCa and SiAlBaCaSr.

  9. Barium-borate-flyash glasses: As radiation shielding materials

    Science.gov (United States)

    Singh, Sukhpal; Kumar, Ashok; Singh, Devinder; Thind, Kulwant Singh; Mudahar, Gurmel S.

    2008-01-01

    The attenuation coefficients of barium-borate-flyash glasses have been measured for γ-ray photon energies of 356, 662, 1173 and 1332 keV using narrow beam transmission geometry. The photon beam was highly collimated and overall scatter acceptance angle was less than 3°. Our results have an uncertainty of less than 3%. These coefficients were then used to obtain the values of mean free path (mfp), effective atomic number and electron density. Good agreements have been observed between experimental and theoretical values of these parameters. From the studies of the obtained results it is reported here that from the shielding point of view the barium-borate-flyash glasses are better shields to γ-radiations in comparison to the standard radiation shielding concretes and also to the ordinary barium-borate glasses.

  10. 75 FR 36629 - Barium Chloride From the People's Republic of China: Continuation of Antidumping Duty Order

    Science.gov (United States)

    2010-06-28

    ... International Trade Administration Barium Chloride From the People's Republic of China: Continuation of... China: Final Results of Expedited Third Sunset Review of Antidumping Duty Order, 74 FR 55814 (October 29... Barium Chloride From China, 75 FR 33824 (June 15, 2010), and Barium Chloride from China (Inv. No....

  11. Esophageal intramural pseudodiverticulosis characterized by barium esophagography: a case report

    LENUS (Irish Health Repository)

    O'Connor, Owen J

    2010-05-21

    Abstract Introduction Esophageal intramural pseudodiverticulosis is a rare condition characterized by the dilatation of the submucosal glands. Case presentation We present a case of esophageal intramural pseudodiverticulosis in a 72-year-old Caucasian man who presented with dysphagia and with a background history of alcohol abuse. An upper gastrointestinal endoscopy of our patient showed an esophageal stricture with abnormal mucosal appearances, but no malignant cells were seen at biopsy. Appearances on a barium esophagram were pathognomonic for esophageal intramural pseudodiverticulosis. Conclusion We demonstrate the enduring usefulness of barium esophagography in the characterization of abnormal mucosal appearances at endoscopy.

  12. Photoionization and Photoelectric Loading of Barium Ion Traps

    CERN Document Server

    Steele, A V; Churchill, L R; Griffin, P F

    2007-01-01

    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading technique that employs an in-expensive UV epoxy curing lamp to generate photoelectrons.

  13. Psalm 137 en die beryming van wraakpsalms

    Directory of Open Access Journals (Sweden)

    H. F. van Rooy

    2009-07-01

    Full Text Available Psalm 137 and metrical versions of imprecatory psalms This article discusses seven metrical versions of the im- precatory section of Psalm 137, two in Dutch (1773 and 1968, two in English (in the “Psalter hymnal” of the Christian Re- formed Church and in “Sing psalms” of the Free Church of Scotland and three Afrikaans versions (J.D. du Toit, T.T. Cloete and Lina Spies, looking at the way in which these versions treated this section. This is done in the light of recent research on Psalm 137, and especially the imprecatory section. In the literature questions are asked about the singing of this kind of psalm in the church, but also about the omission or softening of this part of Psalm 137 in the versions of Cloete and Spies. The choice of melody, the number of strophes used and the division of the contents of the psalm in strophes play an important role in determining most of the omissions or alle- viations in the metrical versions. All seven the versions dis- cussed took the imprecatory section seriously. The problems raised against these versions can be ascribed to these choices, and not to a deliberate attempt to circumvent the problem of such an imprecatory section. The version of Spies is the only exception, with the omission of the last line of the psalm.

  14. 7 CFR 1150.137 - Procedure.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM Dairy Promotion and Research Order National Dairy Promotion and Research Board § 1150.137 Procedure. (a) A majority of the...

  15. 42 CFR 137.280 - Construction Definitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Construction Construction Definitions § 137... environmental assessment nor an environmental impact statement is required. Any procedures under this section... environmental effect. CEQ means Council on Environmental Quality in the Office of the President....

  16. Barium Ferrite Films Grown By Pulsed Laser Ablation

    NARCIS (Netherlands)

    Lisfi, A.; Lodder, J.C.; Haan, de P.; Roesthuis, F.J.G.

    1998-01-01

    Abstract available only. It is known that barium ferrite (BaFe12019) can grow with perpendicular anisotropy on A1203 a single crystal substrate,' but also on an amorphous substrate by using a ZnO buffer.2 Because of its large magnetic anisotropy which can easily overcome the shape anisotropy of the

  17. Synthesis of Nanocrystalline Barium Ferrite in Ethanol/Water Media

    Institute of Scientific and Technical Information of China (English)

    M.Montazeri-Pour; A.Ataie

    2009-01-01

    Nanocrystalline particles of barium ferrite magnetic material have been prepared by co-precipitation route using aqueous and non-aqueous solutions of iron and barium chlorides with a Fe/Ba molar ratio of 11 and subsequent drying-annealing treatment. Water and ethanol/water mixture with volume ratio of 3:1 were used as solvents in the process. Coprecipitated powders were annealed at various temperatures for 1 h. FTIR (Fourier transform infrared spectroscopy), XRD (X-ray diffraction), DTA/TGA (differential thermal analy-sis/thermogravimetric analysis) and SEM (scanning electron microscopy) techniques were used to evaluate powder particle characteristics. DTA/TGA results confirmed by those obtained from XRD indicated that the formation of barium ferrite occurs in sample synthesized in ethanol/water solution at a relatively low temperature of 631℃. Nano-size particles of barium ferrite with mean particle size of almost 75 and 100 nm were observed in the SEM micrographs of the samples synthesized in ethanol/water solution after annealing at 700 and 800℃ for 1 h, respectively.

  18. Heavy ion recoil spectrometry of barium strontium titanate films

    Science.gov (United States)

    Stannard, W. B.; Johnston, P. N.; Walker, S. R.; Bubb, I. F.; Scott, J. F.; Cohen, D. D.; Dytlewski, N.; Martin, J. W.

    1995-05-01

    Thin films of barium strontium titanate have been analysed using heavy ion recoil spectrometry with 77 and 98 MeV 127I ions at the new heavy ion recoil facility at ANSTO, Lucas Heights. New calibration procedures have been developed for quantitative analysis. Energy spectra for each of the elements present reveal interdiffusion that was not previously known.

  19. Magnetoelastic coupling in epitaxial cobalt ferrite/barium titanate heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Gräfe, Joachim; Welke, Martin [Wilhelm-Ostwald-Institut für Physikalische und Theoretische Chemie, Universität Leipzig, Linnéstraße 2, 04103 Leipzig (Germany); Bern, Francis; Ziese, Michael [Institut für Experimentelle Physik II, Universität Leipzig, Linnéstraße 5, 04103 Leipzig (Germany); Denecke, Reinhard, E-mail: denecke@uni-leipzig.de [Wilhelm-Ostwald-Institut für Physikalische und Theoretische Chemie, Universität Leipzig, Linnéstraße 2, 04103 Leipzig (Germany)

    2013-08-15

    Ultra-thin cobalt ferrite films have been synthesised on ferroelectric barium titanate crystals. The cobalt ferrite films exhibit a magnetic response to strain induced by structural changes in the barium titanate substrate, suggesting a pathway to multiferroic coupling. These structural changes are achieved by heating through the phase transition temperatures of barium titanate. In addition the ferromagnetic signal of the substrate itself is taken into account, addressing the influence of impurities or defects in the substrate. The cobalt ferrite/barium titanate heterostructure is a suitable oxidic platform for future magnetoelectric applications with an established ferroelectric substrate and widely tuneable magnetic properties by changing the transition metal in the ferrite film. - Highlights: ► Ultra-thin CoFe{sub 2}O{sub 4} films grown on ferroelectric BaTiO{sub 3} crystals by PLD. ► Magnetic response to structural changes of BaTiO{sub 3} at transition temperatures. ► Significant magneto-elastic coupling of in-plane magnetisation in SQUID experiments. ► Clear distinction between contribution by BaTiO{sub 3} substrate and by CoFe{sub 2}O{sub 4} film.

  20. CNO and F abundances in the barium star HD 123396

    CERN Document Server

    Alves-Brito, Alan; Yong, David; Meléndez, Jorge; Vásquez, Sergio

    2011-01-01

    [Abridged] Barium stars are moderately rare chemically peculiar objects which are believed to be the result of the pollution of an otherwise normal star by material from an evolved companion on the asymptotic giant branch (AGB). We aim to derive carbon, nitrogen, oxygen, and fluorine abundances for the first time from infrared spectra of the barium red giant star HD 123396 to quantitatively test AGB nucleosynthesis models for producing barium stars via mass accretion. High-resolution and high S/N infrared spectra were obtained using the Phoenix spectrograph mounted at the Gemini South telescope. The abundances were obtained through spectrum synthesis of individual atomic and molecular lines, using the MOOG stellar line analysis program together with Kurucz's stellar atmosphere models. The analysis was classical, using 1D stellar models and spectral synthesis under the assumption of local thermodynamic equilibrium. We confirm that HD 123396 is a metal-deficient barium star ([Fe/H] = -1.05), with A(C) = 7.88, A...

  1. Excitation energies of barium oxide bands measured in flames

    NARCIS (Netherlands)

    Hurk, J. van der; Hollander, Tj.; Alkemade, C.T.J.

    1975-01-01

    Experiments are described that yield additional information about the excitation energy of visible barium oxide bands appearing in flames. Excitation energy differences are derived directly from the ratios of thermal band intensities as a function of temperature and agree with the value calculated f

  2. CD137分子及其肿瘤免疫治疗近况%Research progress of CD137 and tumor immunotherapy

    Institute of Scientific and Technical Information of China (English)

    李加涛; 张洪涛

    2013-01-01

    CD137 (4-1 BB),a member of the TNF receptor superfamily,is an activation-induced T-cell co-stimulatory molecule.Upon ligand binding,CD137 up-regulates survival genes,enhances cell division,induces cytokine production,and prevents activation-induced cell death in T cells.Growing evidence indicates that agonist anti-4-1BB monoclonal antibodies possess strong antitumor properties,and combination therapy of anti-4-1 BB with other anticancer agents has robust tumor-regressing abilities against non-immunogenic or poorly immunogenic tumors.In addition,targeting of tumors with variants of 4-1BBL directed against 4-1BB also have potent antitumor effects.In this review,we discuss the basis of the therapeutic potential of targeting the 4-1BB-4-1 BBL pathway in cancer treatment.%CD137(4-1BB,ILA,TNFRSF9)分子是介导T细胞活化的协同刺激信号,经由CD137/CD137L信号通路增强免疫反应成为肿瘤免疫治疗的潜在靶点.CD137主要表达在活化的T细胞、自然杀伤细胞和树突状细胞(DC)等肿瘤免疫相关细胞,研究发现CD137配体或活化型CD137单抗介导的共刺激信号可促进T细胞等免疫细胞的增殖、诱导细胞因子的分泌以及减少活化诱导的细胞死亡(AICD),维持CD8+T细胞存活状态、增强NK活性.大量动物抗肿瘤尤其是低免疫源性肿瘤临床前实验,单独或者联合其它免疫调节分子作用于4-1BB/4-1BBL途径,已取得良好效果,为临床治疗研究奠定了基础.

  3. Reactive barriers for 137Cs retention.

    Science.gov (United States)

    Krumhansl, J L; Brady, P V; Anderson, H L

    2001-02-01

    137Cs was dispersed globally by cold war activities and, more recently, by the Chernobyl accident. Engineered extraction of 137Cs from soils and groundwaters is exceedingly difficult. Because the half-life of 137Cs is only 30.2 years, remediation might be more effective (and less costly) if 137Cs bioavailability could be demonstrably limited for even a few decades by use of a reactive barrier. Essentially permanent isolation must be demonstrated in those few settings where high nuclear level wastes contaminated the environment with 135Cs (half-life 2.3 x 10(6) years) in addition to 137Cs. Clays are potentially a low-cost barrier to Cs movement, though their long-term effectiveness remains untested. To identify optimal clays for Cs retention, Cs desorption was measured for five common clays: Wyoming Montmorillonite (SWy-1), Georgia Kaolinites (KGa-1 and KGa-2), Fithian Illite (F-Ill), and K-Metabentonite (K-Mbt). Exchange sites were pre-saturated with 0.16 M CsCl for 14 days and readily exchangeable Cs was removed by a series of LiNO3 and LiCl washes. Washed clays were then placed into dialysis bags and the Cs release to the deionized water outside the bags measured. Release rates from 75 to 139 days for SWy-1, K-Mbt and F-Ill were similar; 0.017% to 0.021% sorbed Cs released per day. Both kaolinites released Cs more rapidly (0.12% to 0.05% of the sorbed Cs per day). In a second set of experiments, clays were Cs-doped for 110 days and subjected to an extreme and prolonged rinsing process. All the clays exhibited some capacity for irreversible Cs uptake. However, the residual loading was greatest on K-Mbt (approximately 0.33 wt.% Cs). Thus, this clay would be the optimal material for constructing artifical reactive barriers.

  4. Target Oriented Drugs against Leishmania.

    Science.gov (United States)

    1980-01-31

    the leishmanial source. Leishmanial strains L32 Leishmania tropica LRC L32 L137 Leishmania tropica LRC L137 L52 Leishmania donovani LRC L52 These...RESOLUTION TEST CHAR] 0REPORT NUMBER I TARGET ORIENTED DRUGS AGAINST LEISHMANIA (First Annual Summary Report) 0URI ZEHAVI, PhD and JOSEPH EL-ON, PhD...GOVT ACCESSION NO. 3. RE PIENT.S CATALOG NUMBER A....*( - ) S. TYPE OF REPORT & PERIOD COVERED TARGET ORIENTED DRUGS AGAINST LEISHMANIA 6 FIRST

  5. 29 CFR 102.137 - Public observation of Board meetings.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Public observation of Board meetings. 102.137 Section 102.137 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.137 Public observation of Board meetings. Every portion of every meeting of...

  6. 7 CFR 4280.137 - Repurchase from holder.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Repurchase from holder. 4280.137 Section 4280.137... Efficiency Improvements Program Section B. Guaranteed Loans § 4280.137 Repurchase from holder. Any repurchase from a holder must be in accordance with § 4279.78 of this chapter....

  7. Quantitative Model for Estimating Soil Erosion Rates Using 137Cs

    Institute of Scientific and Technical Information of China (English)

    YANGHAO; GHANGQING; 等

    1998-01-01

    A quantitative model was developed to relate the amount of 137Cs loss from the soil profile to the rate of soil erosion,According th mass balance model,the depth distribution pattern of 137Cs in the soil profile ,the radioactive decay of 137Cs,sampling year and the difference of 137Cs fallout amount among years were taken into consideration.By introducing typical depth distribution functions of 137Cs into the model ,detailed equations for the model were got for different soil,The model shows that the rate of soil erosion is mainly controlled by the depth distrbution pattern of 137Cs ,the year of sampling,and the percentage reduction in total 137Cs,The relationship between the rate of soil loss and 137Cs depletion i neither linear nor logarithmic,The depth distribution pattern of 137Cs is a major factor for estimating the rate of soil loss,Soil erosion rate is directly related with the fraction of 137Cs content near the soil surface. The influences of the radioactive decay of 137Cs,sampling year and 137Cs input fraction are not large compared with others.

  8. 25 CFR 137.2 - Availability of water.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Availability of water. 137.2 Section 137.2 Indians BUREAU... COSTS, SAN CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.2 Availability of water. Pursuant to section... notice to announce when water is actually available for lands in private ownership under the project...

  9. Pressure effects during pulsed-laser deposition of barium titanate thin films

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalo, J.; Afonso, C.N. [Consejo Superior de Investigaciones Cientificas, Madrid (Spain). Inst. de Optica; Gomez San Roman, R.; Perez Casero, R. [Departamento de Fisica Aplicada C-XII, Universidad Autonoma de Madrid, 28049 Cantoblanco, Madrid (Spain); Perriere, J. [Groupe de Physique des Solides, Universites Paris VII et VI, URA 17 du CNRS, Tour 23, 2 Place Jussieu, 75251 Paris Cedex 05 (France)

    1998-05-01

    The composition and homogeneity of barium titanate films grown by pulsed-laser deposition at different substrate temperatures (room temperature, 700 C) and gas environments (O{sub 2},Ar) in a broad pressure range (10{sup -7}-1 mbar) are correlated to the plasma expansion dynamics. It is found that the deposited films present an excess of Ba in the intermediate pressure range (10{sup -2}target lower than L{sub P} and the diffusion of the ejected species for L{sub P}

  10. Radiological protection and calibration of an activity meter with cesium and barium sources in a nuclear medicine center; Proteccion radiologica y calibracion de un activimetro con fuentes de cesio y bario en un centro de medicina nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Morales L, M.E. [IPEN INEN Centro de Medicina Nuclear, Av. Aviacion 3799, Lima 34 (Peru)

    2005-07-01

    Presently work is shown the results when gauging a team Deluxe Isotope (Caliper 11) with some sources of Cesium 137 and Barium 133, in a Center of Medicine Nuclear that operates from the anus 1983 in a modern building inside the one Institute of Illnesses Neoplasia (Inn). This Center was equipped initially with teams donated by the International Organism of Atomic Energy (Oa) with those that it develops assistance, educational works and of investigation, giving services to patient of the Inn and other public and private medical centers. (Author)

  11. Design, testing, fabrication and launch support of a liquid chemical barium release payload (utilizing the liquid fluorine-barium salt/hydrazine system)

    Science.gov (United States)

    Stokes, C. S.; Smith, E. W.; Murphy, W. J.

    1972-01-01

    A payload was designed which included a cryogenic oxidizer tank, a fuel tank, and burner section. Release of 30 lb of chemicals was planned to occur in 2 seconds at the optimum oxidizer to fuel ratio. The chemicals consisted of 17 lb of liquid fluorine oxidizer and 13 lb of hydrazine-barium salt fuel mixture. The fuel mixture was 17% barium chloride, 16% barium nitrate, and 67% hydrazine, and contained 2.6 lb of available barium. Two significant problem areas were resolved during the program: explosive valve development and burner operation. The release payload was flight tested, from Wallops Island, Virginia. The release took place at an altitude of approximately 260 km. The release produced a luminous cloud which expanded very rapidly, disappearing to the human eye in about 20 seconds. Barium ion concentration slowly increased over a wide area of sky until measurements were discontinued at sunrise (about 30 minutes).

  12. Electromagnetic properties of carbon black and barium titanate composite materials

    Energy Technology Data Exchange (ETDEWEB)

    Wang Guiqin [School of Material Science and Engineering, Dalian University of Technology, Dalian 116023 (China)], E-mail: c2b2chen@163.com; Chen Xiaodong; Duan Yuping; Liu Shunhua [School of Material Science and Engineering, Dalian University of Technology, Dalian 116023 (China)

    2008-04-24

    Nanocrystalline carbon black/barium titanate compound particle (CP) was synthesized by sol-gel method. The phase structure and morphology of compound particle were investigated by X-ray diffraction (XRD), transmission electron microscope (TEM) and Raman spectrum measurements, the electroconductivity was test by trielectrode arrangement and the precursor powder was followed by differential scanning calorimetric measurements (DSC) and thermal gravimetric analysis (TGA). In addition, the complex relative permittivity and permeability of compound particle were investigated by reflection method. The compound particle/epoxide resin composite (CP/EP) with different contents of CP were measured. The results show barium titanate crystal is tetragonal phase and its grain is oval shape with 80-100 nm which was coated by carbon black film. As electromagnetic (EM) complex permittivity, permeability and reflection loss (RL) shown that the compound particle is mainly a kind of electric and dielectric lossy materials and exhibits excellent microwave absorption performance in the X- and Ku-bands.

  13. HYBRID AND CHARACTERISTIC OF POLYANILINE- BARIUM TITANATE NANOCOMPOSITE PARTICLES

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Polyaniline-barium titanate (PAn-BaTiO3) ultrafine composite particles were prepared by the oxidative polymerization of aniline with H2O2 while barium titanate nanoparticles were synthesized with a sol-gel method. The infrared spectrogram shows that the polymerization of PAn in the hybrid process of PAn-BaTiO3 is similar with the polymeric process of pure aniline, and there is interaction of PAn and BaTiO3 in the PAn-BaTiO3. SEM and TEM results show that the average diameter of the composite particles is 1.50 μm and the diameters of BaTiO3 nanoparticles are 5-15 nm in the composite particle. The electrical conductivity of the ultrafine composite particles is transformable from 100 to 10-11S/cm by equilibrium doping or dedoping method using various concentration of HCl or NaOH solutions.

  14. The crystal growth of barium flouride in aqueous solution

    Science.gov (United States)

    Barone, J. P.; Svrjcek, D.; Nancollas, G. H.

    1983-06-01

    The kinetics of growth of barium flouride seed crystals were investigated in aqueous solution at 25°C using a constant composition method, in which the supersaturation and ionic strength were maintained constant by the addition of titrants consisting of barium nitrate and potassium flouride solutions. The rates of reaction, studied over a range of supersaturation (σ ≈ 0.4 to 1.0), were interpreted in terms of crystal growth models. A spiral growth mechanism best describes the data, and scanning electron microscopy indicates a three-dimensional growth. In the presence of inorganic additives such as phosphate, however, induction periods precede a morphological two-dimensional crystallization. Coulter Counter results show little crystal agglomeration.

  15. Particularities of Radiation Defect Formation in Ceramic Barium Cerate

    Science.gov (United States)

    Khromushin, I. V.; Aksenova, T. I.; Tuseev, T.; Munasbaeva, K. K.; Ermolaev, Yu V.; Ermolaev, V. N.; Seitov, A. S.

    2015-04-01

    The effects of irradiation with electrons, ions of noble gases (Ne, Ar, Kr) and oxygen on the structure and properties of neodymium-doped barium cerate have been studied using the methods of X-ray diffraction analysis, scanning electron and atomic force microscopy, thermal desorption spectroscopy. It was shown that irradiation by low-energy ions of noble gases stimulates the blistering processes on the sample surface, while the high-energy ions contribute to formation of the structures on the irradiated surface that resemble the various stages of spherulitegrowth. The similar structures were not observed in the case of irradiation with high-energy oxygen ions. According to the data on thermal desorption of water and oxygen molecules from the irradiated barium cerate it was supposed that irradiation by the noble gas ions promotes neodymium oxidation state change. It was noticed that the electron irradiation leads to the formation of the nano-sized acicular structures on the cerate surface.

  16. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine

    Science.gov (United States)

    Graziana Genchi, Giada; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni

    2016-06-01

    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these ‘smart’ nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation.

  17. Stark spectrum of barium in highly excited Rydberg states

    Institute of Scientific and Technical Information of China (English)

    Yang Hai-Feng; Gao Wei; Cheng Hong; Liu Xiao-Jun; Liu Hong-Ping

    2013-01-01

    We present observations of Stark spectra of barium in highly excited Rydberg states in the energy region around n =35.The one-photon excitation concerns the π transition.The observed Stark spectra at electric fields ranging from 0 to 60 V·cm-1 are well explained by the diagonalization of the Hamiltonian incorporating the core effects.From the Stark maps,the anti-crossings between energy levels are identified experimentally and theoretically.The time of flight spectra at the specified Stark states are recorded,where the deceleration and acceleration of barium atoms are observed.This is very consistent with the prediction derived from the Stark maps from the point of view of energy conservation.

  18. Acute barium intoxication following ingestion of soap water solution

    Directory of Open Access Journals (Sweden)

    Nandita Joshi

    2012-01-01

    Full Text Available We present a rare case in which a young girl ingested a solution of a hair-removing soap. The ingestion resulted in profound hypokalemia and severe acidosis leading to flaccid paralysis, respiratory arrest and ventricular arrhythmias. Ultimately the patient made complete recovery. The soapwas found to contain barium sulfide. The degree of paralysis and acidosis appeared to be directly related to serum potassium levels.

  19. Complex Impedance Studies of Optically Excited Strontium Barium Niobate

    Science.gov (United States)

    2007-11-02

    has a tetragonal tungsten - bronze structure. The unit cell for this structure, illustrated below in Fig. 2.1, consists of ten oxygen octahedra joined...4 Kittel, pp. 373-374. 5 P. B. Jamieson, et al, “Ferroelectric Tungsten Bronze -Type Crystal Structures. I. Barium Strontium Niobate...Oxford, 1987). 2. C. Kittel, Introduction to Solid State Physics, (Wiley, New York, 1986). 3. P. B. Jamieson, et al, “Ferroelectric Tungsten

  20. Microwave-hydrothermal synthesis of barium strontium titanate nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Simoes, A.Z., E-mail: alezipo@yahoo.co [Universidade Federal de Itajuba- Unifei - Campus Itabira, Rua Sao Paulo, 377, Bairro, Amazonas, CEP 35900-37, Itabira, MG (Brazil); Universidade Estadual Paulista- Unesp - Faculdade de Engenharia de Guaratingueta, Av. Dr. Ariberto Pereira da Cunha, 333, Bairro Pedregulho, CEP 12516-410 Guaratingueta, SP (Brazil); Moura, F.; Onofre, T.B. [Universidade Federal de Itajuba- Unifei - Campus Itabira, Rua Sao Paulo, 377, Bairro, Amazonas, CEP 35900-37, Itabira, MG (Brazil); Ramirez, M.A.; Varela, J.A.; Longo, E. [Laboratorio Interdisciplinar em Ceramica (LIEC), Departamento de Fisico-Quimica, Instituto de Quimica, UNESP, CEP 14800-900, Araraquara, SP (Brazil)

    2010-10-22

    Research highlights: {yields} Barium strontium titanate nanoparticles were obtained by the Hydrothemal microwave technique (HTMW) {yields} This is a genuine technique to obtain nanoparticles at low temperature and short times {yields} Barium strontium titanate free of carbonates with tetragonal structure was grown at 130 {sup o}C. - Abstract: Hydrothermal-microwave method (HTMW) was used to synthesize crystalline barium strontium titanate (Ba{sub 0.8}Sr{sub 0.2}TiO{sub 3}) nanoparticles (BST) in the temperature range of 100-130 {sup o}C. The crystallization of BST with tetragonal structure was reached at all the synthesis temperatures along with the formation of BaCO{sub 3} as a minor impurity at lower syntheses temperatures. Typical FT-IR spectra for tetragonal (BST) nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH- groups, commonly found in materials obtained by HTMW process. FE/SEM revealed that lower syntheses temperatures led to a morphology that consisted of uniform grains while higher syntheses temperature consisted of big grains isolated and embedded in a matrix of small grains. TEM has shown BST nanoparticles with diameters between 40 and 80 nm. These results show that the HTMW synthesis route is rapid, cost effective, and could serve as an alternative to obtain BST nanoparticles.

  1. Plutonium, (137)Cs and uranium isotopes in Mongolian surface soils.

    Science.gov (United States)

    Hirose, K; Kikawada, Y; Igarashi, Y; Fujiwara, H; Jugder, D; Matsumoto, Y; Oi, T; Nomura, M

    2017-01-01

    Plutonium ((238)Pu and (239,240)Pu), (137)Cs and plutonium activity ratios ((238)Pu/(239,240)Pu) as did uranium isotope ratio ((235)U/(238)U) were measured in surface soil samples collected in southeast Mongolia. The (239,240)Pu and (137)Cs concentrations in Mongolian surface soils (surface soils (0.013-0.06) coincided with that of global fallout. The (235)U/(238)U atom ratios in the surface soil show the natural one. There was a good correlation between the (239,240)Pu and (137)Cs concentrations in the surface soils. We introduce the migration depth to have better understanding of migration behaviors of anthropogenic radionuclides in surface soil. We found a difference of the migration behavior between (239,240)Pu and (137)Cs from (137)Cs/(239,240)Pu - (137)Cs plots for the Mongolian and Tsukuba surface soils; plutonium in surface soil is migrated easier than (137)Cs.

  2. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    OpenAIRE

    Mong, B.; Cook, S; Walton, T.; Chambers, C.; Craycraft, A.; Benitez-Medina, C.; Hall, K.; Fairbank Jr., W.; Albert, J. B.; Auty, D. J.; Barbeau, P. S.; Basque, V.; Beck, D.; Breidenbach, M.; Brunner, T.

    2014-01-01

    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fl...

  3. Preparation of nanosized barium zirconate powder by precipitation in aqueous solution

    OpenAIRE

    Boschini, Frédéric; Guillaume, Bernard; Rulmont, André; Cloots, Rudi

    2004-01-01

    Several ways were explored to synthesize barium zirconate by soft chemistry methods in aqueous solution. In the first method the synthesis of barium zirconate was initiated by urea decomposition, through an homogeneous precipitation of barium and zirconium salts followed by a "low temperature" thermal treatment. The kinetic of the reaction and the optimum urea/cation ratio have been determined by means of X-ray diffraction and Inductive Coupled Plasma analyses. It has been demonstrated that a...

  4. Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, Weitang; Zhang, Zhiyong; Liu, Jinbo; Li, Zhen; Song, Junmin; Wu, Changcai [Department of Colorectal Surgery, The First Affiliated Hospital and Institute of Clinical Medicine, Zhengzhou University, 450052 Zhengzhou (China); Wang, Guixian, E-mail: guixianwang@hotmail.com [Department of Colorectal Surgery, The First Affiliated Hospital and Institute of Clinical Medicine, Zhengzhou University, 450052 Zhengzhou (China)

    2012-09-15

    Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation.

  5. Sponge-associated bacteria mineralize arsenic and barium on intracellular vesicles

    Science.gov (United States)

    Keren, Ray; Mayzel, Boaz; Lavy, Adi; Polishchuk, Iryna; Levy, Davide; Fakra, Sirine C.; Pokroy, Boaz; Ilan, Micha

    2017-01-01

    Arsenic and barium are ubiquitous environmental toxins that accumulate in higher trophic-level organisms. Whereas metazoans have detoxifying organs to cope with toxic metals, sponges lack organs but harbour a symbiotic microbiome performing various functions. Here we examine the potential roles of microorganisms in arsenic and barium cycles in the sponge Theonella swinhoei, known to accumulate high levels of these metals. We show that a single sponge symbiotic bacterium, Entotheonella sp., constitutes the arsenic- and barium-accumulating entity within the host. These bacteria mineralize both arsenic and barium on intracellular vesicles. Our results indicate that Entotheonella sp. may act as a detoxifying organ for its host. PMID:28233852

  6. Effects of powdered versus liquid barium on the viscosity of fluids used in modified swallow studies

    Energy Technology Data Exchange (ETDEWEB)

    Baron, J.; Alexander, T. [Univ. of Alberta, Dept. of Radiology, Edmonton, Alberta (Canada)

    2003-06-01

    To determine if the viscosity of thickened juice mixtures used in modified barium swallow studies significantly changes with the addition of powdered barium. We also describe a test formulation created using liquid barium, which has a negligible effect on juice viscosity. The viscosities of water and standardized honey- and nectar-consistency juices mixed with different amounts of powdered barium were measured by timing the laminar flow of a given initial hydrostatic head of fluid under gravity though an orifice of fixed diameter. Standardized juices were then mixed with a liquid formulation of barium and with measured quantities of water to produce viscosities that more closely equated with those of the standardized juices. With the addition of powdered barium, viscosity increased in all fluids, most markedly with the nectar-consistency juice. Liquid barium formulations maintained the viscosities of the original thickened juices. Rendering juices radio-opaque with barium powder results in dramatic increases in the viscosity of the resulting mixture and compromises diagnostic accuracy. Liquid barium preparations have the advantage that they can be rapidly and accurately dispensed by syringe, and their use does not significantly increase the viscosity of the preparation. (author)

  7. BARIUM SULPHATE ABSORPTION AND THE SERUM DIAGNOSIS OF SYPHILIS.

    Science.gov (United States)

    Noguchi, H; Bronfenbrenner, J

    1911-02-01

    The so-called syphilitic antibodies can be removed from a serum by means of absorption with barium sulphate. The removal is due either to an adsorption or a mechanical absorption. The activity of the syphilitic antibodies is thereby unimpaired. The readiness with which the absorption is accomplished with barium sulphate varies considerably with different syphilitic sera. That barium sulphate exerts the same absorbing effect upon non-syphilitic serum components is made evident by the interfering property which the latter manifest in the absorption experiment of the syphilitic antibodies. The selective removal of the serum components, other than the syphilitic antibodies, by means of barium sulphate absorption is, therefore, impossible. On the other hand, a partial removal of these components, with but little removal of the syphilitic antibodies, may be effected when the content of a given serum is poor in syphilitic antibodies and comparatively rich in the indifferent serum components. But this is impossible if the conditions are reversed. The main reasons why some negative syphilitic sera may be so modified by the barium sulphate treatment as to give positive reactions, are explained below, but these apply only to those methods in which inactivated serum is employed. The inactivation reduces the antibody content to about one-fourth to one-fifth of the original. When the serum is very rich in antibodies, this does not affect the result of the fixation test. But when the amount of the antibodies is small, the process of inactivation creates conditions quite unexpected. It may produce such a condition that a given amount of the serum contains, after inactivation, only one or two antibody units, while the other serum components remain undiminished. Here one must not lose sight of the vital fact that these apparently indifferent serum constituents are not at all indifferent in the fixation processes. They may possess affinities which are similar to those of complement

  8. Magnetoelectric coupling of multiferroic chromium doped barium titanate thin film probed by magneto-impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Shah, Jyoti, E-mail: shah.jyoti1@gmail.com; Kotnala, Ravinder K., E-mail: rkkotnala@nplindia.org, E-mail: rkkotnala@gmail.com [Multiferroic and Magnetics Laboratory, CSIR-National Physical Laboratory, Dr. K.S. Krishnan Road, New Delhi 110012 (India)

    2014-04-07

    Thin film of BaTiO{sub 3} doped with 0.1 at. % Cr (Cr:BTO) has been prepared by pulsed laser deposition technique. Film was deposited on Pt/SrTiO{sub 3} substrate at 500 °C in 50 mTorr Oxygen gas pressure using KrF (298 nm) laser. Polycrystalline growth of single phase Cr:BTO thin film has been confirmed by grazing angle X-ray diffraction. Cr:BTO film exhibited remnant polarization 6.4 μC/cm{sup 2} and 0.79 MV/cm coercivity. Magnetization measurement of Cr:BTO film showed magnetic moment 12 emu/cc. Formation of weakly magnetic domains has been captured by magnetic force microscopy. Theoretical impedance equation fitted to experimental data in Cole-Cole plot for thin film in presence of transverse magnetic field resolved the increase in grain capacitance from 4.58 × 10{sup −12} to 5.4 × 10{sup −11} F. Film exhibited high value 137 mV/cm-Oe magneto-electric (ME) coupling coefficient at room temperature. The high value of ME coupling obtained can reduce the typical processing steps involved in multilayer deposition to obtain multiferrocity in thin film. Barium titanate being best ferroelectric material has been tailored to be multiferroic by non ferromagnetic element, Cr, doping in thin film form opens an avenue for more stable and reliable spintronic material for low power magnetoelectric random excess memory applications.

  9. 铝酸钡与氢氧化钡脱硫过程比较%Comparison of Barium Aluminate and Barium Hydroxide Desulfurization Process

    Institute of Scientific and Technical Information of China (English)

    张念炳; 黎志英; 丁彤

    2012-01-01

    The seed precipitation liquor was desulfurized with barium aluminate and barium hydroxide respectively. The desulfurization slag was characterized by XRD analysis, and the desulfurization process was compared. The results show that barium hydroxide exceeds barium aluminate with better desulfurization in terms of effect, speed and duration. In the desulfurization process with barium aluminate, 2BaO · Al2O3 · 5H2O is firstly produced in the reaction of barium aluminate with alkali, and then it reacts with sodium sulfate and sodium carbonate. To compare, Ba(OH)2 · 8H2O directly reacts with sodium sulfate and sodium carbonate in the desulfurization process with barium hydroxide. Both of desulfurization reaction processes can be described with "shrinking core model".%用铝酸钡和氢氧化钡对种分母液进行脱硫试验,对脱硫渣进行XRD分析,并比较脱硫过程.结果表明,氢氧化钡的脱硫效果更好,脱硫完成时间更短,速率更快;铝酸钡先与碱液反应生成2BaO·Al2O3·5H2O,再与硫碱和碳碱反应,而氢氧化钡直接与硫碱和碳碱反应,脱硫过程均可用未反应核模型描述.

  10. 137Cs and 210Po in Pacific Walrus and Bearded Seal from St. Lawrence Island, Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, T F; Seagars, D J; Jokela, T; Layton, D

    2005-02-02

    The activity concentration of Cesium-137 ({sup 137}Cs) and naturally-occurring Polonium-210 ({sup 210}Po) were measured in the muscle tissue, kidney and liver of Pacific walrus (Odobenus rosmarus divergens) and bearded seal (Erignathus barbatus) collected by native hunters from the Bering Sea. The mean {sup 137}Cs concentrations in muscle, liver and kidney of Pacific walrus were 0.07, 0.09 and 0.07 Bq kg{sup -1} (N= 5, wet weight), respectively, and 0.17, 0.10, and 0.17 Bq kg{sup -1} (N=2, wet weight), respectively, in bearded seal. In general, {sup 137}Cs tissue concentrations are significantly lower than those previously reported for mammals from other regions. By comparison, {sup 210}Po activity concentrations appear to be higher than those reported elsewhere but a larger variation. The mean {sup 210}Po concentration in the muscle tissue, liver and kidney of Pacific walrus (N=5, wet weight) were 28.7, 189, and 174 Bq kg{sup -1}, respectively. This compares with {sup 210}Po concentration values (N=2, wet weight) of 27, 207, and 68 Bq kg{sup -1} measured in the muscle tissue, liver and kidney, of bearded seal, respectively. Estimated bioaccumulation factors--as defined by the radionuclide concentration ratio between the target tissue to that in sea water--were two to three orders of magnitude higher for {sup 210}Po that those of {sup 137}Cs. We conclude from radiological dose estimates that ingestion of {sup 137}Cs in foods derived from walrus and seal will pose no threat to human health. This work has important implications for assessing health risks to Alaskan coastal communities concerned about the dumping of nuclear waste in the Russia Arctic.

  11. An Integrated Hydrologic Modeling Approach to Cesium-137 Transport in Forested Fukushima Watersheds

    Science.gov (United States)

    Siirila-Woodburn, E. R.; Steefel, C. I.; Williams, K. H.; Birkholzer, J. T.

    2015-12-01

    The 2011 Fukushima Daiichi Nuclear Power Plant (FDNPP) accident in Japan resulted in a significant dissemination of cesium-137 (Cs-137) over a wide area west of the plant, including the contamination of many watersheds and the subsequent evacuation of many communities. Today approximately 90% of on-land Cs-137 fallout following the accident resides in the upper 5 cm of forest soils. While this can be partially attributed to the forested composition of the prefecture (70%), there is also difficulty in cleanup efforts in these regions due to a lack of understanding and predictive capability of radioisotopes transport at the catchment to watershed scale. Subsequently, there is an uncertain, but likely long-term impact on local communities with implications for the use of nuclear energy use worldwide. Due to the complex nature of forest eco-hydrology, sophisticated modeling tools to accurately predict Cs-137 fluxes across different spatial and temporal scales are required. High fidelity, high resolution numerical modeling techniques in conjunction with parallel high performance computing is required to accurately determine transport and feedbacks in these complex systems. To better understand the fundamental transport of Cs-137, a watershed near the FDNPP is modeled with an integrated hydrologic model that includes variably saturated groundwater and overland flow in addition to atmospheric and vegetative processes via a coupled land surface model. Of specific interest is the impact of land cover type on hydrologic flow in the area, which will likely play an important role in erosion patterns and the consequent transport of Cs-137 strongly sorbed to surface soils. Risk management practices (for example, passive remediation versus active remediation such as targeted logging) for two principal tree types (evergreen and deciduous) are informed given the simulated responses to flow patterns assuming different quantities and spatial distribution patterns of each tree type.

  12. Polymorphisms in MIR137HG and microRNA-137-regulated genes influence gray matter structure in schizophrenia.

    Science.gov (United States)

    Wright, C; Gupta, C N; Chen, J; Patel, V; Calhoun, V D; Ehrlich, S; Wang, L; Bustillo, J R; Perrone-Bizzozero, N I; Turner, J A

    2016-02-02

    Evidence suggests that microRNA-137 (miR-137) is involved in the genetic basis of schizophrenia. Risk variants within the miR-137 host gene (MIR137HG) influence structural and functional brain-imaging measures, and miR-137 itself is predicted to regulate hundreds of genes. We evaluated the influence of a MIR137HG risk variant (rs1625579) in combination with variants in miR-137-regulated genes TCF4, PTGS2, MAPK1 and MAPK3 on gray matter concentration (GMC). These genes were selected based on our previous work assessing schizophrenia risk within possible miR-137-regulated gene sets using the same cohort of subjects. A genetic risk score (GRS) was determined based on genotypes of these four schizophrenia risk-associated genes in 221 Caucasian subjects (89 schizophrenia patients and 132 controls). The effects of the rs1625579 genotype with the GRS of miR-137-regulated genes in a three-way interaction with diagnosis on GMC patterns were assessed using a multivariate analysis. We found that schizophrenia subjects homozygous for the MIR137HG risk allele show significant decreases in occipital, parietal and temporal lobe GMC with increasing miR-137-regulated GRS, whereas those carrying the protective minor allele show significant increases in GMC with GRS. No correlations of GMC and GRS were found in control subjects. Variants within or upstream of genes regulated by miR-137 in combination with the MIR137HG risk variant may influence GMC in schizophrenia-related regions in patients. Given that the genes evaluated here are involved in protein kinase A signaling, dysregulation of this pathway through alterations in miR-137 biogenesis may underlie the gray matter loss seen in the disease.

  13. Dicty_cDB: AFK137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK137 (Link to dictyBase) - - - Contig-U13893-1 AFK137E (Link... Clone ID AFK137 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dict...DIFKSDQTFTLVQRLRSNVIKAGLKKLNTAYSR ISFNDICTKLKFDGTTQDIMFIIAKTIKDGVIDATXNYEGGYLQSRENIDAYSTQEPLHA FSNRIDICLKIHN...fissygdcsi*hknyslsiiiknflll*fil*ndk*ss*s*iniiists ysnikt***rssnny*fiieklfri*fi*tsr*iigqytipricikqsictlfllsr*...LNSSHKQLEKHHKTLLVVSEELFINFYPIVQLLMGEIPERNTFSQKQLKIA LKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKKLNTAYSR ISFNDICT

  14. Barium Swallow Findings in the Evaluation of Patients with Dysphagia

    Directory of Open Access Journals (Sweden)

    Amirhosein Hashemi Attar

    2011-05-01

    Full Text Available Background/Objective: Dysphagia is a subjective"nsensation of difficulty in swallowing that has a wide"nrange of etiologies from psychosomatic disorders"nto high grade neoplasms. In this study we evaluated"nbarium swallow findings of patients with dysphagia."nPatients and Methods: We evaluated 200 patients"n(117 men, 83 women; mean age, 49.6 years with"ncomplaint of dysphagia. Fluoroscopic barium"nswallow was done for all the patients and they were"nreviewed for primary peristalsis (presence or absence,"nAbstracts"nS62 Iran J Radiol 2011, 8 (Supp.1"nAbstracts"nimpaired lower esophageal sphincter, esophageal dilatation, delayed emptying of barium, nonperistaltic contractions, stricture and filling defects. Clinical and in some cases endoscopic or manometric follow up was done for all patients."nResults: We had 134 (67% normal barium swallow"nexams with uncomplicated clinical courses. Sixty"nsix patients (33% had abnormal imaging findings"nincluding stricture in 24 patients (12%, filling defect"nin 12 patients (6% and mucosal abnormality in 14"n(7% patients (six cases of mucosal irregularity, three"ncases of mucosal ulceration and five cases of mucosal"nherniation, Bird's beak sign in three patients (1.5%,"ntertiary spasm in six patients (3% and hiatal hernia in"nseven patients (3.5%."nConclusion: In the majority of patients with dysphagia,"nbarium swallow is the only paraclinical study needed"nto plan proper treatment. If radiographic findings are"nequivocal, endoscopy or manometry may be required"nfor more certain diagnosis.

  15. New efficient catalyst for ammonia synthesis: barium-promoted cobalt on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus

    2002-01-01

    Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia......Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia...

  16. Obtaining of Nanostructured Powders of Barium and Strontium Hexaferrite by the Polymer Precursor Method

    Directory of Open Access Journals (Sweden)

    V.G. Kostishyn

    2015-12-01

    Full Text Available Studied the possibility of obtaining by precursors in the polymer nanostructured powders of barium hexaferrite BaFe12O19 and strontium hexaferrite SrFe12O19. The reagents were used as starting barium nitrate, strontium nitrate and ferric nitrate nonahydrate (III, and polyethylene glycol-400 used this technology as a polymer.

  17. Control on Crystal Forms of Ultrafine Barium Carbonate Particles and Study on its Mechanism

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Barium carbonate particles were prepared by using homogeneous precipitation method and co-precipitation method respectively. Through adding different crystalline controlling modifiers, Barium carbonate particles in five different shapes including linear, needle-like, pillarlike, sphere-like and dumbbell-like were synthesized. These particles were characterized by SEM and XRD, and their synthetic mechanism was discussed in this paper.

  18. Investigation on the effects of milling atmosphere on synthesis of barium ferrite/magnetite nanocomposite

    NARCIS (Netherlands)

    Molaei, M.J.; Ataie, A.; Raygan, S.; Picken,n S.J.

    2011-01-01

    In this research, barium ferrite /magnetite nanocomposites synthesized via a mechano-chemical route. Graphite was used in order to reduce hematite content of barium ferrite to magnetite to produce a magnetic nanocomposite. The effects of processing conditions on the powder characteristics were inves

  19. Different cesium-137 transfers to forest and stream ecosystems.

    Science.gov (United States)

    Sakai, Masaru; Gomi, Takashi; Negishi, Junjiro N; Iwamoto, Aimu; Okada, Kengo

    2016-02-01

    Understanding the mechanisms of (137)Cs movement across different ecosystems is crucial for projecting the environmental impact and management of nuclear contamination events. Here, we report differential movement of (137)Cs in adjacent forest and stream ecosystems. The food webs of the forest and stream ecosystems in our study were similar, in that they were both dominated by detrital-based food webs and the basal energy source was terrestrial litter. However, the concentration of (137)Cs in stream litter was significantly lower than in forest litter, the result of (137)Cs leaching from litter in stream water. The difference in (137)Cs concentrations between the two types of litter was reflected in the (137)Cs concentrations in the animal community. While the importance of (137)Cs fallout and the associated transfer to food webs has been well studied, research has been primarily limited to cases in a single ecosystem. Our results indicate that there are differences in the flow of (137)Cs through terrestrial and aquatic ecosystems, and that (137)Cs concentrations are reduced in both basal food resources and higher trophic animals in aquatic systems, where primary production is subsidized by a neighboring terrestrial ecosystem.

  20. A barium-rich binary central star in Abell 70

    CERN Document Server

    Boffin, Henri M J; Frew, D J; Acker, A; Köppen, J; Moffat, A F J; Parker, Q A

    2011-01-01

    We have found the central star of Abell 70 (PN G038.1-25.4, hereafter A 70) to be a binary consisting of a G8 IV-V secondary and a hot white dwarf. The secondary shows enhanced Ba II and Sr II features, firmly classifying it as a barium star. The nebula is found to have Type-I chemical abundances with helium and nitrogen enrichment, which combined with future abundance studies of the central star, will establish A 70 as a unique laboratory for studying s-process AGB nucleosynthesis.

  1. Spectroscopic properties of trivalent praseodymium in barium yttrium fluoride

    Energy Technology Data Exchange (ETDEWEB)

    Di Bartolo, B. E-mail: dibartob@bc.edurinodiba@attbi.com; Bowlby, B.E

    2003-05-01

    We have conducted a spectroscopic investigation of Pr{sup 3+} in barium yttrium fluoride (BaY{sub 2}O{sub 8}). Two doping concentrations were used: BaY{sub 2}F{sub 8}:Pr{sup 3+} (0.3%) and BaY{sub 2}F{sub 8}:Pr{sup 3+} (1%). The measurements included absorption, luminescence under continuous and pulsed excitations, and thermal effects on some sharp lines. The experimental results were used to characterize this system.

  2. The Kerr nonlinearity of the beta-barium borate crystal

    DEFF Research Database (Denmark)

    Bache, Morten; Guo, Hairun; Zhou, Binbin;

    2013-01-01

    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond...... experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e. generate a self-defocusing Kerr-like nonlinearity. However, the material Kerr nonlinearity nI 2...

  3. Strong constraints on sub-GeV dark sectors from SLAC beam dump E137.

    Science.gov (United States)

    Batell, Brian; Essig, Rouven; Surujon, Ze'ev

    2014-10-24

    We present new constraints on sub-GeV dark matter and dark photons from the electron beam-dump experiment E137 conducted at SLAC in 1980-1982. Dark matter interacting with electrons (e.g., via a dark photon) could have been produced in the electron-target collisions and scattered off electrons in the E137 detector, producing the striking, zero-background signature of a high-energy electromagnetic shower that points back to the beam dump. E137 probes new and significant ranges of parameter space and constrains the well-motivated possibility that dark photons that decay to light dark-sector particles can explain the ∼3.6σ discrepancy between the measured and standard model value of the muon anomalous magnetic moment. It also restricts the parameter space in which the relic density of dark matter in these models is obtained from thermal freeze-out. E137 also convincingly demonstrates that (cosmic) backgrounds can be controlled and thus serves as a powerful proof of principle for future beam-dump searches for sub-GeV dark-sector particles scattering off electrons in the detector.

  4. Long non-coding RNA GAS5 inhibits tumorigenesis via miR-137 in melanoma

    Science.gov (United States)

    Bian, Donghui; Shi, Wen; Shao, Yang; Li, Peilong; Song, Guodong

    2017-01-01

    Melanoma is the leading cause of death in patients with skin cancer. In the present study, we aimed to prove the functions and molecular mechanisms of lncRNA-GAS5 in melanoma. Herein, we found that the expression of GAS5 was down-regulated in melanoma tissues compared to adjacent normal tissues. GAS5 was significantly associated with distal metastasis and TNM stage in melanoma. Furthermore, we found that GAS5 suppressed melanoma cell proliferation, migration and invasion. Then, we found thatmiR-137 was decreased in melanoma tissues compared to adjacent normal tissues and was correlated with GAS5. Using a luciferase reporter gene assay, we also demonstrated that GAS5 positively regulated miR-137 transcription. Finally, we suggested that GAS5 inhibited the growth of melanoma through miR-137 in vivo. Therefore, our research demonstrated that the GAS5/miR-137 axis could be a potential therapeutic target for the treatment of melanoma.

  5. Mecp2-mediated Epigenetic Silencing of miR-137 Contributes to Colorectal Adenoma-Carcinoma Sequence and Tumor Progression via Relieving the Suppression of c-Met

    Science.gov (United States)

    Chen, Tao; Cai, Shi-Lun; Li, Jian; Qi, Zhi-Peng; Li, Xu-Quan; Ye, Le-Chi; Xie, Xiao-Feng; Hou, Ying-Yong; Yao, Li-Qing; Xu, Mei-Dong; Zhou, Ping-Hong; Xu, Jian-Min; Zhong, Yun-Shi

    2017-01-01

    The molecular mechanisms underlying colorectal cancer (CRC) development remain elusive. In this study, we examined the miRNA and mRNA expressions in the adenoma-carcinoma sequence (ACS), a critical neoplastic progression in CRC development. We found that miR-137 was down-regulated in all adenoma and carcinoma tissues. Low miR-137 levels were correlated negatively with tumor progression and metastasis. Then we identified the inhibition effect of the miR-137 in CRC development, both in CRC cell lines and mouse models. MiR-137 was shown to control CRC cell proliferation, colony formation, migration and invasion and to control tumor growth and metastasis. We further confirmed the negative association between miR-137 and c-Met expression and thus validated this important oncogene as the target of miR-137 in CRC. In addition, we found a DNA methyl-CpG-binding protein, Mecp2, was up-regulated in ACS tissues via mRNA sequencing. Further experiment showed that miR-137 expression in CRC was subjected to epigenetic regulation mediated by Mecp2. We also confirmed c-Met expression can be up-regulated by silencing of miR-137 and suppressed by coexpression of Mecp2 and miR-137. These findings highlight the critical role of miR-137-c-Met nexus in CRC development and reveal Mecp2-regulated epigenetic silence causes the downregulation of miR-137 in colorectal adenoma and carcinoma. PMID:28291253

  6. Preparation of nanosized barium zirconate powder by thermal decomposition of urea in an aqueous solution containing barium and zirconium, and by calcination of the precipitate

    OpenAIRE

    Boschini, Frédéric; Robertz, B.; Rulmont, André; Cloots, Rudi

    2003-01-01

    The synthesis of barium zirconate was initiated by urea induced homogeneous precipitation followed by a "low temperature" thermal treatment. The kinetic of the reaction and the optimum urea/cation ratio have been determined by means of X-ray diffraction and Inductive Coupled Plasma analyses. It has been demonstrated that an amorphous zirconium hydrated oxide starts to precipitate followed by the precipitation of barium carbonate. A calcination at 1200 degreesC during 2 h gives rise to the for...

  7. Temperature dependence dielectric properties of modified barium titanate-PVB composites

    Science.gov (United States)

    Joshi, N. J.; Rakshit, P. B.; Grewal, G. S.; Shrinet, V.; Pratap, A.

    2013-06-01

    In this work, attempts are made to prepare ceramic polymer-composite followed by characterization of dielectric properties. The Barium Titanate ceramic powders are synthesized using the hydrothermal process. Silane treatment is carried out on Barium Titanate powder to increase its compatibility with polymer, followed with preparation of ceramic-polymer composite. Polyvinyl Butyral (PVB) is used as matrix for preparation of the composites and the concentration of Barium Titanate is increased from 60 to 90 wt%. Dielectric properties such as volume resistivity, dielectric constant, dissipation factor are evaluated. Results indicate that the dielectric constant and dissipation factor vary between 52 to 120 and 0.01 to 0.07; respectively as the relative ratio of polymer and silane modified Barium Titanate is varied. Specifically, at 90 wt% of silane modified Barium Titanate, the highest dielectric constant of 123 along with dissipation factor of 0.07 is obtained.

  8. Barium Tagging in Liquid Xenon for the nEXO Experiment

    Science.gov (United States)

    Kravitz, Scott; nEXO Collaboration

    2016-09-01

    nEXO is a next-generation experiment designed to search for neutrinoless double beta decay of xenon-136 in a liquid xenon time projection chamber. Positive observation of this decay would determine the neutrino to be a MAJORANA particle, as well as measure the absolute neutrino mass scale. In order to greatly reduce background contributions to this search, the collaboration is developing several ``barium tagging'' techniques to recover and identify the decay daughter, barium-136. Barium tagging may be available for a second phase of nEXO operation, allowing for neutrino mass sensitivity beyond the inverted mass hierarchy. Tagging methods for this phase include barium-ion capture on a probe with identification by resonance ionization laser spectroscopy. Inclusion of an argon ion gun in this system allows for improved cleaning and preparation of the barium deposition substrate, with recent results reported in this presentation.

  9. Anion and cation diffusion in barium titanate and strontium titanate; Anionen- und Kationendiffusion in Barium- und Strontiumtitanat

    Energy Technology Data Exchange (ETDEWEB)

    Kessel, Markus Franz

    2012-12-19

    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO{sub 3} single crystals has been studied by means of {sup 18}O{sub 2}/{sup 16}O{sub 2} isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial

  10. Down-regulation of G protein-coupled receptor 137 by RNA interference inhibits cell growth of two hepatoma cell lines.

    Science.gov (United States)

    Shao, Xin; Liu, Yong; Huang, Hai; Zhuang, Linyuan; Luo, Tianping; Huang, Huping; Ge, Xinguo

    2015-04-01

    G protein-coupled receptors (GPCRs) are important signal transduction mediators and pharmacological therapeutic targets. G protein-coupled receptor 137 (GPR137) was initially reported as a novel orphan GPCR around 10 years ago. Some orphan GPCRs have been implicated in cancer cell proliferation and migration. The aim of this study is to investigate the role of GPR137 in hepatocellular carcinoma (HCC). GPR137 is widely expressed in several human HCC cell lines, as determined by real-time PCR. We then applied lentivirus mediated RNA interference (RNAi) to knock down GPR137 expression in two HCC cell lines HepG2 and Bel7404. Depletion of GPR137 remarkably inhibited cell proliferation and colony formation capacity. Knockdown of GPR137 in HepG2 cells led to cell cycle arrest at G0/G1 phase and G2/M phase, and induced cell apoptosis, as determined by flow cytometry analysis, which contributed to cell growth inhibition. Our findings suggested that GPR137 could facilitate HCC cell proliferation and thus promote hepatocarcinogenesis.

  11. Tungsten and Barium Transport in the Internal Plasma of Hollow Cathodes

    Science.gov (United States)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.

    2008-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushedback to the emitter surface by the electric field and drag from the xenon ion flow. Thisbarium ion flux is sufficient to maintain a barium surface coverage at the downstream endgreater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length,so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollowcathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  12. Thermal expansion behaviour of barium and strontium zirconium phosphates

    Indian Academy of Sciences (India)

    P Srikari Tantri; K Geetha; A M Umarji; Sheela K Ramasesha

    2000-12-01

    Ba1.5–SrZr4P5SiO24 compounds with = 0, 0.25, 0.5, 0.75, 1.0, 1.25 and 1.5, belonging to the low thermal expansion NZP family were synthesized by the solid state reaction method. The XRD pattern could be completely indexed with respect to R$\\bar{3}$ space group indicating the ordering of vacancy at the divalent cation octahedral sites. The microstructure and bulk thermal expansion coefficient from room temperature to 800°C of the sintered samples have been studied. All the samples show very low coefficient of thermal expansion (CTE), with = 0 samples showing negative expansion. A small substitution of strontium in the pure barium compound changes the sign of CTE. Similarly, = 1.5 sample (pure strontium) shows a positive CTE and a small substitution of barium changes its sign. = 1.0 and 1.25 samples have almost constant CTE over the entire temperature range. The low thermal expansion of these samples can be attributed to the ordering of the ions in the crystal structure of these materials.

  13. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.

    2009-01-01

    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  14. Total Absorption Spectroscopy of the 137Xe, 137I, and 92Rb β-Decays

    Science.gov (United States)

    Rasco, B. C.; Fijałkowska, A.; Karny, M.; Rykaczewski, K. P.; Wolińska-Cichocka, M.; Goetz, K. C.; Grzywacz, R. K.; Gross, C. J.; Miernik, K.; Stracener, D.

    2015-10-01

    The NaI(Tl) based Modular Total Absorption Spectrometer (MTAS) was constructed to measure improved β-decay feeding patterns from neutron-rich nuclei. It is difficult to measure β-decay feeding intensities with high precision γ-ray measurements due to the low efficiency of high precision detectors. There are several important applications of improved measurements of β-decay feeding patterns by total absorption spectroscopy; improve understanding of elemental abundances in the universe, help with stockpile stewardship, contribute to understanding of underlying nuclear structure, and improve β-decay feeding measurements to calculate accurately the νe spectra needed to evaluate precisely reactor neutrino measurements. We present β-decay feeding results for two ``priority one'' measurements, 137Xe and 137I, and for 92Rb, which is a large individual contributor to the νe uncertainty of the reactor anomaly. In addition to β- γ decays, 137I has a β-neutron decay channel which is measurable in MTAS. We will demonstrate techniques for analyzing MTAS γ-decay data. We will also describe β and neutron spectroscopy in MTAS. This work was supported by the US DOE by Award No. DE-FG02- 96ER40978 and by US DOE, Office of Nuclear Physics.

  15. 21 CFR 133.137 - Washed curd cheese for manufacturing.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Washed curd cheese for manufacturing. 133.137... Standardized Cheese and Related Products § 133.137 Washed curd cheese for manufacturing. Washed curd cheese for manufacturing conforms to the definition and standard of identity prescribed for washed curd cheese by §...

  16. 14 CFR 21.137 - Location of manufacturing facilities.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Location of manufacturing facilities. 21.137 Section 21.137 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... manufacturing facilities. The Administrator does not issue a production certificate if the...

  17. Distribution and behavior of {sup 137}Cs in undisturbed soil

    Energy Technology Data Exchange (ETDEWEB)

    Satta, Naoya [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst.

    1996-04-01

    The depth distribution of {sup 137}Cs in soils which has not been artificially disturbed for 100 years was compared to fallout history. The model of {sup 137}Cs distribution rate was established to estimate fallout history from soil samples. (J.P.N.)

  18. Identification of 137Cs Reference Sites in Southeastern China

    Institute of Scientific and Technical Information of China (English)

    TANG Xiang-Yu; YANG Hao; DU Ming-Yuan; ZHAO Qi-Guo; LI Ren-Ying

    2006-01-01

    The 137Cs vertical distributions in uncultivated and cultivated soils, developed from Quaternary red clay, granite,argillaceous shale, and red sandstone, were studied to develop reliable guidelines for selecting reference sites in southeastern China, which is dominated by strong acidic and/or clay-textured soils, and examine their reliability by comparing them to the reported 137Cs reference inventory data to see whether they agreed with the global distribution pattern. It was observed that a relatively high proportion of 137Cs was concentrated in the surface layers of soils with relatively high clay content. In the paddy soils developed from granite more 137Cs penetrated to depths below the plow layer (about 45.3%),when compared to those from the other three parent materials. The relatively low soil 137Cs inventories on crests excluded using the crest as the 137Cs reference site; instead the paddy field on the hillock plain was selected. Furthermore, within a specific county characterized by great systematic spatial variations of rainfall and topography across the landscape,a significant (P < 0.01) and positive linear relationship (r2 = 0.81) between local 137Cs inventory and corresponding local annual rainfall was observed. Thus, for areas with large variations in rainfall, a single uniform value of local 137Cs reference inventory should be used with caution.

  19. 21 CFR 146.137 - Frozen orange juice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen orange juice. 146.137 Section 146.137 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR..., except that it is frozen. (b) The name of the food is “Frozen orange juice”. Such name may be preceded...

  20. 10 CFR 26.137 - Quality assurance and quality control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Quality assurance and quality control. 26.137 Section 26....137 Quality assurance and quality control. (a) Quality assurance program. Each licensee testing... metabolites. (b) Performance testing and quality control requirements for validity screening tests....

  1. 49 CFR 229.137 - Sanitation, general requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Sanitation, general requirements. 229.137 Section... Cab Equipment § 229.137 Sanitation, general requirements. (a) Sanitation compartment. Except as provided in paragraph (b) of this section, all lead locomotives in use shall be equipped with a...

  2. The Multifarious Hippocampal Functions of MicroRNA-137

    NARCIS (Netherlands)

    Kos, A.; Aschrafi, A.; Nadif Kasri, N.

    2016-01-01

    MicroRNAs (miRs) have emerged as a powerful class of endogenous noncoding RNAs involved in posttranscriptional gene expression regulation. miR-137 has repeatedly been associated with schizophrenia and intellectual disability. Recent studies describe the mechanisms of miR-137 in mediating basic synap

  3. 49 CFR 37.137 - Paratransit plan development.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Paratransit plan development. 37.137 Section 37... WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.137 Paratransit plan... the plan to identify any person or entity (public or private) which provides a paratransit or...

  4. 40 CFR 49.137 - Rule for air pollution episodes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Rule for air pollution episodes. 49.137... of an air pollution emergency within the Indian reservation due to the effects of these air... Application to Indian Reservations in Epa Region 10 § 49.137 Rule for air pollution episodes. (a) What is...

  5. Accumulation and distribution 137Сs in predators’ organism

    Directory of Open Access Journals (Sweden)

    A. V. Gulakov

    2007-10-01

    Full Text Available Data of the long-term research of accumulation and distribution 137Cs radionuclide in organisms of predatory wild animals from the alienation zone of the Chernobyl nuclear power station are presented. Essential fluctuations of the 137Cs contents in muscular tissue are noted. The results have large practical value for management of the hunting facilities on the radioactively polluted territories.

  6. The behaviour of sup 137 Cs in some edible fruits

    Energy Technology Data Exchange (ETDEWEB)

    Monte, L.; Quaggia, S.; Pompei, F.; Fratarcangeli, S. (ENEA, Casaccia (Italy). Centro Ricerche Energia)

    1990-01-01

    The aim of this research was to study the behaviour of {sup 137}Cs in fruit-bearing plants following the Chernobyl accident. Samples of hazel-nuts were collected over a period of three years after the accident. The {sup 137}Cs content of the fruit shows an exponential decrease with time. Evaluation of the {sup 134}Cs/{sup 137}Cs ratios in samples of atmospheric particulates, soils and fruit suggests that foliar translocation is the main pathway for {sup 137}Cs migration to the fruit. In addition, estimates of the effective half-times of {sup 137}Cs in hazel-nuts, walnuts, olives and apples and of the 'translocation factors' for hazel-nuts, walnuts, olives, apples and chestnuts have been made. (author).

  7. Sediment environmental capacity of 137Cs in Daya Bay

    Institute of Scientific and Technical Information of China (English)

    ZHANG Junli; CHEN Jiajun; XU Jialin; LI Yuanxin; HUANG Naiming

    2007-01-01

    Sediment environmental capacity of pollutants is very important for marine environmental management.Based on the methodology of a study on water,soil environmental capacity,and mass conservation theory in a system,the concept and model on sediment environmental capacity for 137Cs in Daya Bay were developed.The static capacity for 137Cs in the upper sediment near the shore at a shallow area was calculated,and the annual dynamic capacity and total dynamic capacity were also calculated through determination of the typical biomass in the sediment.The results showed that the estimated environmental capacity for 137Cs in sediments was approximately equal to the current input of 137Cs into the sediments.Controlling the input of 137Cs in the sediments within the environmental capacity guarantees the sustainability of the current situation of the Daya Bay ecosystem and avoidance of a significant degradation of the system.

  8. Preparation of Barium Titanate Nanopowder through Thermal Decomposition of Peroxide Precursor and Its Formation Mechanism

    Institute of Scientific and Technical Information of China (English)

    PENG, Yangxi; CHEN, Qiyuan; LIU, Shijun

    2009-01-01

    H_2TiO_3 was dissolved in the mixture of hydrogen formed peroxide and ammonia under the pH range of 8-10 with a transparent yellow solution formed. When an equivalent mole of Ba~(2+) solution was added into the yellow solution, the precipitate produced was the peroxide precursor of barium titanate. The cubic nanopowder of barium titanate was obtained when the precipitate was washed, stoved, and then calcined at 600 ℃ for 1 h. The peroxide precursor of barium titanate and barium titanate nanopowder prepared were characterized to be BaTi(H_2O_2)_2O_3 by TGA-DTA, XRD, TEM, SEM, and XREDS. The peroxide precursor of barium titanate was determined to be BaTi(H_2O_2)_2O_3. The particle size of the barium titanate nanopowder, the calcined product of BaTi(H_2O_2)_2O_3, was in the range of 20-40 nm. A formation mechanism of the barium titanate nanopowder through thermal decomposition of its peroxide precursor was proposed and then validated.

  9. Bio-based barium alginate film: Preparation, flame retardancy and thermal degradation behavior.

    Science.gov (United States)

    Liu, Yun; Zhang, Chuan-Jie; Zhao, Jin-Chao; Guo, Yi; Zhu, Ping; Wang, De-Yi

    2016-03-30

    A bio-based barium alginate film was prepared via a facile ionic exchange and casting approach. Its flammability, thermal degradation and pyrolysis behaviors, thermal degradation mechanism were studied systemically by limiting oxygen index (LOI), vertical burning (UL-94), microscale combustion calorimetry (MCC), thermogravimetric analysis (TGA) coupled with Fourier transform infrared analysis (FTIR) and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS). It showed that barium alginate film had much higher LOI value (52.0%) than that of sodium alginate film (24.5%). Moreover, barium alginate film passed the UL-94 V-0 rating, while the sodium alginate film showed no classification. Importantly, peak of heat release rate (PHRR) of barium alginate film in MCC test was much lower than that of sodium alginate film, suggested that introduction of barium ion into alginate film significantly decreased release of combustible gases. TG-FTIR and Py-GC-MS results indicated that barium alginate produced much less flammable products than that of sodium alginate in whole thermal degradation procedure. Finally, a possible degradation mechanism of barium alginate had been proposed.

  10. Magnetic properties of Ni substituted Y-type barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Won, Mi Hee; Kim, Chul Sung, E-mail: cskim@kookmin.ac.kr [Department of Physics, Kookmin University, Seoul 136-702 (Korea, Republic of)

    2014-05-07

    Y-type barium hexaferrite is attractive material for various applications, such as high frequency antennas and RF devices, because of its interesting magnetic properties. Especially, Ni substituted Y- type hexaferrites have higher magnetic ordering temperature than other Y-type. We have investigated macroscopic and microscopic properties of Y-type barium hexaferrite. Ba{sub 2}Co{sub 2−x}Ni{sub x}Fe{sub 12}O{sub 22} (x = 0, 0.5, 1.0, 1.5, and 2.0) samples are prepared by solid-state reaction method and studied by X-ray diffraction (XRD), vibrating sample magnetometer, and Mössbauer spectroscopy, as well as a network analyzer for high frequency characteristics. The XRD pattern is analyzed by Rietveld refinement method and confirms the hexagonal structure with R-3m. The hysteresis curve shows ferrimagnetic behavior. Saturation magnetization (M{sub s}) decreases with Ni contents. Ni{sup 2+}, which preferentially occupies the octahedral site with up-spin sub-lattice, has smaller spin value S of 1 than Co{sup 2+} having S = 3/2. The zero-field-cooled (ZFC) measurement of Ba{sub 2}Co{sub 1.5}Ni{sub 0.5}Fe{sub 12}O{sub 22} shows that Curie and spin transition temperatures are found to be 718 K and 209 K, respectively. The Curie temperature T{sub C} is increased with Ni contents, while T{sub S} is decreased with Ni. The Mössbauer spectra were measured at various temperatures and fitted by using a least-squares method with six sextet of six Lorentzian lines for Fe sites, corresponding to the 3b{sub VI}, 6c{sub IV}*, 6c{sub VI}, 18h{sub VI}, 6c{sub IV}, and 3a{sub IV} sites at below T{sub C}. From Mössbauer measurements, we confirmed the spin state of Fe ion to be Fe{sup 3+} and obtained the isomer shift (δ), magnetic hyperfine field (H{sub hf}), and the occupancy ratio of Fe ions at six sub-lattices. The complex permeability and permittivity are measured between 100 MHz and 4 GHz, suggesting that Y-type barium hexaferrite is promising for antenna

  11. Magnetic properties of Ni substituted Y-type barium ferrite

    Science.gov (United States)

    Won, Mi Hee; Kim, Chul Sung

    2014-05-01

    Y-type barium hexaferrite is attractive material for various applications, such as high frequency antennas and RF devices, because of its interesting magnetic properties. Especially, Ni substituted Y- type hexaferrites have higher magnetic ordering temperature than other Y-type. We have investigated macroscopic and microscopic properties of Y-type barium hexaferrite. Ba2Co2-xNixFe12O22 (x = 0, 0.5, 1.0, 1.5, and 2.0) samples are prepared by solid-state reaction method and studied by X-ray diffraction (XRD), vibrating sample magnetometer, and Mössbauer spectroscopy, as well as a network analyzer for high frequency characteristics. The XRD pattern is analyzed by Rietveld refinement method and confirms the hexagonal structure with R-3m. The hysteresis curve shows ferrimagnetic behavior. Saturation magnetization (Ms) decreases with Ni contents. Ni2+, which preferentially occupies the octahedral site with up-spin sub-lattice, has smaller spin value S of 1 than Co2+ having S = 3/2. The zero-field-cooled (ZFC) measurement of Ba2Co1.5Ni0.5Fe12O22 shows that Curie and spin transition temperatures are found to be 718 K and 209 K, respectively. The Curie temperature TC is increased with Ni contents, while TS is decreased with Ni. The Mössbauer spectra were measured at various temperatures and fitted by using a least-squares method with six sextet of six Lorentzian lines for Fe sites, corresponding to the 3bVI, 6cIV*, 6cVI, 18hVI, 6cIV, and 3aIV sites at below TC. From Mössbauer measurements, we confirmed the spin state of Fe ion to be Fe3+ and obtained the isomer shift (δ), magnetic hyperfine field (Hhf), and the occupancy ratio of Fe ions at six sub-lattices. The complex permeability and permittivity are measured between 100 MHz and 4 GHz, suggesting that Y-type barium hexaferrite is promising for antenna applications in UHF band.

  12. Genomic analyses reveal broad impact of miR-137 on genes associated with malignant transformation and neuronal differentiation in glioblastoma cells.

    Directory of Open Access Journals (Sweden)

    Saleh Tamim

    Full Text Available miR-137 plays critical roles in the nervous system and tumor development; an increase in its expression is required for neuronal differentiation while its reduction is implicated in gliomagenesis. To evaluate the potential of miR-137 in glioblastoma therapy, we conducted genome-wide target mapping in glioblastoma cells by measuring the level of association between PABP and mRNAs in cells transfected with miR-137 mimics vs. controls via RIPSeq. Impact on mRNA levels was also measured by RNASeq. By combining the results of both experimental approaches, 1468 genes were found to be negatively impacted by miR-137--among them, 595 (40% contain miR-137 predicted sites. The most relevant targets include oncogenic proteins and key players in neurogenesis like c-KIT, YBX1, AKT2, CDC42, CDK6 and TGFβ2. Interestingly, we observed that several identified miR-137 targets are also predicted to be regulated by miR-124, miR-128 and miR-7, which are equally implicated in neuronal differentiation and gliomagenesis. We suggest that the concomitant increase of these four miRNAs in neuronal stem cells or their repression in tumor cells could produce a robust regulatory effect with major consequences to neuronal differentiation and tumorigenesis.

  13. Barium ferrite nanoparticles prepared by self-propagating low-temperature combustion method and its characterization

    Indian Academy of Sciences (India)

    P M Prithviraj Swamy; S Basavaraja; Vijayanand Havanoor; N V Srinivas Rao; R Nijagunappa; A Venkataraman

    2011-12-01

    The barium ferrite particles were prepared using a self-propagating low-temperature combustion method using polyethylene glycol (PEG) as a fuel. The process was investigated with simultaneous thermogravimetric-differential thermal analysis (TG–DTA). The crystalline structure, morphology and the magnetic properties of the barium ferrite particles were studied by means of X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM) and SQUID susceptometer. The results show that the ignition temperature of PEG is lower compared with other combustion methods and gives nanocrystalline barium ferrite.

  14. Addition of methyl cellulose enema to double-contrast barium imaging of sigmoid diverticulosis

    Energy Technology Data Exchange (ETDEWEB)

    Olsson, R. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Adnerhill, I. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Bjoerkdahl, P. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Ekberg, O. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Fork, F.T. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology

    1997-01-01

    Double-contrast barium enema has a reduced sensitivity in patients with severe sigmoid diverticulosis. Therefore a carboxy methyl cellulose enema was employed after the conventional double-contrast examination in 15 patients with sigmoid diverticulosis. A significant increase in lumen diameter and a superior removal of barium residue from the diverticulas facilitated the interpretation of the sigmoid loops. Conclusion: The addition of methyl cellulose enema to double-contrast barium imaging improves diagnostic imaging in diverticulosis by expanding the lumen and emptying the diverticulas. (orig.).

  15. A Comparative Study on Magnetostructural Properties of Barium Hexaferrite Powders Prepared by Polyethylene Glycol

    Directory of Open Access Journals (Sweden)

    Zehra Durmus

    2014-01-01

    Full Text Available Nanocrystalline particles of barium hexaferrite were synthesized by a sol-gel combustion route using nitrate-citrate gels prepared from metal nitrates and citric acid solutions with Fe/Ba molar ratio 12. The present paper aims to study the effect of addition of polyethylene glycol (PEG solutions with different molecular weights (MW: 400, 2000, and 10.000 g/mol on magnetostructural properties of barium hexaferrite. The formation of the barium hexaferrite was inspected using X-ray diffraction (XRD analysis, Fourier transform infrared (FT-IR analysis, thermogravimetric (TGA analysis, scanning electron microscopy (SEM analysis and vibrating sample magnetometer (VSM analysis for magnetic measurements.

  16. Physico-chemical study of barium (II) dipivaloylmethanate nature

    Energy Technology Data Exchange (ETDEWEB)

    Fedotova, N.E. [Rossijskaya Akademiya Nauk, Novosibirsk (Russian Federation). Inst. of Inorganic Chemistry; Igumenov, I.K. [Rossijskaya Akademiya Nauk, Novosibirsk (Russian Federation). Inst. of Inorganic Chemistry; Mamatyuk, V.I. [Rossijskaya Akademiya Nauk, Novosibirsk (Russian Federation). Inst. of Inorganic Chemistry; Sidorenko, G.V. [Rossijskaya Akademiya Nauk, Novosibirsk (Russian Federation). Inst. of Inorganic Chemistry

    1995-06-01

    A physico-chemical research of bis-(dipivaloylmethanato)barium(II) (Ba(thd){sub 2}) has been carried out from the point of its use in CVD processes as a precursor (thermal stability, immunity to external effects and etc.). The optimal conditions for synthesis, purification and storage have been found. It has been shown, that the sublimated product presents a mixture of several modifications with the main phase of a composition Ba{sub 4}(thd){sub 8}. At a lowered pressure the sublimated product is preserved without decomposition for a long time. In the air it is a monomer of a composition Ba(thd){sub 2}*2H{sub 2}O, decomposing in the course of time with forming a free ligand or a diketone (C{sub 8}H{sub 21}O{sub 2}) depending on the way of purification of the initial compound. (orig.).

  17. Synthesis and optical study of barium magnesium aluminate blue phosphors

    Science.gov (United States)

    Jeet, Suninder; Sharma, Manoj; Pandey, O. P.

    2015-05-01

    Europium doped barium magnesium aluminate (BaMgAl10O17:Eu2+) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl10O17(JCPDS 26-0163) along with an additional phase BaAl2O4(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f6 5d → 4f7 transition of Eu2+ which lies in the blue region of the visible spectrum.

  18. Synthesis and optical study of barium magnesium aluminate blue phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Jeet, Suninder, E-mail: suninder.jeet@thapar.edu; Pandey, O. P., E-mail: oppandey@thapar.edu [School of Physics and Materials Science, Thapar University, Patiala (147003), Punjab (India); Sharma, Manoj, E-mail: manojnarad@sggswu.org [Department of Nanotechnology, Sri Guru Granth Sahib World University, Fatehgarh Sahib(146406), Punjab (India)

    2015-05-15

    Europium doped barium magnesium aluminate (BaMgAl{sub 10}O{sub 17}:Eu{sup 2+}) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl{sub 10}O{sub 17}(JCPDS 26-0163) along with an additional phase BaAl{sub 2}O{sub 4}(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f{sup 6} 5d → 4f{sup 7} transition of Eu{sup 2+} which lies in the blue region of the visible spectrum.

  19. A new type of microphone using flexoelectric barium strontium titnate

    Science.gov (United States)

    Kwon, Seol ryung; Huang, Wenbin; Zhang, Shujun; Yuan, Fuh-Gwo; Jiang, Xiaoning

    2014-03-01

    A flexoelectric bridge-structured microphone using bulk barium strontium titanate (Ba0.65Sr0.35TiO3 or BST) ceramic was investigated in this study. The flexoelectric microphone was installed in an anechoic box and exposed to the sound pressure emitted from a loud speaker. Charge sensitivity of the flexoelectric microphone was measured and calibrated using a reference microphone. The 1.5 mm×768 μm×50 μm micro-machined bridge-structured flexoelectric microphone has a sensitivity of 0.92 pC/Pa, while its resonance frequency was calculated to be 98.67 kHz. The analytical and experimental results show that the flexoelectric microphone has both high sensitivity and broad bandwidth, indicating that flexoelectric microphones are potential candidates for many applications.

  20. Influence of Barium Hexaferrite on Magnetic Properties of Hydroxyapatite Ceramics.

    Science.gov (United States)

    Jarupoom, P; Jaita, P

    2015-11-01

    Hydroxyapatite (HA) powders was derived from natural bovine bone by sequence of thermal processes. The barium hexaferrite (BF) find magnetic powders were added into HA powders in ratio of 1-3 vol.%. The HA-BF ceramics were prepared by a solid state reaction method and sintered at 1250 degrees C for 2 h. Effects of BF additive on structural, physical and magnetic properties of HA ceramics were investigated. X-ray diffraction revealed that all HA-BF samples showed a main phase of high purity hydroxyapatite [Ca10(PO4)6(OH)2] with calcium and phosphate molar ratio of 1.67. The addition of BF into HA inhibited grain growth and caused an improvement of mechanical properties. The M-H hysteresis loops also showed an improvement in magnetic behavior for higher content of BF. Moreover, in vitro bioactivity test indicated that the 2-3 vol.% sample may be suitable for biological applications.

  1. Barium depletion study on impregnated cathodes and lifetime prediction

    Energy Technology Data Exchange (ETDEWEB)

    Roquais, J.M.; Poret, F.; Doze, R. le; Ricaud, J.L.; Monterrin, A.; Steinbrunn, A

    2003-06-15

    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK)

  2. Analysis of barium hydroxide and calcium hydroxide slurry carbonation reactors

    Energy Technology Data Exchange (ETDEWEB)

    Patch, K.D.; Hart, R.P.; Schumacher, W.A.

    1980-05-01

    The removal of CO/sub 2/ from air was investigated by using a continuous-agitated-slurry carbonation reactor containing either barium hydroxide (Ba(OH)/sub 2/) or calcium hydroxide (Ca(OH)/sub 2/). Such a process would be applied to scrub /sup 14/CO/sub 2/ from stack gases at nuclear-fuel reprocessing plants. Decontamination factors were characterized for reactor conditions which could alter hydrodynamic behavior. An attempt was made to characterize reactor performance with models assuming both plug flow and various degrees of backmixing in the gas phase. The Ba(OH)/sub 2/ slurry enabled increased conversion, but apparently the process was controlled under some conditions by phenomena differing from those observed for carbonation by Ca(OH)/sub 2/. Overall reaction mechanisms are postulated.

  3. Infrared Spectroscopic Characterization of Calcium and Barium Hydrazone Complexes

    Directory of Open Access Journals (Sweden)

    *A. Adeniyi

    2013-06-01

    Full Text Available Hydrazones have attracted considerable interest on account of their biological activities. Introduction of calcium and barium metal ions into m- and p-nitrobenzoic hydrazones is expected to modify these biological properties for enhanced activity and versatility. The ligands were synthesized from the parent acids. The complexes have been characterized using C, H and N microanalyses and IR spectrometry. The IR spectral data of the ligands and complexes revealed bonding via the C=O and C=N groups. The suggested metal to ligand stoichiometries are: [M (m-NBHx]Cl2.yH2O, x, y = 1 and 4 for M = Ca; x, y = 2 and 3 for M = Ba respectively. [M(p-NBHx]Cl2.yH2O, x, y = 1 and 12 for M = Ca; x, y = 1 and 3 for M = Ba respectively. The structural deductions are tentative pending future X-ray structural studies.

  4. Communication: Barium ions and helium nanodroplets: solvation and desolvation.

    Science.gov (United States)

    Zhang, Xiaohang; Drabbels, Marcel

    2012-08-07

    The solvation of Ba(+) ions created by the photoionization of barium atoms located on the surface of helium nanodroplets has been investigated. The excitation spectra corresponding to the 6p (2)P(1/2) ← 6s (2)S(1/2) and 6p (2)P(3/2) ← 6s (2)S(1/2) transitions of Ba(+) are found to be identical to those recorded in bulk He II [H. J. Reyher, H. Bauer, C. Huber, R. Mayer, A. Schafer, and A. Winnacker, Phys. Lett. A 115, 238 (1986)], indicating that the ions formed at the surface of the helium droplets become fully solvated by the helium. Time-of-flight mass spectra suggest that following the excitation of the solvated Ba(+) ions, these are being ejected from the helium droplets either as bare Ba(+) ions or as small Ba(+)He(n) (n < 20) complexes.

  5. Ionoluminescence of trivalent rare-earth-doped strontium barium niobate

    Energy Technology Data Exchange (ETDEWEB)

    Calvo del Castillo, H. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain); Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Ruvalcaba, J.L. [Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Bettinelli, M.; Speghini, A. [Dipartimento Scientifico e Tecnologico, Universita di Verona and INSTM, UdR Verona, Ca Vignal, Strada Le Grazie 15, I-37134 Verona (Italy); Barboza Flores, M. [Centro de Investigacion en Fisica, Universidad de Sonora, Hermosillo, Sonora (Mexico); Calderon, T. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain)], E-mail: tomas.calderon@uam.es; Jaque, D.; Garcia Sole, J. [Departamento de Fisica de Materiales, Universidad Autonoma de Madrid, 28049 Cantoblanco, Madrid (Spain)

    2008-05-15

    Ionoluminescence spectra for different rare-earth ion (Pr{sup 3+} and Eu{sup 3+})-activated Sr{sub x}Ba{sub 1-x}Nb{sub 2}O{sub 6} strontium barium niobate crystals (x=0.33 and 0.60) have been induced with a 3 MeV proton beam for a variety of beam current intensities (45, 40 and 20 nA). The proton-beam induced luminescent spectra have shown features associated with the presence of the rare-earth ion and some spectral features mostly related to the host crystal, which appear only for high beam current intensities. We have compared the ionoluminescence results to those obtained under UV light excitation (photoluminescence technique) where a direct excitation of the band gap would occur.

  6. Structural and functional characterization of barium zirconium titanate / epoxy composites

    Directory of Open Access Journals (Sweden)

    Filiberto González Garcia

    2011-12-01

    Full Text Available The dielectric behavior of composite materials (barium zirconium titanate / epoxy system was analyzed as a function of ceramic concentration. Structure and morphologic behavior of the composites was investigated by X-ray Diffraction (XRD, Fourier transformed infrared spectroscopy (FT-IR, Raman spectroscopy, field emission scanning electron microscopy (FE-SEM and transmission electron microscopy (TEM analyses. Composites were prepared by mixing the components and pouring them into suitable moulds. It was demonstrated that the amount of inorganic phase affects the morphology of the presented composites. XRD revealed the presence of a single phase while Raman scattering confirmed structural transitions as a function of ceramic concentration. Changes in the ceramic concentration affected Raman modes and the distribution of particles along into in epoxy matrix. Dielectric permittivity and dielectric losses were influenced by filler concentration.

  7. Effect of Nb on barium titanate prepared from citrate solutions

    Directory of Open Access Journals (Sweden)

    Stojanović Biljana D.

    2002-01-01

    Full Text Available The influence of the addition of dopants on the microstructure development and electrical properties of BaTiO3 doped with 0.2, 0.4, 0.6, 0.8 mol% of Nb and 0.01 mol% of Mn based compounds was studied. Doped barium titanate was prepared using the polymeric precursor method from citrate solutions. The powders calcined at 700°C for 4 hours were analysed by infrared (IR spectroscopy to verify the presence of carbonates, and by X-ray diffraction (XRD for phase formation. The phase composition, microstructure and dielectric properties show a strong dependence on the amount of added niobium.

  8. Calcium, Strontium and Barium Homogeneous Catalysts for Fine Chemicals Synthesis.

    Science.gov (United States)

    Sarazin, Yann; Carpentier, Jean-François

    2016-12-01

    The large alkaline earths (Ae), calcium, strontium and barium, have in the past 15 years yielded a brand new generation of heteroleptic molecular catalysts for the production of fine chemicals. However, the integrity of these complexes is often plagued by ligand redistribution equilibria in solution. This personal account retraces the paths followed in our research group towards the design of stable heteroleptic alkalino-earth complexes, including the use of intramolecular noncovalent Ae···H-Si and Ae···F-C interactions. Their implementation as homogenous precatalysts for reactions such as the intramolecular and intermolecular hydroamination and hydrophosphination of activated alkenes, the hydrophosphonylation of ketones, and the dehydrogenative coupling of amines and hydrosilanes that enable the efficient and controlled formations of CP, CN, or SiN σ-bonds, is presented in a synthetic perspective that highlights their overall outstanding catalytic performance.

  9. Preparation and Characterization of Nano-particle Substituted Barium Hexaferrite

    CERN Document Server

    Atassi, Yomen; Tally, Mohammad

    2014-01-01

    High density magnetic recording requires high coercivity magnetic media and small particle size. Barium hexaferrite has been considered as a leading candidate material because of its chemical stability, fairly large crystal anisotropy and suitable magnetic characteristics. In this work, we present the preparation of the hexagonal ferrite BaFe12O19 and one of its derivative; the Zn-Sn substituted hexaferrite by the chemical co-precipitation method. The main advantage of this method on the conventional glass-ceramic one, resides in providing a small enough particle size for magnetic recording. We demonstrate using the X-ray diffraction patterns that the particle size decreases when substituting the hexaferrite by the Zn-Sn combination. This may improve the magnetic properties of the hexaferrite as a medium for HD magnetic recording

  10. Barium and carbon fluxes in the Canadian Arctic Archipelago

    Science.gov (United States)

    Thomas, Helmuth; Shadwick, Elizabeth; Dehairs, Frank; Lansard, Bruno; Mucci, Alfonso; Navez, Jacques; Gratton, Yves; Prowe, Friederike; Chierici, Melissa; Fransson, Agneta; Papakyriakou, Tim N.; Sternberg, Erika; Miller, Lisa A.; Tremblay, Jean-ÉRic; Monnin, Christophe

    2011-09-01

    The seasonal and spatial variability of dissolved Barium (Ba) in the Amundsen Gulf, southeastern Beaufort Sea, was monitored over a full year from September 2007 to September 2008. Dissolved Ba displays a nutrient-type behavior: the maximum water column concentration is located below the surface layer. The highest Ba concentrations are typically observed at river mouths, the lowest concentrations are found in water masses of Atlantic origin. Barium concentrations decrease eastward through the Canadian Arctic Archipelago. Barite (BaSO4) saturation is reached at the maximum dissolved Ba concentrations in the subsurface layer, whereas the rest of the water column is undersaturated. A three end-member mixing model comprising freshwater from sea-ice melt and rivers, as well as upper halocline water, is used to establish their relative contributions to the Ba concentrations in the upper water column of the Amundsen Gulf. Based on water column and riverine Ba contributions, we assess the depletion of dissolved Ba by formation and sinking of biologically bound Ba (bio-Ba), from which we derive an estimate of the carbon export production. In the upper 50 m of the water column of the Amundsen Gulf, riverine Ba accounts for up to 15% of the available dissolved Ba inventory, of which up to 20% is depleted by bio-Ba formation and export. Since riverine inputs and Ba export occur concurrently, the seasonal variability of dissolved Ba in the upper water column is moderate. Assuming a fixed organic carbon to bio-Ba flux ratio, carbon export out of the surface layer is estimated at 1.8 ± 0.45 mol C m-2 yr-1. Finally, we propose a climatological carbon budget for the Amundsen Gulf based on recent literature data and our findings, the latter bridging the surface and subsurface water carbon cycles.

  11. The transfer of {sup 137}Cs from barley to beer

    Energy Technology Data Exchange (ETDEWEB)

    Proehl, G.; Mueller, H.; Voigt, G. [Institut fuer Strahlenschutz, Oberschleibheim (Germany)] [and others

    1997-01-01

    Beer has been brewed from barley contaminated with {sup 137}Cs as a consequence of the Chernobyl accident. The {sup 137}Cs activity has been measured in all intermediate steps and in the by-products of the production process. About 35 % of the {sup 137}Cs in barley were recovered in beer. Processing factors defined as the concentration ratio of processed and raw products were determined to be 0.61, 3.3, 0.1 and 0.11 for malt, malt germs, spent grains and beer, respectively. 4 refs., 2 tabs.

  12. Severe acute cholangitis after endoscopic sphincterotomy induced by barium examination: A case report

    Institute of Scientific and Technical Information of China (English)

    Zhen-Hai Zhang; Ya-Guang Wu; Cheng-Kun Qin; Zhong-Xue Su; Jian Xu; Guo-Zhe Xian; Shuo-DongWu

    2012-01-01

    Endoscopic sphincterotomy (EST) is considered as a possible etiological factor for severe cholangitis.We herein report a case of severe cholangitis after endoscopic sphincterotomy induced by barium examination.An adult male patient presented with epigastric pain was diagnosed as having choledocholithiasis by ultrasonography.EST was performed and the stone was completely cleaned.Barium examination was done 3d after EST and severe cholangitis appeared 4 h later.The patient was recovered after treated with tienam for 4 d.Barium examination may induce severe cholangitis in patients after EST,although rare,barium examination should be chosen cautiously.Cautions should be also used when EST is performed in patients younger than 50 years to avoid the damage to the sphincter of Oddi.

  13. Characterization and growth dynamics of barium titanate crystallite on nanometer scale

    Institute of Scientific and Technical Information of China (English)

    Sen Wang; Yue Zhang; Zhen Ji; Yousong Gu; Yunhua Huang; Cheng Zhou

    2005-01-01

    Barium titanate powder on nanometer scale was synthesized by means of co-precipitation. The thermal mass loss, crystal grain growth and phase transition of the barium titanate nanometer powder were investigated by TG (Thermogravimetric)-DTA (Differential scanning calorimetric) and XRD (X-ray powder diffractometer) at different heat treatment temperatures. The results show that amorphous barium titanate powder can transfer into tetragonal symmetry structure after heat treatment. When the heat treatment temperature is below 900℃, the grains grow rapidly because the activation energy at low temperature is greatly less than that at high temperature. By controlling theheat treatment temperature, the optimization of the barium titanate crystallite size and formation of tetragonal phase can be realized.

  14. Research on fabricating technique of Ba-Al-S:Eu sputtering target

    Institute of Scientific and Technical Information of China (English)

    DING Zhao; YU Zhinong; ZHANG Dongpu; XUE Wei; WANG Wuyu

    2009-01-01

    Ba-Al-S-Eu sputtering target for blue emitting phosphors was prepared by powder sintering method. XRD patterns showed that the main components of the target were barium tetra aluminum sulfide (BaAl4S7), bariutm sulfide (BaS), and europium sulfide (EuS). In the samples, part of the barium and aluminum are formed into barium aluminum oxide (BaAl2O4) with the impurity element of oxygen. The PL characteristic spectra of the target showed the 470 nm blue emission obviously, and the Ba-Al-S thin films also transmitted a purple-blue emission at the position of 440 nm.The results indicated that this method was suitable for the fabrication of the Ba-Al-S:Eu sputtering target.

  15. Study on Effectiveness of Barium Enema in the Diagnosis of Hirschsprung Disease

    Directory of Open Access Journals (Sweden)

    M. Karami Chanlah

    2005-08-01

    Full Text Available Introduction & Aims: The study aims to investigate barium enema accuracy in diagnosing Hischsprung's disease (HD. Patients & Methods: This study was performed on 58 patients diagnosed with Hischsprung's disease later confirmed by pathology; the patients had undergone surgical operation in the last 3 years. The radiographs were reached from their medical records and were later assessed by a skilled pediatric radiologist. Bar-ium enema findings were also evaluated. Rectosig-moid index with the sign of transitional zone (TZ, and barium evacuation of delayed radiographs were recorded by a radiologist. Results: We measured accuracy of rectosigmoid index in these patients to be 94.8%, the sign of TZ to be 70.7%, and the barium evacuation of delayed radio-graphs to be 100% for diagnosis of HD. Fifty percent of the cases were neonates, 42% infants, and 7% more than 2 years old. Of all the patients, 76% were male and 24% were female. The most common diseases accompanying HD were cardiac abnormalities. We did not find any total aganglionosis. Conclusion & Discussion: Half of the patients were newborn infants. The fact that the ratio is more than usual shows timely diagnosis of the condition by phy-sicians of this center. Barium enema findings in new-borns of our study contradicted significantly the re-searches done in other countries. In this study, it was found that with increasing age, barium enema find-ings would be defined in such a way that in in-fantsover 2 years, it can reach a diagnosis accuracy of up to 100%. Regarding the availability of barium en-ema and its lower costs than other diagnostic meth-ods, its accuracy seems very promising. Our study emphasizes that perhaps with barium enema, we may operate these infants in one stage so that they can get rid of multiphasic operation difficulties.

  16. Study of the immunoisolating effects of barium-alginate microencapsulation on rat islets allograft survival

    Institute of Scientific and Technical Information of China (English)

    Mei Zhang; Chao Liu; Cuiping Liu; Youwen Qin; Zhaosun Zhen

    2005-01-01

    Objective: To evaluate the immunoisolating effects of barium-alginate microencapsulation on islets allograft survival. Methods: The nonmicroencapsulated and microencapsulated islets were transplanted under the kidney capsule or intraperitoneally into Wistar rat with STZ-induced diabetes. The blood glucose and insulin secretion of grafts were observed. Graft function was tested by oral rats was associated with normal glucose and insulin profiles in response to OGTT. Conclusion: Microencapsulation with barium-alginate membrane can prolong islet survival and protect islets against allorejection.

  17. 33 CFR 137.1 - Purpose and applicability.

    Science.gov (United States)

    2010-07-01

    ... ALL APPROPRIATE INQUIRIES UNDER THE INNOCENT LAND-OWNER DEFENSE Introduction § 137.1 Purpose and... their functions as sovereigns under 33 U.S.C. 2703(d)(2)(B). Involuntary acquisition of properties...

  18. Screening of plant species for phytoremediation of uranium, thorium, barium, nickel, strontium and lead contaminated soils from a uranium mill tailings repository in South China.

    Science.gov (United States)

    Li, Guang-yue; Hu, Nan; Ding, De-xin; Zheng, Ji-fang; Liu, Yu-long; Wang, Yong-dong; Nie, Xiao-qin

    2011-06-01

    The concentrations of uranium, thorium, barium, nickel, strontium and lead in the samples of the tailings and plant species collected from a uranium mill tailings repository in South China were analyzed. Then, the removal capability of a plant for a target element was assessed. It was found that Phragmites australis had the greatest removal capabilities for uranium (820 μg), thorium (103 μg) and lead (1,870 μg). Miscanthus floridulus had the greatest removal capabilities for barium (3,730 μg) and nickel (667 μg), and Parthenocissus quinquefolia had the greatest removal capability for strontium (3,920 μg). In this study, a novel coefficient, termed as phytoremediation factor (PF), was proposed, for the first time, to assess the potential of a plant to be used in phytoremediation of a target element contaminated soil. Phragmites australis has the highest PFs for uranium (16.6), thorium (8.68), barium (10.0) and lead (10.5). Miscanthus floridulus has the highest PF for Ni (25.0). Broussonetia papyrifera and Parthenocissus quinquefolia have the relatively high PFs for strontium (28.1 and 25.4, respectively). On the basis of the definition for a hyperaccumulator, only Cyperus iria and Parthenocissus quinquefolia satisfied the criteria for hyperaccumulator of uranium (36.4 μg/g) and strontium (190 μg/g), and could be the candidates for phytoremediation of uranium and strontium contaminated soils. The results show that the PF has advantage over the hyperaccumulator in reflecting the removal capabilities of a plant for a target element, and is more adequate for assessing the potential of a plant to be used in phytoremediation than conventional method.

  19. Carbon nanotubes allow capture of krypton, barium and lead for multichannel biological X-ray fluorescence imaging

    Science.gov (United States)

    Serpell, Christopher J.; Rutte, Reida N.; Geraki, Kalotina; Pach, Elzbieta; Martincic, Markus; Kierkowicz, Magdalena; de Munari, Sonia; Wals, Kim; Raj, Ritu; Ballesteros, Belén; Tobias, Gerard; Anthony, Daniel C.; Davis, Benjamin G.

    2016-10-01

    The desire to study biology in situ has been aided by many imaging techniques. Among these, X-ray fluorescence (XRF) mapping permits observation of elemental distributions in a multichannel manner. However, XRF imaging is underused, in part, because of the difficulty in interpreting maps without an underlying cellular `blueprint' this could be supplied using contrast agents. Carbon nanotubes (CNTs) can be filled with a wide range of inorganic materials, and thus can be used as `contrast agents' if biologically absent elements are encapsulated. Here we show that sealed single-walled CNTs filled with lead, barium and even krypton can be produced, and externally decorated with peptides to provide affinity for sub-cellular targets. The agents are able to highlight specific organelles in multiplexed XRF mapping, and are, in principle, a general and versatile tool for this, and other modes of biological imaging.

  20. Characteristics of 137Cs deposition in steppe area

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Soil wind erosion in the semiarid steppe area was studied using the 137Cs tracing technique. Comparisons of 137Cs deposition characteristics between different soil profiles indicated that slight aeolian activities occurred on sandy grasslands and semi-fixed dunes with erosion/deposition rates of less than 0.108 cm/a, whereas they were intense on semi-shifting dunes with erosion/deposition rates of higher than 1.35 cm/a.

  1. Obsah Cs-137 v houbách

    OpenAIRE

    ČADOVÁ, Michaela

    2015-01-01

    The aim of this work is to compare the presence of Cs-137 in different kinds of mushrooms in selected locations using semiconductor gamma-ray spectrometry. Research question was determined: Does Cs-137 content amount vary depending on the fungal species? The first part deals with basic knowledge of ionizing radiation, which is important for the complex understanding of thematic problems. This concerns basic radiobiological terms such as radioactivity, ionizing radiation, its biological effect...

  2. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough

    Directory of Open Access Journals (Sweden)

    Carlos Shuler Nin

    2013-12-01

    Full Text Available OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons.RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6% of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6% of the patients, whereas the treatment was ineffective in 1 (8.4%. We observed no complications related to barium swallow, such as contrast aspiration.CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.

  3. Synthesis of nonstoichiometric M-type barium ferrite nanobelt by spark plasma sintering method

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wenyu; ZHANG Qingjie; TANG Xinfeng; CHENG Haibin

    2005-01-01

    This study investigated the feasibility of ultrafast crystallization of M-type barium ferrite when the coprecipitation precursors in stoichiometric proportions as BaFe12O19, Fe(OH)3 and BaCO3 nanoparticles, had been heated by spark plasma sintering (SPS) process. The results show that SPS method may realize the ultrafast crystallization of M-type barium ferrite, absolutely prevent the crystallization of intermediate phase α-Fe2O3, and significantly decrease the crystallization temperature of M-type barium ferrite. The sintered samples obtained at 800℃ by sintering the precursors for 10 minutes are a kind of multiphase ferrites composed of major phase M-type barium ferrite and trace amount of BaFe0.24Fe0.76O2.88. It is discovered that M-type barium ferrites in the holes of the sintered samples are in nanobelt microstructure about 100-300 nm in width and several micrometers in length. These M-type barium ferrite nanobelts are non-stoichiometric and may be expressed as BaFe12+Xo19+1.5x (-4.77≤x≤6.50). Their composistions suggest completely random Fe-rich or Ba-rich domains.

  4. Experimental studies on 3D printing of barium titanate ceramics for medical applications

    Directory of Open Access Journals (Sweden)

    Schult Mark

    2016-09-01

    Full Text Available The present work deals with the 3D printing of porous barium titanate ceramics. Barium titanate is a biocompatible material with piezoelectric properties. Due to insufficient flowability of the starting material for 3D printing, the barium titanate raw material has been modified in three different ways. Firstly, barium titanate powder has been calcined. Secondly, flow additives have been added to the powder. And thirdly, flow additives have been added to the calcined powder. Finally, a polymer has been added to the three materials and specimens have been printed from these three material mixtures. The 3D printed parts were then sintered at 1320°C. The sintering leads to shrinkage which differs between 29.51–71.53% for the tested material mixtures. The porosity of the parts is beneficial for cell growth which is relevant for future medical applications. The results reported in this study demonstrate the possibility to fabricate porous piezoelectric barium titanate parts with a 3D printer that can be used for medical applications. 3D printed porous barium titanate ceramics can especially be used as scaffold for bone tissue engineering, where the bone formation can be promoted by electrical stimulation.

  5. The first barium tin(II) bromide fluoride

    Science.gov (United States)

    Dénès, Georges; Merazig, Hocine; Muntasar, Abdualhafeed; Porterfield, Robyn

    2014-04-01

    In an effort to prepare barium tin(II) bromide fluorides for the first time, possibly similar to the chloride fluorides obtained earlier in our laboratory, precipitation reactions were carried out by mixing aqueous solutions of SnF2 and of BaBr2.2H2O. In contrast with the chloride fluoride system, a single powdered phase was obtained throughout the SnF2 - BaBr2 system, with the yield being maximum at X ≈ 0.25, where X is the molar fraction of barium bromide in the reaction mixture. Phase identification with the JCPDS database failed to produce a match, confirming that a new phase had been produced. The exact chemical composition of the new compound has not been obtained yet. Based on the X value for the maximum yield, the Sn/Ba ratio is likely to be 3/1 or 2/1. The Mössbauer spectrum at ambient conditions shows that bonding to tin(II) is covalent, therefore with the tin lone pair being stereoactive. The Mössbauer parameters ( δ = 3.68 mm/s, Δ = 0.99 mm/s) are similar to those of SnBrF and of Sn2BrF5, thereby showing that tin is bonded to both fluorine and bromine. The larger isomer shift and lower quadrupole splitting than in tin(II) fluorides show that the stereoactivity of the tin lone pair is lower than in the fluorides. The Mössbauer parameters fit well the linear correlation of the quadrupole splitting versus the isomer shift" that has been shown to be present in other series of tin(II) compounds. The linear decrease on this correlation shows that the contribution of non-spherical orbitals ( p and d) to the lone pair is a much larger contributor to the quadrupole splitting than lattice distortions. The structure is likely made of Ba2+ cations and tin(II) fluoride bromide polyatomic anions, with covalent bonding withinthe anions.

  6. Enthalpy of formation of (In, Gd)-doped barium cerate

    Energy Technology Data Exchange (ETDEWEB)

    Matskevich, N.I., E-mail: nata.matskevich@yandex.ru [Nikolaev Institute of Inorganic Chemistry, Siberian Branch of the Russian Academy of Sciences, 630090 Novosibirsk (Russian Federation); Karlsruhe Institute of Technology, Institute of Solid State Physics, D-76334 Karlsruhe (Germany); Wolf, Th. [Karlsruhe Institute of Technology, Institute of Solid State Physics, D-76334 Karlsruhe (Germany); Adelmann, P.; Semerikova, A.N.; Anyfrieva, O.I. [Nikolaev Institute of Inorganic Chemistry, Siberian Branch of the Russian Academy of Sciences, 630090 Novosibirsk (Russian Federation)

    2015-09-10

    Highlights: • BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85} was prepared by solid-state reaction. • The standard formation enthalpy was determined. • The stabilization energy (Δ{sub st}H°) was calculated. • Δ{sub st}H° of BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85} is higher than BaCe{sub 0.7}Nd{sub 0.2}In{sub 0.1}O{sub 2.85} and BaCeO{sub 3}. - Abstract: Solution enthalpies of barium cerate doped by gadolinium and indium and a mixture of BaCl{sub 2} + 0.7CeCl{sub 3} + 2GdCl{sub 3} + 0.1InCl{sub 3} have been measured in 1 mol dm{sup −3} HCl with 0.1 mol dm{sup −3} KI. For the first time the standard molar formation enthalpy of BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85} has been determined by solution calorimetry as follows: Δ{sub f}H° (298.15 K) = −1615.84 ± 9.01 kJ mol{sup −1}. The stabilization energy for above-mentioned compound has been calculated as well. It has been shown that barium cerate doped gadolinium and indium has higher stabilization energy than BaCe{sub 0.7}Nd{sub 0.2}In{sub 0.1}O{sub 2.85} and BaCeO{sub 3}. The reaction enthalpy with CO{sub 2} interaction has been calculated for BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85}.

  7. Optimization of multiroute synthesis for polyaniline-barium ferrite composites

    Energy Technology Data Exchange (ETDEWEB)

    Ben Ghzaiel, Tayssir, E-mail: tayssir.ben-ghzaiel@satie.ens-cachan.fr [Université de Tunis El Manar Faculté des Sciences de Tunis, UR11ES18 Unité de Recherche de Chimie Minérale Appliquée, 2092, Tunis (Tunisia); SATIE, ENS Cachan, CNRS, Université Paris-Saclay, 61 av du Président Wilson, F-94230, Cachan (France); Dhaoui, Wadia [Université de Tunis El Manar Faculté des Sciences de Tunis, UR11ES18 Unité de Recherche de Chimie Minérale Appliquée, 2092, Tunis (Tunisia); Pasko, Alexander; Mazaleyrat, Frédéric [SATIE, ENS Cachan, CNRS, Université Paris-Saclay, 61 av du Président Wilson, F-94230, Cachan (France)

    2016-08-15

    A comparative study of physicochemical and magnetic properties of Polyaniline-BaFe{sub 12}O{sub 19} composites prepared by Solid-Based Polymerization (SBP) and by Aqueous-Based Polymerization (ABP) is carried out. The composites obtained by the latter method underwent a grinding to study the influence of shear stress. Thus, in a systematic approach, an investigation of stirring effect was done by synthesizing these composites using aqueous-based polymerization but without mechanical stirring. Different mass ratio of BaFe{sub 12}O{sub 19} was used to explore their impact on composites properties. X-ray diffraction, FTIR, SEM, TGA, conductivity and vibrating sample magnetometer measurements were performed. Structural and morphological investigations confirmed the presence of polyaniline and barium hexaferrite phase, which were in interaction in the composites regardless the polymerization route. The powder obtained by solid-based pathway revealed distinct particles with uniform distribution for various compositions (wt. %) of BaFe{sub 12}O{sub 19} in Pani, while the composites obtained by aqueous-based polymerization presented agglomerated nanostructures. Thermogravimetric analysis exhibited an improved thermal stability for Pani-BaFe{sub 12}O{sub 19} obtained by solid-based route. The electric conductivity has displayed decreasing trend of DC conductivity with the increase of BaFe{sub 12}O{sub 19} particles in the polymer matrix. Magnetic studies showed a ferromagnetic behaviour for all composites. The saturation magnetization monotonously increased with the increasing of BaFe{sub 12}O{sub 19} amount. The magnetic properties of the powders were mainly related to the hexaferrite loading which was determined using measured magnetic data. These results revealed that magnetization saturation was dependant of volume fraction of ferrite in the composites which was significantly affected by the reaction medium and mechanical stirring. The powders obtained by solid

  8. Defect Chemistry and Microstructure of Complex Perovskite Barium Zinc Niobate

    Science.gov (United States)

    Peng, Ping

    1991-02-01

    This dissertation presents a systematic study of the characterization of the phase transitions, microstructures, defects and transport properties of undoped and doped complex perovskite barium zinc niobate (BZN). Complex perovskite BZN is a paraelectric material while its parent material barium titanate is ferroelectric. With codoping of (Zn + 2Nb) into Ti site, BaTiO_3 shows three distinguished features. First, the Curie temperature is lowered; second, the three phase transitions (cubic-tetragonal-orthorhombic-rhombohedral) coalesce; and lastly, the transition becomes diffuse showing a typical 2nd order phase transition compared with 1st order in undoped BaTiO_3. Complex microchemical ordering is another characteristic of BZN. Stoichiometric BZN shows a mixture of two types of ordering schemes. 1:1, 1:2 ordered microdomains and the disordered matrix co-exist. The 1:1 type ordering involves an internal charge imbalance which inhibits the growth of 1:1 type of ordered microdomains. The 1:2 type ordering is consistent with the chemical composition of BZN. These ordering patterns can be modified by either adjustment of the Zn/Nb ratio or by doping. The defect structure of the stoichiometric BZN is closely related to that of BaTiO_3. Stoichiometric BZN is an insulator with wide band gap (~ 3.70 eV). Undoped BZN has a high oxygen vacancy concentration which comes from three possible sources, such as unavoidable acceptor impurities, due to their natural abundance, Zn/Nb ratio uncertainty due to processing limitations, and high temperature ZnO loss due to sintering process. The oxygen vacancy concentration for undoped BZN lays in the neighborhood of 1500 ppm (atm.). The compensation defects for various dopants have also been identified. Both electrons and holes conduct by a small polaron mechanism. Various thermodynamic parameters, such as enthalpies of oxidation and reduction, mass action constants for intrinsic electronic disorder, oxidation and reduction have been

  9. Mechanism of Phase Transformation and Formation of Barium Hexaferrite Doped with Rare-Earths in Sol-Gel Process

    Institute of Scientific and Technical Information of China (English)

    甘树才; 洪广言; 张军; 车平; 唐娟

    2003-01-01

    The phase-transformation in sol-gel preparation of barium hexaferrite and the formation of barium hexaferrite doped with La3+ were studied by chemical phase analysis, X-ray diffraction and infrared spectrometry analysis. The experimental results show that phase transformation reactions of FeCO3, Fe2O3 and BaFe2O4, barium hexaferrite and γ-Fe2O3 take place in the heat treatment of gel. While the doping lanthanide ion replace barium ion, an equivalent quantity of Fe3+ are reduced to Fe2+ to maintain the charge equilibrium.

  10. Dielectric and Impedance Spectroscopy of Barium Bismuth Vanadate Ferroelectrics

    Science.gov (United States)

    Sutar, B. C.; Choudhary, R. N. P.; Das, Piyush R.

    2014-07-01

    Structural, micro-structural and electrical properties of barium bismuth vanadate Ba(Bi0.5V0.5)O3 ceramics were investigated. X-ray diffraction (XRD) analysis of the prepared material confirmed the formation of the compound with monoclinic crystal system. Scanning electron microscopy (SEM) of the compound exhibits well-defined grains that are uniformly distributed throughout the surface of the sample. Dielectric properties of the compound were studied as a function of temperature at different frequencies. An observation of dielectric anomaly at 295 °C is due to ferroelectric phase transition that was later confirmed by the appearance of hysteresis loop. Detailed studies of complex impedance spectroscopy have provided a better understanding of the relaxation process and correlations between the microstructure-electrical properties of the materials. The nature of frequency dependence of ac conductivity obeys the Debye power law. The dc conductivity, calculated from the ac conductivity spectrum, shows the negative temperature coefficient of resistance behavior similar to that of a semiconductor.

  11. NLTE Strontium and Barium in metal poor red giant stars

    CERN Document Server

    Short, C I

    2006-01-01

    We present atmospheric models of red giant stars of various metallicities, including extremely metal poor (XMP, [Fe/H]<-3.5) models, with many chemical species, including, significantly, the first two ionization stages of Strontium (Sr) and Barium (Ba), treated in Non-Local Thermodynamic Equilibrium (NLTE) with various degrees of realism. We conclude that 1) for all lines that are useful Sr and Ba abundance diagnostics the magnitude and sense of the computed NLTE effect on the predicted line strength is metallicity dependent, 2) the indirect NLTE effect of overlap between Ba and Sr transitions and transitions of other species that are also treated in NLTE non-negligibly enhances NLTE abundance corrections for some lines, 3) the indirect NLTE effect of NLTE opacity of other species on the equilibrium structure of the atmospheric model is not significant, 4) the computed NLTE line strengths differ negligibly if collisional b-b and b-f rates are an order of magnitude smaller or larger than those calculated wi...

  12. On-line ultrasonic characterisation of barium doped lanthanum perovskites

    Energy Technology Data Exchange (ETDEWEB)

    Thamilmaran, P.; Arunachalam, M. [Department of Physics, Sri SRNM College, Sattur 626203, Tamil Nadu (India); Research scholars in Physics, Manonmanium Sundaranar University, Tirunelveli 627012 Tamil Nadu (India); Sankarrajan, S. [Department of Physics, Unnamalai Institute of Technology, Kovilpatti 628503, Tamil Nadu (India); Sakthipandi, K., E-mail: sakthipandi@gmail.com [Department of Physics, Sethu Institute of Technology, Kariapatti 626115, Tamil Nadu (India)

    2015-06-15

    Perovskite manganite samples La{sub 1−x}Ba{sub x}MnO{sub 3} with the composition of x=0.30, 0.33 and 0.36 were prepared by employing solid state reaction technique. The X-ray diffraction (XRD) patterns confirmed the rhombhedral structure with R3c space group of the samples. The obtained energy dispersive analysis X-rays (EDX) spectra of the samples have confirmed the elemental composition of the samples. The scanning electron microscope (SEM) images of the samples were used to find out the size of the particles. In-situ ultrasonic measurements were carried out on the samples by through transmission method. The temperature dependence of the ultrasonic parameters revealed interesting features of the samples. The observed ultrasonic velocities and attenuation both in longitudinal and shear mode are related to the paramagnetic (PM) to ferromagnetic (FM) phase transition in the prepared samples. The results confirmed that an increase in the barium content in the sample leads to an increase in the phase transition temperature T{sub C}.

  13. Barium oxide, calcium oxide, magnesia, and alkali oxide free glass

    Science.gov (United States)

    Lu, Peizhen Kathy; Mahapatra, Manoj Kumar

    2013-09-24

    A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.

  14. Review on dielectric properties of rare earth doped barium titanate

    Science.gov (United States)

    Ismail, Fatin Adila; Osman, Rozana Aina Maulat; Idris, Mohd Sobri

    2016-07-01

    Rare earth doped Barium Titanate (BaTiO3) were studied due to high permittivity, excellent electrical properties and have wide usage in various applications. This paper reviewed on the electrical properties of RE doped BaTiO3 (RE: Lanthanum (La), Erbium (Er), Samarium (Sm), Neodymium (Nd), Cerium (Ce)), processing method, phase transition occurred and solid solution range for complete study. Most of the RE doped BaTiO3 downshifted the Curie temperature (TC). Transition temperature also known as Curie temperature, TC where the ceramics had a transition from ferroelectric to a paraelectric phase. In this review, the dielectric constant of La-doped BaTiO3, Er-doped BaTiO3, Sm-doped BaTiO3, Nd-doped BaTiO3 and Ce-doped BaTiO3 had been proved to increase and the transition temperature or also known as TC also lowered down to room temperature as for all the RE doped BaTiO3 except for Er-doped BaTiO3.

  15. Growth and characterization of barium oxide nanoclusters on YSZ(111)

    Energy Technology Data Exchange (ETDEWEB)

    Nachimuthu, Ponnusamy; Kim, Yong Joo; Kuchibhatla, Satyanarayana V N T; Yu, Zhongqing; Jiang, Weilin; Engelhard, Mark H.; Shutthanandan, V.; Szanyi, Janos; Thevuthasan, Suntharampillai

    2009-08-13

    Barium oxide (BaO) was grown on YSZ(111) substrate by oxygen-plasma-assisted molecular beam epitaxy (OPA-MBE). In-situ reflection high-energy electron diffraction, ex-situ x-ray diffraction, atomic force microscopy and x-ray photoelectron spectroscopy have confirmed that the BaO grows as clusters on YSZ(111). During and following the growth under UHV conditions, BaO remains in single phase. When exposed to ambient conditions, the clusters transformed to BaCO3 and/or Ba(OH)2 H2O. However, in a few attempts of BaO growth, XRD results show a fairly single phase cubic BaO with a lattice constant of 0.5418(1) nm. XPS results show that exposing BaO clusters to ambient conditions results in the formation BaCO3 on the surface and partly Ba(OH)2 throughout in the bulk. Based on the observations, it is concluded that the BaO nanoclusters grown on YSZ(111) are highly reactive in ambient conditions. The variation in the reactivity of BaO between different attempts of the growth is attributed to the cluster size.

  16. Colonic diverticulosis: evaluation with double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja [Korea Veterans Hospital, Seoul (Korea, Republic of)

    1997-02-01

    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west.

  17. Sintering and foaming of barium silicate glass powder compacts

    Science.gov (United States)

    Mueller, Ralf; Reinsch, Stefan; Agea-Blanco, Boris

    2016-10-01

    The manufacture of sintered glasses and glass-ceramics, glass matrix composites and glass-bounded ceramics or pastes is often affected by gas bubble formation. Against this background, we studied sintering and foaming of barium silicate glass powders used as SOFC sealants using different powder milling procedures. Sintering was measured by means of heating microscopy backed up by XPD, DTA, Vacuum Hot Extraction (VHE) and optical and electron microscopy. Foaming increased significantly as milling progressed. For moderately milled glass powders, subsequent storage in air could also promote foaming. Although the powder compacts were uniaxially pressed and sintered in air, the milling atmosphere sig¬ni¬ficantly affected foaming. The strength of this effect increased in the order Ar ? N2 encapsulated CO2, even for powders milled in Ar and N2. Results of this study thus indicate that foaming is caused by carbonaceous species trapped on the glass powder surface. Foaming could be substantially reduced by milling in water and 10 wt% HCl.

  18. Abundance analysis of s-process enhanced barium stars

    CERN Document Server

    Mahanta, Upakul; Goswami, Aruna; Duorah, Kalpana

    2016-01-01

    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ~ 42000) of these objects spanning a wavelength range from 4000 to 6800 A, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature T_eff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] > 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars wit...

  19. Sintering and foaming of barium silicate glass powder compacts

    Directory of Open Access Journals (Sweden)

    Ralf Mueller

    2016-10-01

    Full Text Available The manufacture of sintered glasses and glass-ceramics, glass matrix composites and glass-bounded ceramics or pastes is often affected by gas bubble formation. Against this background, we studied sintering and foaming of barium silicate glass powders used as SOFC sealants using different powder milling procedures. Sintering was measured by means of heating microscopy backed up by XPD, DTA, Vacuum Hot Extraction (VHE and optical and electron microscopy. Foaming increased significantly as milling progressed. For moderately milled glass powders, subsequent storage in air could also promote foaming. Although the powder compacts were uniaxially pressed and sintered in air, the milling atmosphere sig¬ni¬ficantly affected foaming. The strength of this effect increased in the order Ar  N2 < air < CO2. Conformingly, VHE studies revealed that the pores of foamed samples predominantly encapsulated CO2, even for powders milled in Ar and N2. Results of this study thus indicate that foaming is caused by carbonaceous species trapped on the glass powder surface. Foaming could be substantially reduced by milling in water and 10 wt% HCl.

  20. Combustion synthesis, characterization and luminescence properties of barium aluminate phosphor

    Institute of Scientific and Technical Information of China (English)

    AH Wako; FB Dejene; HC Swart

    2014-01-01

    The blue-green emitting Eu2+and Nd3+ doped polycrystalline barium aluminate (BaAl2O4:Eu2+,Nd3+) phosphor, was pre-pared by a solution-combustion method at 500 ºC without a post-annealing process. The characteristic variation in the structural and luminescence properties of the as-prepared samples was evaluated with regards to a change in the Ba/Al molar ratio from 0.1:1 to 1.4:1. The morphologies and the phase structures of the products were characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS), while the optical properties were investigated using ultra-violet (UV) and photoluminescence (PL) spectroscopy, respectively. The XRD and TEM results revealed that the average crystallite size of the BaAl2O4:Eu2+,Nd3+ phosphor was about 70 nm. The broad-band UV-excited luminescence of the phosphors was observed atλmax=500 nm due to transitions from the 4f65d1 to the 4f7 configuration of the Eu2+ ion. The PL results indi-cated that the main peaks in the emission and excitation spectrum of phosphor particles slightly shifted to the short wavelength due to the changes in the crystal field due to the structure changes caused by the variation in the quantity of the Ba ions in the host lattice.

  1. Enhanced photocatalytic hydrogen generation from barium tantalate composites.

    Science.gov (United States)

    Marschall, Roland; Soldat, Julia; Busser, G Wilma; Wark, Michael

    2013-04-01

    (111)-layered Ba5Ta4O15 photocatalysts were synthesised by a solid state reaction route and a citrate synthesis route, and their structural and electronic properties were investigated. After citrate route preparation, the presence of a second phase, namely Ba3Ta5O15, was determined by X-ray powder diffraction and absorption spectroscopy. The existence of this phase had a profound effect on the photocatalytic activity of this Ba5Ta4O15/Ba3Ta5O15 composite in comparison to the pure Ba5Ta4O15 materials. The photocatalytic performance of the barium tantalates was evaluated by investigating the capability in ˙OH radical formation and hydrogen generation. Strongly increased hydrogen evolution rates for the Ba5Ta4O15/Ba3Ta5O15 composite, up to 160% higher than for the pure Ba5Ta4O15, were determined, and only very small amounts of Rh co-catalyst, deposited on the photocatalysts by stepwise reductive photo-deposition, were needed to achieve these results.

  2. Abdominal actinomycosis: barium enema and computed tomography findings.

    Science.gov (United States)

    Uchiyama, N; Ishikawa, T; Miyakawa, K; Iinuma, G; Nakajima, H; Ushio, K; Yokota, T; Akasu, T; Shimoda, T

    1997-02-01

    A case of abdominal actinomycosis is described in a woman with recurrent right lower abdominal pain and low-grade fever without history of appendectomy. Past history included the use of an intrauterine device (IUD) until 10 years before manifestation of these symptoms. We followed up the patient, via diagnostic imaging, for 7 months. On initial barium enema, a polypoid lesion was visualized at the bottom of the cecum and there was constriction of the sigmoid colon; the appendix was not seen. Seven months later, poor extension at the cecum, severe constriction in the sigmoid colon, and narrowing of the terminal ileum were also visualized. On computed tomography (CT), the lesion was initially localized only in the ileocecal region adjacent to the sigmoid colon. After 7 months, the lesion had infiltrated adjacent anatomic components and showed direct infiltration of the pelvic space. Differential diagnosis was difficult, as it was not obvious whether this was a pelvic abscess due to inflammation or appendiceal carcinoma. Laparotomy was performed. Macroscopically, the lesion was not limited to the ileocecal region, but involved the right ureter, tubes the Fallopian and ovary, bladder, psoas muscle, and abdominal wall. Pathology findings showed, chronic inflammatory tissue with evidence of actinomycosis. Although previous reports have described a lack of specific findings in this disease. When actinomycosis is suspected, CT is recommended to define its extent.

  3. Rapid and accurate determination of barium by instrumental neutron activation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Armelin, Maria Jose A.; Maihara, Vera A.; Saiki, Mitiko, E-mail: marmelin@ipen.br, E-mail: vmaihara@ipen.br, E-mail: mitiko@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Trevizam, Anderson R., E-mail: aanrt@hotmail.com [Universidade Estadual do Centro Oeste (UNICENTRO), Guarapuava, PR (Brazil)

    2013-07-01

    Barium is an alkaline earth metal naturally present in soils. When available at a high level in the soil it can cause toxicity to plants and animals. Not all the barium is readily available to living organisms. Inorganic and organic barium compounds can be presented as soluble or insoluble forms in the soil. The soluble form of BaS is extremely toxic to humans, animals and plants. Researchers have noted a decrease of K absorption in the plant when Ba concentrations are increased and a change in overall plant growth. In case of animals, Ba tends to be concentrated in the bones which may compete with calcium, although only about 2% barium ingested in dietary is absorbed by the body. Another effect is that the Ba can interfere with the availability of sulfur in the soil due to the sulphate formation of low solubility. Barium and some other elements are considered palioclimatic proxies. For some researchers, barite is perhaps the most appropriate indicator of paleoproductivity because of a high resistance to dissolution. As explained about the barium effects in various situations, it was considered important to study the more appropriated experimental conditions for determination of this element by INAA. Conditions established for this analysis were: a) Irradiation time, 15 and 40 seconds, under thermal flux neutron about 4 x 10{sup 12} n cm{sup -2} s{sup -1}, for determining barium in geological and biological matrices, respectively; b) Decay time, approximately of 4 minutes; c) Counting time of 30 minutes; d) Radionuclide measured {sup 139}Ba. The quality of Ba results was evaluated from the analysis of certified reference materials. The performance of the method was satisfactory, according to the criterion of E.ζ score. Results obtained in this study indicate INAA is a good alternative for Ba determination in geological and biological samples. (author)

  4. An 8-year review of barium studies in the diagnosis of gastroparesis

    Energy Technology Data Exchange (ETDEWEB)

    Levin, A.A. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States); Levine, M.S. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)], E-mail: marc.levine@uphs.upenn.edu; Rubesin, S.E.; Laufer, I. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)

    2008-04-15

    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings.

  5. Gastrointestinal tract labeling for MDCT of abdomen: Comparison of low density barium and low density barium in combination with water

    Energy Technology Data Exchange (ETDEWEB)

    Gulati, Kavita; Shah, Zarine K.; Sainani, Nisha; Uppot, Raul; Sahani, Dushyant V. [Massachusetts General Hospital and Harvard Medical School, Department of Abdominal Imaging and Intervention, Boston, MA (United States)

    2008-05-15

    The purpose of the study was to compare the quality of stomach and small bowel marking/labeling using 1,350 ml of low-density barium alone (Volumen) with 900 ml of low-density barium and 450 ml of water for 16-MDCT scans of the abdomen and pelvis and assess cost benefits with the two protocols. In this IRB approved study, 80 consecutive patients scheduled for routine CECT (contrast-enhanced CT) of the abdomen-pelvis were studied. Patients were randomized into two groups and were administered either 1,350 ml of VoLumen (two bottles at 20-min intervals, one half bottle at 50 min and the last half on the table) or 900 ml of Volumen (two bottles at 20-min intervals and 450 ml water on the table). Portal venous phase scanning (detector collimation = 0.625 mm, speed = 18.75 mm, thickness = 5 mm) was subsequently performed. Images were reconstructed in axial and coronal plane at the CT console. Two blinded readers used a pre-designed template to assess distension and wall characteristics of the stomach and small bowel on a 5-point scale. Median scores with the two protocols were compared using the Wilcoxon rank sum test. The stomach and small bowel labeling was rated fair to optimal in all patients and did not differ significantly in the two protocols. The mean scores for distension of the small bowel and stomach were comparable. Inter-observer agreement for bowel labeling was found to be excellent (k 0.81). With the use of coronal images there was increased reader confidence in tracing the small bowel with both protocols. Acceptance for two bottles of Volumen and water was greater among patients as compared to three bottles of VoLumen. Use of two bottles of Volumen and water combination cost less than three bottles of Volumen. Stomach and small bowel labeling with administration of 900 ml of Volumen followed by 450 ml of water is cost effective and compares well to 1,350 ml of Volumen alone. (orig.)

  6. 氯化钡除杂制取高纯氢氧化钡%Preparation of high purity barium hydroxide by impurity - removed barium chloride

    Institute of Scientific and Technical Information of China (English)

    翁贤芬; 毛逢银; 何琳; 李莉

    2009-01-01

    Removal technology of strontium and iron from crude barium chloride raw material were studied.Optimization of process conditions of strontium and iron removal were discussed.When crude barium chloride stiring and dissolving the mixture at 60 ℃ for 40 min,impurities of stromtium and calcuim can be removed and mass fraction of strontium in the obatined solid barium chloride was below 1×10-4.Then add oxydol (H2O2) at proportion of 100 g raw materials per 8 mL H2O2,and add active carbon and small quantity of sodium hydroxide.Finally,iron could be get rid of when pH was controlled below 10.Mass fraction of iron in barium hydroxide product was less than 1×10-5 when using the iron - removed barium chaloride as raw material.Therefore,purified barium chloride by this method can be used to produce purity barium hydroxide.%研究了粗氯化钡原料中锶和铁杂质的脱除工艺,探讨了脱除锶和铁的优化工艺条件.在粗氯化钡原料中加入去离子水,液固质量比为0.25: 1,在60 ℃下搅拌溶解40 min,可除去锶和钙杂质,所得氯化钡固体中锶质量分数低于1×10-4.在氯化钡溶液中加入双氧水,每100 g原料中加入双氧水8 mL,加入活性炭和少量氢氧化钠,控制pH低于10时,可除去铁杂质,用除铁后的氯化钡制取氢氧化钡,产品中铁质量分数低于1×10-5.用除杂后的氯化钡可制得高纯氢氧化钡.

  7. Fabrication of cesium-137 brachytherapy sources using vitrification technology.

    Science.gov (United States)

    Dash, Ashutosh; Varma, R N; Ram, Ramu; Saxena, S K; Mathakar, A R; Avhad, B G; Sastry, K V S; Sangurdekar, P R; Venkatesh, Meera

    2009-08-01

    137Cs source in solid matrix encapsulated in stainless-steel at MBq (mCi) levels are widely used as brachytherapy sources for the treatment of carcinoma of cervix uteri. This article describes the large-scale preparation of such sources. The process of fabrication includes vitrification of 137Cs-sodium borosilicate glass, its transformation into spheres of 5-6 mm diameter, casting of glass spheres into a cylinder of 1.5 mm (varphi) x 80 mm (l) in a platinum mould, cutting of the moulds into 5-mm-long pieces, silver coating on the sources, and finally, encapsulation in stainless steel capsules. Development of safety precautions used to trap 137Cs escaping during borosilicate glass preparation is also described. The leach rates of the radioactive sources prepared by the above technology were within permissible limits, and the sources could be used for encapsulation in stainless steel capsules and supplied for brachytherapy applications. This development was aimed at promoting the potential utility of 137Cs-brachytherapy sources in the country and reducing the user's reliance on imported sources. Since its development, more than 1000 such sources have been made by using 4.66 TBq(126 Ci) of 137Cs.

  8. Modelling turnover of Cs-137 in two subarctic salmonid ecosystems

    Energy Technology Data Exchange (ETDEWEB)

    Nordlinder, S.; Bergstroem, U. (Studsvik AB, Ecosafe, Nykoeping (Sweden)); Hammar, J. (Institute of Freshwater Research, Drottningholm (Sweden) Uppsala Univ. (Sweden). Dept. of Zoology); Notter, M. (Swedish Environmental Protection Agency, Solna (Sweden))

    1993-01-01

    The turnover of cesium-137 was simulated in two categories of subarctic, alpine lake ecosystems - a natural lake with Gammarus lacustris as major fish prey and a lake reservoir with introduced Mysis relicta as a new fish-food organism. The resulting concentrations of Cs-137 in two salmonid species - Arctic char (Salvelinus alpinus) and brown trout (Salmo trutta) - were calculated using a multi-compartment model. Observed data were taken from a major case study evaluating the distribution, pathways and major transport mechanisms of Chernobyl cesium through northern lake ecosystems in 1986-90. The aim of this study was to design a specific conceptual model for calculation of the levels of Cs-137 in fish from simple lake ecosystems, which could be adopted for other more complex types of lakes. A multi-compartment model of the ecosystem was designed and the equations were solved with the BIOPATH-code. The uncertainty of the results due to the uncertainty of input values was examined using the PRISM-system. The model gave good correlations to measured data for Cs-137 in water, zooplankton, macro invertebrates and fish in both lakes. The predicted levels in sediments were, however, considerably lower than the observed values. The inflow of Cs-137 from the drainage area to the two lakes was identified as the main contributor to the uncertainty of the long-term prognoses. 33 refs, 6 figs, 3 tabs.

  9. {sup 137} Cs as a tracer of the Catalan current

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Cabeza, J.A.; Molero, J.; Merino, J.; Pujol, L. [Universidad Autonoma de Barcelona (Spain); Mitchell, P.I. [University Coll., Dublin (Ireland). Dept. of Physics

    1995-12-31

    A number of nuclear power installations located in the north-western Mediterranean (NWM) area are known to enhance {sup 137}Cs levels in various marine compartments. The nuclear fuel reprocessing plant at Marcoule (France) has been reported to originate a significant increase of {sup 137}Cs in Rhone river waters and sediments because of the discharge of low-level liquid radioactive waste. This radionuclide may be used as a tracer of oceanographic processes in the NWM; in fact, {sup 137}Cs of Rhone river origin has been detected in the Gulf of Lions by several authors. The results reported in this work correspond to various transect experiments in waters of the Catalan Sea and show that: (i) surface salinity measurements confirmed the presence of the Catalan current in the Cap de Creus area; (ii) the 1991 Cap de Creus transect showed clearly the presence of {sup 137}Cs above a baseline level of 4.3 {+-} 0.2 Bq.m{sup -3}; (iii) the Cap de Salou transect showed elevated levels towards the coast; (iv) the 1992 Cap de Creus transect showed no structure at all. Therefore, it was concluded that traces of {sup 137}Cs from the Marcoule nuclear fuel reprocessing plant were transported by the Catalan current and were detectable in the Catalan Sea with a complex spatio-temporal structure. (authors). 25 refs., 4 figs.

  10. Radiological protection and routinary controls of an activimeter with a cesium and barium sources in an nuclear medicine center; Proteccion radiologica y controles rutinarios de un activimetro con fuentes de cesio y bario en un centro de medicina nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Morales L, M.E. [IPEN INEN, Centro de Medicina Nuclear, Av. Aviacion 3799, Lima 34 (Peru)]. e-mail: toyoco3000@hotmail.com

    2006-07-01

    In the present work the results when carrying out the routine controls in a Deluxe Isotope (Calibrator II) equipment, with some sources of Cesium 137 and Barium 133, in a Nuclear Medicine Center that operates from the year 1983 in a modern one construction inside the Institute of Neoplastic Illnesses (INEN) are shown. Taking in account the Radiological Protection measures to verify if the equipment responds to the personnel's demands in the measurements of activities of the diverse radionuclides that are used in different types of exams that are carried out in this Nuclear Medicine Center are the objectives of this work. This Center was equipped initially with donated equipment by the International Atomic Energy Agency (IAEA) with those that it develops assistance, educational works and of research, giving services to patients of the INEN and other public and private medical centers. (Author)

  11. Household methods to reduce {sup 137}Cs contents of mushrooms

    Energy Technology Data Exchange (ETDEWEB)

    Kostiainen, E. [Radiation and Nuclear Safety Authority - STUK, Helsinki (Finland)

    2005-09-15

    High radiocaesium contents in different species of mushrooms have been observed in areas contaminated by radiocaesium deposition after the Chernobyl accident in 1986. There has been no significant reduction in the {sup 137}Cs contents of mushrooms during the past ten years, besides via radioactive decay. The internal radiation dose received via mushrooms can be reduced by processing mushrooms before consumption. Various household methods were studied to find out their efficiency to reduce {sup 137}Cs contents of mushrooms. The methods tested were the same as normally used in cooking. The tests were made for the species of edible mushrooms widely consumed. The retention factors for the treatments tested were in most cases 0.2-0.3. The efficiency of treatments in reducing the {sup 137}Cs contents increased with larger water volumes and prolonged treatment times.

  12. Nuclear structure and high-spin states of 137Pr

    Science.gov (United States)

    Dragulescu, E.; Ivascu, M.; Petrache, C.; Popescu, D.; Semenescu, G.; Gurgu, I.; Ionescu-Bujor, M.; Iordachescu, A.; Pascovici, G.; Meyer, R. A.; Lopac, V.; Brant, S.; Paar, V.; Vorkapić, D.; Vretenar, D.

    1992-10-01

    Levels in 137Pr were populated in the 126Te( 14N, 3n) and 122Sn( 19F, 4n) reactions and the subsequent radiation was studied using in-beam γ-ray spectroscopy methods including γ-ray excitation-function, angular-distribution, γγ( t) coincidence and γ( t) measurements. A level scheme with new states up to spin {35}/{2} belonging to 137Pr is given. The lifetime of the {11}/{21} state at 563.4 keV has been determined as T {1}/{2} = 2.66±0.07 μ s. The calculation of low-lying levels in 137Pr performed in IBFM has been compared to experimental data.

  13. Dating of mine waste in lacustrine sediments using cesium-137

    Science.gov (United States)

    Rember, W. C.; Erdman, T. W.; Hoffmann, M. L.; Chamberlain, V. E.; Sprenke, K. F.

    1993-11-01

    For over a century Medicine Lake in northern Idaho has received heavy-metal-laden tailings from the Coeur d'Alene mining district. Establishing the depositional chronology of the lake bottom sediments provides information on the source and rate of deposition of the tailings. Cesium-137, an isotope produced in the atmosphere by nuclear bomb tests, was virtually absent in the environment prior to 1951, but reached its apex in 1964. Our analysis of cesium-137 in the sediments of Medicine Lake revealed that 14 cm of fine-grained tailings were deposited in the lake from 1951 to 1964 and tailing deposition downstream was greatly reduced by the installation of tailings dams in the district in 1968. Cesium-137 analysis is accomplished by a fairly simple gamma-ray counting technique and should be a valuable tool for analyzing sedimentation in any lacustrine environment that was active during the 1950s and 1960s.

  14. Radiochemical determination of {sup 137}Cs in foods

    Energy Technology Data Exchange (ETDEWEB)

    Kastner, Geraldo F.; Ferreira, Andrea Vidal; Monteiro, Roberto P.G., E-mail: gfk@cdtn.br, E-mail: avf@cdtn.br, E-mail: rpgm@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2013-07-01

    A determination of radionuclides in food samples is important in commodities in order to attend to regulatory requirements for international trade. As a long-lived radioisotope of cesium, {sup 137}Cs is produced as a result of human nuclear activities and than its contamination level evaluation among others radionuclides in foods is necessary. A methodology for the determination of {sup 137}Cs in foods, pork and fish, is described. The procedures covered homogenization and freeze-drying of the samples. The {sup 137}Cs was measured by gamma spectrometry using Canberra 50% HPGe detector. The counting was carried out with Monte Carlo software for detection conditions optimization including geometry and chemical data information. A certified sample, SRM IAEA-375, was analyzed in order to evaluate the reliability of the method, and the results showed good agreement between the measured and certified values. (author)

  15. Barium Tagging in Solid Xenon for the nEXO Experiment

    Science.gov (United States)

    Chambers, Christopher; Craycraft, Adam; Walton, Timothy; Fairbank, William; nEXO Collaboration

    2016-09-01

    The proposed nEXO experiment utilizes a tonne-scale liquid xenon time projection chamber to search for neutrinoless double beta decay in xenon-136. Positive observation of this decay would determine the nature of the neutrino to be a MAJORANA particle, as well as measure the absolute neutrino mass scale. A critical concern for any rare decay search is reducing or eliminating backgrounds that cannot be distinguished from signal. A powerful background discrimination technique is positive identification of the daughter atom of the decay, in this case barium. This technique, called ``barium tagging'' may be available for a second phase of nEXO operation, allowing for neutrino mass sensitivity beyond the inverted mass hierarchy. Development is underway on a scheme to capture the barium daughter in solid xenon with a cryogenic probe and detect the barium by laser-induced fluorescence inside the solid xenon sample. This presentation reports results on imaging of single barium atoms frozen in a solid xenon matrix, as well as the progress on the freezing and removal of a solid xenon sample from liquid xenon. Graduated.

  16. Fabrication of barium/strontium carbonate coated amorphous carbon nanotubes as an improved field emitter

    Science.gov (United States)

    Maity, S.; Jha, A.; Das, N. S.; Chattopadhyay, K. K.

    2013-02-01

    Amorphous carbon nanotubes (aCNTs) were synthesized by a chemical reaction between ferrocene and ammonium chloride at a temperature ˜250 ∘C in an air furnace. As-synthesized aCNTs were coated with the barium/strontium carbonate through a simple chemical process. The coating of barium/strontium carbonate was confirmed by a high resolution transmission electron microscopy, X-ray diffraction, and Fourier transformed infrared spectroscopy. Morphology of the as-prepared samples was studied by field emission scanning electron microscopy. Thermal gravimetric analysis showed that barium/strontium carbonate coated aCNTs are more stable than the pristine aCNTs. As-prepared barium/strontium carbonate coated aCNTs showed significantly improved field emission properties with a turn-on field as low as 2.5 V/μm. The variation of field emission characteristics of the barium/strontium carbonate coated aCNTs with interelectrode distances was also studied.

  17. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    Energy Technology Data Exchange (ETDEWEB)

    Matoso, Erika, E-mail: ematoso@hotmail.com [Centro Tecnologico da Marinha em Sao Paulo (CEA/CTMS), Ipero, SP (Brazil). Centro Experimental Aramar; Cadore, Solange, E-mail: cadore@iqm.unicamp.br [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Quimica. Departamento de Quimica Analica

    2015-07-01

    Barium can be found in waters up to 1 mg L{sup -1} and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L{sup -1} and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  18. SALT reveals the barium central star of the planetary nebula Hen 2-39

    CERN Document Server

    Miszalski, B; Jones, D; Karakas, A I; Köppen, J; Tyndall, A A; Mohamed, S S; Rodríguez-Gil, P; Santander-García, M

    2013-01-01

    Classical barium stars are binary systems which consist of a late-type giant enriched in carbon and slow neutron capture (s-process) elements and an evolved white dwarf (WD) that is invisible at optical wavelengths. The youngest observed barium stars are surrounded by planetary nebulae (PNe), ejected soon after the wind accretion of polluted material when the WD was in its preceeding asymptotic giant branch (AGB) phase. Such systems are rare but powerful laboratories for studying AGB nucleosynthesis as we can measure the chemical abundances of both the polluted star and the nebula ejected by the polluter. Here we present evidence for a barium star in the PN Hen 2-39. The polluted giant is very similar to that found in WeBo 1. It is a cool (Teff=4250 +/- 150 K) giant enhanced in carbon ([C/H]=0.42 +/- 0.02 dex) and barium ([Ba/Fe]=1.50 +/- 0.25 dex). A spectral type of C-R3 C_24 nominally places Hen 2-39 amongst the peculiar early R-type carbon stars, however the barium enhancement and likely binary status mea...

  19. Dosimetry of a Cesium 137 source; Dosimetria de una fuente de Cesio 137

    Energy Technology Data Exchange (ETDEWEB)

    Torres R, J.G.; Manzanares A, E.; Vega C, H.R. [Unidades Academicas de Estudios Nucleares, Universidad de Zacatecas (Mexico)

    2005-07-01

    It was carried out a dosimetric study of a source of Cesium 137 used in investigations of Radiobiology. This radionuclide has a half life of 30.07 years and it emits photons of 661.657 keV with a probability of 85.2%. The source has been used in a series of experiments trending to observe the cellular response before the gamma rays, as well as for the calibration of equipment of radiological protection. For such reason it is important to determine the dosimetric properties. In this work it was determined the absorbed dose that this source takes when being placed in the center from a methylmethacrylate badge to three distances, 5, 10 and 15 cm. The dose was measured with thermoluminescent dosemeters and it was calculated by means of Monte Carlo method, also was derived an expression that allows to determine the dose starting from the information of the activity of the source and of the distance regarding the same one. (Author)

  20. Transport processes of Cs-137 in lake environments

    Energy Technology Data Exchange (ETDEWEB)

    Hilton, J.; Carrick, T.R.; Lishman, J.P.; Rigg, E. [Inst. of Freshwater Ecology, Windermere (United Kingdom); Davison, W.; Kelly, M.; Hamilton-Taylor, J. [Lancaster Univ. (United Kingdom). Inst. of Environmental and Biological Sciences

    1992-12-31

    Radiocesium levels in the waters of the Lake District dropped after the initial deposition following the Chernobyl reactor accident. However they continued to be measurable several years after the event. Caesium 137 concentrations were measured in the sediments of Esthwaite water and Windermere to determine the input of caesium 137 from the catchment area to the lakes. Experiments were conducted to ascertain the chemical conditions such as pH value, adsorption, competing ions which might contribute to maintaining caesium levels in the lakes. (U.K.).

  1. Evaluation of antibacterial properties of Barium Zirconate Titanate (BZT nanoparticle

    Directory of Open Access Journals (Sweden)

    Simin Mohseni

    2014-12-01

    Full Text Available So far, the antibacterial activity of some organic and inorganic compounds has been studied. Barium zirconate titanate [Ba(Zr xTi1-xO3] (x = 0.05 nanoparticle is an example of inorganic materials. In vitro studies have provided evidence for the antibacterial activity of this nanoparticle. In the current study, the nano-powder was synthesized by sol-gel method. X-ray diffraction showed that the powder was single-phase and had a perovskite structure at the calcination temperature of 1000 ºC. Antibacterial activity of the desired nanoparticle was assessed on two gram-positive (Staphylococcus aureus PTCC1431 and Micrococcus luteus PTCC1625 and two gram-negative (Escherichia coli HP101BA 7601c and clinically isolated Klebsiella pneumoniae bacteria according to Radial Diffusion Assay (RDA. The results showed that the antibacterial activity of BZT nano-powder on both gram-positive and gram-negative bacteria was acceptable. The minimum inhibitory concentration of this nano-powder was determined. The results showed that MIC values for E. coli, K. pneumoniae, M. luteus and S. aureus were about 2.3 µg/mL, 7.3 µg/mL, 3 µg/mL and 12 µg/mL, respectively. Minimum bactericidal concentration (MBC was also evaluated and showed that the growth of E. coli, K. pneumoniae, M. luteus and S. aureus could be decreased at 2.3, 14, 3 and 18 µg/mL of BZT. Average log reduction in viable bacteria count in time-kill assay ranged between 6 Log10 cfu/mL to zero after 24 h of incubation with BZT nanoparticle.

  2. Dose optimisation of double-contrast barium enema examinations.

    Science.gov (United States)

    Berner, K; Båth, M; Jonasson, P; Cappelen-Smith, J; Fogelstam, P; Söderberg, J

    2010-01-01

    The purpose of the present work was to optimise the filtration and dose setting for double-contrast barium enema examinations using a Philips MultiDiagnost Eleva FD system. A phantom study was performed prior to a patient study. A CDRAD phantom was used in a study where copper and aluminium filtration, different detector doses and tube potentials were examined. The image quality was evaluated using the software CDRAD Analyser and the phantom dose was determined using the Monte Carlo-based software PCXMC. The original setting [100 % detector dose (660 nGy air kerma) and a total filtration of 3.5 mm Al, at 81 kVp] and two other settings identified by the phantom study (100 % detector dose and additional filtration of 1 mm Al and 0.2 mm Cu as well as 80 % detector dose and added filtration of 1 mm Al and 0.2 mm Cu) were included in the patient study. The patient study included 60 patients and up to 8 images from each patient. Six radiologists performed a visual grading characteristics study to evaluate the image quality. A four-step scale was used to judge the fulfillment of three image quality criteria. No overall statistical significant difference in image quality was found between the three settings (P > 0.05). The decrease in the effective dose for the settings in the patient study was 15 % when filtration was added and 34 % when both filtrations was added and detector dose was reduced. The study indicates that additional filtration of 1 mm Al and 0.2 mm Cu and a decrease in detector dose by 20 % from the original setting can be used in colon examinations with Philips MultiDiagnost Eleva FD to reduce the patient dose by 30 % without significantly affecting the image quality. For 20 exposures, this corresponds to a decrease in the effective dose from 1.6 to 1.1 mSv.

  3. Scintillation Properties of Eu2+-Activated Barium Fluoroiodide

    Energy Technology Data Exchange (ETDEWEB)

    Gundiah, Gautam; Bourret-Courchesne, Edith; Bizarri, Gregory; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew; Moses, William W.; Derenzo, Stephen E.

    2009-11-18

    The scintillation properties of powders and single-crystals of BaFI doped with Eu2+ are presented. Single crystals were grown by the vertical Bridgman technique. Under optical and X-ray excitation, the samples exhibit a narrow E2+ 5d-4f transition emission centered at 405 nm. The scintillation light output is estimated to be 55,000+-5,000 photons/MeV at 662 keV with 85percent of the light decaying within 600 ns. An energyresolution of 8.5percent full width at half maximum (FWHM) has been achieved using this scintillator for 662 keV excitation (137Cs source) at room temperature.

  4. 134Cs: 137Cs and 106Ru: 137Cs ratios in intertidal sediments from the Cumbria and Lancashire coasts England

    Science.gov (United States)

    Stanners, D. A.; Aston, S. R.

    1981-10-01

    The distributions of 134Cs, 137Cs and 106Ru in intertidal surface sediments from the coasts of Cumbria and Lancashire, north-west England, are reported. The ratios of 134Cs: 137Cs and 106Ru: 137Cs activities have been used together with the isotopic composition of the Windscale radioactive effluents to examine the contamination history of sediments. Distinct differences between the activities and time of contamination of muds, silts and sands are found, and the apparent lag times of transport of radioactive wastes to different sediment localities are estimated. The relatively high activities in fine sediments reflect recent discharges indicating a rapid response to discharge, while the sands contain low levels of older contamination. Apparent lag times of up to 6 years are estimated for the study area; the transport to the south is generally more rapid than to the north. These results have consequences for the operation and interpretation of radiological monitoring in coastal areas.

  5. Colonic transit time in patient with slow-transit constipation: Comparison of radiopaque markers and barium suspension method

    Energy Technology Data Exchange (ETDEWEB)

    Xu Huimin [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Department of General Surgery, Weifang People' s Hospital, ShanDong Province 261041 (China); Han Jiagang [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Na Ying [Department of Medical Imaging, Weifang People' s Hospital, ShanDong Province 261041 (China); Zhao Bo; Ma Huachong [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Wang Zhenjun, E-mail: wang3zj@sohu.com [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China)

    2011-08-15

    Background: Colonic transit study provides valuable information before surgical treatment is considered for patient with constipation. The radiopaque markers method is the most common way for evaluating colon transit time. The aim of this study is to compare the barium suspension with the radiopaque makers to assess the colonic mobility in patient with constipation. Methods: Colonic transit time was measured in 11 female patients with slow-transit constipation using both radiopaque markers and barium suspension method. In radiopaque markers method, the patient ingested 20 markers on the first day, and an abdominal radiograph was performed every 24 h until 80% markers were excreted. In barium suspension method, the patient swallowed up to 50 ml of 200% (w/v) barium meal. The abdominal radiographs were taken at the same time point as the former. Results: The total or segmental colonic transit time were obviously prolonged in all patients. Segmental transits time spent in the right colon, left colon and rectosigmoid for radiopaque markers and barium suspension method was, respectively, 30 {+-} 6 h and 34 {+-} 7 h; 38 {+-} 9 h and 32 {+-} 6 h; 40 {+-} 8 h and 38 {+-} 10 h. In the radiopaque markers method, total colonic transit time was 108 {+-} 14 h and it was 103 {+-} 13 h in the barium suspension method (P > 0.05). Conclusion: The barium suspension and radiopaque markers gave the similar results for colonic transit time. The barium suspension was a simple and cheap method for evaluating the colonic mobility.

  6. Demonstrating the potential of yttrium-doped barium zirconate electrolyte for high-performance fuel cells

    Science.gov (United States)

    Bae, Kiho; Jang, Dong Young; Choi, Hyung Jong; Kim, Donghwan; Hong, Jongsup; Kim, Byung-Kook; Lee, Jong-Ho; Son, Ji-Won; Shim, Joon Hyung

    2017-02-01

    In reducing the high operating temperatures (>=800 °C) of solid-oxide fuel cells, use of protonic ceramics as an alternative electrolyte material is attractive due to their high conductivity and low activation energy in a low-temperature regime (fuel cells. However, poor sinterability of yttrium-doped barium zirconate discourages its fabrication as a thin-film electrolyte and integration on porous anode supports, both of which are essential to achieve high performance. Here we fabricate a protonic-ceramic fuel cell using a thin-film-deposited yttrium-doped barium zirconate electrolyte with no impeding grain boundaries owing to the columnar structure tightly integrated with nanogranular cathode and nanoporous anode supports, which to the best of our knowledge exhibits a record high-power output of up to an order of magnitude higher than those of other reported barium zirconate-based fuel cells.

  7. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    CERN Document Server

    Mong, B; Walton, T; Chambers, C; Craycraft, A; Benitez-Medina, C; Hall, K; Fairbank, W; Albert, J B; Auty, D J; Barbeau, P S; Basque, V; Beck, D; Breidenbach, M; Brunner, T; Cao, G F; Cleveland, B; Coon, M; Daniels, T; Daugherty, S J; DeVoe, R; Didberidze, T; Dilling, J; Dolinski, M J; Dunford, M; Fabris, L; Farine, J; Feldmeier, W; Fierlinger, P; Fudenberg, D; Giroux, G; Gornea, R; Graham, K; Gratta, G; Heffner, M; Hughes, M; Jiang, X S; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krucken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Moore, D; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Retiere, F; Rowson, P C; Rozo, M P; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Twelker, K; Vuilleumier, J -L; Walton, J; Weber, M; Wen, L J; Wichoski, U; Yang, L; Yen, Y -R; Zhao, Y B

    2014-01-01

    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fluorescence quantum efficiency of the principal Ba emission transition are reported. Under current conditions, an image of $\\le10^4$ Ba atoms can be obtained. Prospects for imaging single Ba atoms in solid xenon are discussed.

  8. Determination of barium in bottled drinking water by graphite furnace atomic absorption spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Fagioli, F.; Locatelli, C.; Lanciotti, E.; Vallone, G.; Mazzotta, D.; Mugelli, A.

    1988-11-01

    In relation to the wide environmental spread of barium and to its cardiovascular effects, barium levels were determined by graphite furnace atomic absorption spectrometry in 60 different brands of bottled water marketed in Italy. Matrix interferences were investigated in order to evaluate the use of an analytical calibration function rather than the much more time consuming addition technique. The barium content ranged from limit of detection C/sub L/ (7.0 ..mu..g/1) up to 660 ..mu..g/1, the median value being 80 ..mu..g/l, while the recovery tests varied between 90 and 110% and the precision of the method (s/sub yx/) was 2.5%.

  9. Phenotype abnormality: 137 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 137 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u643i decreased effic...iency during process named unidimensional cell growth ... decreased efficiency ... unidimensional cell growth ...

  10. 14 CFR 137.51 - Operation over congested areas: General.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Operation over congested areas: General... AGRICULTURAL AIRCRAFT OPERATIONS Operating Rules § 137.51 Operation over congested areas: General. (a) Notwithstanding part 91 of this chapter, an aircraft may be operated over a congested area at altitudes...

  11. 49 CFR 572.137 - Test conditions and instrumentation.

    Science.gov (United States)

    2010-10-01

    ... Hybrid III 5th Percentile Female Test Dummy, Alpha Version § 572.137 Test conditions and instrumentation. (a) The test probe for thoracic impacts, except for attachments, shall be of rigid metallic...-sec2) in yaw and pitch about the CG of the probe. One-third (1/3) of the weight of suspension...

  12. 40 CFR 1.37 - Office of External Affairs.

    Science.gov (United States)

    2010-07-01

    ... environmental impact statements, in relation to proposed legislation and reports on legislation. The Office... Section 1.37 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL STATEMENT OF ORGANIZATION... program manager for five major programs that include: (1) The review of other agency environmental...

  13. Cesium-137 Levels Detected in Otters from Austria

    Directory of Open Access Journals (Sweden)

    Gutleb A.C.

    1991-02-01

    Full Text Available Pollution seems to be one of the most important causes for the decline of the European otter (Lutra lutra. The accident in the Chernobyl nuclear power plant added another aspect to environmental pollution. Few data on cesium-137 contents in otters are available, so levels were measured in 3 otters from Austria. All levels found were very low.

  14. Chemical composition of nanomodified composite binder with nano- and microsized barium silicate

    Directory of Open Access Journals (Sweden)

    KOROLEV Evgenij Valerjevich

    2014-08-01

    Full Text Available There are several possibilities to improve cement-based binders. In particular, many properties of cement stone can be enhanced by means of micro- and nanoscale modification. In a number of previous works we had shown that application of barium hydrosilicates leads to such improvement. The present article is devoted to the investigation of the chemical composition of the cement stone which is modified by means of addition of barium hydrosilicates. The modification was performed on different scales: micro- and nanoscale; the results of simultaneous multi-scale modification are also presented. The examination was carried out with help of different modern research techniques – FT IR spectroscopy, differential thermal analysis and X-ray phase analysis. Identification of the new phases and comparative quantitative assessment of their content are performed. It is found that the use of nano- and micro-sized barium hydrosilicates as additives leads to reduction of portlandite by 27...28%; by means of multi-scale modification it is possible to reduce the content of portlandite much more (by 83.3%. Due to addition of nano- and micro-sized barium-based modifiers both the amount of calcium hydrosilicates in reaction products is enlarged, and structure of the mentioned hydrosilicates is changed (the formation of a fine-grained structure of hydration products takes place. Micro-sized barium hydrosilicates are chemically active additives and promote the formation of an additional quantity of calcium hydrosilicates of type CSH (I. The use of nanoscale barium hydrosilicates promotes the formation of CSH (I and CSH (II calcium hydrosilicates, and also both riversidite and xonotlite. As a result of simultaneous application of nano- and micro-sized barium hydrosilicates the content of CSH (II increases. This can be confirmed by means of differential thermal and X-ray analysis. The amount of CSH (I, riversidite and various tobermorites is also increases. It is

  15. Synthesis, characterization and thermostability of barium β-diketonate with tetraethylenepentamine ligand

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    The metal-organic chemical vapor deposition (MOCVD) technique is a promising process for high-temperature superconductor YBa2Cu3O7-δ(YBCO) preparation. In this technique, it is a challenge to obtain barium precursors with high volatility. In addition, the purity, evaporation characteristics and thermostability of adopted precursors in the whole process would decide the quality and reproducible results of YBCO film. In the present report, the barium precursor containing 2,2,6,6-tetramethylheptane-3,5-dionate...

  16. Study of the microstructural transformations of borate glass and barium metaborate crystals induced by femtosecond laser

    Institute of Scientific and Technical Information of China (English)

    Chen Bin; Yu Bing-Kun; Yan Xiao-Na; Qiu Jian-Rong; Jiang Xiong-Wei; Zhu Cong-Shan

    2004-01-01

    This paper describes the microstructural transformations of borate glass and barium metaborate crystals induced by femtosecond laser. Such structural transformations were verified by Raman spectroscopy. The borate glass is transformed into low temperature (LT) phase of barium metaborate (BaB2O4) crystals after being irradiated for 10 min by a femtosecond laser. In addition, after 20 min of irradiation, high temperature (HT) phase of BaB2O4 crystals is also produced. Further studies demonstrate that LT phase BaB2O4 crystals are formed in the HT phase BaB2O4 crystals after femtosecond laser irradiation for 10 s.

  17. Temperature-Dependent Raman Spectra and Microstructure of Barium Metaborate Crystals and Its Melts

    Institute of Scientific and Technical Information of China (English)

    尤静林; 蒋国昌; 侯怀宇; 吴永全; 陈辉; 徐匡迪

    2002-01-01

    We have measured the Raman spectra of β- and α-barium metaborate in crystal and liquid states from room temperature to 1873K, with a semiconductor laser as the laser source, coupled with a time-resolved detection system to eliminate the dense thermal emission background when temperature was considerably high.Temperature-dependent Raman spectra can clearly indicate that the phase transformation from β- to α-barium metaborate has been completed during 1273 - 1300 K. Variations of different kinds of microstructure units with temperature are identified and discussed.

  18. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate

    Indian Academy of Sciences (India)

    P Sarah; S V Suryanarayana

    2003-12-01

    Piezoelectric 3–0 composite ceramics are prepared from a mixture of barium titanate and lithium ferrite phase constituents. Dielectric properties of composites are affected by a number of parameters that include electrical properties, size, shape and amount of constituent phases. The frequency dependent measurements can provide additional insight into mechanisms controlling electrical response. Frequency dependence of dielectric constant plots of lithium ferrite/barium titanate composites will be given and the relevance of trends seen in them will be discussed. Connectivity in composites developed is studied.

  19. Physical states and properties of barium titanate films in a plane electric field

    Science.gov (United States)

    Shirokov, V. B.; Kalinchuk, V. V.; Shakhovoi, R. A.; Yuzyuk, Yu. I.

    2016-07-01

    The influence of a plane electric field on the phase states of barium titanate thin films under the conditions of forced deformation has been studied. The field dependence of a complete set of material constants has been taken in the region of the c-phase, where polarization losses are absent. The material constants are calculated using equations of the piezoelectric effect derived by linearizing the nonlinear equations of state from the phenomenological; theory for barium titanate. It has been shown that there is a critical value of the field at which the electromechanical coupling coefficient reaches a maximum.

  20. Synthesis and characterization of nickel oxide doped barium strontium titanate ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, M. [Dept. of Electrical Engineering, Bengal Institute of Technology Kolkata (India); Mukherjee, S. [Dept. of Metallurgical Engineering, Jadavpur University, Kolkata (India); Maitra, S. [Govt. College of Engg. and Ceramic Technology, Kolkata (India)

    2012-01-15

    Barium strontium titanate (BST) ceramics (Ba{sub 0.6}Sr{sub 0.4})TiO{sub 3} were synthesized by solid state sintering using barium carbonate, strontium carbonate and rutile as the precursor materials. The samples were doped with nickel oxide in different proportions. Different phases present in the sintered samples were determined from X-ray diffraction investigation and the distribution of different phases in the microstructure was assessed from scanning electron microscopy study. It was observed that the dielectric properties of BST were modified significantly with nickel oxide doping. These ceramics held promise for applications in tuned circuits. (author)

  1. The burden of cesium 137 in forest clerks; Die Belastung mit Caesium 137 bei Beschaeftigten der Forstverwaltung

    Energy Technology Data Exchange (ETDEWEB)

    Piechotowski, I.; Jaroni, J. [Landesgesundheitsamt Baden-Wuerttemberg, Stuttgart (Germany); Link, B. [Arbeits- und Sozialministerium des Landes Baden-Wuerttemberg, Stuttgart (Germany); Groezinger, O. [Ministerium fuer Umwelt und Verkehr des Landes Baden-Wuerttemberg, Stuttgart (Germany)

    2000-07-01

    In 47 forest clerks from the regions Ortenau and Oberschwaben in south-west Germany the incorporation of cesium 137 and potassium 40 was measured in autumn 1994. Soil burden as well as burden of nutrition with cesium 137 are different in these regions for geological reasons and as a result of the nuclear accident of Chernobyl. Caused by low content of clay in Oberschwaben, the transfer of cesium to plants is assisted. Heavy rainfall after the nuclear accident led to an additional increase of burden. The median of the concentration of cesium 137 was 1.4 Bq/kg body weight. The median for potassium 40 was 58 Bq/kg body weight. For cesium 137 regional differences were observed. For persons from Oberschwaben the median for cesium 137 was with 2.8 Bq/kg body weight clearly higher than for persons from Ortenau with 0,6 Bq/kg body weight. Concerning nutrition habits, the clearest difference was found comparing persons who had ate a minimum of four portions of deer from the surroundings within the last four weeks with persons who had ate less than four portions of deer from the surroundings within the last four weeks. The difference was greater in Oberschwaben than in Ortenau. The effective dose of cesium 137 calculated on the basis of the incorporation is very low compared to natural radiation. This is also valid for persons from Oberschwaben. (orig.) [German] Im Herbst 1994 wurde bei insgesamt 47 Bediensteten der Forstverwaltung aus den Regionen Ortenaukreis und Oberschwaben die Inkorportation an Caesium 137 und Kalium 40 gemessen. Sowohl die Bodenbelastung als auch die Belastung von Nahrungsmitteln mit Caesium 137 unterscheiden sich in diesen Gebieten bedingt durch geologische Besonderheiten und in Folge des Reaktorunfalls von Tschernobyl. Aufgrund eines geringen Anteils an Tonerden wird in Oberschwaben der Caesiumtransfer in Pflanzen beguenstigt, eine zusaetzliche Erhoehung der Belastung erfolgte durch starke Niederschlaege nach dem Reaktorunfall. Die Konzentration fuer

  2. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage.

    Science.gov (United States)

    Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J

    2012-01-01

    Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3).

  3. Using 137Cs technique to quantify soil conservation capacities of different ecosystems in Wolong Natural Reserve, southwestern China

    Institute of Scientific and Technical Information of China (English)

    GAO Jun; OUYANG ZhiYun

    2007-01-01

    Reliable information about soil conservation capacities of different natural ecosystems is an important reference for the design of targeted erosion and sediment control strategies. The objective of this paper is to quantify the soil conservation capacities of different natural ecosystems that can represent different climatic zones. The 137Cs technique has been used to estimate soil redistribution rates in different natural ecosystems over the past 40 years in Wolong Nature Reserve. The reserve, transiting from the Chengdu plain to the Qinghai-Tibet plateau, maintains rich ecosystems from subtropical to frigid.The net soil erosion rates of 5 selected ecosystems that represent a warm coniferous-broadleaf-mixed forest, a cold-resistant deciduous taiga forest, a cold-resistant shrub, an evergreen cold-resistant taiga servation capacities are reversed in order. The reference inventories for 137Cs in different ecosystems velop effective erosion and sediment strategies in areas with similar climates should consider natural ecosystem types.

  4. A surface-chemistry study of barium ferrite nanoplates with DBSa-modified surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Lisjak, Darja, E-mail: darja.lisjak@ijs.si [Jožef Stefan Institute, Ljubljana (Slovenia); Ovtar, Simona; Kovač, Janez [Jožef Stefan Institute, Ljubljana (Slovenia); Gregoratti, Luca; Aleman, Belen; Amati, Matteo [Elettra – Sincrotrone Trieste S.C.p.A. di interesse nazionale, Trieste (Italy); Fanetti, Mattia [University of Nova Gorica, Nova Gorica (Slovenia); Istituto Officina dei Materiali CNR, Area Science Park, Trieste (Italy); Makovec, Darko [Jožef Stefan Institute, Ljubljana (Slovenia)

    2014-06-01

    Barium ferrite (BaFe{sub 12}O{sub 19}) is a ferrimagnetic oxide with a high magnetocrystalline anisotropy that can be exploited in magnetically aligned ceramics or films for self-biased magnetic applications. Magnetic alignment of the films can be achieved by the directed assembly of barium ferrite nanoplates. In this investigation the nanoplates were synthesized hydrothermally and suspended in 1-butanol using dodecylbenzene sulphonic acid (DBSa) as a surfactant. They were then deposited in an electric or magnetic field on flat substrates and exhibited a significant preferential alignment in the plane of the substrate, allowing a differentiation between the analysis of their basal and side planes using scanning photoelectron microscopy with a lateral resolution down to 100 nm. The surface chemistry of the nanoplates was additionally studied with X-ray photoelectron spectroscopy and time-of-flight secondary ion mass spectrometry. For a comparison, bare barium ferrite nanoplates were also analyzed after decomposing the DBSa at 460 °C. The deviation of the surface chemistry from the stoichiometric composition was observed and the adsorption of the DBSa molecules on the nanoplates was confirmed with all three methods. Different types of bonding (physi- or chemisorption) were possible and considered with respect to the assembly of the barium ferrite nanoplates into anisotropic magnetic films.

  5. X-Ray Fluorescence Analysis for Barium, Zinc, Calcium and Phosphorus in Oil Additives.

    Science.gov (United States)

    1983-08-01

    HOAlD-I’ 908 XRAY FLUORESCENCE ANALYSIS FOR BARIUM ZINC CALCIUM AND i/i PHOSPHORUS IN OIL HDDITIVES(U MATERIALS RESEARCH LABS ASCOT VALE (AUSTRALIA...film technique was used by McGinness, Scott and Mortensen [101 for the quantitative x-ray emission analysis of paints . The paint films, "one-half mil

  6. Inconceivable Hypokalemia: A Case Report of Acute Severe Barium Chloride Poisoning

    Directory of Open Access Journals (Sweden)

    Haibo Tao

    2016-01-01

    Full Text Available Barium is a heavy divalent alkaline earth metal that has been known as a muscle poison. Barium can cause human toxicity, which may lead to significant hypokalemia and have serious consequences. This paper reports a case of unprecedented barium intoxication in which the patient, who suffered from depression, swallowed at least 3.0 g barium chloride to commit suicide. On admission, the patient presented with nausea, vomiting, stomach burning feeling, dizziness, and weakness. Emergency biochemical testing showed that the patient was suffering from severe hypokalemia (K+ 1.7 mmol/L. His electrocardiogram (ECG prompted atrioventricular blocking, ventricular tachycardia, prolongation of PR interval, ST segment depression with U waves, and T wave inversion. Intravenous potassium supplements were given immediately to correct hypokalemia and regular monitoring of vital signs and fluid balance was arranged. After all-out rescue of our hospital personnel, the condition of the patient is currently stable and he is gradually recovering. This case exemplifies the weaknesses of the management of toxic substances and the lack of mental health education for young people. We hope to get more attention for the supervision of toxic substances and the healthy development of young people.

  7. Demonstrating the potential of yttrium-doped barium zirconate electrolyte for high-performance fuel cells.

    Science.gov (United States)

    Bae, Kiho; Jang, Dong Young; Choi, Hyung Jong; Kim, Donghwan; Hong, Jongsup; Kim, Byung-Kook; Lee, Jong-Ho; Son, Ji-Won; Shim, Joon Hyung

    2017-02-23

    In reducing the high operating temperatures (≥800 °C) of solid-oxide fuel cells, use of protonic ceramics as an alternative electrolyte material is attractive due to their high conductivity and low activation energy in a low-temperature regime (≤600 °C). Among many protonic ceramics, yttrium-doped barium zirconate has attracted attention due to its excellent chemical stability, which is the main issue in protonic-ceramic fuel cells. However, poor sinterability of yttrium-doped barium zirconate discourages its fabrication as a thin-film electrolyte and integration on porous anode supports, both of which are essential to achieve high performance. Here we fabricate a protonic-ceramic fuel cell using a thin-film-deposited yttrium-doped barium zirconate electrolyte with no impeding grain boundaries owing to the columnar structure tightly integrated with nanogranular cathode and nanoporous anode supports, which to the best of our knowledge exhibits a record high-power output of up to an order of magnitude higher than those of other reported barium zirconate-based fuel cells.

  8. Settling barium fluxes in the Arabian Sea: Critical evaluation of relationship with export production

    Digital Repository Service at National Institute of Oceanography (India)

    Nair, T.M.B.; Ittekkot, V.; Shankar, R.; Guptha, M.V.S.

    discrepancy is documented between the export flux calculated from the barium-based algorithm and from C sub(org) fluxes at different depths. However, approx. 35% increase in Ba fluxes and a concomitant increase in Ba/C sub(org) ratios are documented between...

  9. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    CERN Document Server

    Anderson, NG; Firsching, M; de Ruiter, N; Schleich, N; Butzer, J S; Cook, N J; Grasset, R; Campbell, M; Scott, N J A; Anderson, N G

    2010-01-01

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 A mu A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct f...

  10. Study of structural, ferromagnetic and ferroelectric properties of nanostructured barium doped Bismuth Ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Chaudhuri, A., E-mail: arkac123@gmail.com [Department of Applied Science, Haldia Institute of Technology, Dist.- Purba Medinipur, Haldia- 721657, West Bengal (India); Department of Condensed Matter Physics and Material Science, S.N. Bose National Center for Basic Sciences, Block JD, Salt Lake, Kolkata 700098 (India); Mandal, K. [Department of Applied Science, Haldia Institute of Technology, Dist.- Purba Medinipur, Haldia- 721657, West Bengal (India); Department of Condensed Matter Physics and Material Science, S.N. Bose National Center for Basic Sciences, Block JD, Salt Lake, Kolkata 700098 (India)

    2014-03-15

    Nanostructured multiferroic Bi{sub (1−x)}Ba{sub x}FeO{sub 3}x=0.0, 0.1, 0.2 were prepared by hydrothermal technique. All samples belonged to the rhombohedrally distorted perovskite structure. The morphology of the particles changed with the doping of barium. Effect of barium doping on the dielectric constant was studied over a wide frequency range of 1000 Hz–1 MHz. The activation energy due to relaxation and due to conduction was measured from the Cole Cole plot and the AC conductivity versus frequency plot respectively. The activation energy estimated from both the studies was close to each other. The activation energy also enhanced with the increase in the barium content. The magnetization at the highest available field (∼1.6 T) increased from 0.05 emu/g for the sample with x=0.0–12 emu/g for the sample with x=0.2. The magnetic measurements show a significant increase in magnetization around 400 °C. Remnant polarization for x=0.0 was negligible and it increased to 0.06 µC/cm{sup 2} for x=0.2. - Highlights: • Bismuth Ferrite nanostructures were synthesized by the hydrothermal technique. • Barium was doped in Bismuth site. • Morphology changed with doping. • Ferromagnetic, Ferroelectric and Dielectric properties enhanced with doping. • An unreported magnetic transition due to spin canting was observed near 550 °C.

  11. Electromechanical Response of Polycrystalline Barium Titanate Resolved at the Grain Scale

    DEFF Research Database (Denmark)

    Majkut, Marta; Daniels, John E.; Wright, Jonathan P.

    2017-01-01

    critical for understanding bulk polycrystalline ferroic behavior. Here, three-dimensional X-ray diffraction is used to reconstruct a 3D grain map (grain orientations and neighborhoods) of a polycrystalline barium titanate sample and track the grain-scale non-180° ferroelectric domain switching strains...

  12. Diffuse X-ray scattering and far infrared absorption of barium and lead β" aluminas

    DEFF Research Database (Denmark)

    Hayes, W.; Kjær, Kristian; Pratt, F. L.;

    1985-01-01

    The authors have carried out high-momentum-resolution studies in diffuse X-ray scattering of barium and lead B" aluminas in the temperature range 20-700 degrees C. They have also measured the vibrational spectra of these compounds between 2K and 300K in the energy range 10-100 cm-1. The results a...

  13. Development of an oil tracer labelled with 137mBa

    Science.gov (United States)

    Stavsetra, L.; Fure, K.; Haugan, A.; Bjørnstad, T.

    2013-05-01

    The extraction of barium ions by isooctane solutions of di-nonyl naphthalene sulfonic acid (HDNNS) and di-cyclohexano-18-crown-6 (DC18C6) from aqueous solutions of hydrochloric acid and sodium chloride has been investigated. The extraction and the associated back extraction results suggest that this barium complex is a suitable oil tracer for petroleum related applications, such as measurement of Residence Time Distribution (RTD) and oil carry-over to the gas outlet in multiphase separators and scrubbers.

  14. Contribution of Asian dust to atmospheric deposition of radioactive cesium ((137)Cs).

    Science.gov (United States)

    Fukuyama, Taijiro; Fujiwara, Hideshi

    2008-11-01

    Both Asian dust (kosa) transported from the East Asian continent and locally suspended dust near monitoring sites contribute to the observed atmospheric deposition of (137)Cs in Japan. To estimate the relative contribution of these dust phenomena to the total (137)Cs deposition, we monitored weekly deposition of mineral particles and (137)Cs in spring. Deposition of (137)Cs from a single Asian dust event was 62.3 mBq m(-2) and accounted for 67% of the total (137)Cs deposition during the entire monitoring period. Furthermore, we found high (137)Cs specific activity in the Asian dust deposition sample. Although local dust events contributed to (137)Cs deposition, their contribution was considerably smaller than that of Asian dust. We conclude that the primary source of atmospheric (137)Cs in Japan is dust transported from the East Asian continent.

  15. Distribution of 137Cs Radionuclide in Industrial Wastes Effluents of Gresik, East Java, Indonesia

    Directory of Open Access Journals (Sweden)

    Muslim

    2015-04-01

    Full Text Available The distribution of anthropogenic radionuclides 137Cs was measured from industrial waste effluent of Gresik to Gresik Sea in east Java, Indonesia. The activity of 37Cs detected at all stations was much lower than in northeast Japan both before and after NPP Fukushima accident. This indicated that in Gresik industrials waste did not consist of 137Cs. The lowest activity 137Cs occurred at the station nearest to the industrial waste effluent that contained some particle ions that were able to scavenge 137Cs and then precipate this radionuclide. Furthermore, the greatest 137Cs occured at the station that has high current speeds that stirred up sediment to release 137Cs in seawater as a secondary source. The lowest salinity did not effect on the activity of 137Cs even though the lowest salinity and activity 137Cs occured at the same station

  16. Possible discovery of the r-process characteristics in the abundances of metal-rich barium stars

    CERN Document Server

    Cui, W Y; Shi, J R; Zhao, G; Wang, W J; Niu, P

    2014-01-01

    We study the abundance distributions of a sample of metal-rich barium stars provided by Pereira et al. (2011) to investigate the s- and r-process nucleosynthesis in the metal-rich environment. We compared the theoretical results predicted by a parametric model with the observed abundances of the metal-rich barium stars. We found that six barium stars have a significant r-process characteristic, and we divided the barium stars into two groups: the r-rich barium stars ($C_r>5.0$, [La/Nd]\\,$<0$) and normal barium stars. The behavior of the r-rich barium stars seems more like that of the metal-poor r-rich and CEMP-r/s stars. We suggest that the most possible formation mechanism for these stars is the s-process pollution, although their abundance patterns can be fitted very well when the pre-enrichment hypothesis is included. The fact that we can not explain them well using the s-process nucleosynthesis alone may be due to our incomplete knowledge on the production of Nd, Eu, and other relevant elements by the ...

  17. Body concentration of caesium-137 in patients from Western Isles of Scotland.

    OpenAIRE

    Isles, C G; Robertson, I.; MacLeod, J A; Preston, T; East, B W; Hole, D J; Lever, A. F.

    1991-01-01

    OBJECTIVES--To compare caesium-137 concentrations in patients from the Western Isles Health Board, Glasgow area, and other parts of the Scottish mainland, and to investigate the source of 137Cs in patients from the Western Isles. DESIGN--Study of hypertensive patients having electrolyte concentrations measured, including 137Cs. Interview by questionnaire of island subjects about intake of foods likely to contain radiocaesium and the source of these foods. Measurement of 137Cs and 134Cs in foo...

  18. Bioaccumulation of Cs-137 and Co-57 by marine phytoplankton

    Energy Technology Data Exchange (ETDEWEB)

    Heldal, H.E. [Inst. of Marine Research, Bergen (Norway); Stupakoff, I.; Fisher, N.S. [State Univ. of New York, Marine Sciences Research Center, Stone Brook, NY (United States)

    1999-11-01

    Under controlled laboratory conditions we have examined the bioaccumulation of Cs-137 and Co-57 in three prymnesiophytes, the coccolithophorid Emiliania huxleyi and the non-calcareous species Isochrysis galbana and Phaeocystis globosa, and two diatoms Skeletonema costatum and Thalassiosira pseudonana. We measured uptake in growing and non-growing cells, and determined concentration factors on both volume and dry weight basis. For Co-57 uptake in non-growing cells, volume concentration factors (VCF) at equilibrium ranged from 0.2{sup *}10{sup 3} for Emiliana huxleyi to 4{sup *}10{sup 3} for the diatom Thalassiosira pseudonana. For Cs-137 uptake in non-growing cells the VCFs were close to zero. The results suggest that, in contrast to Co, the cycling and bioaccumulation in animals of Cs in marine systems is unlikely to be affected by primary producers. (au)

  19. Granulomatous colitis: findings on double contrast barium enema and follow-up studies

    Energy Technology Data Exchange (ETDEWEB)

    Song, Jong Gi; Han, Joon Koo; Kim, Seung Hoon; Choo, Sung Wook; Kim, Seung Cheol; Choi, Byung Ihn [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    1995-10-15

    To evaluate the radiologic findings of granulomatous colitis on double contrast barium enema and changes on follow-up studies. Serial double contrast barium enema of six patients with granulomatous colitis confirmed by endoscopic biopsy were reviewed. We analyzed the radiologic findings and their follow-up changes, including aphthous ulcers, lymphoid hyperplasia, deep ulcers, cobble stone appearance, geographic ulcers, asymmetric involvement of ulcers, skip lesions, sinus tract, fistula formation, pseudosacculation, focal stricture, and small bowel involvement. Pretreatment double contrast barium enema findings were aphthous ulcers in five patients, deep ulcer in six, cobble stone appearance in five, longitudinal geographic ulcers in two, fistulas in one, pseudosacculations in two, focal stricture in one, and pseudopolyps in six. Also, anal ulcers were observed in two patients, asymmetric involvement of ulcers in three, skip lesions in four, and small bowel involvement in five in five patients proved to have inactive disease after treatment, aphthous ulcers and deep ulcers disappeared. Geographic ulcers of two patients and anal ulcer of one patients decreased in size or depth. Pseudosacculation in one patient disappeared. Pseudopolyps decreased in two patients, increased in one, and decreased after increase in two. One patient whose disease remained active after treatment showed maintenance or increase of ulcers or fistula. And their pseudosacculation or focal stricture unchanged and pseudopolyps decreased. The major radiologic findings of chronic granulomatous colitis on double contrast barium enema are aphthous ulcer, deep ulcer, cobble stone appearance, discontinuity of the lesion and coexistence of ulcers and pseudopolyps. And, double contrast barium enema is good follow-up modality because its findings correlate with clinical course of the granulomatous colitis after treatment.

  20. Influence of barium substitution on bioactivity, thermal and physico-mechanical properties of bioactive glass

    Energy Technology Data Exchange (ETDEWEB)

    Arepalli, Sampath Kumar, E-mail: askumar.rs.cer11@iitbhu.ac.in; Tripathi, Himanshu; Vyas, Vikash Kumar; Jain, Shubham; Suman, Shyam Kumar; Pyare, Ram; Singh, S.P., E-mail: spsinghceram@gmail.com

    2015-04-01

    Barium with low concentration in the glasses acts as a muscle stimulant and is found in human teeth. We have made a primary study by substituting barium in the bioactive glass. The chemical composition containing (46.1 − X) SiO{sub 2−}–24.3 Na{sub 2}O–26.9 CaO–2.6 P{sub 2}O{sub 5}, where X = 0, 0.4, 0.8, 1.2 and 1.6 mol% of BaO was chosen and melted in an electric furnace at 1400 ± 5 °C. The glasses were characterized to determine their use in biomedical applications. The nucleation and crystallization regimes were determined by DTA and the controlled crystallization was carried out by suitable heat treatment. The crystalline phase formed was identified by using XRD technique. Bioactivity of these glasses was assessed by immersion in simulated body fluid (SBF) for various time periods. The formation of hydroxy carbonate apatite (HCA) layer was identified by FTIR spectrometry, scanning electron microscope (SEM) and XRD which showed the presence of HCA as the main phase in all tested bioactive glass samples. Flexural strength and densities of bioactive glasses have been measured and found to increase with increasing the barium content. The human blood compatibility of the samples was evaluated and found to be pertinent. - Highlights: • In vitro bioactivity of soda-lime–baria-phospho-silicate glass was investigated. • HCA formed on surface of glasses was confirmed by XRD, SEM and FTIR spectrometry. • Mechanical properties of glasses were found to increase with barium addition. • Hemolysis showed that 1.2 mol% BaO bioactive glass exhibited better biocompatibility. • Barium substituted bioactive glasses can be used as bone implants.

  1. Scanning electron microscopic and electrophoretic observations on barium sulphate used to absorb clotting factors.

    Science.gov (United States)

    Howell, R M; Deacon, S L

    1975-04-30

    Electron microscopy and particle electrophoresis were found to be complementary techniques with which to complete the physical data from an earlier study on barium sulphates used to absorb clotting factors from serum. The differences revealed by scanning electron microscopy (S. E. M) in the physical shape of low and high density grades of barium sulphate particles appear to be of greater significance than charge as expressed by electrophoretic mobility, in determining whether or not precursor or performed factor Xa is eluted. This conclusion was based on the finding that at pH values close to 7, where the adsorption from serum occurs, all samples with the exception of natural barytes were uncharged. However as the high-density, or soil-grade, was found by S. E. M. to consist of large solid crystals it was suggested that this shape might induce activiation of factor X as a result of partial denaturation and consequent unfolding of the adsorbed protein. In contrast, uptake of protein into the centre of the porous aggregates revealed by S. E. M. pictures of low-density or X-ray grade barium sulphate may afford protection against denaturation and exposure of the enzyme site. The porous nature of particles of low-density barium sulphate compared with the solid crystalline forms of other grades accounts not only for its lower bulk density but also for its greater surface/gram ratio which is reflected by an ability to adsorb more protein from serum. Neither technique produced evidence from any of the samples to indicate the presence of stabilising agents sometimes used to coat particles in barium meals.

  2. Marine dispersion of caesium 137 released from Sellafield and Chernobyl

    Science.gov (United States)

    Prandle, D.; Beechey, J.

    1991-09-01

    This modelling study examines the dispersion within the shelf seas surrounding the UK, of 137Cs discharged from Sellafield between 1969 and 1988 together with the atmospheric deposition following Chernobyl (April 1986). The close agreement obtained between computed and observed distributions lends confidence to estimates of flushing times-fundamental parameters in determining pollutant concentrations. Moreover, this study confirms, to first-order, the estimates of Chernobyl fall-out provided by atmospheric dispersion models.

  3. Study on accumulation of 137Cs in aquatic organisms

    Institute of Scientific and Technical Information of China (English)

    FengDing-Hua; CheungT

    1998-01-01

    The organisms were cultivated for 7d in well water contaminated with 137Cs,The experimental results show that the accumulation level of tissues of carassius auratus had the order of gill>viscera>epidermis(including scales)>bone(including head and tail)>flesh.The concentration capability of them had the order of shrimp>carassius auratus>ophiocephalus argus,The concentration factors(CF) of shrimp was 12.6 times of that of ophiocephalus argus.

  4. 40 CFR 86.137-96 - Dynamometer test run, gaseous and particulate emissions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Dynamometer test run, gaseous and particulate emissions. 86.137-96 Section 86.137-96 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... New Otto-Cycle Complete Heavy-Duty Vehicles; Test Procedures § 86.137-96 Dynamometer test run,...

  5. 47 CFR 101.137 - Interconnection of private operational fixed point-to-point microwave stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Interconnection of private operational fixed point-to-point microwave stations. 101.137 Section 101.137 Telecommunication FEDERAL COMMUNICATIONS....137 Interconnection of private operational fixed point-to-point microwave stations....

  6. 47 CFR 13.7 - Classification of operator licenses and endorsements.

    Science.gov (United States)

    2010-10-01

    ... endorsements. 13.7 Section 13.7 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMERCIAL RADIO OPERATORS General § 13.7 Classification of operator licenses and endorsements. (a) Commercial radio operator... are eleven types of commercial radio operator licenses, certificates and permits (licenses)....

  7. 33 CFR 137.60 - Reviews of Federal, State, tribal, and local government records.

    Science.gov (United States)

    2010-07-01

    ..., and local government records. 137.60 Section 137.60 Navigation and Navigable Waters COAST GUARD... DEFENSE Standards and Practices § 137.60 Reviews of Federal, State, tribal, and local government records. (a) Federal, State, tribal, and local government records or databases of government records of...

  8. 42 CFR 137.32 - Is a compact required to participate in self-governance?

    Science.gov (United States)

    2010-10-01

    ...-governance? 137.32 Section 137.32 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.32 Is a compact required to participate in self-governance? Yes, Tribes must have...

  9. THERMAL DECOMPOSITION MECHANISM OF BARIUM BENZOATE%苯甲酸钡的热分解机理

    Institute of Scientific and Technical Information of China (English)

    张克立; 袁继兵; 袁良杰; 孙聚堂

    1999-01-01

    Barium benzoate was synthesized in semi-solid phase reaction. The complex was characterized by elemental analysis, IR, X-ray powder diffraction. It is layered structure, monoclinic system. The mechanism of thermal decomposition for barium benzoate was studied by using TG, DTA, IR and gas chromatography-mass spectrometer. The thermal decompositon of barium benzoate in nitrogen proceeded in one stage: it decomposed to form BaCO3 and organic compounds. The organic compounds obtained from decomposition reaction are mainly benzophenone, triphenylmethane and so on.

  10. Obtaining of barium sulfate from solution formed after desulfation of the active mass of scrap lead-acid batteries

    Directory of Open Access Journals (Sweden)

    O. A. Kalko

    2014-03-01

    Full Text Available Analyses of literature data about processes for solution utilization formed after desulfation of the active mass of scrap lead-acid batteries is performed. Optimal conditions for obtaining of barium sulfate sediment from ammonium sulfate solute and chemically pure Ba(OH2×8H2O и BaCl2×2H2O were found experimentally. In laboratory the commercial barium sulfate from sulfate solutions, that are waste of recycling process of battery scrap, with application of chloride and barium hydroxide was production. The possibility of using this product were discussed.

  11. Estimating Cs-137 fallout inventories in Iceland from precipitation data

    Energy Technology Data Exchange (ETDEWEB)

    Palsson, S.E.; Sigurgeirsson, M.A.; Gudnason, K. [Icelandic Radiation Protection Inst., Reykjavik (Iceland); Arnalds, O. [Agricultural Research Inst., Reykjavik (Iceland); Howard, B.J.; Wright, S.M. [Centre for Ecology and Hydrology Merlewood, Cumbria, (United Kingdom); Palsdottir, I. [Iceland Meteorological Office, Reykjavik (Iceland)

    2002-12-01

    Iceland was identified in the Arctic Monitoring and Assessment Programme (AMAP) as one of the Arctic areas which received the most global fallout from atmospheric nuclear weapons tests, due to relatively high precipitation rates compared with much of the Arctic and sub arctic. Cs-137 in the Icelandic terrestrial ecosystem almost entirely originates from the nuclear weapons tests carried out in the atmosphere until the early sixties. Fallout was greatest in mid nineteen sixties. Additional fallout from the accident at the Chernobyl Nuclear Power Plant was relatively small. The study gave preliminary information on the spatial variation in {sup 137} Cs deposition in Iceland, especially in areas used for agriculture. The objectives of the study were (1) to measure the spatial variation of radiocaesium inventories in soils in Iceland and (2) to compare the results with different approaches to predicting {sup 137} Cs contents in soil. This quantification is a necessary first step in an evaluation of vulnerability to radiocaesium deposition in Iceland. It is anticipated that Icelandic soils could be highly vulnerable to radiocaesium due to their volcanic nature and consequent lack of illitic minerals, as has been suggested by initial chemical studies on the properties of soils in the Nordic countries. (ln)

  12. Cs-137 fallout in Iceland, model predictions and measurements

    Energy Technology Data Exchange (ETDEWEB)

    Palsson, S.E.; Sigurgeirsson, M.A.; Gudnason, K. [Icelandic Radiation Protection Inst. (Iceland); Arnalds, O.; Karlsdottir, I.A. [Agricultural Research Inst. (Iceland); Palsdottir, P. [Icelandic Meteorological Office (Iceland)

    2002-04-01

    Basically all the fallout Cs-137 in Iceland came from the atmospheric nuclear weapons tests in the late fifties and early sixties, the addition from the accident in the Chernobyl Nuclear Power Plant was relatively very small. Measurements of fallout from nuclear weapons tests started in Iceland over 40 years ago and samples of soil, vegetation and agricultural products have been collected from various places and measured during this period. Considerable variability has been seen in the results, even between places close to each other. This is understandable due to the mountainous terrain, changing strong winds and high levels of precipitation. This variability has been especially noticeable in the case of soil samples. The important role of uncultivated rangelands in Icelandic agriculture (e.g. for sheep farming) makes it necessary to estimate deposition for many remote areas. It has thus proven difficult to get a good overview of the distribution of the deposition and its subsequent transfer into agricultural products. Over a year ago an attempt was made to assess the distribution of Cs-137 fallout in Iceland. The approach is based on a model predicting deposition using precipitation data, in a similar manner as that used previously within the Arctic Monitoring and Assessment Programme (AMAP). 1999). One station close to Reykjavik has a time series of Cs-137 deposition data and precipitation data from 1960 onwards. The AMAP deposition model was calibrated for Iceland by using deposition and precipitation data from this station. (au)

  13. Bioremoval of Am-241 and Cs-137 from liquid radioactive wasters by bacterial consortiums; Biorremocao de Am-241 e Cs-137 de rejeitos radioativos liquidos por consorcios bacterianos

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi, E-mail: rpadua@ipen.b, E-mail: sksakata@ipen.b, E-mail: jblima@ipen.b, E-mail: mbmarumo@ipen.b, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-10-26

    This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137

  14. Experimental contamination of pink shrimps by caesium 137; Contamination experimentale de crevettes roses par le cesium 137

    Energy Technology Data Exchange (ETDEWEB)

    Ancellin, J.; Michon, G.; Vilquin, A. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1965-07-01

    The authors describe first of all the technique used for the determination of cesium 137 concentration factors in the pink shrimp (Leander Serratus Pennant). Experiments over three months have shown that the specific activity of the shrimps becomes stable between the thirtieth and the fortieth day. The concentration factors then have values between 30 and 40. These results are similar to those obtained by other authors. (authors) [French] Les auteurs decrivent tout d'abord la technique utilisee pour la determination des facteurs de concentration du Cesium 137 chez la crevette rose (Leander Serratus Pennant). Le resultat des experimentations menees pendant trois mois montre que l'activite specifique des crevettes se stabilise entre le trentieme et le quarantieme jour. Les facteurs de concentration se situent alors entre 30 et 40, Ces donnees sont comparables a celles obtenues par d'autres auteurs. (auteur)

  15. Divergence of Cs-137 sources fluence used in brachytherapy; Divergencia da fluencia de fontes de Cs-137 usadas em braquiterapia

    Energy Technology Data Exchange (ETDEWEB)

    Vianello, E.A.; Almeida, C.E. de [Laboratorio de Ciencias Radiologicas- LCR-DBB (UERJ). R. Sao Francisco Xavier, 524- Pav. HLC, sala 136 terreo- CEP 20.550- 013. Rio de Janeiro (Brazil)

    1998-12-31

    In this work the experimental determination of correction factor for fluence divergence (kln) of linear Cs-137 sources CDCS J4, with Farmer ionization chamber model 2571 in a central and perpendicular plan to source axis, for distances range from 1 to 7 cm., has been presented. The experimental results were compared to calculating by Kondo and Randolph (1960) isotropic theory and Bielajew (1990) anisotropic theory. (Author)

  16. Quality assurance of {sup 137}Cs Photons for Vivo Mouse Irradiation System

    Energy Technology Data Exchange (ETDEWEB)

    Noh, S. J. [Inje Univ., Kimhae (Korea, Republic of); Kim, H. J.; Jeong, D. H.; Yang, K. M.; Son, T. G.; Kang, Y. R. [Dongnam Institute of Radiological and Medical Sciences, Busan (Korea, Republic of); Shin, S. G.; Kye, Y. U. [Pohang University of Science and Technology, Pohang (Korea, Republic of)

    2014-10-15

    The multi-purpose irradiation apparatus using a {sup 137}Cs, which can be used for the blood test, can be affected by the other components of the experiments such as the size and shape of the beaker and the maximum variation of more than 35% has been reported. The mount of the absorbed dose is determined by the distance between irradiation target and the source and the irradiation time with the irradiator (Gamma Irradiator, Chiyoda Technol Co, Japan) for this experiment. The low-dose irradiation has been used in this study is advantageous for irradiating the cell culture vessel or the small animal. However, radiation is performed by placing the 3-5 mice in each mouse cage (polycarbonate cage). In this case, overlapping often happens to the target during irradiation. Irradiating without considering the geometrical aspect of the irradiation device can occur as well. To solve the problems, the mouse apartment with the 45 mouse cages is built and the device is assessed by being compared with the conventional method in 2 different ways. Firstly, the glass dosimeters were inserted into the head and the body of the lab mice for 2 methods. Secondly, MCNP simulation was performed for absorbed dose and air kerma measurements in each mouse apartment chamber. In this study, the system that allows the accurate irradiation using the {sup 137}Cs gamma irradiator mainly used in Radiation Biology was developed and the accuracy of the system has been confirmed by the experiments. The dose delivery using the conventional system had the variation of 42% at most whereas the variation was less than 6% for the mouse apartment. From the MCNP simulation, the difference between each chamber was less than 0.1% and 0.4% for the air kerma and the absorbed dose respectively. Considering the statistical error of MCNP and the assumption from the simulation, the accuracy of the simulation was matched well with the measurements with the glass dosimeters.

  17. Bioaccumulation of cesium-137 in yellow bullhead catfish (Ameiurus natalis) inhabiting an abandoned nuclear reactor reservoir

    Energy Technology Data Exchange (ETDEWEB)

    McCreedy, C.D.; Glickman, L.T. [Purdue Univ., West Lafayette, IN (United States). Dept. of Veterinary Pathobiology; Jagoe, C.H.; Brisbin, I.L. Jr. [Univ. of Georgia, Aiken, SC (United States). Savannah River Ecology Lab.

    1997-02-01

    Bioaccumulation of {sup 137}Cs was investigated in yellow bullhead catfish (Ameiurus natalis) inhabiting an abandoned reactor reservoir, Pond B, Savannah River Site, Barnwell Co., South Carolina. The authors collected fish by trap-netting, and determined ages from pectoral spines. Muscle and other tissues were assayed for {sup 137}Cs by NaI-scintillation. Music {sup 137}Cs was unrelated to sex or mass of fish, but was related to age. Examination of least-squares means suggested that {sup 137}Cs in muscle increased up to about age 3, but did not increase with greater age. A modified Richards model showed equilibrium {sup 137}Cs concentration in muscle was acquired in approximately 2.4 years. Growth differed between sexes and the time to asymptotic body mass was longer than the time to attain equilibrium {sup 137}Cs concentration. Males attained an asymptotic mass of 577 g in approximately 6.3 years; females attained an asymptotic mass of 438 g in approximately 5.9 years. The cumulative {sup 137}Cs burden of the population was 4.9 {times} 10{sup 6} Bq, representing <0.001% of the {sup 137}Cs inventory of the reservoir. Concentration of {sup 137}Cs varied among tissues with gill and muscle the lowest and highest. Concentration of {sup 137}Cs in ovaries declined with increasing ovary mass. Until equilibrium is attained in these fish, {sup 137}Cs concentration is directly related to increasing age rather than size.

  18. Effects of barium on the nonlinear electrical characteristics and dielectric properties of SnO2-based varistors

    Institute of Scientific and Technical Information of China (English)

    Wang Chun-Ming; Wang Jin-Feng; Wang Chun-Lei; Chen Hong-Cun; Su Wen-Bin; Zang Guo-Zhong; Qi Peng; Zhao Ming-Lei; Ming Bao-Quan

    2004-01-01

    The effects of barium on electrical and dielectric properties of the SnO2·Co2Oa.Ta2O5 varistor system sintered at 1250℃ for 60min were investigated. It is found that barium significantly improves the nonlinear properties. The breakdown electrical field increases from 378.0 to 2834.5V/mm, relative dielectric constant (at 1kHz) falls from 1206 to 161 and the resistivity (at 1kHz) rises from 60.3 to 1146.5kΩ·cm with an increase of BaCO3 concentration from 0mol%to 1.00mol%. The sample with 1.00mol% barium has the best nonlinear electrical property and the highest nonlinear coefficient (α=29.2). A modified defect barrier model is introduced to illustrate the grain-boundary barrier formation of barium-doped SnO2-based varistors.

  19. Evaluating gully erosion using {sup 137}Cs and {sup 210}Pb/{sup 137}Cs ratio in a reservoir catchment

    Energy Technology Data Exchange (ETDEWEB)

    Li, Y. [Institute of Agricultural Environment and Sustainable Development, CAAS, Beijing (China) and Institute for Application of Atomic Energy, CAAS, Beijing (China)]. E-mail: yongli32@hotmail.com and yongli@ami.ac.cn; Poesen, J. [Laboratory for Experimental Geomorphology, Catholic University Leuven, Leuven (Belgium); Yang, J.C.; Zhang, J.H. [Institute of Agricultural Environment and Sustainable Development, CAAS, Beijing (China); Institute for Application of Atomic Energy, CAAS, Beijing (China); Fu, B. [Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing (China)

    2003-02-15

    Water erosion in the hilly areas of west China is the main process contributing to the overall sediment of the Yellow River and the Yangtze River. The impact of gully erosion in total sediment output has been mostly neglected. Our objective was to assess the sediment production and sediment sources at both the hillslope and catchment scales in the Yangjuangou reservoir catchment of the Chinese Loess Plateau, northwest China. Distribution patterns in sediment production caused by water erosion on hills and gully slopes under different land use types were assessed using the fallout {sup 137}Cs technique. The total sediment production from the catchment was estimated by using the sediment record in a reservoir. Sediment sources and dominant water erosion processes were determined by comparing {sup 137}Cs activities and {sup 210}Pb/{sup 137}Cs ratios in surface soils and sub-surface soils with those of sediment deposits from the reservoir at the outlet of the catchment. Results indicated that landscape location had the most significant impact on sediment production for cultivated hillslopes, followed by the terraced hillslope, and the least for the vegetated hillslope. Sediment production increased in the following order: top>upper>lower>middle for the cultivated hillslope, and top>lower>upper>middle for the terraced hillslope. The mean value of sediment production declined by 49% for the terraced hillslope and by 80% for the vegetated hillslope compared with the cultivated hillslope. Vegetated gully slope reduced the sediment production by 38% compared with the cultivated gully slope. These data demonstrate the effectiveness of terracing and perennial vegetation cover in controlling sediment delivery at a hillslope scale. Averaged {sup 137}Cs activities and {sup 210}Pb/{sup 137}Cs ratios in the 0-5 cm surface soil (2.22-4.70 Bq kg{sup -1} and 20.70-22.07, respectively) and in the 5-30 cm subsoil (2.60 Bq kg{sup -1} and 28.57, respectively) on the cultivated hills and

  20. Fukushima 137Cs at the base of planktonic food webs off Japan

    Science.gov (United States)

    Baumann, Z.; Fisher, N. S.; Gobler, C. J.; Buesseler, K. O.; George, J. A.; Breier, C. F.; Nishikawa, J.

    2015-12-01

    The potential bioaccumulation of 137Cs in marine food webs off Japan became a concern following the release of radioactive contaminants from the damaged Fukushima nuclear power plant into the coastal ocean. Previous studies suggest that 137Cs activities increase with trophic level in pelagic food webs, however, the bioaccumulation of 137Cs from seawater to primary producers, to zooplankton has not been evaluated in the field. Since phytoplankton are frequently the largest component of suspended particulate matter (SPM) we used SPM concentrations and particle-associated 137Cs to understand bioaccumulation of 137Cs in through trophic pathways in the field. We determined particle-associated 137Cs for samples collected at 20 m depth from six stations off Japan three months after the initial release from the Fukushima nuclear power plant. At 20 m SPM ranged from 0.65 to 1.60 mg L-1 and rapidly declined with depth. The ratios of particulate organic carbon to chlorophyll a suggested that phytoplankton comprised much of the SPM in these samples. 137Cs activities on particles accounted for on average 0.04% of the total 137Cs in seawater samples, and measured concentration factors of 137Cs on small suspended particles were comparatively low (∼102). However, when 137Cs in crustacean zooplankton was derived based only on modeling dietary 137Cs uptake, we found predicted and measured 137Cs concentrations in good agreement. We therefore postulate the possibility that the dietary route of 137Cs bioaccumulation (i.e., phytoplankton ingestion) could be largely responsible for the measured levels in the copepod-dominated (%) zooplankton assemblages in Japanese coastal waters. Finally, our data did not support the notion that zooplankton grazing on phytoplankton results in a biomagnification of 137Cs.

  1. 青海共和盆地土壤风蚀的137Cs法研究(Ⅱ)--137Cs背景值与风蚀速率测定%Application of Caesium-137 Technique on Wind Erosion in Gonghe Basin, Qinghai Province (Ⅱ)-137Cs Reference Inventory and 137Cs Model for Wind Erosion Estimation

    Institute of Scientific and Technical Information of China (English)

    严平; 董光荣; 张信宝; 邹学勇

    2003-01-01

    通过对高寒草原背景值样点(RS7)的分析,将共和盆地的137Cs背景值含量确定为(2 691.78±196.08) Bq*m-2,基本接近北半球137Cs背景值的平均水平,其137Cs剖面满足尖峰分布函数,与公认的理论分布(即负指数分布)相比,呈现出峰值下移和曲线趋平的现象,可能与近几十年来137Cs的稳定下渗有关.应用137Cs背景值剖面分布函数,建立了风蚀速率的137Cs估算模型,估算出四个样方的土壤风蚀速率,并由此转化为区域风蚀速率,计算出共和盆地区域土壤风蚀速率为12.556 t*hm-2*a-1,通过蚀积平衡检验,其误差水平小于10%.并分析了风蚀物的输出途径及其所占比例.

  2. 33 CFR 137.70 - Specialized knowledge or experience on the part of persons specified in § 137.1(a).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Specialized knowledge or... INNOCENT LAND-OWNER DEFENSE Standards and Practices § 137.70 Specialized knowledge or experience on the... located, persons specified in § 137.1(a) must take into account their own specialized knowledge of...

  3. Use of Different Barium Salts to Inhibit the Thaumasite Form of Sulfate Attack in Cement-based Materials

    Institute of Scientific and Technical Information of China (English)

    SU Ying; WEI Xiaochao; HUANG Jian; WANG Yingbin; HE Xingyang; WANG Xiongjue; MA Baoguo

    2016-01-01

    We investigated the effects of different barium compounds on the thaumasite form of sulphate attack (TSA) resistance of cement-based materials when they were used as admixtures in mortars. Moreover, we analyzed the inhibition mechanisms within different types of barium salts, namely BaCO3 and Ba(OH)2, on the thaumasite formation. The control cement mortar and mortars with barium salts to cement and limestone weight ratios of 0.5%, 1.0%, and 1.5% were immersed in 5% (by weight) MgSO4 solution at 5℃ to mimic TSA. Appearance, mass, and compressive strength of the mortar samples were monitored and measured to assess the general degradation extent of these samples. The products of sulphate attack were further analyzed by XRD, FTIR, and SEM, respectively. Experimental results show that different degradation extent is evident in all mortars cured in MgSO4 solution. However, barium salts can greatly inhibit such degradation. Barium in hydroxide form has better effectiveness in protection against TSA than carbonate form, which may be due to their solubility difference in alkaline cement pore solution, and the presence of these barium compounds can reduce the degree of TSA by comparison with the almost completely decomposed control samples.

  4. 8 GHz Tunable Gunn Oscillator in WR-137 Waveguide

    Directory of Open Access Journals (Sweden)

    P. C. Rakshit

    1983-01-01

    Full Text Available The conventional technique of realising waveguide resonators for Gunn diode oscillators to operate at the band edge of the waveguide fails owing to the excitation of a coaxial mode resonance formed by the post and the side walls of the waveguide. One of the solutions to the problem is to mount the diode in a ridged waveguide resonator. This has been demonstrated by constructing an 8 GHz Gunn oscillator using a single ridge in WR-137 waveguide.The steps in designing the oscillator system are also presented.

  5. Scaled-energy spectroscopy of a |M|=1 Rydberg barium atom in an electric field

    Institute of Scientific and Technical Information of China (English)

    Wang Lei; Quan Wei; Shen Li; Yang Hai-Feng; Shi Ting-Yun; Liu Xiao-Jun; Liu Hong-Ping; Zhan Ming-Sheng

    2009-01-01

    We observe strong energy-dependent quantum defects in the scaled-energy Stark spectra for |M|=1 Rydberg states of barium atoms at three scaled energies: ε= -2.000, ε= -2.500 and ε=-3.000. In an attempt to explain the observations, theoretical calculations of closed orbit theory based on a model potential including core effect are performed for non-hydrogenic atoms. While such a potential has been uniformly successful for alkali atoms with a single valence electron, it fails to match experimental results for barium atoms in the 6snp Rydberg states with two valence electrons. Our study points out that this discrepancy is due to the strong perturbation from the 5d8p state, which voids the simple approximation for constant quantum defects of principle quantum number n.

  6. CORRELATED STRONTIUM AND BARIUM ISOTOPIC COMPOSITIONS OF ACID-CLEANED SINGLE MAINSTREAM SILICON CARBIDES FROM MURCHISON

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Nan; Davis, Andrew M.; Dauphas, Nicolas; Pellin, Michael J. [Department of the Geophysical Sciences, The University of Chicago, Chicago, IL, 60637 (United States); Savina, Michael R. [Chicago Center for Cosmochemistry, Chicago, IL 60637 (United States); Gallino, Roberto; Bisterzo, Sara [Dipartimento di Fisica, Università di Torino, I-10125 Torino (Italy); Gyngard, Frank [Laboratory for Space Sciences, Washington University, St. Louis, MO 63130 (United States); Käppeler, Franz [Karlsruhe Institute of Technology, Institut für Kernphysik, Karlsruhe D-76021 (Germany); Cristallo, Sergio [INAF, Osservatorio Astronomico di Collurania, I-64100 Teramo (Italy); Dillmann, Iris, E-mail: lnsmile@uchicago.edu [TRIUMF, 4004 Wesbrook Mall, Vancouver BC V6T 2A3 (Canada)

    2015-04-10

    We present strontium, barium, carbon, and silicon isotopic compositions of 61 acid-cleaned presolar SiC grains from Murchison. Comparison with previous data shows that acid washing is highly effective in removing both strontium and barium contamination. For the first time, by using correlated {sup 88}Sr/{sup 86}Sr and {sup 138}Ba/{sup 136}Ba ratios in mainstream SiC grains, we are able to resolve the effect of {sup 13}C concentration from that of {sup 13}C-pocket mass on s-process nucleosynthesis, which points toward the existence of large {sup 13}C pockets with low {sup 13}C concentrations in asymptotic giant branch stars. The presence of such large {sup 13}C pockets with a variety of relatively low {sup 13}C concentrations seems to require multiple mixing processes in parent asymptotic giant branch stars of mainstream SiC grains.

  7. Synthesis and Fluorescence of Europium-Doped Barium Fluoride Cubic Nanocolumns

    Institute of Scientific and Technical Information of China (English)

    连洪州; 刘洁; 叶泽人; 石春山

    2004-01-01

    Europium-doped barium fluoride cubic nanocolumns were synthesized from the quaternary water in oil reverse microemulsions. In this process, the aqueous cores of water/cetyl trimethyl ammonium bromide(CTAB)/n-butanol/n-octane reverse microemulsions were used as microreactors for the precipitation of europium doped barium fluoride. XRD analysis shows that under the dopant concentration of 0.06%(molar fraction), the products are single phase. The result products are cubic column-like with about 30~50 nm edge length of cross section, and about 200 nm of length obtained from the transmission electron microscopy(TEM), and atomic force microscopy(AFM). Under the 0.06%(molar fraction) of dopant concentration, the fluorescence of Eu2+ and Eu3+ under the 589 of excitation wavelength is observed.

  8. Barium phosphate conversion coating on die-cast AZ91D magnesium alloy

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Poor corrosion resistance limits the application of magnesium alloys.Conversion coating is widely used to protect magnesium alloys because of easy operation and low cost.A novel conversion coating on die.cast AZ91D magnesium alloy containing barium salts was studied.The optimum concentrations of Ba(NO3)2,Mn(NO3)2 and NH4H2PO4 are 25 g/L,15 mL/L and 20 g/L,respectively,based on orthogonal test resulm.The treating time,solution temperature and PH value are settled to be 5-30 min,50-70℃and 2.35-3.0.respectively.The corrosion resistance of barium conversion coating is better than that of manganese-based phosphate conversion coating by immersion test.The coating is composed of Ba,P, O,Mg,Zn,Mn and Al by EDX analysis.

  9. Study on the preparation and formation mechanism of barium sulphate nanoparticles modified by different organic acids

    Indian Academy of Sciences (India)

    Yuhua Shen; Chuanhao Li; Xuemei Zhu; Anjian Xie; Lingguang Qiu; Jinmiao Zhu

    2007-07-01

    This paper reports a simple method to prepare barium sulphate nanoparticles by use of tetradecanoic acid, hexadecanoic acid and stearic acid as modifier. The barium sulphate nanoparticles obtained are characterized by using Fourier transform infra-red spectroscopy (FT-IR), powder X-ray diffraction (XRD), transmission electron microscopy (TEM), dynamic laser light scatter (DLLS) and thermogravimetric analysis (TGA), respectively. The results show that the BaSO4 particles are all spherical and in the nano-scale. Our method has a better dispersion and controllable diameter dependent on the length of the chain of organic acid and the pH value of the system. A possible mechanism is also discussed.

  10. Efficient photoionization for barium ion trapping using a dipole-allowed resonant two-photon transition

    CERN Document Server

    Leschhorn, G; Schaetz, T

    2011-01-01

    Two efficient and isotope-selective resonant two-photon ionization techniques for loading barium ions into radio-frequency (RF)-traps are demonstrated. The scheme of using a strong dipole-allowed transition at \\lambda=553 nm as a first step towards ionization is compared to the established technique of using a weak intercombination line (\\lambda=413 nm). An increase of two orders of magnitude in the ionization efficiency is found favoring the transition at 553 nm. This technique can be implemented using commercial all-solid-state laser systems and is expected to be advantageous compared to other narrowband photoionization schemes of barium in cases where highest efficiency and isotope-selectivity are required.

  11. Barium hexaferrite/graphene oxide: controlled synthesis and characterization and investigation of its magnetic properties

    Science.gov (United States)

    Maddahfar, Mahnaz; Ramezani, Majid; Mostafa Hosseinpour-Mashkani, S.

    2016-08-01

    In the present study, barium hexaferrite nanocrystals (BaFe12O19) were successfully synthesized through the two-step sol-gel method in an aqueous solution in the presence of barium nitrate and iron (III) nitrate. Besides, the effect of the molar ratio of graphene oxide on the particle size and magnetic properties of final product was investigated. In this research, glucose plays a role as capping and chelating agent in the synthesis of BaFe12O19/graphene oxide. Moreover, it was found that the size, morphology, and magnetic properties of the final products could be greatly influenced by the molar ratio of graphene oxide. BaFe12O19/graphene oxide was characterized by using X-ray diffraction, scanning electron microscope, Fourier transform infrared spectroscopy, vibrating sample magnetometer, and energy-dispersive spectrometry.

  12. Correlated Strontium and Barium Isotopic Compositions of Acid-Cleaned Single Silicon Carbides from Murchison

    CERN Document Server

    Liu, Nan; Gallino, Roberto; Davis, Andrew M; Bisterzo, Sara; Gyngard, Frank; Kaeppeler, Franz; Cristallo, Sergio; Dauphas, Nicolas; Pellin, Michael J; Dillmann, Iris

    2015-01-01

    We present strontium, barium, carbon, and silicon isotopic compositions of 61 acid-cleaned presolar SiC grains from Murchison. Comparison with previous data shows that acid washing is highly effective in removing both strontium and barium contamination. For the first time, by using correlated $^{88}Sr$/$^{86}Sr$ and $^{138}Ba$/$^{136}Ba$ ratios in mainstream SiC grains, we are able to resolve the effect of $^{13}C$ concentration from that of $^{13}C$-pocket mass on s-process nucleosynthesis, which points towards the existence of large $^{13}C$-pockets with low $^{13}C$ concentration in AGB stars. The presence of such large $^{13}$R-pockets with a variety of relatively low $^{13}C$ concentrations seems to require multiple mixing processes in parent AGB stars of mainstream SiC grains.

  13. Absolute Te$_2$ reference for barium ion at $455.4~$nm

    CERN Document Server

    Dutta, T; Mukherjee, M

    2016-01-01

    Precision atomic spectroscopy is presently the work horse in quantum information technology, metrology, trace analysis and even for fundamental tests in physics. Stable lasers are inherent part of precision spectroscopy which in turn requires absolute wavelength markers suitably placed corresponding to the atomic species being probed. Here we present, new lines of tellurium (Te$_2$) which allows locking of external cavity diode laser (ECDL) for precision spectroscopy of singly charged barium ions. In addition, we have developed an ECDL with over 100 GHz mod-hop-free tuning range using commercially available diode from $\\textit{Nichia}$. These two developments allow nearly drift-free operation of a barium ion trap set-up with one single reference cell thereby reducing the complexity of the experiment.

  14. Gamma-ray shielding and structural properties of barium-bismuth-borosilicate glasses

    Science.gov (United States)

    Bootjomchai, Cherdsak; Laopaiboon, Jintana; Yenchai, Chadet; Laopaiboon, Raewat

    2012-07-01

    The attenuation coefficients of barium-bismuth-borosilicate glasses have been measured for gamma-ray photon energies of 662, 1173 and 1332 keV using a narrow beam transmission geometry. These coefficients were then used to obtain the values of mass attenuation coefficients, effective atomic number, effective electron density and mean free path. Good agreement has been observed between experimental and theoretical values of these parameters. From the obtained results it is reported here that from the barium-bismuth-borosilicate glasses are better shields to gamma-radiations in comparison to the standard radiation shielding concretes from the shielding point of view. The molar volume, FTIR and acoustic investigations have been used to study the structural properties of the prepared glass system. The obtained results reveal that the formation of non-bridging oxygens occurs at higher concentration of Bi2O3.

  15. Kinetics of barium sulphate reaction crystallization in crystallizers with internal circulation

    Directory of Open Access Journals (Sweden)

    J. Koralewska

    2008-06-01

    Full Text Available Kinetic calculation results describing the observed nucleation and growth rates of barium sulphate crystals precipitated in an integrated reaction-crystallization process in a barium sulphate-ammonium chloride-water system are presented and analyzed. The scope of experiments included two continuous model DTM-type crystallizers (Draft Tube Magma with internal circulation of the suspension forced by a liquid jet-pump device responsible for stable and intensive enough ascending/descending flow of BaSO4 crystal magma in a mixing chamber. For comparison purposes the experimental data corresponding to a continuous DT (Draft Tube crystallizer with propeller agitator are presented and discussed. The various types of laboratory crystallizers used were fed with concentrated water solution of barium chloride (of 10 or 24 mass % and - in a stoichiometric proportion - crystalline ammonium sulphate, assuming isothermal (348 K and hydrodynamic (average residence time of suspension in a crystallizer: 900 s process conditions. The observed nucleation and growth rates of barium sulphate crystals were estimated on the basis of crystal size distributions (CSDs using convenient calculation scheme derived for an MSMPR (Mixed Suspension Mixed Product Removal model approach. Considering the experimental population density distribution courses, a size-dependent growth (SDG phenomenon was taken into account in the kinetic calculations. Five SDG kinetic models recommended in the accessible literature were used for kinetic parameter values estimation. It was proved statistically, that Rojkowski’s two SDG models (hyperbolic and exponential best suit for our own experimental data description. The experimental data presented can be practically applied for improving the constructions of liquid jet-pump DTM crystallizers recommended for reaction crystallization of sparingly soluble inorganic salts (especially for high concentrations of reaction substrates in the modern

  16. Establishment of a protocol for determining gastrointestinal transit time in mice using barium and radiopaque markers

    Energy Technology Data Exchange (ETDEWEB)

    Myagmarjaibuu, Bilomaa; Moon, Myeong Ju; Heo, Suk Hee; Jeong, Seo In; Jeong, Yong Yeon; Kang, Heoung Keun [Dept. of Radiology, Chonnam National University Hwasun Hospital, Chonnam National University Medical School, Hwasun (Korea, Republic of); Park, Jong Seong [Dept. of Physiology, Chonnam National University Medical School, Gwangju (Korea, Republic of); Jun, Jae Yeoul [Dept. of Physiology, College of Medicine, Chosun University, Gwangju (Korea, Republic of)

    2013-01-15

    The purpose of this study was to establish a minimally invasive and reproducible protocol for estimating the gastrointestinal (GI) transit time in mice using barium and radiopaque markers. Twenty 5- to 6-week-old Balb/C female mice weighing 19-21 g were used. The animals were divided into three groups: two groups that received loperamide and a control group. The control group (n = 10) animals were administered physiological saline (1.5 mL/kg) orally. The loperamide group I (n = 10) and group II (n = 10) animals were administered 5 mg/kg and 10 mg/kg loperamide orally, respectively. Thirty minutes after receiving the saline or loperamide, the mice was administered 80 μL of barium solution and six iron balls (0.5 mm) via the mouth and the upper esophagus by gavage, respectively. Afterwards, the mice were continuously monitored with fluoroscopic imaging in order to evaluate the swallowing of the barium solution and markers. Serial fluoroscopic images were obtained at 5- or 10-min intervals until all markers had been excreted from the anal canal. For analysis, the GI transit times were subdivided into intestinal transit times (ITTs) and colon transit times (CTTs). The mean ITT was significantly longer in the loperamide groups than in the control group (p < 0.05). The mean ITT in loperamide group II (174.5 ± 32.3) was significantly longer than in loperamide group I (133.2 ± 24.2 minute) (p < 0.05). The mean CTT was significantly longer in loperamide group II than in the control group (p < 0.05). Also, no animal succumbed to death after the experimental procedure. The protocol for our study using radiopaque markers and barium is reproducible and minimally invasive in determining the GI transit time of the mouse model.

  17. Wideband electromagnetic wave absorber using doped barium hexaferrite in Ku-band

    Energy Technology Data Exchange (ETDEWEB)

    Tehrani, Masoud Kavosh, E-mail: m_kavosh@mut-es.ac.ir [Department of Physics, Malek-ashtar University of Technology, Shahin Shahr (Iran, Islamic Republic of); Ghasemi, Ali [Department of Material Engineering, Malek-ashtar University of Technology, Shahin Shahr (Iran, Islamic Republic of); Moradi, Mahmood; Alam, Reza Shams [Department of Physics, Shiraz University, Shiraz (Iran, Islamic Republic of)

    2011-08-18

    Highlights: > Substituted barium hexaferrite BaMg{sub 0.25}Mn{sub 0.25}Co{sub 0.5}Ti{sub 1.0}Fe{sub 10}O{sub 19} was prepared in powder configuration by solid state reaction. > The results exhibit a wideband single-layer microwave absorber with a satisfactory reflection loss throughout Ku-band. > The composite specimens for measurement of microwave absorber properties were prepared by mixing doped barium ferrite and PVC with a concentration of 70:30 by weight. > The bandwidth that can be achieved by utilization of this sample is 4.5 GHz. Minimum reflection loss of -34 dB can be obtained by sample '(e)'. - Abstract: Substituted barium hexaferrite BaMg{sub 0.25}Mn{sub 0.25}Co{sub 0.5}Ti{sub 1.0}Fe{sub 10}O{sub 19} was prepared in powder configuration by solid state reaction. The ferrite powders were mixed with polyvinylcloride (PVC) plasticizer to fabricate a microwave absorbing composite. X-ray diffraction (XRD), scanning electron microscope (SEM), vibrating sample magnetometer (VSM), and vector network analyzer were employed to characterize phase identification coupled with size and morphology of powder and microwave absorption properties of synthesized composites. It was found that the maximum reflection loss of -40 dB was appeared at frequency range of 12-18 GHz. In the present work, new cation substitutions in iron sites in the crystal lattice of barium ferrite, which can easily tune the bandwidth of the reflection loss, were used. To the best of our knowledge, this is the first study which displays the wideband absorber by employing single layer hexaferrite backed on the surface of copper.

  18. Electrical properties of thick film capacitors based on barium titanate glass formulations

    Energy Technology Data Exchange (ETDEWEB)

    Leppaevuori, S.; Uusimaeki, A.; Hannula, T.

    1981-12-18

    We carried out an investigation of the effects of the glass content of the dielectric layer of thick film capacitors with a barium titanate glass formulation on the capacitance density, loss factor and breakdown voltage of the capacitors. These effects were studied by varying the firing temperature and glass content of the dielectric paste and by using different types of electrode paste. The characteristics of a test capacitor were also measured.

  19. Effect of boric acid sintering aid on densification of barium ferrite

    Indian Academy of Sciences (India)

    S S Vidyawathi; R Amaresh; L N Satapathy

    2002-11-01

    Boric acid has been added in 0.1–0.6% range for studying the densification characteristics of solid state sintered barium hexaferrite. Sintering studies have been carried out at three different temperatures. Physical properties like density and porosity have been studied for all compositions. The phase identification and microstructural investigation on the fractured surface have been carried out to understand the effect of sintering aid on the densification characteristics.

  20. Nanoparticles for cultural heritage conservation: calcium and barium hydroxide nanoparticles for wall painting consolidation.

    Science.gov (United States)

    Giorgi, Rodorico; Ambrosi, Moira; Toccafondi, Nicola; Baglioni, Piero

    2010-08-16

    Nanotechnology provides new concepts and materials for the consolidation and protection of wall paintings. In particular, humble calcium and barium hydroxide nanoparticles offer a versatile and highly efficient tool to combat the main degradation processes altering wall paintings. Clear example of the efficacy and potentiality of nanotechnology is represented by the conservation in situ of Maya wall paintings in the archaeological area in Calakmul (Mexico).

  1. Phase conjugation, isotropic and anisotropic higher order diffraction generation, and image correlation using photorefractive barium titanate

    Science.gov (United States)

    Buranasiri, Prathan

    2005-04-01

    Using barium titanate as the photorefractive material, we demonstrate phase conjugation, beam coupling, higher diffraction order generation. At small incident angles less than 0.015 radian, both codirectional isotropic self-diffraction (CODIS) and contradirectional isotropic self-diffraction (CONDIS) are generated simultaneously. At bigger incident angles approximately more than 0.2094 radian, only codirectional anisotropic-self diffraction (CODAS) are generated. On going imaging correlation is also showing.

  2. Neutron beam test of barium fluoride crystal for dark matter direct detection

    Science.gov (United States)

    Guo, C.; Ma, X. H.; Wang, Z. M.; Bao, J.; Dai, C. J.; Guan, M. Y.; Liu, J. C.; Li, Z. H.; Ren, J.; Ruan, X. C.; Yang, C. G.; Yu, Z. Y.; Zhong, W. L.

    2016-10-01

    In order to test the capabilities of Barium Fluoride (BaF2) crystal for dark matter direct detection, nuclear recoils are studied with mono-energetic neutron beam. The energy spectra of nuclear recoils, quenching factors for elastic scattering neutrons and discrimination capability between neutron inelastic scattering events and γ events are obtained for various recoil energies of the F content in BaF2.

  3. Growth and study of barium oxalate single crystals in agar gel

    Indian Academy of Sciences (India)

    P V Dalal; K B Saraf

    2006-10-01

    Barium oxalate was grown in agar gel at ambient temperature. The effect of various parameters like gel concentration, gel setting time and concentration of the reactants on the growth of these crystals was studied. Prismatic platy shaped spherulites and dendrites were obtained. The grown crystals were characterized by X-ray powder diffractometry, infrared spectroscopy, thermogravimetric and differential thermal analysis. An attempt is made to explain the spherulitic growth mechanism.

  4. A System for Trapping Barium Ions in a Microfabricated Surface Trap

    CERN Document Server

    Graham, Richard D; Sakrejda, Tomasz; Wright, John; Zhou, Zichao; Blinov, Boris B

    2013-01-01

    We have developed a vacuum chamber and control system for rapid testing of microfabricated surface ion traps. Our system uses a modular design and is based on an in-vacuum PCB with integrated filters. We have used this system to successfully trap and cool barium ions. We have demonstrated ion 'dark' lifetimes of 31.6 s +- 3.4 s and controlled shuttling of ions using a custom 96 electrode control system with an update rate of 40 kHz.

  5. Absolute Te$_2$ reference for barium ion at $455.4~$nm

    OpenAIRE

    Dutta, T; Munshi, D; Mukherjee, M.(Variable Energy Cyclotron Centre, Kolkata, India)

    2016-01-01

    Precision atomic spectroscopy is presently the work horse in quantum information technology, metrology, trace analysis and even for fundamental tests in physics. Stable lasers are inherent part of precision spectroscopy which in turn requires absolute wavelength markers suitably placed corresponding to the atomic species being probed. Here we present, new lines of tellurium (Te$_2$) which allows locking of external cavity diode laser (ECDL) for precision spectroscopy of singly charged barium ...

  6. Modification of gray iron produced by induction melting with barium strontium

    Science.gov (United States)

    Modzelevskaya, G.; Feoktistov, A. V.; Selyanin, I. F.; Kutsenko, A. I.; Kutsenko, A. A.

    2016-09-01

    The article provides analysis of results of gray iron experimental melts in induction furnace and the following melt modification with barium-strontium carbonate (BSC-2). It is shown that modification positively affects mechanical and casting properties and as-cast iron structure. It was established that BSC-2 granulated immediately prior to use has greater impact on melt than BSC-2 of the same faction, supplied by the manufacturer.

  7. Caesium 137: Properties and biological effects resulting of an internal contamination;Cesium 137: proprietes et effets biologiques apres contamination interne

    Energy Technology Data Exchange (ETDEWEB)

    Lestaevel, P.; Racine, R.; Bensoussan, H.; Rouas, C.; Gueguen, Y.; Dublineau, I.; Bertho, J.M.; Gourmelon, P.; Jourdain, J.R.; Souidi, M. [Institut de Radioprotection et de Surete Nucleaire, IRSN, laboratoire de radiotoxicologie experimentale, direction de la radioprotection de l' homme, 92 - Fontenay-aux-Roses (France)

    2010-02-15

    Caesium-137 ({sup 137}Cs) is a radionuclide present in the environment mainly as the result of the atmospheric nuclear weapons testing and accidents arising in nuclear power plants like the Chernobyl accident in 1986. Nowadays, the health consequences resulting from a chronic exposure to this radionuclide remain unknown. After absorption, the caesium is distributed relatively homogeneously within the body, with a more important load in children than in adults. The toxicity of {sup 137}Cs is mainly due to its radiological properties. A high dose of {sup 137}Cs is responsible for a medullar dystrophy, disorders of the reproductive function, and effects on liver and renal functions. Disorders of bone mineralization and brain damages were also described in human beings. At lowest dose, {sup 137}Cs induces disturbances of wakefulness-sleep cycle, but not accompanied with behavioural disorders. The cardiovascular system was also perturbed. Biological effects of {sup 137}Cs on the metabolisms of the vitamin D, cholesterol and steroid hormones were described, but do not lead to clinical symptoms. In human beings, {sup 137}Cs leads to an immune deficiency, congenital and foetal deformations, an increased of thyroid cancer, as well as neurological disorders. It seems that children are more sensitive to the toxic effects of caesium than the adults. At present, the only effective treatment for the decorporation of the ingested {sup 137}Cs is the Prussian Blue (Radiogardase). The use of pectin to de-corporate the ingested {sup 137}Cs, in children notably, is sometimes proposed, but its administration still remains an open question. To conclude, the available scientific data suggest that {sup 137}Cs could affect a number of physiological and metabolic functions and consequently, could participate in the health risks associated to the presence of other contaminants in the environment. (authors)

  8. Luminescence of Er3+ Doped Titanium Barium Glass Microsphere under 514 nm Excitation

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The titanium barium glass microspheres doped with Er2O3 were designed and prepared. The components of the glass sample were 25TiO2-27BaCO3-8Ba(NO3)2-5ZnO2-10CaCO3-5H3BO3-10SiO2-7water glass-3Er2O3 (%, mass fraction). The emission spectra of titanium barium glass matrix and the titanium barium glass microsphere under 514 nm excitation were measured with micro-Raman spectrometer. Whispering gallery modes in the emission spectra from a 31 μm glass microsphere were observed. Many regularly spaced, sharp peaks appeared in the emission spectra of the Er2O3-doped glass microsphere. The wavelength separation between the two adjacent peaks is 1.92 nm for the 31 μm microsphere. According to the Lorenz-Mie formula, the calculated value of the wavelength separation between the two adjacent peaks is 1.95 nm. The observed resonances could be assigned by using the well-known Lorenz-Mie formula.

  9. An effective quantum defect theory for the diamagnetic spectrum of a barium Rydberg atom

    Institute of Scientific and Technical Information of China (English)

    Li Bo; Liu Hong-Ping

    2013-01-01

    A theoretical calculation is carried out to investigate the spectrum of a barium Rydberg atom in an external magnetic field.Using an effective approach incorporating quantum defect into the centrifugal term in the Hamiltonian,we reexamine the reported spectrum of the barium Rydberg atom in a magnetic field of 2.89 T [J.Phys.B 28 L537 (1995)].Our calculation employs B-spline basis expansion and complex coordinate rotation techniques.For single photon absorption from the ground 6s2 to 6snp Rydberg states,the spectrum is not influenced by quantum defects of channels ns and nd.The calculation is in agreement with the experimental observations until the energy reaches E =-60 cm-1.Beyond this energy,closer to the threshold,the calculated and experimental results do not agree with each other.Possible reasons for their discrepancies are discussed.Our study affirms an energy range where the diamagnetic spectrum of the barium atom can be explained thoroughly using a hydrogen model potential.

  10. Single molecule fluorescence imaging as a technique for barium tagging in neutrinoless double beta decay

    Science.gov (United States)

    Jones, B. J. P.; McDonald, A. D.; Nygren, D. R.

    2016-12-01

    Background rejection is key to success for future neutrinoless double beta decay experiments. To achieve sensitivity to effective Majorana lifetimes of ~ 1028 years, backgrounds must be controlled to better than 0.1 count per ton per year, beyond the reach of any present technology. In this paper we propose a new method to identify the birth of the barium daughter ion in the neutrinoless double beta decay of 136Xe. The method adapts Single Molecule Fluorescent Imaging, a technique from biochemistry research with demonstrated single ion sensitivity. We explore possible SMFI dyes suitable for the problem of barium ion detection in high pressure xenon gas, and develop a fiber-coupled sensing system with which we can detect the presence of bulk Ba++ ions remotely. We show that our sensor produces signal-to-background ratios as high as 85 in response to Ba++ ions when operated in aqueous solution. We then describe the next stage of this R&D program, which will be to demonstrate chelation and fluorescence in xenon gas. If a successful barium ion tag can be developed using SMFI adapted for high pressure xenon gas detectors, the first essentially zero background, ton-scale neutrinoless double beta decay technology could be realized.

  11. Optical planar waveguide in sodium-doped calcium barium niobate crystals by carbon ion implantation

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Jin-Hua, E-mail: zhaojinhuazjh@gmail.com [School of Science, Shandong Jianzhu University, Jinan 250101 (China); Qin, Xi-Feng; Wang, Feng-Xiang; Fu, Gang; Wang, Hui-Lin [School of Science, Shandong Jianzhu University, Jinan 250101 (China); Wang, Xue-Lin [School of Physics, Key Laboratory of Particle Physics and Particle Irradiation, Ministry of Education, and State Key Laboratory of Crystal Materials, Shandong University, Jinan 250100 (China)

    2013-07-15

    There is great interest in niobate crystals which belong to the tetragonal tungsten bronze (TTB) families owing to their intriguing properties. As one representative of such crystals, CBN (calcium barium niobate) has attracted rapidly growing attention. Because it has a higher Curie temperature than SBN (strontium barium niobate), possesses outstanding ferroelectric and it possesses optical properties. In addition, doped with sodium, CBN will show a higher Curie temperature than pure CBN. We report on the fabrication and characterization of optical planar waveguide in x-cut sodium-doped calcium barium niobate crystal by using C ion implantation. The guided-mode properties at the wavelength of 633 and 1539 nm are investigated through prism-coupling measurements, respectively. By applying direct end-face coupling arrangement, the near-field optical intensity distribution of waveguide modes is measured at 633 nm. For comparison, the modal profile of the same guided mode is also numerically calculated by the finite difference beam-propagation method via computer software BeamPROP. The transmission spectra of the waveguide before and after ion implantation treatments were investigated also. Our experiment results reveal that the waveguide could propagate light with transverse magnetic polarized direction only and it is assumed that the polarization selectivity of CBN crystal may responsible for this phenomenon.

  12. Factors influencing the detection of abnormalities in barium enemas performed by junior radiologists

    Energy Technology Data Exchange (ETDEWEB)

    Vehmas, T. [Department of Occupational Medicine, Finnish Institute of Occupational Health, Helsinki and Department of Radiology, Helsinki University Central Hospital, Helsinki (Finland)]. E-mail: tapio.vehmas@ttl.fi

    2006-03-15

    Aim: To study the effects of patient variability, technical examination and radiologist-related factors on the radiological diagnosis of barium enema studies. Materials and Methods: Twenty-one residents (12 women and nine men, age 26-39 years) performed 523 double contrast barium enemas in a university hospital. Diagnoses were classified as normal (n=203), diverticulosis (n=224), polyps (n=25), tumours (n=20) and other (n=46); five were missing diagnoses. Binary and multinomial logistic regressions were used to study the relations between the independent variables and the radiological diagnoses. Results: Patients' advanced age (p<0.001) and obesity (p=0.041) were significant positive predictors for the detection of any abnormalities, as was good or moderate study quality (p=0.023). However, patients' obesity was negatively associated with the detection of polyps (p=0.037). Pathological findings were associated with higher dose-area products (p=0.047) than normal cases. Residents' advanced age (p=0.029) and experience (a high number of previously performed barium enemas; p=0.009) were negative predictors for the detection of pathological findings. Conclusion: Patients' obesity hampers polyp detection, possibly due to decreased image quality or coexisting diverticula. The most experienced and oldest residents missed positive findings, possibly due to insufficient consultation of supervising radiologists, emphasizing the need for their optimal cooperation.

  13. A Preliminary Trial on the Use of Barium Chloride for Pregnancy Diagnosis in Sows

    Directory of Open Access Journals (Sweden)

    Ndu, A.

    2000-01-01

    Full Text Available Urine was collected twice daily (once in the morning and once in the afternoon for 5 days from 80 Yorkshire x Landrace crossbred gilts/sows made up of 40 non-pregnant and 40 pregnant pigs in an investigation to determine the possibility of using 1 % barium chloride solution for pregnancy diagnosis in pigs based on a previous report that addition of a few drops of 1 % barium chloride solution to bovine urine caused a white precipitate with non-pregnant but not with pregnant cows. The pregnant pigs were in various stages of gestation. Urine reaction to 1 % barium chloride was highly (P <0.01 dependent on the pregnancy status of the sows, the test being 100 % and 81 % effective in identifying non-pregnant and pregnant sows respectively. The sensitivity of the test in the gravid sows was significantly (P <0.05 influenced by and tended to increa-se with the stage of gestation, with 59 % of the sows in their first stage of gestation (<38 days post-coitum being correctly diagnosed as pregnant, and 95-100 % of those in their latter stages of gestation being so correctly diagnosed. Parity and time of day of performance of the test had no effect on urine reaction. It was concluded that the test was at least 95 % accurate when used as from about 39 days after breeding for pregnancy diagnosis in sows.

  14. Effects of Dysprosium Oxide Doping on Microstructure and Properties of Barium Titanate Ceramic

    Institute of Scientific and Technical Information of China (English)

    Pu Yongping; Ren Huijun; Chen Wei; Chen Shoutian

    2005-01-01

    Different amounts of dysprosium oxide were incorporated into barium titanate powders synthesized by hydrothermal method. Relations of substitution behaviors and lattice parameters with solid-solubility were studied. Furthermore, the influences of dysprosium oxide doping fraction on grain size and dielectric properties of barium titanate ceramic, including dielectric constant and breakdown electric field strength, were investigated via scanning electron microscope, X-ray diffraction and electric property tester. The results show that dysprosium oxide can restrain abnormal grain growth during sintering and that fine-grained and high density of barium titanate ceramic can result in excellent dielectric properties. As mass fraction of dysprosium oxide is 0.6%, the lattice parameters of grain increase to the maximum because of the lowest vacancy concentration. The electric property parameters are cited as following: dielectric constant (25 ℃) reaches 4100, the change in relative dielectric constant with temperature is -10% to 10% within the range of -15~100 ℃, breakdown electric field strength (alternating current) achieves 3.2 kV·mm-1, which can be used in manufacturing high voltage ceramic capacitors.

  15. Hydrothermal Synthesis and Characterization of Europium-dop ed Barium Titanate Nano crys-tallites

    Institute of Scientific and Technical Information of China (English)

    Margarita Garca-Hernandez; Genevieve Chadeyron; Damien Boyer; Antonieta Garca-Murillo; Felipe Carrillo-Romo; Rachid Mahiou

    2013-01-01

    Barium titanate nanocrystallites were synthesized by a hydrothermal technique from barium chlo-ride and tetrabutyl titanate. Single-crystalline cubic perovskite BaTiO3 consisting of spherical particles with diameters ranging from 10 to 30 nm was easily achieved by this route. In order to study the influence of the syn-thesis process on the morphology and the optical properties, barium titanate was also prepared by a solid-state reaction. In this case, only the tetragonal phase which crystallizes above 900℃ was observed. High-temperature X-ray diffraction measurements were performed to investigate the crystallization temperatures as well as the particle sizes via the Scherrer formula. The lattice vibrations were evidenced by infrared spectroscopy. Eu3+was used as a structural probe, and the luminescence properties recorded from BaTiO3:Eu3+and elaborated by a solid-state reaction and hydrothermal process were compared. The reddish emission of the europium is increased by the nanometric particles.

  16. Barium Surface Abundances of Blue Stragglers in the Open Cluster NGC 6819

    CERN Document Server

    Milliman, Katelyn E; Schuler, Simon C

    2015-01-01

    We present the barium surface abundance of 12 blue stragglers (BSs) and 18 main-sequence (MS) stars in the intermediate-age open cluster NGC 6819 (2.5 Gyr) based on spectra obtained from the Hydra Multi-object Spectrograph on the WIYN 3.5 m telescope. For the MS stars we find [Fe/H] = $+$0.05 $\\pm$ 0.04 and [Ba/Fe] = $-$0.01 $\\pm$ 0.10. The majority of the BS stars are consistent with these values. We identify five BSs with significant barium enhancement. These stars most likely formed through mass transfer from an asymptotic giant branch star that polluted the surface of the BS with the nucleosynthesis products generated during thermal pulsations. This conclusion aligns with the results from the substantial work done on the BSs in old open cluster NGC 188 that identifies mass transfer as the dominant mechanism for BS formation in that open cluster. However, four of the BSs with enhanced barium show no radial-velocity evidence for a companion. The one star that is in a binary is a double-lined system, meaning...

  17. A barium central star binary in the Type-I diamond ring planetary nebula Abell 70

    CERN Document Server

    Miszalski, B; Frew, D J; Acker, A; Köppen, J; Moffat, A F J; Parker, Q A

    2011-01-01

    Abell 70 (PN G038.1-25.4, hereafter A 70) is a planetary nebula (PN) known for its diamond ring appearance due a superposition with a background galaxy. The previously unstudied central star is found to be a binary consisting of a G8IV-V secondary at optical wavelengths and a hot white dwarf (WD) at UV wavelengths. The secondary shows Ba II and Sr II features enhanced for its spectral type that, combined with the chromospheric Halpha emission and possible 20-30 km/s radial velocity amplitude, firmly classifies the binary as a Barium star. The proposed origin of Barium stars is intimately linked to PNe whereby wind accretion pollutes the companion with dredged-up material rich in carbon and s-process elements when the primary is experiencing thermal pulses on the Asymptotic Giant Branch (AGB). A 70 provides further evidence for this scenario together with the other very few examples of Barium central stars. The nebula is found to have Type-I chemical abundances with helium and nitrogen enrichment, which when c...

  18. Er3+-substituted W-type barium ferrite: preparation and electromagnetic properties

    Institute of Scientific and Technical Information of China (English)

    HUANG

    2010-01-01

    Er3+-substituted W-type barium ferrites Ba1-xErx(Zn0.3Co0.7)2Fe16O27(x=0.00,0.05,0.10,0.15,0.20)were synthesized by polymer adsorbent combustion method.Samples were characterized by X-ray diffraction analysis(XRD),X-ray fluorescence(XRF),scanning electron microscopy(SEM)and network analyzer to investigate the relationships among Er3+concentration,crystal structure,surface mcrphology and electromagnetic properties.All the XRD patterns showed pure phase of W-type barium ferrite when x≤0.15,while the impurity phase of ErFeO3 appeared when x=0.20.The pure W-type barium ferrite showed a hexagonal flake shape.In addition,the microwave electromagnetic properties of samples were analyzed in the frequency range of 2-18 GHz.It was indicated that the electromagnetic properties were significantly improved when Er3+doping content was 0.10.The reasons were also discussed using electromagnetic theory.The optimized ferrite exhibited excellent microwave absoption performance.The maximum of reflection loss(RL)reached about-27.4 dB and RL was below-10dB at the frequency range from 8.4 GHz to 18 GHz,when the thickness was 2.6 mm.

  19. {sup 137}Cs applicability to soil erosion assessment: theoretical and empirical model; Aplicabilidade do {sup 137}Cs para medir erosao do solo: modelos teoricos e empiricos

    Energy Technology Data Exchange (ETDEWEB)

    Andrello, Avacir Casanova

    2004-02-15

    The soil erosion processes acceleration and the increase of soil erosion rates due to anthropogenic perturbation in soil-weather-vegetation equilibrium has influenced in the soil quality and environment. So, the possibility to assess the amplitude and severity of soil erosion impact on the productivity and quality of soil is important so local scale as regional and global scale. Several models have been developed to assess the soil erosion so qualitative as quantitatively. {sup 137}Cs, an anthropogenic radionuclide, have been very used to assess the superficial soil erosion process Empirical and theoretical models were developed on the basis of {sup 137} Cs redistribution as indicative of soil movement by erosive process These models incorporate many parameters that can influence in the soil erosion rates quantification by {sup 137} Cs redistribution. Statistical analysis was realized on the models recommended by IAEA to determinate the influence that each parameter generates in results of the soil redistribution. It was verified that the most important parameter is the {sup 137} Cs redistribution, indicating the necessity of a good determination in the {sup 137} Cs inventory values with a minimum deviation associated with these values. After this, it was associated a 10% deviation in the reference value of {sup 137} Cs inventory and the 5% in the {sup 137} Cs inventory of the sample and was determinate the deviation in results of the soil redistribution calculated by models. The results of soil redistribution was compared to verify if there was difference between the models, but there was not difference in the results determinate by models, unless above 70% of {sup 137} Cs loss. Analyzing three native forests and an area of the undisturbed pasture in the Londrina region, can be verified that the {sup 137} Cs spatial variability in local scale was 15%. Comparing the {sup 137} Cs inventory values determinate in the three native forest with the {sup 137} Cs inventory

  20. 137Ba Double Gamma Decay Measurement with GAMMASPHERE

    Directory of Open Access Journals (Sweden)

    Merchán E.

    2015-01-01

    Full Text Available The study of the electromagnetic moments (EM, and decay probability, provides detailed information about nuclear wave functions. The well-know properties of EM interactions are good for extracting information about the motion of nucleons. Higher order EM processes always occur, but are usually too weak to be measured. In the case of a 0+ → 0+ transitions [1, 2], where a single gamma transition is forbidden, the simultaneous emission of two γ-rays has been studied. An interesting opportunity to further investigate 2-photon emission phenomena is by using a standard 137Cs source populating, via β-decay, the Jπ = 11/2− isomeric state at 662 keV in 137Ba. In this case, two photon process can have contributions from quadrupole-quadrupole or dipole-octupole multipolarities in direct competition with the high multipolarity M4 decay. Since the yield of the double gamma decay is around six orders of magnitude less than the first order transition, very good statistics are needed in order to observe the phenomena and great care must be taken to suppress the first-order decay. The Gammasphere array is ideal since its configuration allows a good coverage of the angular distribution and the Compton events can be suppressed. Nevertheless the process to understand and eliminate the Compton background is a challenge. Geant4 simulations were carried out to help understand and correct for those factors.

  1. A Study on Reactive Ion Etching of Barium Strontium Titanate Films Using Mixtures of Argon (Ar), Carbon Tetrafluoride (CF4), and Sulfur Hexafluoride (SF6)

    Science.gov (United States)

    2014-07-01

    A Study on Reactive Ion Etching of Barium Strontium Titanate Films Using Mixtures of Argon (Ar), Carbon Tetrafluoride (CF4), and Sulfur...Etching of Barium Strontium Titanate Films Using Mixtures of Argon (Ar), Carbon Tetrafluoride (CF4), and Sulfur Hexafluoride (SF6) Samuel G...Study on Reactive Ion Etching of Barium Strontium Titanate Films Using Mixtures of Argon (Ar), Carbon Tetrafluoride (CF4), and Sulfur Hexafluoride

  2. Fertilization influence on the {sup 137}Cs and {sup 90}Sr uptake by crops

    Energy Technology Data Exchange (ETDEWEB)

    Bogdevitch, I.; Tarasuk, S.; Shmigelskaya, I.; Putyatin, Y. [Belarussian Research Institute for Soil Science and Agrochemistry (BRISSA), Kazintsa 62, Minsk 220108 (Belarus)

    2003-07-01

    Reducing the risk of people internal irradiation based on decreasing of radionuclide concentration in consumed food stuff is a main objective for justified application of the countermeasures on contaminated agricultural land at the last period after Chernobyl radioactive fallout. Liming, fertilizers and manure application are the most widespread, applicable and effective countermeasures to restrict the soil-to-plant radionuclide transfer. Efficiency of the fertilization depends on radionuclide deposition, texture and chemical properties of the soils, biological characteristics of plants and type of the fertilizers. The selection of the types of agro-chemical treatments should be considered with combined economical and radiological justification. Countermeasures treatments have to lead to the profitable or self-sufficient production of extra yield with low radionuclide contamination. As objective of this work, mentioned is the assessment of the different types of agro-chemical countermeasures on agricultural land contaminated by {sup 137}Cs and {sup 90}Sr based on radiological economical justification. The efficiency of K fertilizer on different K supply soils, the efficiency of balanced fertilization at the different rates of manure utilization and the efficiency of liming and K fertilizer rates are presented. In conclusion, the soil fertility improvement based on balanced fertilization and liming to achieve the optimal agro-chemical properties allow significantly (up to 2-4 times) reduce the concentration of {sup 137}Cs and {sup 90}Sr in crop production with the simultaneous yield increase. The agro-chemical countermeasures targeted for balanced plant nutrition should have priority, on the assumption of providing the profitable or self-sufficient production of extra yield to pay for expenses. The profitability of agricultural production is a main criterion for justification of countermeasure application in long-term period after Chernobyl accident.

  3. Reconstruction of 137Cs activity in the ocean following the Fukushima Daiichi Nuclear Power Plant Accident

    Science.gov (United States)

    Tsumune, Daisuke; Aoyama, Michio; Tsubono, Takaki; Tateda, Yutaka; Misumi, Kazuhiro; Hayami, Hiroshi; Toyoda, Yasuhiro; Maeda, Yoshiaki; Yoshida, Yoshikatsu; Uematsu, Mitsuo

    2014-05-01

    A series of accidents at the Fukushima Dai-ichi Nuclear Power Plant following the earthquake and tsunami of 11 March 2011 resulted in the release of radioactive materials to the ocean by two major pathways, direct release from the accident site and atmospheric deposition. We reconstructed spatiotemporal variability of 137Cs activity in the ocean by the comparison model simulations and observed data. We employed a regional scale and the North Pacific scale oceanic dispersion models, an atmospheric transport model, a sediment transport model, a dynamic biological compartment model for marine biota and river runoff model to investigate the oceanic contamination. Direct releases of 137Cs were estimated for more than 2 years after the accident by comparing simulated results and observed activities very close to the site. The estimated total amounts of directly released 137Cs was 3.6±0.7 PBq. Directly release rate of 137Cs decreased exponentially with time by the end of December 2012 and then, was almost constant. The daily release rate of 137Cs was estimated to be 3.0 x 1010 Bq day-1 by the end of September 2013. The activity of directly released 137Cs was detectable only in the coastal zone after December 2012. Simulated 137Cs activities attributable to direct release were in good agreement with observed activities, a result that implies the estimated direct release rate was reasonable, while simulated 137Cs activities attributable to atmospheric deposition were low compared to measured activities. The rate of atmospheric deposition onto the ocean was underestimated because of a lack of measurements of dose rate and air activity of 137Cs over the ocean when atmospheric deposition rates were being estimated. Observed 137Cs activities attributable to atmospheric deposition in the ocean helped to improve the accuracy of simulated atmospheric deposition rates. Although there is no observed data of 137Cs activity in the ocean from 11 to 21 March 2011, observed data of

  4. [Using barium fluoride fine particles as stationary phase for TLC/FTIR analysis].

    Science.gov (United States)

    Liu, Xi; Pan, Qing-hua; Ding, Jie; Zhu, Qing; He, An-qi; Yue, Shi-juan; Li, Xiao-pei; Hu, Li-ping; Xia, Jin-ming; Liu, Cui-ge; Wei, Yong-ju; Yu, Jiang; Yang, Zhan-lan; Zhu, Xi; Xu, Yi-zhuang; Wu, Jin-guang

    2011-07-01

    In situ TLC/FTIR technique has tremendous potential in the analysis of complex mixtures. However, the progress in this technique was quite slow. The reason is that conventional stationary phase such as silica gel etc. has strong absorption in FTIR spectrum and thus brings about severe interference in the detection of samples. To solve the problem, the authors propose to use barium fluoride fine particles as stationary phase of TLC plate. The reasons are as follows: Barium fluoride wafer has been extensively used as infrared window in FTIR experiments and it has no absorbance in an IR region between 4 000 and 800 cm'. As a matter of fact, the atomic mass of barium and fluoride is quite large, thus the normal vibration of BaF2 lattice is limited in far-IR region and low frequency part of mid-IR region. Therefore, the interference caused by IR absorption of stationary phase can be resolved if BaF2 is used as stationary phase of TLC plate. Moreover, BaF2 is quite stable and insolvable in water and most organic solvents and it will not be dissolved by mobile phase or react with samples in TLC separation. Additionally, decreasing the particle size of BaF2 is very important in TLC/FTIR analysis technique. The reason is two-fold: First, decreasing the particle size of stationary phase is helpful to improving the efficiency of separation by TLC plate; second, decreasing the size of BaFz particle can improve the quality of FTIR spectra by alleviating the problem of light scattering. By optimizing the synthetic conditions, fine particles of barium fluoride were obtained. SEM results indicate that the size of the BaF2 particles is around 500 nm. FTIR spectrum of the BaF2 particles shows that no absorption of impurity was observed. Moreover, the elevation of baseline caused by light scattering is insignificant. The authors have developed a new technique named "settlement volatilization method" to prepare TLC plate without polymeric adhesive that may bring about significant

  5. MicroRNA-137 Inhibits EFNB2 Expression Affected by a Genetic Variant and Is Expressed Aberrantly in Peripheral Blood of Schizophrenia Patients.

    Science.gov (United States)

    Wu, Shanshan; Zhang, Rui; Nie, Fayi; Wang, Xiaoli; Jiang, Congshan; Liu, Meng; Valenzuela, Robert K; Liu, Wanqing; Shi, Yongyong; Ma, Jie

    2016-10-01

    MicroRNAs (miRNAs) are a class of endogenous and non-coding single-stranded RNAs of approximately 22 nucleotides, many of which are evolutionarily conserved. Genome-wide association studies have identified a robust statistical association between the MIR137 gene and schizophrenia in Europeans, which was replicated in the Han Chinese population in a case-control study. In the previous study, we provided evidence for a significant association between the EFNB2 gene and schizophrenia in Han Chinese subjects. In the current study, we utilized computational analysis, vector construction of point mutations, luciferase reporter assays and gene expression assays including RT-qPCR and western blotting methods to investigate miR-137 directly targeting EFNB2 gene and explore the reversal effect of a genetic variant of SNP rs550067317 in the putative seed-pair region of EFNB2 3'-UTR. We also found that miR-137 could be detected in the peripheral blood of a cohort of first-onset schizophrenia patients and healthy controls, and the area under curve was 0.795 (95% confidence interval 0.700-0.890), which is a middle diagnostic value for disease, suggesting that it might be valuable for diagnosing schizophrenia. In summary, this study would improve our understanding of the role of miR-137 in schizophrenia-associated signaling pathways and identify the genetic basis of rs550067317 for schizophrenia. Furthermore, we provided new evidence for the involvement of miR-137 in the etiology and diagnosis of schizophrenia, which might contribute to the discovery of new biomarkers and therapeutic targets for the disease.

  6. MicroRNA-137 Inhibits EFNB2 Expression Affected by a Genetic Variant and Is Expressed Aberrantly in Peripheral Blood of Schizophrenia Patients

    Directory of Open Access Journals (Sweden)

    Shanshan Wu

    2016-10-01

    Full Text Available MicroRNAs (miRNAs are a class of endogenous and non-coding single-stranded RNAs of approximately 22 nucleotides, many of which are evolutionarily conserved. Genome-wide association studies have identified a robust statistical association between the MIR137 gene and schizophrenia in Europeans, which was replicated in the Han Chinese population in a case-control study. In the previous study, we provided evidence for a significant association between the EFNB2 gene and schizophrenia in Han Chinese subjects. In the current study, we utilized computational analysis, vector construction of point mutations, luciferase reporter assays and gene expression assays including RT-qPCR and western blotting methods to investigate miR-137 directly targeting EFNB2 gene and explore the reversal effect of a genetic variant of SNP rs550067317 in the putative seed-pair region of EFNB2 3′-UTR. We also found that miR-137 could be detected in the peripheral blood of a cohort of first-onset schizophrenia patients and healthy controls, and the area under curve was 0.795 (95% confidence interval 0.700–0.890, which is a middle diagnostic value for disease, suggesting that it might be valuable for diagnosing schizophrenia. In summary, this study would improve our understanding of the role of miR-137 in schizophrenia-associated signaling pathways and identify the genetic basis of rs550067317 for schizophrenia. Furthermore, we provided new evidence for the involvement of miR-137 in the etiology and diagnosis of schizophrenia, which might contribute to the discovery of new biomarkers and therapeutic targets for the disease.

  7. 137例内脏利什曼病患者临床分析%Clinical Analysis of 137 Patients with Visceral Leishmaniasis

    Institute of Scientific and Technical Information of China (English)

    高芹; 刘焱斌; 钟册俊; 吕晓菊

    2013-01-01

    目的 分析近十几年四川地区内脏利什曼病住院患者临床和流行病学特征.方法 收集2000年1月至2012年4月四川大学华西医院收治的内脏利什曼病患者137例的资料,回顾性分析流行病学、临床特点、治疗和转归.结果 137例患者中,64.2% (88/137)居住在四川及周边内脏利什曼病流行区,35.8% (49/137)有流行区逗留史.137例中,农村占84.7% (116/137),城镇占15.3% (21/137).临床表现以发热,肝、脾及淋巴结肿大,全血细胞减少和球蛋白明显增高为主.137例患者利什曼原虫rk39抗体试纸条检测均为阳性.诊断明确者用葡萄糖酸锑钠治疗.治愈118例(86.1%),脾切除4例(2.9%),复发9例(6.6%).137例中首诊疑诊为内脏利什曼病者105例,误诊率为23.4% (32/137).结论 关注流行病学史、检测rk39抗体,以及尽早骨髓涂片或组织活检有助于早期诊治,葡萄糖酸锑钠疗效较好.%Objective To analyze the clinical and epidemiological characteristics of visceral leishmaniasis cases in Sichuan. Methods The medical records of 137 patients with visceral leishmaniasis were reviewed between January 2000 and April 2012 in West China Hospital. The epidemiological data, clinical manifestations, laboratory features, diagnosis, therapeutic procedures and outcome of the patients were retrospectively analyzed. Results Eighty-eight(64.2%) out of 137 cases were the residents in the endemic area of Sichuan Province and adjacent areas, and 49 (35.8%) were non-endemic area residents with a history of visiting endemic area. Patients living in rural areas accounted for 84.7%(116/137), in town for 15.3% (21/137). Visceral leishmaniasis should be strongly suspected in a patient with prolonged fever, marked hepatosplenomegaly, Iymphadenectasis, cytopenia and hypergammaglobulinemia. All patients showed positive in rk39 dipstick test, and were treated with antimony sodium gluconate. Among these patients, 86.1% (118/137) were cured by

  8. Effect of arbuscular mycorrhizal (AM) fungi on 137Cs uptake by plants grown on different soils.

    Science.gov (United States)

    Vinichuk, M; Mårtensson, A; Ericsson, T; Rosén, K

    2013-01-01

    The potential use of mycorrhiza as a bioremediation agent for soils contaminated by radiocesium was evaluated in a greenhouse experiment. The uptake of (137)Cs by cucumber, perennial ryegrass, and sunflower after inoculation with a commercial arbuscular mycorrhizal (AM) product in soils contaminated with (137)Cs was investigated, with non-mycorrhizal quinoa included as a "reference" plant. The effect of cucumber and ryegrass inoculation with AM fungi on (137)Cs uptake was inconsistent. The effect of AM fungi was most pronounced in sunflower: both plant biomass and (137)Cs uptake increased on loamy sand and loamy soils. The total (137)Cs activity accumulated within AM host sunflower on loamy sand and loamy soils was 2.4 and 3.2-fold higher than in non-inoculated plants. Although the enhanced uptake of (137)Cs by quinoa plants on loamy soil inoculated by the AM fungi was observed, the infection of the fungi to the plants was not confirmed.

  9. MicroRNA-137 promoter methylation in oral lichen planus and oral squamous cell carcinoma

    DEFF Research Database (Denmark)

    Dang, Jun; Bian, Yong-qian; Sun, Jian-yong

    2013-01-01

    Oral lichen planus (OLP) is a common oral mucosal disease, which is generally considered a potentially malignant lesion. To identify efficiently prognostic biomarker, we investigated the microRNA-137 (miR-137) promoter methylation in OLP and compared with the samples from healthy volunteers...... and patients with oral squamous cell carcinoma (OSCC). A total of 20 OLP and 12 patients with OSCC as well as 10 healthy subjects were subjected to miR-137 promoter methylation analysis using methylation-specific PCR (MSP). To address the malignancy prediction potential from miR-137 promoter methylation status...... between miR-137 and p16 methylation levels were statistically significant between healthy controls and patients. Methylation levels of the two promoters were also influenced by age, gender, and lesion duration. Interestingly, aberrant promoter methylation of the p16 and miR-137 genes was only found...

  10. Development of an oil tracer labelled with 137mBa

    Directory of Open Access Journals (Sweden)

    Haugan A.

    2013-05-01

    Full Text Available The extraction of barium ions by isooctane solutions of di-nonyl naphthalene sulfonic acid (HDNNS and di-cyclohexano-18-crown-6 (DC18C6 from aqueous solutions of hydrochloric acid and sodium chloride has been investigated. The extraction and the associated back extraction results suggest that this barium complex is a suitable oil tracer for petroleum related applications, such as measurement of Residence Time Distribution (RTD and oil carry-over to the gas outlet in multiphase separators and scrubbers.

  11. Role of CD137 signaling in dengue virus-mediated apoptosis

    Energy Technology Data Exchange (ETDEWEB)

    Nagila, Amar [Medical Molecular Biology Unit, Office for Research and Development, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Department of Biochemistry, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Netsawang, Janjuree [Faculty of Medical Technology, Rangsit University, Bangkok (Thailand); Srisawat, Chatchawan [Department of Biochemistry, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Noisakran, Sansanee [Dengue Hemorrhagic Fever Research Unit, Office for Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok (Thailand); Medical Biotechnology Unit, National Center for Genetic Engineering and Biotechnology, National Science and Technology Development Agency, Bangkok (Thailand); Morchang, Atthapan; Yasamut, Umpa [Medical Molecular Biology Unit, Office for Research and Development, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Department of Immunology, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok (Thailand); Puttikhunt, Chunya [Dengue Hemorrhagic Fever Research Unit, Office for Research and Development, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok (Thailand); Medical Biotechnology Unit, National Center for Genetic Engineering and Biotechnology, National Science and Technology Development Agency, Bangkok (Thailand); Kasinrerk, Watchara [Division of Clinical Immunology, Department of Medical Technology, Faculty of Associated Medical Sciences, Chiang Mai University, Chiang Mai (Thailand); Biomedical Technology Research Center, National Center for Genetic Engineering and Biotechnology, National Science and Technology Development Agency at Chiang Mai University, Chiang Mai (Thailand); and others

    2011-07-08

    Highlights: {yields} For the first time the role of CD137 in dengue virus (DENV) infection. {yields} Induction of DENV-mediated apoptosis by CD137 signaling. {yields} Sensitization to CD137-mediated apoptosis by dengue virus capsid protein (DENV C). {yields} Nuclear localization of DENV C is required for CD137-mediated apoptosis. -- Abstract: Hepatic dysfunction is a well recognized feature of dengue virus (DENV) infection. However, molecular mechanisms of hepatic injury are still poorly understood. A complex interaction between DENV and the host immune response contributes to DENV-mediated tissue injury. DENV capsid protein (DENV C) physically interacts with the human death domain-associated protein Daxx. A double substitution mutation in DENV C (R85A/K86A) abrogates Daxx interaction, nuclear localization and apoptosis. Therefore we compared the expression of cell death genes between HepG2 cells expressing DENV C and DENV C (R85A/K86A) using a real-time PCR array. Expression of CD137, which is a member of the tumor necrosis factor receptor family, increased significantly in HepG2 cells expressing DENV C compared to HepG2 cells expressing DENV C (R85A/K86A). In addition, CD137-mediated apoptotic activity in HepG2 cells expressing DENV C was significantly increased by anti-CD137 antibody compared to that of HepG2 cells expressing DENV C (R85A/K86A). In DENV-infected HepG2 cells, CD137 mRNA and CD137 positive cells significantly increased and CD137-mediated apoptotic activity was increased by anti-CD137 antibody. This work is the first to demonstrate the contribution of CD137 signaling to DENV-mediated apoptosis.

  12. The spatial distribution of caesium-137 over Northern Ireland from fallout from the Chernobyl nuclear accident

    OpenAIRE

    Rawlins, B. G.; Scheib, C.; Tyler, A.N.; Jones, D.; Webster, R; Young, M. E.

    2009-01-01

    The spatial distribution of caesium-137 (137Cs) across the land is of much interest because it can tell us about the redistribution of the radionuclide as a result of soil erosion, differential migration through the soil—or its complement, differential retention in the soil. Any such inferences from survey measurements depend on the assumption of a broadly even distribution from weapons testing fallout, and the substantial deposition of 137Cs in rain following the Chernobyl accide...

  13. Caesium 137 in meat from reindeer and grouses from Svaldbard 1980

    Energy Technology Data Exchange (ETDEWEB)

    Kjos-Hanssen, B.; Rennesund, J.S. (Forsvarets Forskningsinstitutt, Kjeller (Norway))

    1981-01-01

    Concentration of Caesium 137 in meat from Spitsbergen (Svalbard) and mainland Norway reindeer has been measured. It appears that the concentration values for Spitsbergen are of the order of 1 per cent of corresponding values for the mainland. It is suggested that low precipitation rates and a different reindeer diet contributes to the low Cs 137 concentration values in Svaldbard. The concentration of Cs 137 in Svaldbard grouse did not exceed the detection limit of the measurements (approximately 10 pCi/kg).

  14. (Caesium 137 in meat from reindeer and grouse from Svalbard 1980 (author's transl))

    Energy Technology Data Exchange (ETDEWEB)

    Kjos-Hanssen, B.; Rennesund, J.S.

    Concentration of Caesium 137 in meat from Spitsbergen (Svalbard) and mainland Norway reindeer has been measured. It appears that the concentration values for Spitsbergen are of the order of 1 per cent of corresponding values for the mainland. It is suggested that low precipitation rates and a different reindeer diet contributes to the low Cs 137 concentration values in Svalbard. The concentration of Cs 137 in Svalbard grouse did not exceed the detection limit of the measurements (infinity 10 pCi/kg).

  15. a Biokinetic Model for CESIUM-137 in the Fetus

    Science.gov (United States)

    Jones, Karen Lynn

    1995-01-01

    Previously, there was no method to determine the dose to the embryo, fetus, fetal organs or placenta from radionuclides within the embryo, fetus, or placenta. In the past, the dose to the fetus was assumed to be equivalent to the dose to the uterus. Watson estimated specific absorbed fractions from various maternal organs to the uterine contents which included the fetus, placenta, and amniotic fluid and Sikov estimated the absorbed dose to the embryo/fetus after assuming 1 uCi of radioactivity was made available to the maternal blood.^{1,2} However, this method did not allow for the calculation of a dose to individual fetal organs or the placenta. The radiation dose to the embryo or fetus from Cs-137 in the fetus and placenta due to a chronic ingestion by the mother was determined. The fraction of Cs-137 in the maternal plasma crossing the placenta to the fetal plasma was estimated. The absorbed dose from Cs-137 in each modelled fetal organ was estimated. Since there has been more research regarding potassium in the human body, and particularly in the pregnant woman, a biokinetic model for potassium was developed first and used as a basis and confirmation of the cesium model. Available pertinent information in physiology, embryology, biokinetics, and radiation dosimetry was utilized. Due to the rapid growth of the fetus and placenta, the pregnancy was divided into four gestational periods. The numerous physiological changes that occurred during pregnancy were considered and an appropriate biokinetic model was developed for each of the gestational periods. The amount of cesium in the placenta, embryo, and fetus was estimated for each period. The dose to the fetus from cesium deposited in the embryo or fetus and in the placenta was determined for each period using Medical Internal Radiation Dosimetry (MIRD) methodology. An uncertainty analysis was also performed to account for the variability of the parameters in the biokinetic model based on the experimental data

  16. Inferring the chemical form of 137Cs deposited by the Fukushima Dai-ichi Nuclear Power Plant accident by measuring (137)Cs incorporated into needle leaves and male cones of Japanese cedar trees.

    Science.gov (United States)

    Kanasashi, Tsutomu; Takenaka, Chisato; Sugiura, Yuki

    2016-05-15

    We hypothesized that the water-soluble (ionic) and water-insoluble (stable) radiocesium from the initial fallout of the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident was distributed in various proportions in the surrounding areas and that this distribution was reflected in the trees that suffered deposition from the initial fallout. This study attempted to evaluate local variations in the chemical form of (137)Cs derived from the initial fallout of the FDNPP accident and whether its chemical form affected the radiocesium concentration in the tissues currently growing in trees, even after the initial fallout ceased. For these estimations, the ratio between the (137)Cs concentration in Cryptomeria japonica needle leaves in the tree crown, which existed before the FDNPP accident and subsequently directly exposed to the initial fallout ((137)Cs pre-accident N), and the amount of (137)Cs in the initial fallout itself ((137)Cs fallout) was determined ((137)Cs pre-accident N/(137)Cs fallout) at 66 sites. In addition, the (137)Cs ratios between the male cones produced in 2012 ((137)Cs male cone) and needle leaves that had elongated in the spring of 2011 ((137)Cs 2011N) was determined at 82 sites ((137)Cs male cone/(137) Cs 2011N). Most of the sites with lower (137)Cs pre-accident N /(137)Cs fallout ratios were distributed in eastern Fukushima, relatively close to the Pacific Ocean coastline. Lower (137)Cs pre-accident N/(137)Cs fallout and higher (137)Cs malecone/(137)Cs 2011N were found to be associated with higher proportions of (137)Cs in ionic forms. These observations are consistent with the hypothesis, and likely reflect regional variations in the chemical form of the deposited radiocesium.

  17. Arbuscular mycorrhizal fungi mediated uptake of {sup 137}Cs in leek and ryegrass

    Energy Technology Data Exchange (ETDEWEB)

    Rosen, Klas; Weiliang, Zhong; Maertensson, Anna [Department of Soil Sciences, Swedish University of Agricultural Sciences P.O. Box 7014, SE-750 07 Uppsala (Sweden)

    2005-02-15

    In a first experiment of soil contaminated with {sup 137}Cs, inoculation with a mixture of arbuscular mycorrhizae enhanced the uptake of {sup 137}Cs by leek under greenhouse conditions, while no effect on the uptake by ryegrass was observed. The mycorrhizal infection frequency in leek was independent of whether the {sup 137}Cs-contaminated soil was inoculated with mycorrhizal spores or not. The lack of mycorrhizae-mediated uptake of {sup 137}Cs in ryegrass could be due to the high root density, which was about four times that of leek, or due to a less well functioning mycorrhizal symbiosis than of leek. In a second experiment, ryegrass was grown for a period of four cuts. Additions of fungi enhanced {sup 137}Cs uptake of all harvests, improved dry weight production in the first cut, and also improved the mycorrhizal infection frequencies in the roots. No differences were obtained between the two fungal inoculums investigated with respect to biomass production or {sup 137}Cs uptake, but root colonization differed. We conclude that, under certain circumstances, mycorrhizae affect plant uptake of {sup 137}Cs. There may be a potential for selecting fungal strains that stimulate {sup 137}Cs accumulation in crops. The use of ryegrass seems to be rather ineffective for remediation of {sup 137}Cs-contaminated soil.

  18. The fate of caesium-137 in a soil environment controlled by immobilization on clay minerals

    OpenAIRE

    NAKAO, Atsushi; Funakawa, Shinya; Tsukada, Hirofumi; Kosaki, Takashi

    2012-01-01

    Caesium-137 (137Cs), with its high release rate and long half life, is the most important longterm contributor to environmental contamination of all the radionuclides released by the accident at the Fukushima Dai-ichi nuclear power plant in March 2011. There have been many surveys of the fate of 137Cs in terrestrial environments, especially after the atmospheric nuclear tests of the 1950s and 60s and the Chernobyl accident in 1986. Previous surveys revealed that most of the 137Cs deposited on...

  19. The 137Cs activity and its geographical significance in terrestrial ecosystem of Great Wall Station, Antarctica

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The radioactive isotope——137 Cs is one of the important tracers for studying the physical processes and the human impacts on the environment. Based on the investigation results of the terrestrial ecosystem of Great Wall Station, Antarctica, it was shown that there are some artificial radioactive elements——137Cs in Antarctic terrestrial ecosystem. The sequence of 137Cs specific activities is as follows: crustaceous lichen>fruticose lichen>surface-moss>surface soil, and the crustaceous lichen is one of the most sensitive ways in monitoring the impact of the long-term diffusion of 137Cs on the environment.

  20. Species difference of CD137 ligand signaling in human and murine monocytes.

    Directory of Open Access Journals (Sweden)

    Qianqiao Tang

    Full Text Available BACKGROUND: Stimulation of CD137 ligand on human monocytes has been shown to induce DC differentiation, and these CD137L-DCs are more potent than classical DCs, in stimulating T cell responses in vitro. To allow an in vivo evaluation of the potency of CD137L-DCs in murine models we aimed at generating murine CD137L-DCs. METHODOLOGY/PRINCIPAL FINDINGS: When stimulated through CD137 ligand murine monocytes responded just as human monocytes with an increased adherence, morphological changes, proliferation and an increase in viable cell numbers. But CD137 ligand signaling did not induce expression of inflammatory cytokines and costimulatory molecules in murine monocytes and these cells had no T cell stimulatory activity. Murine monocytes did not differentiate to inflammatory DCs upon CD137 ligand signaling. Furthermore, while CD137 ligand signaling induces maturation of human immature classical DCs it failed to do so with murine immature classical DCs. CONCLUSIONS/SIGNIFICANCE: These data demonstrate that both human and murine monocytes become activated by CD137 ligand signaling but only human and not murine monocytes differentiate to inflammatory DCs.

  1. Oxidation of 1,3,7-trimethylxanthine by hypochlorite ion

    Science.gov (United States)

    Kheidorov, V. P.; Ershov, Yu. A.; Chalyi, G. Yu.; Titorovich, O. V.

    2011-08-01

    The kinetics of the oxidative conversion of 1,3,7-trimethylxanthine upon treatment with hypochlorite ions (OCl-) in aqueous medium at 283-298 K and pH 8.2 was studied. The reaction order with respect to each component was determined and proved to be 1. It was established that the temperature dependence of the reaction rate follows the Arrhenius equation. The activation parameters of the reaction were measured: E a = 33.58 kJ/mol, Δ H ≠ = 31.12 kJ/mol, Δ S ≠ = -170.02 J/(K mol), Δ G ≠ = 81.45 kJ/mol. The stoichiometry of the reaction was studied, and the chemistry of the oxidative conversion of caffeine treated with OCl- is discussed.

  2. Uptake of {sup 137}Cs by fresh water fish

    Energy Technology Data Exchange (ETDEWEB)

    Man, C.K.; Kwok, Y.H

    2000-02-01

    The uptake and discharge rates of {sup 137}Cs by fresh water fish at different radionuclide concentrations have been studied. A dual compartment model was used to fit the experimental data. The discharge rates have been found to be negligible for the duration of the experiment of 10 days. The uptake rates were independent of radionuclide concentrations for a particular type of fresh water fish and were different for different types of fish. The uptake rates of carp, tilapia and snakehead were 1.58, 1.66 and 2.23, in unit of 10{sup -6} h{sup -1}, respectively. It was also estimated that the consumption of fresh water fish, even if the water were contaminated as much as that in the Chernobyl accident, leads to negligible latent cancer fatality to the Hong Kong population.

  3. Mercury and cesium-137 in urban gray squirrels

    Energy Technology Data Exchange (ETDEWEB)

    Jenkins, J.H. (Univ. of Georgia, Athens); Davis, A.H.; Bigler, W.J.; Hoff, G.L.

    1980-08-01

    Recent emphasis upon the revitalization of major cities has underscored a need for urban wildlife management. Intensive management of the wildlife populations indigenous to metropolitan areas will enhance our quality of life in many ways. One important benefit is that certain species can serve as sensitive indicators of environmental change. The gray squirrel (Sciurus carolinensis) is usually abundant in cities and they are often subject to a variety of destructive environmental factors. In an attempt to evaluate the gray squirrel as an indicator of zoonoses and pollutants, the Health Program Office of the Department of Health and Rehabilitative Services conducted a multifaceted study in Jacksonvlle, Florida during 1974. This report presents baseline measurements of body burdens of mercury and cesium-137.

  4. Observation of a Collective Oblate Band in 137Ce

    Institute of Scientific and Technical Information of China (English)

    ZHU Sheng-Jiang; Jon Myang-Gil; WEN Shu-Xian; WU Xiao-Guang; LIU Xiang-An; ZHU Ling-Yan; LI Ming; GAN Cui-Yun; M. Sakhaee; YANG Li-Ming; ZHANG Zheng; JIANG Zhuo; LONG Gui-Lu

    2000-01-01

    High spin states in 137 Ce have been studied by using the heavy-ion induced reaction 124Sn(18 O, 5n) carried out at China Institute of Atomic Energy. Partial level scheme with spin up to (43/2-), including a high spin collective rotational band observed for the first time, has been established. The collective band shows the properties similar to those oblate bands with γ ~-60° in neighboring nuclei and probably originates from the five quasi-particle configuration νs1/2 [vh11/2]2 π97/2 πh11/2. The characteristics of this oblate band have been discussed.

  5. Dosimetry of IRIDIUM-192 and CESIUM-137 Seed Sources.

    Science.gov (United States)

    Thomason, Cynthia

    The use of ^{192}Ir in brachytherapy implants both alone and in conjunction with other modalities for the treatment of various types of cancer has greatly increased in recent years. This increased usage has led to a greater need for detailed information concerning the dose distribution surrounding commerically available ^{192} Ir seed sources. This is especially truce since improvements in computer technology along with their increased availability and utilization have enabled more precise calculation of dose distributions. The radiation does distribution in water was measured using LiF thermoluminescent dosimeters for an ^{192}Ir seed source with platinum encapsulation, for an ^{192}Ir seed source with stainless steel encapsulation and for a ^{137}Cs seed source intended as a substitute for ^{192 }Ir. The Electron-Gamma-Shower (EGS) computer code, which is a package for doing Monte Carlo simulation of the transport of photons and electrons in any medium or geometry specified by the user, also was used to study the dose distribution around these seed sources. In addition, the exposure rate constant, exposure rate at 1 meter, transmission through the source capsule, f-factor, and energy distribution exiting the source capsule were evaluated by Monte Carlo simulation of these three sources. Good agreement was seen between the measured data and the Monte Carlo generated data. In addition to producing valuable dosimetric data, this study has demonstrated that Monte Carlo modeling of ^{192} Ir and ^{137}Cs seed sources using the EGS Monte Carlo code can provide an accurate means of evaluating these data.

  6. {sup 137}Cs in marine sediments of Admiralty Bay, King George Island, Antarctica

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Paulo Alves de Lima [Instituto Oceanográfico, Universidade de São Paulo (IO-USP), Pça. do Oceanográfico, 191, Butantã, SP, 05508 900 (Brazil); Ribeiro, Andreza Portella, E-mail: andrezpr@usp.br [Instituto Oceanográfico, Universidade de São Paulo (IO-USP), Pça. do Oceanográfico, 191, Butantã, SP, 05508 900 (Brazil); Mestrado de Gestão Ambiental e Sustentabilidade, Universidade Nove de Julho (UNINOVE), Avenida Francisco Matarazzo, 612, prédio C, andar térreo, Água Branca, São Paulo, SP, 05001 100 (Brazil); Nascimento, Mylene Giseli do; Martins, Cesar de Castro [Centro de Estudos do Mar, Universidade Federal do Paraná (CEM-UFPR), Av. Beira-mar, no number, Balneário Pontal do Sul, Pontal do Paraná, PR, 83255 971 (Brazil); Mahiques, Michel Michaelovitch de; Montone, Rosalinda Carmelo; Figueira, Rubens Cesar Lopes [Instituto Oceanográfico, Universidade de São Paulo (IO-USP), Pça. do Oceanográfico, 191, Butantã, SP, 05508 900 (Brazil)

    2013-01-15

    The radionuclide cesium-137 ({sup 137}Cs) is produced exclusively by anthropogenic processes and primarily by nuclear explosions. This study determined the reference inventory that is {sup 137}Cs associated with the element's original input, and utilized the levels of activity of this radionuclide previously measured in five sediment profiles collected from Admiralty Bay, Antarctica, to investigate the mobility of this element in the environment. {sup 137}Cs has a half-life of 30 years. Because of this, it is environmentally persistent and has been shown to accumulate in marine organisms. The mean reference inventory of this radionuclide in Admiralty Bay sediments, determined using high resolution gamma ray spectrometry, was 20.23 ± 8.94 Bq m{sup −2}, and within the ambient {sup 137}Cs activity range. A model of {sup 137}Cs diffusion–convection was applied to data collected from 1 cm intervals in sediment cores with the aim of providing insights with respect to this element's behavior in sediments. Model results showed a significant correlation between measured and modeled values using the concentrations of {sup 137}Cs, and estimated input into the system from the global fallout of past nuclear tests and expected values based on local sedimentation rates. Results highlight the importance of accounting for the vertical diffusion of {sup 137}Cs in marine sediments when used as a tracer for environmental processes and for assessing potential bioavailability. - Highlights: ► Cesium-137 ({sup 137}Cs) is produced exclusively by anthropogenic processes. ► A model of diffusion–convection simulated {sup 137}Cs environmental behavior. ► This is important for assessing the bioavailability of this toxic element. ► In Antarctica ice cover influenced the input to the sediments.

  7. Oak Ridge Reservation Volume 3. Records relating to RaLa, iodine-131, and cesium-137 at the Oak Ridge National Laboratory and the Oak Ridge Operations Office: A guide to record series of the Department of Energy and its contractors

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-21

    The purpose of this guide is to describe each of the documents and record series pertaining to the production, release, and disposal of radioactive barium-lanthanum (RaLa), iodine-131, and cesium-137 at the Department of Energy`s (DOE) Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. History Associates Incorporated (HAI) prepared this guide as part of DOE`s Epidemiologic Records Inventory Project, which seeks to verify and conduct inventories of epidemiologic and health-related records at various DOE and DOE contractor sites. This introduction briefly describes the Epidemiologic Records Inventory Project and HAI`s role. It provides information on the history of the DOE-Oak Ridge Reservation (ORR), particularly ORNL. Specific attention is given to the production of RaLa and the fission products iodine-131 and cesium-137. This introduction also describes the methodologies HAI used in the selection and inventorying of documents and record series pertaining to RaLa, iodine-131, and cesium-137, and in the production of this guide. Concluding paragraphs describe the arrangement of the record series, explain the information contained in the record series descriptions, and indicate restrictions on access to the records.

  8. Upward mobilization of 137Cs in surface soils of Chamaecyparis obtusa Sieb. et Zucc. (hinoki) plantation in Japan.

    Science.gov (United States)

    Fukuyama, Taijiro; Takenaka, Chisato

    2004-01-05

    The use of 137Cs has recently been adopted to estimate erosion in hinoki plantations in Japan. However, there have been several reports of the upward mobilization of 137Cs in forest humus layers. In this study, the vertical distribution of 137Cs within the soil profile was measured in a hinoki plantation. In order to confirm the upward migration of 137Cs from mineral soil to fresh surface litter and to identify mechanisms of the transfer, changes in 137Cs specific activity in the contents of litterbags were examined in a hinoki plantation. A controlled laboratory experiment was also conducted to assess the effect of microbial activity on the upward migration of 137Cs. As a result, the higher 137Cs activities in the surface organic layer of a hinoki plantation than in fresh litter and the increasing 137Cs total content of litterbags with time demonstrated the upward mobilization of 137Cs from mineral soil to the surface organic layer. Physical movement of soil particles by raindrop splash was considered an important process in 137Cs upward migration. The results of our laboratory experiment indicate an influence from soil microbial activity on the upward mobilization of 137Cs. Thus, upward migration of 137Cs and constant litter removal by runoff may induce 137Cs loss from steep forested catchments and underestimation of the 137Cs inventory leading to the overestimation of soil redistribution rates.

  9. BRS 137: cultivar de soja para cultivo no Sul do Brasil BRS 137: soybean cultivar for southern Brazil

    Directory of Open Access Journals (Sweden)

    Emídio Rizzo Bonato

    2001-05-01

    Full Text Available A liberação de cultivares de elevado potencial produtivo e com resistência a doenças é fundamental para continuar agregando rendimento na produção brasileira de soja. A cultivar BRS 137 é resultado do programa de melhoramento de soja desenvolvido pela Embrapa. A cultivar apresentou rendimento médio de grãos 2% superior ao da cultivar IAS 5, em 24 ambientes, no Rio Grande do Sul. É resistente à pústula-bacteriana (Xanthomonas axonopodis pv. glycines, ao cancro-da-haste (Diaporthe phaseolorum f. sp. meridionalis, à podridão-parda-da-haste (Phialophora gregata, à mancha-olho-de-rã (Cercospora sojina e ao oídio (Microsphaera diffusa. É indicada para cultivo no Rio Grande do Sul, em semeaduras realizadas a partir de meados de outubro até fim de novembro, com população máxima de 300.000 plantas/ha.The goals of the soybean breeding program for the release of a new cultivar include high yield potential and resistance to diseases in order to improve Brazilian production. The cultivar BRS 137 is a result of the soybean breeding program of Embrapa (Brazil. Prior to its release, the cultivar had shown a mean grain yield potential 2% higher than the cultivar IAS 5 in 24 environments in the State of Rio Grande do Sul, Brazil. Moreover, it is resistant to bacterial pustule (Xanthomonas axonopodis pv. glycines, soybean stem canker (Diaporthe phaseolorum f. sp. meridionalis, brown stem rot (Phialophora gregata, frogeye leaf spot (Cercospora sojina, and powdery mildew (Microsphaera diffusa. The cultivar is being indicated to be cropped in the Rio Grande do Sul state for sowing from mid October to the end of November with a maximum population of 300,000 plants/ha.

  10. Small-scale fluctuations in barium drifts at high latitudes and associated Joule heating effects

    Science.gov (United States)

    Hurd, L. D.; Larsen, M. F.

    2016-01-01

    Most previous estimates of Joule heating rates, especially the contribution of small-scale structure in the high-latitude ionosphere, have been based on incoherent scatter or coherent scatter radar measurements. An alternative estimate can be found from the plasma drifts obtained from ionized barium clouds released from sounding rockets. We have used barium drift data from three experiments to estimate Joule heating rates in the high-latitude E region for different magnetic activity levels. In particular, we are interested in the contribution of small-scale plasma drift fluctuations, corresponding to equivalent electric field fluctuations, to the local Joule heating rate on scales smaller than those typically resolved by radar or other measurements. Since Joule heating is a Lagrangian quantity, the inherently Lagrangian estimates provided by the chemical tracer measurements are a full description of the effects of electric field variance and neutral winds on the heating, differing from the Eulerian estimates of the type provided by ground-based measurements. Results suggest that the small-scale contributions to the heating can be more than a factor of 2 greater than the mean field contribution regardless of geomagnetic conditions, and at times the small-scale contribution is even larger. The high-resolution barium drift measurements, moreover, show that the fine structure in the electric field can be more variable than previous studies have reported for similar conditions. The neutral winds also affect the heating, altering the height-integrated Joule heating rates by as much as 12%, for the cases studied here, and modifying the height distribution of the heating profile as well.

  11. Intermediate milling energy optimization to enhance the characteristics of barium hexaferrite magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Hodaei, A.; Ataie, A., E-mail: aataie@ut.ac.ir; Mostafavi, E.

    2015-08-15

    Highlights: • Nano-sized BaFe{sub 12}O{sub 19} was successfully synthesized via a solid-state reaction. • Intermediate milling energy was optimized to improve BaFe{sub 12}O{sub 19} properties. • Minimum total energy of 93.7 kJ/g was necessary for formation of BaFe{sub 12}O{sub 19}. • Deviation from the optimum milling energy deteriorates the magnetic properties. - Abstract: Nano-sized barium hexaferrite particles were synthesized by mechanical activation of BaCO{sub 3} and Fe{sub 2}O{sub 3} powders mixture as starting materials. The effects of mechanical milling energy on the phase composition, morphology, thermal behavior and magnetic properties of the samples were systematically investigated by employing X-ray diffractometer, field emission scanning electron microscopy, differential thermal/thermo gravimetry analysis and vibrating sample magnetometer, respectively. The milling energy was calculated at five different levels using collision model. It was found that there is an optimum milling energy value for obtaining barium hexaferrite phase. The results revealed that applying a minimum total milling energy of 93.7 kJ/g was necessary for formation of almost single barium hexaferrite at a relatively low calcination temperature of 800 °C. FESEM micrograph of the above sample exhibited nano-size particles with a mean particle size of 80 nm. Further increase in milling energy leads to dramatic decrease in phase purity as well as magnetic characteristics of the samples. By increasing the milling energy from 93.7 to 671.9 kJ/g, saturation magnetization (M{sub s}) decreased from 22.5 to 0.39 emu/g, and also coercivity (H{sub c}) decreased from 4.28 to 1.46 kOe.

  12. Microstructure and magnetic properties of Al-doped barium ferrite with sodium citrate as chelate agent

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Daming, E-mail: chendaming1986@gmail.com [State Key Laboratory of Electronic Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Liu, Yingli, E-mail: lyl@uestc.edu.cn [State Key Laboratory of Electronic Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Li, Yuanxun; Yang, Kai; Zhang, Huaiwu [State Key Laboratory of Electronic Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China)

    2013-07-15

    In this paper, M-type Al-doped barium ferrites were successfully synthesized using sodium citrate (SC) as the chelate agent by a chemical process complemented by a suitable thermal treatment of the precursor. It was found in TGA/DTA and XRD analysis that the crystallization and formation of single phase BaM had completed before 860 °C. The XRD data also confirmed Al substituting into Fe sites. Meanwhile, it can be seen from the SEM images that the particle size and morphology were not affected by Al doping. However, Al substitution played an important role on the magnetic properties. The saturation magnetization (M{sub s}) of BaAl{sub x}Fe{sub 12−x}O{sub 19} decreased from 51.43 emu/g for the sample with x=0 to 28.32 emu/g at x=1.5. The anisotropy field (H{sub a}), however, increased from 16.21 kOe to 25.01 kOe. In addition, M{sub s} increased with enhancing the ratio of SC/Ba{sup 2+}(molar ratio), reaching a maximum when SC/Ba{sup 2+} was 13. - Highlights: ► Doped barium ferrite was successfully synthesized using sodium citrate as chelate agent. ► Sodium citrate allows the mixing of metal cations in the as-synthesized barium ferrite. ► The radio of Sodium citrate/Ba{sup 2+} pay an important effect on magnetic properties.

  13. Curie temperature and magnetic properties of aluminum doped barium ferrite particles prepared by ball mill method

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Daming [Center for Magnetism and Magnetic Nanostructures, University of Colorado at Colorado Springs, 1420 Austin Bluffs Pkwy, Colorado Springs, Colorado 80918 (United States); College of Materials and Chemical Engineering, Hainan University, Haikou 570228, Hainan (China); Harward, Ian; Baptist, Joshua; Goldman, Sara; Celinski, Zbigniew [Center for Magnetism and Magnetic Nanostructures, University of Colorado at Colorado Springs, 1420 Austin Bluffs Pkwy, Colorado Springs, Colorado 80918 (United States)

    2015-12-01

    Barium ferrite has attracted considerable interest in the fields of permanent magnets and perpendicular magnetic recording due to its strong uniaxial anisotropy and high Curie temperature (T{sub c}). We prepared aluminum doped barium ferrite ceramics (BaAl{sub x}Fe{sub 12−x}O{sub 19}, 0≤x≤6) by the ball mill method. The powder was milled for 96 h, and after forming pellets, annealed for 48 h in air at 1000 °C. The X-ray diffraction (XRD) data show that there are only single hexagonal phases in the samples without any impurity phase. The crystal lattice constants, a and c, were calculated by Cohen's method. Both a and c decrease with increasing x, ranging from 0.588 nm and 2.318 nm to 0.573 nm and 2.294 nm, respectively. A Vibrating Sample Magnetometer (VSM) and Superconducting Quantum Interference Device (SQUID) were used to investigate T{sub c} and magnetic properties of BaFe{sub 12−x}Al{sub x}O{sub 19}. It is found that T{sub c} decreases with increasing x, from 425 °C to 298 °C. It is also found that the saturated magnetization (4πM{sub s}) decreases with increasing x, while the coercivity (H{sub c}) increases with the increase in x. The anisotropy field was also determined from the SQUID measurement. - Highlights: • The Curie temperature and magnetic properties of aluminum doped barium ferrite particles were studied systemically. • The relation between 4πM{sub s} and composition x at 50 K (both experimental value and theoretical calculation) was revealed. • Occupation number for spin up and spin down as a function of temperature was shown. • The relation between 4πM{sub s} and composition x from 50 K to room temperature was revealed.

  14. Barium meal follow through with pneumocolon: Screening test for chronic bowel pain

    Institute of Scientific and Technical Information of China (English)

    Sandeep Nijhawan; Saket Kumpawat; P Mallikarjun; RP Bansal; Dinesh Singla; Prachis Ashdhir; Amit Mathur; Ramesh Roop Rai

    2008-01-01

    AIM:To study the sensitivity,specificity and cost effectiveness of barium meal follow through with pneumocolon (BMFTP) used as a screening modality for patients with chronic abdominal pain of luminal origin in developing countries.METHODS:Fifty patients attending the Gastroenterology Unit,SMS Hospital,whose clinical evaluation revealed chronic abdominal pain of bowel origin were included in the study.After routine testing,BMFT,BMFTP,contrast enhanced computed tomography (CECT) of the abdomen,barium enema and colonoscopy were performed.The sensitivity,specificity and cost effectiveness of these imaging modalities in the detection of small and/or large bowel lesions were compared.RESULTS:Out of fifty patients,structural pathology was found in ten.Nine out of these ten patients had small bowel involvement while seven had colonic involvement alone or in combination with small bowel involvement.The sensitivity of BMFTP was 100% compared to 88.89% with BMFT when detecting small bowel involvement (BMFTP detected one additional patient with ileocecal involvement).The sensitivity and specificity of BMFTP for the detection of colonic pathology were 85.71% and 95.35%(41/43),respectively.Screening a patient with chronic abdominal pain (bowel origin) using a combination of BMFT and barium enema cost significantly more than BMFTP while their sensitivity was almost comparable.CONCLUSION:BMFTP should be included in the investigative workup of patients with chronic abdominal pain of luminal origin,where either multiple sites (small and large intestine) of involvement are suspected or the site is unclear on clinical grounds.BMFTP is an economical,quick and comfortable procedure which obviates the need for colonoscopy in the majority of patients.

  15. Discovery and Understanding of the Ambient-Condition Degradation of Doped Barium Cerate Proton-Conducting Perovskite Oxide in Solid Oxide Fuel Cells

    NARCIS (Netherlands)

    Yan, N.; Zeng, Y.; Shalchi, B; Wang, W.; Gao, T; Rothenberg, G.; Luo, J.L.

    2015-01-01

    Proton-conducting perovskite oxides such as doped barium cerate and barium zirconate are promising electrolytes for solid oxide fuel cells (SOFCs). Here we report that the typical high performance proton conductor, BaZr0.1Ce0.7Y0.2O3±δ (BZCY), is prone to physical, chemical and thereby electrochemic

  16. Microstructural and Electrical Characterization of Barium Strontium Titanate-Based Solid Solution Thin Films Deposited on Ceramic Substrates by Pulsed Laser Deposition

    Science.gov (United States)

    2003-04-03

    Strontium Titanate-Based Solid Solution Thin Films Deposited on Ceramic Substrates by Pulsed Laser Deposition DISTRIBUTION: Approved for public...Society H2.4 Microstructural and Electrical Characterization of Barium Strontium Titanate- based Solid Solution Thin Films Deposited on Ceramic...investigated and report the microstructural and electrical characterization of selected barium strontium titanate-based solid solution thin films

  17. Review - Fabrication of crystal-oriented barium-bismuth titanate ceramics in high magnetic field and subsequent reaction sintering

    Directory of Open Access Journals (Sweden)

    Satoshi Tanaka, Yusuke Tomita, Ryoichi Furushima, Hiroyuki Shimizu, Yutaka Doshida and Keizo Uematsu

    2009-01-01

    Full Text Available High magnetic field was applied to fabricate novel lead-free piezoelectric ceramics with a textured structure. A compact of crystallographically oriented grains was prepared by dry forming in a high magnetic field from a mixed slurry of bismuth titanate and barium titanate powders. Bismuth titanate particles with a size of about 1 μ m were used as the host material. In the forming process, the slurry was poured into a mold and set in a magnetic field of 10 T until completely dried. Bismuth titanate particles were highly oriented in the slurry under the magnetic field. The dried powder compact consisted of highly oriented bismuth titanate particles and randomly oriented barium titanate particles. Barium bismuth titanate ceramics with a- and b-axis orientations were successfully produced from the dried compact by sintering at temperatures above 1100 ° C.

  18. Synthesis and characterization of highly-ordered barium-strontium titanate nanotube arrays fabricated by sol-gel method

    Institute of Scientific and Technical Information of China (English)

    Chen Yu; Chen Wei; Guo Feng; Li Mei-Ya; Liu Wei; Zhao Xing-Zhong

    2009-01-01

    Highly uniformed barium-strontium titanate nanotube arrays were fabricated using a porous anodic aluminum oxide template from a barium-strontium titanate sol-gel solution. Electron microscope results showed that nanotubes with uniform length and diameter were obtained. The diameters and lengths of these nanotubes were dependent on the pore diameter and the thickness of the applied anodic aluminum oxide template. High resolution transmission electron microscopy and the selected-area electron diffraction pattern investigations demonstrated the perovskite structure and the polycrystaltine of the fabricated barium-strontium titanate nanotubes. The characterization of the electrical and dielectric properties had also been made. Compared to thin film material,the intrinsic leakage current density is almost the same. Besides,at 30 ℃,the dielectric constant and dielectric loss of the fabricated nanotube is 80 and 0.027 at 1 MHz respectively.

  19. 46 CFR 201.137 - Rights of parties as to presentation of evidence.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Rights of parties as to presentation of evidence. 201.137 Section 201.137 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE... presentation of evidence. Every party shall have the right to present his case or defense by oral...

  20. 21 CFR 516.137 - Notification of decision regarding eligibility for indexing.

    Science.gov (United States)

    2010-04-01

    ... indexing. 516.137 Section 516.137 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... Notification of decision regarding eligibility for indexing. (a) Within 90 days after the filing of a request for a determination of eligibility for indexing based on § 516.129(c)(7)(i), or 180 days for a...

  1. 42 CFR 137.25 - Are planning and negotiation grants available?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Are planning and negotiation grants available? 137... for Participation in Self-Governance Planning Phase § 137.25 Are planning and negotiation grants... planning and negotiation grants available, an explanation of the application process for such grants,...

  2. 10 CFR 1.37 - Office of Small Business and Civil Rights.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Office of Small Business and Civil Rights. 1.37 Section 1... Headquarters Staff Offices § 1.37 Office of Small Business and Civil Rights. The Office of Small Business and Civil Rights— (a) Develops and implements an effective small and disadvantaged business program...

  3. Iodine-129 and Caesium-137 in Chernobyl contaminated soil and their chemical fractionation

    DEFF Research Database (Denmark)

    Hou, Xiaolin; Fogh, C.L.; Kucera, J.

    2003-01-01

    Soil samples from areas in Belarus, Russia and Sweden contaminated by the Chernobyl accident were analysed for I-129 by radiochemical neutron activation analysis, as well as for Cs-137 by gamma-spectrometry. The atomic ratio of I-129/(CS)-C-137 in the upper layer of the examined soil cores ranged...

  4. Yeast Interacting Proteins Database: YFR015C, YJL137C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available y into stationary phase Rows with this bait as bait (3) Rows with this bait as prey (1) YJL137C GLG2 Self-gl...s bait as prey (1) Prey ORF YJL137C Prey gene name GLG2 Prey description Self-glu

  5. 14 CFR 91.137 - Temporary flight restrictions in the vicinity of disaster/hazard areas.

    Science.gov (United States)

    2010-01-01

    ... vicinity of disaster/hazard areas. 91.137 Section 91.137 Aeronautics and Space FEDERAL AVIATION... disaster/hazard areas. (a) The Administrator will issue a Notice to Airmen (NOTAM) designating an area within which temporary flight restrictions apply and specifying the hazard or condition requiring...

  6. 42 CFR 137.20 - What is required during the planning phase?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false What is required during the planning phase? 137.20... Participation in Self-Governance Planning Phase § 137.20 What is required during the planning phase? The planning phase must be conducted to the satisfaction of the Indian Tribe and must include: (a) legal...

  7. 42 CFR 137.30 - What is a self-governance compact?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false What is a self-governance compact? 137.30 Section... SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.30 What is a self-governance compact? A self-governance compact is a legally binding and...

  8. 42 CFR 137.35 - What is the term of a self-governance compact?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false What is the term of a self-governance compact? 137... HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.35 What is the term of a self-governance compact? Upon approval and execution of a...

  9. 42 CFR 137.15 - Who may participate in Tribal Self-Governance?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Who may participate in Tribal Self-Governance? 137... HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Selection of Indian Tribes for Participation in Self-Governance § 137.15 Who may participate in Tribal Self-Governance?...

  10. 46 CFR 56.97-30 - Hydrostatic tests (modifies 137.4).

    Science.gov (United States)

    2010-10-01

    ...) Examination for leakage after application of pressure. Following the application of the hydrostatic test... 46 Shipping 2 2010-10-01 2010-10-01 false Hydrostatic tests (modifies 137.4). 56.97-30 Section 56... SYSTEMS AND APPURTENANCES Pressure Tests § 56.97-30 Hydrostatic tests (modifies 137.4). (a) Provision...

  11. ESTIMATION OF THE DECREASING OF 137 CS SEDIMENT IN THE SOIL DUE TO HORIZONTAL FLOWING

    Directory of Open Access Journals (Sweden)

    O. N. Prokof'ev

    2008-01-01

    Full Text Available The purpose of work is to estimate the possible decreasing of the density of  137 Cs sediment in the soil influenced by the horizontal flowing basing on the analysis of on location observations on the density of  137 Cs sediment in the soil after the Chernobyl accident.

  12. 42 CFR 137.308 - Does the Secretary have any enforcement authority for Federal environmental responsibilities...

    Science.gov (United States)

    2010-10-01

    ... for Federal environmental responsibilities assumed by Tribes under section 509 of the Act ? 137.308... SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Construction Nepa Process § 137.308 Does the Secretary have any enforcement authority for Federal environmental...

  13. Early manifestation of Yersinia colitis demonstrated by the double-contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Aspestrand, F.

    1986-11-01

    A 19-year old female with a bloody, diarrheal illness of acute onset where Crohn's disease primarly was suspected is presented. The double-contrast barium enema revealed multiple, diffusely scattered aphthous erosions of the colonic mucosa: the rectum was scarcely affected. Biopsies taken by endoscopy demonstrated nonspecific inflammatory changes of the mucous membrane. However, routinely taken stool cultures revealed an infectious colitis due to Yersinia enterocolitica. Our case demonstrates the necessity to consider Yersinia enterocolitis in the radiographic differential diagnosis when the diagnosis of Crohn's disease or ulcerative colitis seems obvious.

  14. Comparison of barium titanate thin films prepared by inkjet printing and spin coating

    Directory of Open Access Journals (Sweden)

    Jelena Vukmirović

    2015-09-01

    Full Text Available In this paper, barium titanate films were prepared by different deposition techniques (spin coating, office Epson inkjet printer and commercial Dimatix inkjet printer. As inkjet technique requires special rheological properties of inks the first part of the study deals with the preparation of inks, whereas the second part examines and compares structural characteristics of the deposited films. Inks were synthesized by sol-gel method and parameters such as viscosity, particle size and surface tension were measured. Deposited films were examined by optical and scanning electron microscopy, XRD analysis and Raman spectroscopy. The findings consider advantages and disadvantages of the particular deposition techniques.

  15. LOCULATED PYOTHORAX, PLEURAL THICKENING DUE TO ACQU IRED BOCHDALEK HERNIA AND BARIUM INGESTION- A RARE CASE

    Directory of Open Access Journals (Sweden)

    Vijayalaxmi

    2013-05-01

    Full Text Available ABSTRACT: Here, we report a fifty six year old male patient wit h intrathoracic incarceration and perforation of the stomach on the left side of t he diaphragmatic defect resulting as empyema and a late sequelae of barium induced pleural thickening where decortication was performed. It is not usual, without a history of tra uma patient developing acquired Bochdalek hernia with empyema as seen in our case. Anaesthetic management was successful in the repair of acquired Bochdalek hernia during the first surge ry and decortication of the lung during the second surgery in our patient

  16. A plasmonic modulator based on metal-insulator-metal waveguide with barium titanate core

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Lavrinenko, Andrei

    2013-01-01

    domains from the in-plane to out-of-plane orientation provides the change of the refractive index, which can be exploited for effective light modulation. By numerical analysis we prove that the π phase change can be achieved with a 12…15μm length device having propagation losses 0.05…0.2dB/μm.......We design a plasmonic modulator which can be utilized as a compact active device in photonic integrated circuits. The active material, barium titanate (BaTiO3), is sandwiched between metal plates and changes its refractive index under applied voltage. Some degree of switching of ferroelectric...

  17. Direct writing of ferroelectric domains on strontium barium niobate crystals using focused ultraviolet laser light

    Energy Technology Data Exchange (ETDEWEB)

    Boes, Andreas; Crasto, Tristan; Steigerwald, Hendrik; Mitchell, Arnan [School of Electrical and Computer Engineering and ARC Center for Ultra-High Bandwidth Devices for Optical Systems (CUDOS), RMIT University, Melbourne, Victoria 3001 (Australia); Wade, Scott [Faculty of Engineering and Industrial Sciences, Swinburne University of Technology, Hawthorn, Victoria 3122 (Australia); Frohnhaus, Jakob; Soergel, Elisabeth [Institute of Physics, University of Bonn, Wegelerstr. 8, 53115 Bonn (Germany)

    2013-09-30

    We report ferroelectric domain inversion in strontium barium niobate (SBN) single crystals by irradiating the surface locally with a strongly focused ultraviolet (UV) laser beam. The generated domains are investigated using piezoresponse force microscopy. We propose a simple model that allows predicting the domain width as a function of the irradiation intensity, which indeed applies for both SBN and LiNbO{sub 3}. Evidently, though fundamentally different, the domain structure of both SBN and LiNbO{sub 3} can be engineered through similar UV irradiation.

  18. Chondrite barium, neodymium, and samarium isotopic heterogeneity and early Earth differentiation.

    Science.gov (United States)

    Carlson, Richard W; Boyet, Maud; Horan, Mary

    2007-05-25

    Isotopic variability in barium, neodymium, and samarium in carbonaceous chondrites reflects the distinct stellar nucleosynthetic contributions to the early solar system. We used 148Nd/144Nd to correct for the observed s-process deficiency, which produced a chondrite 146Sm-142Nd isochron consistent with previous estimates of the initial solar system abundance of 146Sm and a 142Nd/144Nd at average chondrite Sm/Nd ratio that is lower than that measured in terrestrial rocks by 21 +/- 3 parts per million. This result strengthens the conclusion that the deficiency in 142Nd in chondrites relative to terrestrial rocks reflects 146Sm decayand earlyplanetary differentiation processes.

  19. Seasonal variability in the input of lead, barium and indium to Law Dome, Antarctica

    DEFF Research Database (Denmark)

    Burn-Nunes...[], L.J.; Vallelonga, Paul Travis; Loss, R.D.

    2011-01-01

    Lead (Pb) isotopic compositions and concentrations, and barium (Ba) and indium (In) concentrations have been determined at monthly resolution in five Law Dome (coastal Eastern Antarctica) ice core sections dated from similar to 1757 AD to similar to 1898 AD. 'Natural' background Pb concentrations...... more impurity laden air from the Southern Hemisphere continental regions to Eastern Antarctica and Law Dome. As this Pb is isotopically identical to that emitted from south-eastern Australia (Broken Hill, Port Pine) this implies a relatively direct air trajectory pathway from southern Australia to Law...... Dome (Eastern Antarctica). (C) 2010 Elsevier Ltd. All rights reserved...

  20. Lead-barium fluoroborate glass ceramics doped with Nd3+ or Er3+

    Science.gov (United States)

    Petrova, O. B.; Sevostjanova, T. S.; Anurova, M. O.; Khomyakov, A. V.

    2016-02-01

    Lead-barium fluoroborate glasses in the PbF2-BaF2-B2O3, PbF2-BaO-B2O3, and PbO- BaF2-B2O3 systems doped with rare-earth ions (Nd3+ or Er3+) are synthesized and studied. It is shown that, based on these glasses, it is possible to produce transparent glass ceramics with fluoride crystalline phases, including ceramics with one crystalline phase of the fluorite structure. The spectral and luminescent properties of the doped glasses, glass ceramics, and polycrystalline complex fluorides containing Pb, Ba, and rare ions are studied.

  1. Femtosecond index grating in barium flouride: efficient self-diffraction and enhancement of surface SHG

    Science.gov (United States)

    Schneider, Th; Wolfframm, D.; Mitzner, R.; Reif, J.

    2000-02-01

    A transient refractive index grating is formed in barium fluoride crystals under irradiation with femtosecond laser pulses from two non-collinear beams. At low intensities energy coupling takes place. At high intensities, a typical self-diffraction pattern is obtained with a diffraction efficiency better than 10%. Simultaneously, an enhancement of the SHG signal from the surface, as well as the generation and diffraction of the third harmonic is observable. For all effects the nonlinear Kerr-effect is responsible, with the response time being limited only by the temporal pulse shape.

  2. EDTA-type Polymer Based on Diazacrown Ether as the Solubilizer of Barium Sulfate to Water

    Institute of Scientific and Technical Information of China (English)

    Bo ZHOU; Jian Zhang LI; Chun Hong HE; Sheng Ying QIN

    2005-01-01

    The EDTA dianhydride reacted with diazacrown ethers to obtain the water-soluble EDTA-diazacrown ether polymers 1~3. The effects of crown ether ring in the polymer chains including its cavity size on the solubilization of barium sulfate to water were investigated by comparison with the crown ring-free analogue 4. The result shows that the polymer 2 is the efficient solubilizer of BaSO4 and the highest solubilization efficiency of the BaSO4 to water is up to 72.5%.

  3. Synthesis of Barium Lithium Fluoride Nanocrystals Using Reverse Micelles as Microemulsion

    Institute of Scientific and Technical Information of China (English)

    Rui Nian HUA; De Min XIE; Chun Shan SHI

    2004-01-01

    Barium lithium fluoride nanocrystals were synthesized in cetyltrimethylammonium bromide (CTAB)/ 2-octanol/ water microemulsion systems. The impurity peaks in XRD patterns were not determined. The result of SEM confirmed that the average sizes and shape of the BaLiF3 nanocrystals. The formation of BaLiF3 and particles size were strongly affected by water content. With increasing water content and reaction times, the size of the particle increases. Meanwhile, the solvent was also found to play a key role in the synthesis of the BaLiF3 nanocrystals.

  4. The ac Stark shifts of the terahertz clock transitions of barium

    Institute of Scientific and Technical Information of China (English)

    余庚华; 耿鹰鸽; 李隆; 周超; 段丞博; 柴瑞鹏; 杨永明

    2015-01-01

    Wavelength-dependent AC Stark shifts and magic wavelengths of the terahertz clock transitions between the metastable triplet states 6s5d 3D1 and 6s5d 3D2 are investigated with considering the optical lattice trapping of barium atoms with the linearly polarized laser. The trap depths and the slopes of light shift difference with distinct magic wave-lengths of the optical lattices are also discussed in detail. Several potentially suitable working points for the optical lattice trapping laser are recommended and selected from these magic wavelengths.

  5. Motional Stark Effect and Its Active Cancellation in Diamagnetic Spectrum of Barium

    Institute of Scientific and Technical Information of China (English)

    QUAN Wei; LIU Hong-Ping; SHEN Li; ZHAN Ming-Sheng

    2007-01-01

    With time-of-flight and electric field ionization detection technique, we investigate the motional Stark effect for highly excited Rydberg barium in high magnetic field and its active cancellation experimentally. In the experiment, the atom beam is aligned at a small angle of 15° with respect to the magnetic field. The motional Stark effect cancellation is demonstrated on two sets of circularly polarized spectra in static magnetic field B = 1.00000 Tesla and B = 1.70000 Tesla, respectively, although the effect is very small (~ 3.5 Vcm-1) in our apparatus configuration.

  6. Barium halide nanocrystals in fluorozirconate based glass ceramics for scintillation application

    Energy Technology Data Exchange (ETDEWEB)

    Selling, J.

    2007-07-01

    Europium (Eu)-activated barium halide nanocrystals in fluorozirconate based glass ceramics represent a promising class of Xray scintillators. The scintillation in these glass ceramics is mainly caused by the emission of divalent Eu incorporated in hexagonal BaCl{sub 2} nanocrystals which are formed in the glass matrix upon appropriate annealing. Experiments with cerium (Ce)-activated fluorozironate glass ceramics showed that Ce is an interesting alternative. In order to get a better understanding of the scintillation mechanism in Eu- or Ce-activated barium halide nanocrystals, an investigation of the processes in the corresponding bulk material is essential. The objective of this thesis is the investigation of undoped, Eu-, and Ce-doped barium halides by X-ray excited luminescence (XL), pulse height, and scintillation decay spectra. That will help to figure out which of these crystals has the most promising scintillation properties and would be the best nanoparticles for the glass ceramics. Furthermore, alternative dopants like samarium (Sm) and manganese (Mn) were also investigated. Besides the above-mentioned optical investigation electron paramagnetic resonance (EPR) and Moessbauer measurements were carried out in order to complete the picture of Eu-doped barium halides. The EPR data of Eu-doped BaI{sub 2} is anticipated to yield more information about the crystal field and crystal structure that will help to understand the charge carrier process during the scintillation process. The main focus of the Moessbauer investigations was set on the Eu-doped fluorochlorozirconate glass ceramics. The results of this investigation should help to improve the glass ceramics. The Eu{sup 2+}/Eu{sup 3+} ratio in the glass ceramics should be determined and optimize favor of the Eu{sup 2+}. We also want to distinguish between Eu{sup 2+} in the glass matrix and Eu{sup 2+} in the nanocrystals. For a better understanding of Moessbauer spectroscopy on Eu also measurements on Eu in a

  7. Investigation of thermal evolution of nanodomain structures in nonlinear barium sodium niobate crystals

    Institute of Scientific and Technical Information of China (English)

    S.V.Ivanova

    2008-01-01

    By the 90°elastic light scattering investigation and far field observation in the range of 20-800℃,the relation between behavior of light scattering anomalies and evolution of nanodomain structures in lattice of barium sodium niobate(Ba2NaNb5O15,BSN)crystal was clarified.The correlation between anomalies on the temperature curves of the elastic light scattering intensity and temperature transformations of nanodomains was studied by X-ray and electron microscope methods.Phase transition near 500℃ and movement in field of scattering light could be explained by appearance of a new incommensurate phase.

  8. Improvement of the thermal properties of a polystyrene via inclusion of barium hexaferrite particles

    Science.gov (United States)

    Hemeda, O. M.; El-Sayed, Adly H.; Tawfik, A.; Hamad, Mahmoud A.

    2016-07-01

    M-type barium hexaferrite (BaM) particles-polystyrene (PS) composite has been successfully synthesized. Fourier transform infrared spectra confirm the synthesis of the BaM-PS composite. Scanning electron microscopy shows that BaM particles are attached rather well to the PS matrix and have variable sizes and shapes. Differential and thermogravimetric analysis indicate that PS chains are well coupled within the BaM powder and the thermal stability of PS is enhanced by incorporating BaM in the PS matrix.

  9. Cascaded Brillouin lasing in monolithic barium fluoride whispering gallery mode resonators

    CERN Document Server

    Lin, Guoping; Saleh, Khaldoun; Martinenghi, Romain; Beugnot, Jean-Charles; Sylvestre, Thibaut; Chembo, Yanne K

    2015-01-01

    We report the observation of stimulated Brillouin scattering and lasing at 1550~nm in barium fluoride (BaF$_2$) crystal. Brillouin lasing was achieved with ultra-high quality ($Q$) factor monolithic whispering gallery mode (WGM) mm-size disk resonators. Overmoded resonators were specifically used to provide cavity resonances for both the pump and all Brillouin Stokes waves. Single and multiple Brillouin Stokes radiations with frequency shift ranging from $8.2$ GHz up to $49$ GHz have been generated through cascaded Brillouin lasing. BaF$_2$ resonator-based Brillouin lasing can find potential applications for high-coherence lasers and microwave photonics.

  10. Fabrication of flexible magnetic papers based on bacterial cellulose and barium hexaferrite with improved mechanical properties

    Science.gov (United States)

    Lim, Guh-Hwan; Lee, Jooyoung; Kwon, Nayoung; Bok, Shingyu; Sim, Hwansu; Moon, Kyoung-Seok; Lee, Sang-Eui; Lim, Byungkwon

    2016-09-01

    We report on a simple approach to fabricate mechanically robust magnetic cellulose papers containing M-type barium hexaferrite (BaFe12O19) nanoplates. BaFe12O19 nanoplates were synthesized by a hydrothermal method and then chemically functionalized by using a silane coupling agent. The magnetic cellulose papers prepared with the silane-treated BaFe12O19 nanoplates exhibited improved mechanical properties with tensile strength of 58.5 MPa and Young's modulus of 2.95 GPa.

  11. Low temperature preparation of nanocrystalline solid solution of strontium barium niobate by chemical process

    Indian Academy of Sciences (India)

    Asit B Panda; Amita Pathak; Panchanan Pramanik

    2002-11-01

    SrBa1–Nb2O6 (with = 0.4, 0.5 and 0.6) powders have been prepared by thermolysis of aqueous precursor solutions consisting of triethanolamine (TEA), niobium tartarate and, EDTA complexes of strontium and barium ions. Complete evaporation of the precursor solution by heating at ∼ 200°C, yields in a fluffy, mesoporous carbon rich precursor material, which on calcination at 750°C/2 h has resulted in the pure SBN powders. The crystallite and average particle sizes are found to be around 15 nm and 20 nm, respectively.

  12. Three-wave mixing mediated femtosecond pulse compression in β-barium borate.

    Science.gov (United States)

    Grün, A; Austin, Dane R; Cousin, Seth L; Biegert, J

    2015-10-15

    Nonlinear pulse compression mediated by three-wave mixing is demonstrated for ultrashort Ti:sapphire pulses in a type II phase-matched β-barium borate (BBO) crystal using noncollinear geometry. 170 μJ pulses at 800 nm with a pulse duration of 74 fs are compressed at their sum frequency to 32 fs with 55 μJ of pulse energy. Experiments and computer simulations demonstrate the potential of sum-frequency pulse compression to match the group velocities of the interacting waves to crystals that were initially not considered in the context of nonlinear pulse compression.

  13. Structural, topographical and electrical properties of cerium doped strontium barium niobate (Ce:SBN60) ceramics

    Science.gov (United States)

    Raj, S. Gokul; Mathivanan, V.; Kumar, G. Ramesh; Yathavan, S.; Mohan, R.

    2016-05-01

    Tungsten bronze type cerium doped strontium barium niobate (Ce:SBN - Sr0.6B0.4Nb2O6) ceramics were synthesized by solid state process. Cerium was used as dopant to improve its electrical properties. Influence of Ce+ ions on the photoluminescence properties was investigated in detail. The grain size topographical behavior of SBN powders and their associated abnormal grain growth (AGG) were completely analyzed through SEM studies. Finally dielectric, measurement discusses about the broad phase transition observed due to cerium dopant The results were discussed in detail.

  14. New neutron-deficient isotopes of barium and rare-earth elements

    CERN Document Server

    Bogdanov, D D; Karnaukhov, V A; Petrov, L A; Plochocki, A; Subbotin, V G; Voboril, J

    1976-01-01

    The authors present an investigation of the short-lived neutron- deficient isotopes of barium and rare-earth elements. By using the BEMS-2 isotope separator on a heavy ion beam, 19 new isotopes were produced with mass numbers ranging from 117 to 138. Five of these (/sup 117/Ba, /sup 129,131/Nd and /sup 133,135/Sm) turned out to be delayed proton emitters. The beta -decay probabilities for the new isotopes have been analyzed in terms of the beta -strength function. An analysis of the proton spectrum shape has been performed using the statistical model for delayed proton emission.

  15. Biological effects of cesium-137 injected in beagle dogs of different ages

    Energy Technology Data Exchange (ETDEWEB)

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C. [and others

    1995-12-01

    The toxicity of cesium-137 ({sup 137}Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of {sup 137}Cs are important to understand because {sup 137}Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy.

  16. Vertical distribution of (137)Cs activity concentration in marine sediments at Amvrakikos Gulf, western of Greece.

    Science.gov (United States)

    Tsabaris, C; Patiris, D L; Fillis-Tsirakis, E; Kapsimalis, V; Pilakouta, M; Pappa, F K; Vlastou, R

    2015-06-01

    The aim of the present work is the study of (137)Cs migration in sediment column taking into account the sedimentation rate in the Amvrakikos Gulf, at the western part of Greece. Marine core sediments were collected and the measurements were performed using the high resolution gamma-ray spectrometry method. The vertical distribution of (137)Cs activity concentration, as part of anthropogenic marine radioactivity, provided averaged sedimentation rate by identifying the depths of activity concentrations due to the Chernobyl accident and the nuclear tests signals. Furthermore, (137)Cs measurements were reproduced using the proposed one-dimensional diffusion-advection model which provides mainly as an output, the sedimentation rate and the average diffusivity of (137)Cs in the sediment column. The proposed model estimates the temporal variation of (137)Cs activity concentration from 1987 (one year after the Chernobyl accident) till today (2014).

  17. Anti-CD137 monoclonal antibodies and adoptive T cell therapy: a perfect marriage?

    Science.gov (United States)

    Weigelin, Bettina; Bolaños, Elixabet; Rodriguez-Ruiz, Maria E; Martinez-Forero, Ivan; Friedl, Peter; Melero, Ignacio

    2016-05-01

    CD137(4-1BB) costimulation and adoptive T cell therapy strongly synergize in terms of achieving maximal efficacy against experimental cancers. These costimulatory biological functions of CD137 have been exploited by means of introducing the CD137 signaling domain in clinically successful chimeric antigen receptors and to more efficiently expand T cells in culture. In addition, immunomagnetic sorting of CD137-positive T cells among tumor-infiltrating lymphocytes selects for the fittest antitumor T lymphocytes for subsequent cultures. In mouse models, co-infusion of both agonist antibodies and T cells attains marked synergistic effects that result from more focused and intense cytolytic activity visualized under in vivo microscopy and from more efficient entrance of T cells into the tumor through the vasculature. These several levels of dynamic interaction between adoptive T cell therapy and CD137 offer much opportunity to raise the efficacy of current cancer immunotherapies.

  18. Extraction of Cs-137 by alcohol-water solvents from plants containing cardiac glycosides

    CERN Document Server

    Dzyubak, S N; Dzyubak, O P; Sorokin, P V; Popov, V F; Orlov, A A; Krasnov, V P; Gubin, Yu.I.

    2001-01-01

    As a result of nuclear power plant accidents, large areas receive radioactive inputs of Cs-137. This cesium accumulates in herbs growing in such territories. The problem is whether the herbs contaminated by radiocesium may be used as a raw material for medicine. The answer depends on the amount of Cs-137 transfered from the contaminated raw material to the medicine. We have presented new results of the transfer of Cs-137 from contaminated Digitalis grandiflora Mill. and Convallaria majalis L. to medicine. We found that the extraction of Cs-137 depends strongly on the hydrophilicity of the solvent. For example 96.5%(vol.) ethyl alcohol extracts less Cs-137 (11.6%) than 40%(vol.) ethyl alcohol or pure water (66.2%). The solubility of the cardiac glycosides is inverse to the solubility of cesium, which may be of use in the technological processes for manufacturing ecologically pure herbal medicine.

  19. A design study for the analysis of 90Sr And 135,137Cs by ISA-AMS

    Science.gov (United States)

    Alary, Jean-François; Cousins, Lisa M.; Eliades, John; Hao, Changtong; Javahery, Gholamreza; Kieser, William E.; Litherland, Albert E.; Zhao, Xiaolei

    2013-04-01

    Extending the range of Accelerator Mass Spectrometry (AMS) to the fission products 90Sr and 135,137Cs would offer numerous advantages for non-proliferation surveillance activities. A new method for suppressing the interfering isobars 90Zr (and 90Y) and 135,137Ba using low kinetic energy (Anions (ISA). Combined with fluoridematrix assisted ionization, this method greatly improves the analytical capabilities of AMS for 90Sr and will enable the direct analysis of 135,137Cs below sub-parts per trillion levels. The ISA alone provides interference suppression factors of 4×10-6 for ZrF3-/SrF3- and 2×10-5 for BaF2-/CsF2-. The general performance improvement provided by the ISA, however, critically depends on the capacity of this device to transmit the wanted anions with a high efficiency and with a stable response to the natural variations of AMS targets. Based on recent SIMION-8.1 studies and on results of a parallel study on the attenuation of other anions, we have developed a pre-commercial design for the ISA. In this design, RFQ rods and split-flow turbo molecular pumps are configured to achieve full control of reaction time, ion energy and fragmentation pathways (chemical and kinetic reactions), and to improve beam transmission through the cell. The mechanical layout will be presented in 3D models using Solid Works; SIMION-8.1 simulations were used to illustrate the importance of optical matching of the RFQ and the front-end DC retardation section of the ISA.

  20. Effects of the composition of standard reference material on the accuracy of determinations of {sup 210}Pb and {sup 137}Cs in soils with gamma spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Li, Y., E-mail: yongli32@hotmail.co [State Key Laboratory of Dryland Farming and Soil Erosion in the Loess Plateau, Institute of Soil and Water Conservation, CAS and MWR, Yangling 712100 (China); Institute of Environment and Sustainable Development in Agriculture, CAAS, No. 12 Zhongguancun South Street, Beijing 100081 (China); Geng, X.C.; Yu, H.Q. [Institute of Environment and Sustainable Development in Agriculture, CAAS, No. 12 Zhongguancun South Street, Beijing 100081 (China); Wan, G.J. [State Key Laboratory of Environmental Geochemistry, Institute of Geochemistry, Chinese Academy of Sciences, Guiyang (China)

    2011-02-15

    The effect of the composition of the used standard reference material (SRM) on results of determination of fallout radionuclides in soil samples was studied. Using five soil types as SRMs, we measured the specific activity of {sup 210}Pb and {sup 137}Cs in six target samples of Chestnut soil. It was observed that the determination of the {sup 210}Pb activity in the samples depended on the chemical composition of SRMs used to create the efficiency curves. Thus, using SRMs similar in chemical composition to the target samples should improve accuracy in the determination of {sup 210}Pb in environmental samples.

  1. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO) precursor employing microwave heating technique

    Indian Academy of Sciences (India)

    Y S Malghe; A V Gurjar; S R Dharwadkar

    2004-06-01

    Cubic barium titanate (BaTiO3) powder was synthesized by heating barium titanyl oxalate hydrate, BaTiO(C2O4)$_{2}\\cdot$4H2O (BTO) precursor in microwave heating system in air at 500°C. Heating BTO in microwave above 600°C yielded tetragonal form of BaTiO3. Experiments repeated in silicon carbide furnace showed that BaTiO3 was formed only above 700°C. The product obtained was cubic.

  2. Geophysical disturbance environment during the NASA/MPE barium release at 5 earth radii on September 21, 1971.

    Science.gov (United States)

    Davis, T. N.; Stanley, G. M.; Boyd, J. S.

    1973-01-01

    The geophysical disturbance environment was quiet during the NASA/MPE barium release at 5 earth radii on September 21, 1971. At the time of the release, the magnetosphere was in the late recovery phase of a principal magnetic storm, the provisional Dst value was -13 gammas, and the local horizontal disturbance at Great Whale River was near zero. Riometer and other observations indicated low-level widespread precipitation of high-energy electrons at Great Whale River before, during, and after the release. Cloudy sky at this station prevented optical observation of aurora. No magnetic or ionospheric effects attributable to the barium release were detected at Great Whale River.

  3. Using 137Cs Tracer Technique to Evaluate Erosion and Deposition of Black Soil in Northeast China

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Soil and water losses through erosion have been serious in the black soil region of Northeast China. Therefore, a sloping cultivated land in Songnen Plain was selected as a case study to: 1) determine the 137Cs reference inventory in the study area; 2) calculate erosion and deposition rates of black soil on different slope locations; 3) conduct a sensitivity analysis of some model parameters; and 4) compare overall outputs using four different models. Three transects were set in the field with five slope locations for each transect, including summit, shoulder-slope, back-slope, foot-slope, and toe-slope. Field measurements and model simulation were used to estimate a bomb-derived 137Cs reference inventory in the study area.Soil erosion and deposition rates were estimated using four 137Cs models and percentage of 137Cs loss/gain. The 137Cs reference value in the study area was 2 232.8 Bq m-2 with 137Cs showing a clear topographic pattern, decreasing from the summit to shoulder-slope, then increasing again at the foot-slope and reaching a maximum at the toe-slope. Predicted soil redistribution rates for different slope locations varied. Among models, the Yang Model (YANG-M) overestimated erosion loss but underestimated deposition. However, the standard mass balance model (MBM1) gave predictions similar to a mass balance model incorporating soil movement by tillage (MBM2). Sensitivity analysis of the proportion factor γand distribution pattern of 137Cs in the surface layer demonstrated the impact of 137Cs enrichment on calculation of the soil erosion rate. Factors influencing the redistribution of fallout 137Cs in landscape should be fully considered as calculating soil redistribution rate using 137Cs technique.

  4. Fallout volume and litter type affect (137)Cs concentration difference in litter between forest and stream environments.

    Science.gov (United States)

    Sakai, Masaru; Gomi, Takashi; Negishi, Junjiro N

    2016-11-01

    It is important to understand the changes in the (137)Cs concentration in litter through leaching when considering that (137)Cs is transferred from basal food resources to animals in forested streams. We found that the difference of (137)Cs activity concentration in litter between forest and stream was associated with both litter type and (137)Cs fallout volume around Fukushima, Japan. The (137)Cs activity concentrations in the litter of evergreen conifers tended to be greater than those in the litter of broad-leaved deciduous trees because of the absence of deciduous leaves during the fallout period in March 2011. Moreover, (137)Cs activity concentrations in forest litter were greater with respect to the (137)Cs fallout volume. The (137)Cs activity concentrations in stream litter were much lower than those in forest litter when those in forest litter were higher. The (137)Cs leaching patterns indicated that the differences in (137)Cs activity concentration between forest and stream litter could change with changes in both fallout volume and litter type. Because litter is an important basal food resource in the food webs of both forests and streams, the (137)Cs concentration gradient reflects to possible (137)Cs transfer from lower to higher trophic animals. Our findings will improve our understanding of the spatial heterogeneity and variability of (137)Cs concentrations in animals resident to the contaminated landscape.

  5. 137Cs vertical migration in a deciduous forest soil following the Fukushima Dai-ichi Nuclear Power Plant accident.

    Science.gov (United States)

    Nakanishi, Takahiro; Matsunaga, Takeshi; Koarashi, Jun; Atarashi-Andoh, Mariko

    2014-02-01

    The large amount of (137)Cs deposited on the forest floor because of the Fukushima Dai-ichi Nuclear Power Plant accident represents a major potential long-term source for mobile (137)Cs. To investigate (137)Cs mobility in forest soils, we investigated the vertical migration of (137)Cs through seepage water, using a lysimetric method. The study was conducted in a deciduous forest soil over a period spanning 2 month to 2 y after the Fukushima nuclear accident. Our observations demonstrated that the major part of (137)Cs in the litter layer moved into the mineral soil within one year after the accident. On the other hand, the topsoil prevented migration of (137)Cs, and only 2% of (137)Cs in the leachate from litter and humus layer penetrated below a 10 cm depth. The annual migration below a 10 cm depth accounted for 0.1% of the total (137)Cs inventory. Therefore, the migration of (137)Cs by seepage water comprised only a very small part of the total (137)Cs inventory in the mineral soil, which was undetectable from the vertical distribution of (137)Cs in the soil profile. In the present and immediate future, most of the (137)Cs deposited on the forest floor will probably remain in the topsoil successively, although a small but certain amount of bioavailable (137)Cs exists in forest surface soil.

  6. DECOMMISSIONING OF A CAESIUM-137 SEALED SOURCE PRODUCTION FACILITY

    Energy Technology Data Exchange (ETDEWEB)

    Murray, A.; Abbott, H.

    2003-02-27

    Amersham owns a former Caesium-137 sealed source production facility. They commissioned RWE NUKEM to carry out an Option Study to determine a strategy for the management of this facility and then the subsequent decommissioning of it. The decommissioning was carried out in two sequential phases. Firstly robotic decommissioning followed by a phase of manual decommissioning. This paper describes the remote equipment designed built and operated, the robotic and manual decommissioning operations performed, the Safety Management arrangements and summarizes the lessons learned. Using the equipment described the facility was dismantled and decontaminated robotically. Some 2300kg of Intermediate Level Waste containing in the order of 4000Ci were removed robotically from the facility. Ambient dose rates were reduced from 100's of R per hour {gamma} to 100's of mR per hour {gamma}. The Telerobotic System was then removed to allow man access to complete the decommissioning. Manual decommissioning reduced ambient dose rates further to less than 1mR per hour {gamma} and loose contamination levels to less than 0.25Bq/cm2. This allowed access to the facility without respiratory protection.

  7. Upgrade Procedure for the Delingha 13.7-m Telescope

    Institute of Scientific and Technical Information of China (English)

    Ying-Xi Zuo; Ji Yang; Sheng-Cai Shi; Shan-Huai Chen; Li-Ben Pei; Qi-Jun Yao; Jin-Jiang Sun; Zhen-Hui Lin

    2004-01-01

    The 13.7-m millimeter-wave radio telescope of Purple Mountain Observatory operates at 3200-m above the sea level near Delingha,Qinghai Province,China.Equipped with a superconducting SIS receiver,the telescope is used in the millimeter-wave band ranging from 85 to 115 GHz.An upgrade procedure is reported here which includes a superconducting SIS receiver,a new phase-locked local oscillator,a dedicated multi-line backend system,and a new control system based on industrial computer with PCI bus.With the dedicated multi-line backend system,the CO and isotopic lines around 110 GHz are obtained simultaneously.In recent years,scientific activities with this telescope have been focused on studies of Galactic molecular clouds and star formation regions,including surveys of molecular lines from IRAS sources and large-scale map of molecular clouds.Other programs include studies of the circumstellar envelope of late-type stars and interaction of Galactic supernova remnants with dense molecular gas.

  8. Karakterisasi ekstrak kasar lipase Rhizopus stolonifer UICC 137

    Directory of Open Access Journals (Sweden)

    Sri Sumiarsih

    2001-12-01

    Full Text Available There is an increasing commercial interest in enzymatic production of biologically active component, because there are a number of well-known advantages compared to chemical synthesis. One of the most valuable synthetic features of enzyme is their ability to discriminate between enantiomers of racemic substrates. Lipase have become of great interest to the chemical industries wing their usefulness in both hydrolytic and synthesis reactions. The aim of this work was to study the production of lipase by Rhizopus stolonifer UICC 137, and determine the crude lipase preparation characteristics. The lipolytic activity was determined by titrimetric method toward oil-arabic gum emultion as a substrate. The strain produced lipase at appreciable lipolytic when cultivated for 72 hours in medium containing 3% glucose and 1% olive oil. Our data suggest that the strain produced lipase since the exponential phase of its growth. Lipase with optimum lipolytic activity was obtained at late stationary phase. The optimum condition for lipolytic activity measurement were pH of 7.5 and temperature 37oC, the crude enzyme had a specific activity 20.2 unit/ mg protein, the Vmax was 15.1 mol/ min and KM was 12.5 mg/ ml. The crude enzyme retained 79.9%, 68.0% and 52.6% of its lipolytic activity, when incubated for 90 minutes at temperature of 40, 50, and 60oC respectively.

  9. Inferring the chemical form of {sup 137}Cs deposited by the Fukushima Dai-ichi Nuclear Power Plant accident by measuring {sup 137}Cs incorporated into needle leaves and male cones of Japanese cedar trees

    Energy Technology Data Exchange (ETDEWEB)

    Kanasashi, Tsutomu, E-mail: kanasashi.tsutomu@g.mbox.nagoya-u.ac.jp [Graduate School of Bioagricultural Sciences, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi 464-8601 (Japan); Takenaka, Chisato [Graduate School of Bioagricultural Sciences, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi 464-8601 (Japan); Sugiura, Yuki [Japan Atomic Energy Agency, 765-1 Funaishikawa, Tokai-mura, Naka-gun, Ibaraki 319-1184 (Japan)

    2016-05-15

    We hypothesized that the water-soluble (ionic) and water-insoluble (stable) radiocesium from the initial fallout of the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident was distributed in various proportions in the surrounding areas and that this distribution was reflected in the trees that suffered deposition from the initial fallout. This study attempted to evaluate local variations in the chemical form of {sup 137}Cs derived from the initial fallout of the FDNPP accident and whether its chemical form affected the radiocesium concentration in the tissues currently growing in trees, even after the initial fallout ceased. For these estimations, the ratio between the {sup 137}Cs concentration in Cryptomeria japonica needle leaves in the tree crown, which existed before the FDNPP accident and subsequently directly exposed to the initial fallout ({sup 137}Cs{sub pre-accident} {sub N}), and the amount of {sup 137}Cs in the initial fallout itself ({sup 137}Cs{sub fallout}) was determined ({sup 137}Cs{sub pre-accident} {sub N}/{sup 137}Cs{sub fallout}) at 66 sites. In addition, the {sup 137}Cs ratios between the male cones produced in 2012 ({sup 137}Cs{sub male} {sub cone}) and needle leaves that had elongated in the spring of 2011 ({sup 137}Cs{sub 2011N}) was determined at 82 sites ({sup 137}Cs{sub male} {sub cone}/{sup 137} Cs{sub 2011N}). Most of the sites with lower {sup 137}Cs{sub pre-accident} {sub N}/{sup 137}Cs{sub fallout} ratios were distributed in eastern Fukushima, relatively close to the Pacific Ocean coastline. Lower {sup 137}Cs{sub pre-accidentN}/{sup 137}Cs{sub fallout} and higher {sup 137}Cs{sub malecone}/{sup 137}Cs{sub 2011N} were found to be associated with higher proportions of {sup 137}Cs in ionic forms. These observations are consistent with the hypothesis, and likely reflect regional variations in the chemical form of the deposited radiocesium. - Highlights: • Study of spatial variation of ionic and stable {sup 137}Cs in the initial

  10. Thick-target yields of radioactive targets deduced from inverse kinematics

    Energy Technology Data Exchange (ETDEWEB)

    Aikawa, M., E-mail: aikawa@sci.hokudai.ac.jp [Faculty of Science, Hokkaido University, Sapporo 060-0810 (Japan); Ebata, S.; Imai, S. [Meme Media Laboratory, Hokkaido University, Sapporo 060-8628 (Japan)

    2015-06-15

    The thick-target yield (TTY) is a macroscopic quantity reflected by nuclear reactions and matter properties of targets. In order to evaluate TTYs on radioactive targets, we suggest a conversion method from inverse kinematics corresponding to the reaction of radioactive beams on stable targets. The method to deduce the TTY is theoretically derived from inverse kinematics. We apply the method to the {sup nat}Cu({sup 12}C,X){sup 24}Na reaction to confirm availability. In addition, it is applied to the {sup 137}Cs + {sup 12}C reaction as an example of a radioactive system and discussed a conversion coefficient of a TTY measurement.

  11. Enhanced Sensitivity of Surface Plasmon Resonance Sensor Based on Bilayers of Silver-Barium Titanate

    Directory of Open Access Journals (Sweden)

    S. Fouad

    2016-12-01

    Full Text Available Surface plasmon resonance (SPR sensors have been widely adopted with various fields such as physics, chemistry, biology and biochemistry. SPR sensor has many advantages like the less number of sensing samples required, freedom of electromagnetic interference and higher sensitivity. This research investigates the phase interrogation technique of a surface plasmon resonance sensor based on silver and thin film dielectric material of Barium titanate layers. Barium titanate (BaTiO3 layer is adopted due to its excellent dielectric properties such as high dielectric constant and low dielectric loss. The numerical results demonstrate that the fusion of the proposed material BaTiO3 layer into surface plasmon resonance sensor yields a higher sensitivity of 280 degree/RIU in comparison with surface plasmon resonance sensor without BaTiO3 layer which shows only a sensitivity of 120 degree/RIU. As the thickness of this layer increases from 5 nm to 10 nm, the sensitivity is enhanced from 160 degree/RIU to 280 degree/RIU for a fixed metal layer of silver with a thickness of (70 nm.

  12. Curie temperature and magnetic properties of aluminum doped barium ferrite particles prepared by ball mill method

    Science.gov (United States)

    Chen, Daming; Harward, Ian; Baptist, Joshua; Goldman, Sara; Celinski, Zbigniew

    2015-12-01

    Barium ferrite has attracted considerable interest in the fields of permanent magnets and perpendicular magnetic recording due to its strong uniaxial anisotropy and high Curie temperature (Tc). We prepared aluminum doped barium ferrite ceramics (BaAlxFe12-xO19, 0≤x≤6) by the ball mill method. The powder was milled for 96 h, and after forming pellets, annealed for 48 h in air at 1000 °C. The X-ray diffraction (XRD) data show that there are only single hexagonal phases in the samples without any impurity phase. The crystal lattice constants, a and c, were calculated by Cohen's method. Both a and c decrease with increasing x, ranging from 0.588 nm and 2.318 nm to 0.573 nm and 2.294 nm, respectively. A Vibrating Sample Magnetometer (VSM) and Superconducting Quantum Interference Device (SQUID) were used to investigate Tc and magnetic properties of BaFe12-xAlxO19. It is found that Tc decreases with increasing x, from 425 °C to 298 °C. It is also found that the saturated magnetization (4πMs) decreases with increasing x, while the coercivity (Hc) increases with the increase in x. The anisotropy field was also determined from the SQUID measurement.

  13. Ammonia synthesis with barium-promoted iron–cobalt alloys supported on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus

    2003-01-01

    Iron–cobalt alloys supported on carbon were investigated as ammonia synthesis catalysts. Barium was found to have a promoting effect for Fe with an optimum atomic ratio Ba/Fe of 0.35. At this Ba loading, a local maximum for the NH3 synthesis activity was found at 4 wt% Co by varying the Fe/Co ratio...... it was not as effective for Fe. Power-law kinetic investigation revealed that, compared to the commercial Fe-based NH3 catalyst, the Ba–Co/C samples showed a lower inhibition by NH3 and were more active under ordinary ammonia synthesis conditions........ Samples containing only Co and no Fe, however, yielded by far the most active catalysts (7.0 μmol (NH3) g−1 s−1, 673 K, 10 bar). Barium was a very efficient promoter for Co, increasing the NH3 synthesis activity by more than two orders of magnitude compared to the unpromoted Co samples, while...

  14. Dielectric properties of barium strontium titanate / non ferroelectric oxide ceramic composites

    Energy Technology Data Exchange (ETDEWEB)

    Nenez, S. [THALES, Domaine de Corbeville, Orsay (France); Univ. de Bourgogne, Lab. de Recherche sur la Reactivite des Solides, Dijon (France); Morell, A.; Pate, M.; Ganne, J.P. [THALES, Domaine de Corbeville, Orsay (France); Maglione, M. [Inst. de Chimie de la Matiere Condensee de Bordeaux - CNRS, Pessac (France); Niepce, J.C. [Univ. de Bourgogne, Lab. de Recherche sur la Reactivite des Solides, Dijon (France)

    2002-07-01

    Barium strontium titanate ceramics present high dielectric permittivity and tunability. In order to reduce their permittivity and loss tangent while keeping tunability, various composites of barium strontium titanate oxide Ba{sub 0.6}Sr{sub 0.4}TiO{sub 3} combined with non-ferroelectric oxides such as magnesium titanate MgTiO{sub 3} or magnesia MgO were investigated. The Ba-Sr oxide powder was mixed with 20, 40 or 60 wt% of the non-ferroelectric oxide (NFO). The paper discusses the processing and the material characterisations by X-ray diffraction and SEM. A secondary phase BaMg{sub 6}Ti{sub 6}O{sub 19} was detected only in the composites synthesised with MgTiO{sub 3}. The microstructure and the dielectric characteristics are presented and discussed. A correlation between the microstructure of the composites, including secondary phase and the dielectric properties is proposed. (orig.)

  15. Calculation of exchange integrals and Curie temperature for La-substituted barium hexaferrites

    Science.gov (United States)

    Wu, Chuanjian; Yu, Zhong; Sun, Ke; Nie, Jinlan; Guo, Rongdi; Liu, Hai; Jiang, Xiaona; Lan, Zhongwen

    2016-10-01

    As the macro behavior of the strength of exchange interaction, state of the art of Curie temperature Tc, which is directly proportional to the exchange integrals, makes sense to the high-frequency and high-reliability microwave devices. Challenge remains as finding a quantitative way to reveal the relationship between the Curie temperature and the exchange integrals for doped barium hexaferrites. Here in this report, for La-substituted barium hexaferrites, the electronic structure has been determined by the density functional theory (DFT) and generalized gradient approximation (GGA). By means of the comparison between the ground and relative state, thirteen exchange integrals have been calculated as a function of the effective value Ueff. Furthermore, based on the Heisenberg model, the molecular field approximation (MFA) and random phase approximation (RPA), which provide an upper and lower bound of the Curie temperature Tc, have been adopted to deduce the Curie temperature Tc. In addition, the Curie temperature Tc derived from the MFA are coincided well with the experimental data. Finally, the strength of superexchange interaction mainly depends on 2b-4f1, 4f2-12k, 2a-4f1, and 4f1-12k interactions.

  16. Growth and characterization of solution-grown tetra glycine barium chloride (TGBC) single crystals

    Science.gov (United States)

    Senthil Pandian, M.; Ramasamy, P.

    2008-05-01

    The single crystals of tetra glycine barium chloride (TGBC), a semi-organic material, were grown by the solvent evaporation technique from an aqueous solution of glycine and barium chloride at ambient temperature. Good optical quality single crystals of size 11×13×7 mm 3 were grown in a period of 2 weeks. Powder X-ray diffraction (XRD) and Fourier transform infrared transmission (FTIR) have confirmed the formation of the new crystal. The grown crystals were characterized by single-crystal XRD analysis to study the crystal structure. The crystalline perfection was evaluated by high-resolution X-ray diffractometry (HRXRD). From this analysis we found that the quality of the crystal was quite good. The full-width at half-maximum (FWHM) of the diffraction curves is 8.5 arcsec, which is very close to that expected from the plane wave dynamical theory of XRD showing that the crystalline perfection is excellent. UV-Vis-NIR spectrum was recorded to study the optical transparency of the grown crystals. Thermal properties of the crystal have been investigated using thermo gravimetric (TG), differential thermal analysis (DTA). The mechanical strength of the crystal is estimated by Vicker's hardness test.

  17. Nanostructured Barium Titanate/Carbon Nanotubes Incorporated Polyaniline as Synergistic Electromagnetic Wave Absorbers

    Directory of Open Access Journals (Sweden)

    Lujun Yu

    2016-01-01

    Full Text Available The three-dimensional (3D conductive network structures formed by barium titanate/carbon nanotubes incorporated polyaniline were favorable for strengthening electromagnetic absorption capability. Herein, an easy and flexible method consisting of sol-gel technique, in situ polymerization, and subsequent mechanical method have been developed to prepare the barium titanate/carbon nanotubes incorporated polyaniline (CNTs/BaTiO3/PANI or CBP ternary composites. The dielectric properties and microwave absorption properties of CNTs/BaTiO3/PANI composites were investigated in the frequency range of 2–18 GHz by vector network analyzer. Interestingly, it is found that the CNTs/BaTiO3/PANI composites with 3D conductive network structures presented outstanding electromagnetic absorption properties, which may be attributed to the high impedance matching behavior and improved dielectric loss ability and novel synergistic effect. Additionally, it also can be supposed that the “geometrical effect” of composite was more beneficial to absorbing the incident electromagnetic wave. The CNTs/BaTiO3/PANI composite (the mass ratio of CNTs/BaTiO3 to PANI is 2 : 3 exhibits the best microwave absorption properties, of which the minimum reflection loss value can reach −30.9 dB at 8 GHz and the absorption bandwidth with a reflection loss blew −10 dB ranges from 7.5 to 10.2 GHz.

  18. Structural and thermal studies of modified silica-strontium-barium glass from CRT

    Science.gov (United States)

    Grelowska, I.; Kosmal, M.; Reben, M.; Pichniarczyk, P.; Sitarz, M.; Olejniczak, Z.

    2016-12-01

    Glasses were prepared by conventional melting method from 100 g batches. The influence of alumina and calcium oxide on the crystallization process of silica-strontium-barium glass from Cathode Ray Tube (CRT) were studied by means of 27Al MAS NMR and FTIR spectroscopy. This made possible to determine the influence of additives, e.g. blast furnace slag and cement dust on the structural changes of glasses (changes in the spectra shapes). The introduction of waste modifiers into the glass structure leads to the breaking of Al-O-Si and Si-O-Si bonds what causes the depolymerization of the glass network. From the FTIR spectra the narrowing of the bands at 1022 and 1027 cm-1 was observed, which may indicate on the ordering of glass network. Appearance of alumina in coordination 4 was confirmed by NMR investigations. The effects of compositional variation, thermal treatment on the nature, type and stability field of crystallizing phases and microstructure formed in CaO and/or Al2O3 silica-strontium-barium glasses were described using DTA/DSC method. Thermal characteristics of glasses like the transition temperature Tg, the temperature for the crystallization Tc, thermal stability parameter were determined. The crystalline phase was determined by the X-ray diffractometry. The microstructure of the samples was studied by SEM technique. Analysis of the local atomic interactions in the structure of glasses has been used to explain the course of the crystallization.

  19. Sulphate removal over barium-modified blast-furnace-slag geopolymer.

    Science.gov (United States)

    Runtti, Hanna; Luukkonen, Tero; Niskanen, Mikko; Tuomikoski, Sari; Kangas, Teija; Tynjälä, Pekka; Tolonen, Emma-Tuulia; Sarkkinen, Minna; Kemppainen, Kimmo; Rämö, Jaakko; Lassi, Ulla

    2016-11-05

    Blast-furnace slag and metakaolin were geopolymerised, modified with barium or treated with a combination of these methods in order to obtain an efficient SO4(2-) sorbent for mine water treatment. Of prepared materials, barium-modified blast-furnace slag geopolymer (Ba-BFS-GP) exhibited the highest SO4(2-) maximum sorption capacity (up to 119mgg(-1)) and it compared also favourably to materials reported in the literature. Therefore, Ba-BFS-GP was selected for further studies and the factors affecting to the sorption efficiency were assessed. Several isotherms were applied to describe the experimental results of Ba-BFS-GP and the Sips model showed the best fit. Kinetic studies showed that the sorption process follows the pseudo-second-order kinetics. In the dynamic removal experiments with columns, total SO4(2-) removal was observed initially when treating mine effluent. The novel modification method of geopolymer material proved to be technically suitable in achieving extremely low concentrations of SO4(2-) (<2mgL(-1)) in mine effluents.

  20. Influence of preparation route and slip casting conditions on titania and barium titanate ceramics

    Institute of Scientific and Technical Information of China (English)

    Arvind K.Nikumbh; Parag V.Adhyapak

    2012-01-01

    Titania (TiO2) and barium titanate (BaTiO3) were synthesized using three different dicarboxylates,which included oxalate,malate and tartarate.These powders were characterized by X-ray powder diffraction,scanning electron micrographs,BET specific surface area and particle size distribution.Their properties depended to a great extent on the nature of the precursor.The titania and barium titanate powders obtained from the tartarate precursor were found to be good for slip casting.Slips of these oxides with different solids contents were prepared at different pH values using both distilled water and ethanol as the dispersing agent and also with and without deflocculant.The theological behaviors of the suspensions were then determined,and the slip,green and sedimentation bulk densities were measured.The minimum viscosities were observed at pH 8.2 for the TiO2-water and pH 10.2 for the BaTiO3-water system.

  1. Dopant Behaviours of Sm2O3 on Microstructure and Properties of Barium Zirconium Titanate Ceramics

    Institute of Scientific and Technical Information of China (English)

    王永力; 李龙土; 齐建全; 桂治轮

    2001-01-01

    The effect of Sm2O3-dopant on the sintering characteristics and dielectric properties of barium zirconium titanate ceramics (BaZrxTi1-xO3) was investigated. It is shown that trace amount of Sm2O3 can greatly affect the grain growth and densification of barium zirconium titanate ceramics during sintering. At the same time, the dielectric peak at high temperature shifts to lower temperature and that at low temperature shifts to higher temperature. The two dielectric peaks overlap with each other when the Sm2O3-dopant content varies from 0.25% to 1%, and the maximum relative dielectric constant is greatly enhanced. These effects may be attributed to the substitution actions of the rare earth element in perovskite lattice. At the doping content of 0.75%, the dielectric constant maximum of 23570 can be obtained. By adopting some proper additives, an excellent Y5V dielective material is obtained, and the room temperature properties are as follows: relative dielectric constant εRT≥23,000, dielectric loss tgδ≤0.0075 and the breakdown strength under alternating field Eb≥5 kV·mm-1.

  2. Synthesis of nanosized barium titanate/epoxy resin composites and measurement of microwave absorption

    Indian Academy of Sciences (India)

    M Murugan; V K Kokate; M S Bapat; A M Sapkal

    2010-12-01

    Barium titanate/epoxy resin composites have been synthesized and tested for microwave absorption/transmission. Nanocrystalline barium titanate (BaTiO3 or BT) was synthesized by the hydrothermal method and the composites of BT/epoxy resin were fabricated as thin solid slabs of four different weight ratios. BT was obtained in the cubic phase with an average particle size of 21 nm, deduced from the X-ray diffraction data. The reflection loss (RL) and transmission loss (TL) of the composite materials were measured by the reflection/transmission method using a vector network analyser R&S: ZVA40, in the frequency range 8.0–18.5 GHz (X and Ku-bands). The RL was found to be better than −10 dB over wide frequency bands. The higher RL for lower concentration of BT could be due to increase in impedance matching effects. Low TL values indicate that the absorption by BT is quite low. This could be due to formation of BT in the cubic paraelectric phase.

  3. Electronic structure of barium strontium titanate by soft-x-ray absorption spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Uehara, Y. [Mitsubishi Electric Co., Hyogo (Japan); Underwood, J.H.; Gullikson, E.M.; Perera, R.C.C. [Ernest Orlando Lawrence Berkeley National Lab., CA (United States)

    1997-04-01

    Perovskite-type titanates, such as Strontium Titanate (STO), Barium Titanate (BTO), and Lead Titanate (PTO) have been widely studied because they show good electric and optical properties. In recent years, thin films of Barium Strontium Titanate (BST) have been paid much attention as dielectrics of dynamic random access memory (DRAM) capacitors. BST is a better insulator with a higher dielectric constant than STO and can be controlled in a paraelectric phase with an appropriate ratio of Ba/Sr composition, however, few studies have been done on the electronic structure of the material. Studies of the electronic structure of such materials can be beneficial, both for fundamental physics research and for improving technological applications. BTO is a famous ferroelectric material with a tetragonal structure, in which Ti and Ba atoms are slightly displaced from the lattice points. On the other hand, BST keeps a paraelectric phase, which means that the atoms are still at the cubic lattice points. It should be of great interest to see how this difference of the local structure around Ti atoms between BTO and BST effects the electronic structure of these two materials. In this report, the authors present the Ti L{sub 2,3} absorption spectra of STO, BTO, and BST measured with very high accuracy in energy of the absorption features.

  4. Single Molecule Fluorescence Imaging as a Technique for Barium Tagging in Neutrinoless Double Beta Decay

    CERN Document Server

    Jones, B J P; Nygren, D R

    2016-01-01

    Background rejection is key to success for future neutrinoless double beta decay experiments. To achieve sensitivity to effective Majorana lifetimes of $\\sim10^{28}$ years, backgrounds must be controlled to better than 0.1 count per ton per year, beyond the reach of any present technology. In this paper we propose a new method to identify the birth of the barium daughter ion in the neutrinoless double beta decay of $^{136}$Xe. The method adapts Single Molecule Fluorescent Imaging, a technique from biochemistry research with demonstrated single ion sensitivity. We explore possible SMFI dyes suitable for the problem of barium ion detection in high pressure xenon gas, and develop a fiber-coupled sensing system with which we can detect the presence of bulk Ba$^{++}$ ions remotely. We show that our sensor produces signal-to-background ratios as high as 85 in response to Ba$^{++}$ ions when operated in aqueous solution. We then describe the next stage of this R\\&D program, which will be to demonstrate chelation...

  5. Organometallic halide perovskite/barium di-silicide thin-film double-junction solar cells

    Science.gov (United States)

    Vismara, R.; Isabella, O.; Zeman, M.

    2016-04-01

    Barium di-silicide (BaSi2) is an abundant and inexpensive semiconductor with appealing opto-electrical properties. In this work we show that a 2-μm thick BaSi2-based thin-film solar cell can exhibit an implied photo-current density equal to 41.1 mA/cm2, which is higher than that of a state-of-the-art wafer-based c-Si hetero-junction solar cell. This performance makes BaSi2 an attractive absorber for high-performing thin-film and multi-junction solar cells. In particular, to assess the potential of barium di-silicide, we propose a thin-film double-junction solar cell based on organometallic halide perovskite (CH3NH3PbI3) as top absorber and BaSi2 as bottom absorber. The resulting modelled ultra-thin double-junction CH3NH3PbI3 / BaSi2 (< 2 μm) exhibits an implied total photo-current density equal to 38.65 mA/cm2 (19.84 mA/cm2 top cell, 18.81 mA/cm2 bottom cell) and conversion efficiencies up to 28%.

  6. Low-Temperature Synthesis and Thermodynamic and Electrical Properties of Barium Titanate Nanorods

    Directory of Open Access Journals (Sweden)

    Florentina Maxim

    2015-01-01

    Full Text Available Studies regarding the morphology dependence of the perovskite-type oxides functional materials properties are of recent interest. With this aim, nanorods (NRs and nanocubes (NCs of barium titanate (BaTiO3 have been successfully synthesized via a hydrothermal route at temperature as low as 408 K, employing barium acetate, titanium isopropoxide, and sodium hydroxide as reagents without any surfactant or template. Scanning electron microscopy (SEM, transmission electron microscopy (TEM, and X-ray powder diffraction (XRD, used for the morphology and structure analyses, showed that the NRs were formed by an oriented attachment of the NCs building-blocks with 20 nm average crystallites size. The thermodynamic properties represented by the relative partial molar free energies, enthalpies, and entropies of the oxygen dissolution in the perovskite phase, as well as the equilibrium partial pressure of oxygen, indicated that NRs powders have lower oxygen vacancies concentration than the NCs. This NRs characteristic, together with higher tetragonallity of the structure, leads to the enhancement of the dielectric properties of BaTiO3 ceramics. The results presented in this work show indubitably the importance of the nanopowders morphology on the material properties.

  7. Measurement of the line-of-sight velocity of high-altitude barium clouds A technique

    Science.gov (United States)

    Mende, S. B.; Harris, S. E.

    1982-01-01

    It is demonstrated that for maximizing the scientific output of future ionospheric and magnetospheric ion cloud release experiments a new type of instrument is required which will measure the line-of-sight velocity of the ion cloud by the Doppler technique. A simple instrument was constructed using a 5-cm diam solid Fabry-Perot etalon coupled to a low-light-level integrating TV camera. It was demonstrated that the system has both the sensitivity and spectral resolution for detection of ion clouds and measurement of their line-of-sight Doppler velocity. The tests consisted of (1) a field experiment using a rocket barium cloud release to check sensitivity, and (2) laboratory experiments to show the spectral resolving capabilities of the system. The instrument was found to be operational if the source was brighter than approximately 1 kR, and it had a wavelength resolution much better than 0.2 A, which corresponds to approximately 12 km/sec or in the case of barium ion an acceleration potential of 100 V. The instrument is rugged and, therefore, simple to use in field experiments or on flight instruments. The sensitivity limit of the instrument can be increased by increasing the size of the etalon.

  8. 青海共和盆地土壤风蚀的137Cs法研究(Ⅰ)--137Cs分布特征%Application of Caesium-137 Technique on Wind Erosion in Gonghe Basin, Qinghai Province (Ⅰ)-137Cs Distribution Characteristics

    Institute of Scientific and Technical Information of China (English)

    严平; 董光荣; 张信宝; 邹学勇

    2003-01-01

    土壤风蚀作为土地沙漠化的首要环节,对其准确测定和评估是十分迫切和必要的.放射性核素137Cs作为人类核试验的产物,以其独特的理化性质而成为研究土壤侵蚀和泥沙沉积一种良好的示踪源.137Cs法在水蚀研究领域已取得了显著的进展,而在风蚀研究中的应用却相对不足,目前尚处于探索阶段.作者选择青海共和盆地作为研究区,探讨137Cs法在土壤风蚀研究中应用的可行性.通过对共和盆地不同类型土壤剖面的137Cs取样分析,基本查清了区域137Cs分布的若干特性,测定出不同类型土地137Cs活度的排序为:林地>干湖盆>高寒草原>旱作农田≈干草原>固定沙丘>荒漠草原>流动沙丘>风蚀地,137Cs总量的排序为:干湖盆>林地>流动沙丘>高寒草原>旱作农田≈干草原>固定沙丘>荒漠草原>风蚀地.并分析了一些典型剖面的137Cs深度分布及其机制,将137Cs深度剖面划分为正常剖面、沉积剖面、侵蚀剖面和人为扰动剖面4种型式.沙丘砂由于遭受反复吹失和沉积,其137Cs含量逐渐减小,趋于微量的均匀化;而高寒草原的137Cs含量在区域上也较为均匀,在深度分布上,接近负指数分布曲线保存了相对完好的137Cs初始沉积剖面,是理想的137Cs背景值样点.

  9. Spallation reaction study for fission products in nuclear waste: Cross section measurements for 137Cs and 90Sr on proton and deuteron

    Science.gov (United States)

    Wang, H.; Otsu, H.; Sakurai, H.; Ahn, D. S.; Aikawa, M.; Doornenbal, P.; Fukuda, N.; Isobe, T.; Kawakami, S.; Koyama, S.; Kubo, T.; Kubono, S.; Lorusso, G.; Maeda, Y.; Makinaga, A.; Momiyama, S.; Nakano, K.; Niikura, M.; Shiga, Y.; Söderström, P.-A.; Suzuki, H.; Takeda, H.; Takeuchi, S.; Taniuchi, R.; Watanabe, Ya.; Watanabe, Yu.; Yamasaki, H.; Yoshida, K.

    2016-03-01

    We have studied spallation reactions for the fission products 137Cs and 90Sr for the purpose of nuclear waste transmutation. The spallation cross sections on the proton and deuteron were obtained in inverse kinematics for the first time using secondary beams of 137Cs and 90Sr at 185 MeV/nucleon at the RIKEN Radioactive Isotope Beam Factory. The target dependence has been investigated systematically, and the cross-section differences between the proton and deuteron are found to be larger for lighter spallation products. The experimental data are compared with the PHITS calculation, which includes cascade and evaporation processes. Our results suggest that both proton- and deuteron-induced spallation reactions are promising mechanisms for the transmutation of radioactive fission products.

  10. Studies on dosimetric tests applying source irradiation force of Cs-137 for using in chambers for calibration and TLD type dosimeters

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro, Laila Lorena X. [Pontificia Univ. Catolica de Goias (PUC-GO), Goiania, GO (Brazil). Dept. de Matematica, Fisica, Quimica e Engenharia de Alimentos; Barbosa, Rugles Cesar, E-mail: rbarbosa@cnen.gov.br [Centro Regional de Ciencias Nucleares do Centro Oeste (CRCN-CO/CNEN-GO), Abadia de Goias, GO (Brazil). Laboratorio de Radioprotecao; Correa, Rosangela S., E-mail: rcorrea@cnen.gov.br [Centro Regional de Ciencias Nucleares do Centro Oeste (CRCN-CO/CNEN-GO), Abadia de Goias, GO (Brazil). Laboratorio de Imagens e Dosimetria

    2011-07-01

    The West Central region of Brazil does not have a basic infrastructure for research, development, training programs, and personnel dosimetry education. All of them applied to environmental, industrial and medical uses. Service deployment for irradiance of TLD, via {sup 137}Cs irradiator J. L. SHEPHERD model 28-8A (444 activity GBq) in CRCN-CO, it is necessary to introduce procedures for calibration of the radiator and other procedures related to dosimetry and calibration. Such procedures should be repeated periodically, as necessary to introduce techniques that make the service of the CRCN-CO a template, and that meet all standards requirements for radioprotection and operation of dosimetry and calibration. The objective of this work was to evaluate the radiation field of Cs-137, and the automatic system which systematizes the calibration procedures attached to a system control target for the radiator/calibration of monitors, and portable dosimeters. (author)

  11. Spallation reaction study for fission products in nuclear waste: Cross section measurements for 137Cs and 90Sr on proton and deuteron

    Directory of Open Access Journals (Sweden)

    H. Wang

    2016-03-01

    Full Text Available We have studied spallation reactions for the fission products 137Cs and 90Sr for the purpose of nuclear waste transmutation. The spallation cross sections on the proton and deuteron were obtained in inverse kinematics for the first time using secondary beams of 137Cs and 90Sr at 185 MeV/nucleon at the RIKEN Radioactive Isotope Beam Factory. The target dependence has been investigated systematically, and the cross-section differences between the proton and deuteron are found to be larger for lighter spallation products. The experimental data are compared with the PHITS calculation, which includes cascade and evaporation processes. Our results suggest that both proton- and deuteron-induced spallation reactions are promising mechanisms for the transmutation of radioactive fission products.

  12. Spallation reaction study for fission products in nuclear waste: Cross section measurements for {sup 137}Cs and {sup 90}Sr on proton and deuteron

    Energy Technology Data Exchange (ETDEWEB)

    Wang, H., E-mail: wanghe@ribf.riken.jp [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Otsu, H.; Sakurai, H.; Ahn, D.S. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Aikawa, M. [Faculty of Science, Hokkaido University, Sapporo 060-0810 (Japan); Doornenbal, P.; Fukuda, N.; Isobe, T. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Kawakami, S. [Department of Applied Physics, University of Miyazaki, Miyazaki 889-2192 (Japan); Koyama, S. [Department of Physics, University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-0033 (Japan); Kubo, T.; Kubono, S.; Lorusso, G. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Maeda, Y. [Department of Applied Physics, University of Miyazaki, Miyazaki 889-2192 (Japan); Makinaga, A. [Graduate School of Medicine, Hokkaido University, North-14, West-5, Kita-ku, Sapporo 060-8648 (Japan); Momiyama, S. [Department of Physics, University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-0033 (Japan); Nakano, K. [Department of Advanced Energy Engineering Science, Kyushu University, Kasuga, Fukuoka 816-8580 (Japan); Niikura, M. [Department of Physics, University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-0033 (Japan); Shiga, Y. [Department of Physics, Rikkyo University, 3-34-1 Nishi-Ikebukuro, Toshima, Tokyo 171-8501 (Japan); RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Söderström, P.-A. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); and others

    2016-03-10

    We have studied spallation reactions for the fission products {sup 137}Cs and {sup 90}Sr for the purpose of nuclear waste transmutation. The spallation cross sections on the proton and deuteron were obtained in inverse kinematics for the first time using secondary beams of {sup 137}Cs and {sup 90}Sr at 185 MeV/nucleon at the RIKEN Radioactive Isotope Beam Factory. The target dependence has been investigated systematically, and the cross-section differences between the proton and deuteron are found to be larger for lighter spallation products. The experimental data are compared with the PHITS calculation, which includes cascade and evaporation processes. Our results suggest that both proton- and deuteron-induced spallation reactions are promising mechanisms for the transmutation of radioactive fission products.

  13. Using 137Cs technique to quantify soil conservation capacities of different ecosystems in Wolong Natural Reserve, southwestern China.

    Science.gov (United States)

    Gao, Jun; Ouyang, ZhiYun

    2007-08-01

    Reliable information about soil conservation capacities of different natural ecosystems is an important reference for the design of targeted erosion and sediment control strategies. The objective of this paper is to quantify the soil conservation capacities of different natural ecosystems that can represent different climatic zones. The (137)Cs technique has been used to estimate soil redistribution rates in different natural ecosystems over the past 40 years in Wolong Nature Reserve. The reserve, transiting from the Chengdu plain to the Qinghai-Tibet plateau, maintains rich ecosystems from subtropical to frigid. The net soil erosion rates of 5 selected ecosystems that represent a warm coniferous-broadleaf-mixed forest, a cold-resistant deciduous taiga forest, a cold-resistant shrub, an evergreen cold-resistant taiga forest, and an alpine meadow are 0.17, 0.16, 0.13, 0.11 and 0.06 kg x m(-2) x a(-1), respectively. Their soil conservation capacities are reversed in order. The reference inventories for (137)Cs in different ecosystems range from 1658 to 3707 Bq x m(-2) with the altitude. Results of this study indicate that any attempt to develop effective erosion and sediment strategies in areas with similar climates should consider natural ecosystem types.

  14. Using 137Cs technique to quantify soil conservation capacities of different ecosystems in Wolong Natural Reserve, southwestern China

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Reliable information about soil conservation capacities of different natural ecosystems is an important reference for the design of targeted erosion and sediment control strategies. The objective of this paper is to quantify the soil conservation capacities of different natural ecosystems that can represent dif-ferent climatic zones. The 137Cs technique has been used to estimate soil redistribution rates in differ-ent natural ecosystems over the past 40 years in Wolong Nature Reserve. The reserve, transiting from the Chengdu plain to the Qinghai-Tibet plateau, maintains rich ecosystems from subtropical to frigid. The net soil erosion rates of 5 selected ecosystems that represent a warm coniferous-broadleaf-mixed forest, a cold-resistant deciduous taiga forest, a cold-resistant shrub, an evergreen cold-resistant taiga forest, and an alpine meadow are 0.17, 0.16, 0.13, 0.11 and 0.06 kg·m-2·a-1, respectively. Their soil con-servation capacities are reversed in order. The reference inventories for 137Cs in different ecosystems range from 1658 to 3707 Bq·m-2 with the altitude. Results of this study indicate that any attempt to de-velop effective erosion and sediment strategies in areas with similar climates should consider natural ecosystem types.

  15. [Effects of natural zeolite-clinoptilollite on processes of removal of Cs-137 from the rat body].

    Science.gov (United States)

    Krasnopërova, A P; Lonin, A Iu

    1999-01-01

    The selectivity of natural and synthetic zeolites to 137Cs in experiments in vitro has been investigated. The influence of natural zeolite-clinoptilolite on the dynamics of withdrawal of 137Cs from rats' organism was estimated.

  16. Grin2A expression under inhibition of miR-17 in poststroke depression rats%卒中后抑郁模型大鼠与miR-137抑制下的Grin2A表达

    Institute of Scientific and Technical Information of China (English)

    杨晓煜; 史齐; 褚秀峰; 张清琴; 张敏; 郑胜哲; 姬颖华; 路平

    2015-01-01

    of miR-137 in the blood and brain of poststroke depression rats and its effect on the behaviors of rats. METHODS:Thirty-six rats were equal y divided into six groups:control, model, agomir-137, agomir-NC, agomir-137+Grin2A and agomir-137+vector groups. Control group had no treatment. Poststroke depression models were established by ligation of middle cerebral artery and chronic mild stimulation in the latter four groups fol owed by receiving an injection of nothing, agomir-137, agomir-NC, LV-CMV-Grin2A or control plasmids into the left lateral ventricle, respectively. RESULTS AND CONCLUSION:We found significantly lower miR-137 levels in the brain and peripheral blood of post-stroke depression rats compared with normal rats. Vertical scores and horizontal scores on the behavior test were significantly higher in the agomir-137 group than the agomir-NC and model groups at 3 weeks after cerebral ischemia;while, sucrose consumption percentage was also higher in the agomir-137 group at the end of 2 weeks after cerebral ischemia. Luciferase assays showed miR-137 bound to the 3’ UTR of Grin2A, regulating Grin2A expression in a neuronal cel line. Grin2A gene overexpression in the brain of post-stroke depression rats noticeably suppressed the inhibitory effect of miR-137 on post-stroke depression. Overal , these findings show that miR-137 suppresses Grin2A protein expression through binding to Grin2A mRNA, thereby exerting an inhibitory effect on post-stroke depression and offering a new therapeutic target for poststroke depression.

  17. Role of intensive milling in the processing of barium ferrite/magnetite/iron hybrid magnetic nano-composites via partial reduction of barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Molaei, M.J., E-mail: mj.molaee@merc.ac.ir [Materials and Energy Research Center, P.O. Box: 31787-316, Karaj (Iran, Islamic Republic of); Delft Chem Tech, Faculty of Applied Sciences, Delft University of Technology, Julianalaan 136, 2628 BL Delft (Netherlands); Ataie, A.; Raygan, S. [School of Metallurgy and Materials Engineering, College of Engineering, University of Tehran, P.O. Box: 14395-553, Tehran (Iran, Islamic Republic of); Picken, S.J. [Delft Chem Tech, Faculty of Applied Sciences, Delft University of Technology, Julianalaan 136, 2628 BL Delft (Netherlands)

    2015-03-15

    In this research a mixture of barium ferrite and graphite was milled for different periods of time and then heat treated at different temperatures. The effects of milling time and heat treatment temperature on the phase composition, thermal behavior, morphology and magnetic properties of the samples have been investigated using X-ray diffraction, differential thermal analysis, high resolution transmission electron microscopy and vibrating sample magnetometer techniques, respectively. X-ray diffraction results revealed that BaFe{sub 12}O{sub 19}/Fe{sub 3}O{sub 4} nanocomposites form after a 20 h milling due to the partial reduction of BaFe{sub 12}O{sub 19}. High resolution transmission electron microscope images of a 40 h milled sample showed agglomerated structure consisting of nanoparticles with a mean particle size of 30 nm. Thermal analysis of the samples via differential thermal analysis indicated that for un-milled samples, heat treatment up to 900 °C did not result in α-Fe formation, while for a 20 h milled sample heat treatment at 700 °C resulted in reduction process progress to the formation of α-Fe. Wustite was disappeared in an X-ray diffraction pattern of a heat treated sample at 850 °C, by increasing the milling time from 20 to 40 h. By increasing the milling time, the structure of heat treated samples becomes magnetically softer due to an increase in saturation magnetization and a decrease in coercivity. Saturation magnetization and coercivity of a sample milled for 20 h and heat treated at 850 °C were 126.3 emu/g and 149.5 Oe which by increasing the milling time to 40 h, alter to 169.1 emu/g and 24.3 Oe, respectively. High coercivity values of milled and heat treated samples were attributed to the nano-scale formed iron particles. - Graphical abstract: Display Omitted - Highlights: • Barium ferrite and graphite were treated mechano-thermally. • Increasing milling time increases reduction progress after heat treatment. • Composites

  18. Lake sediments as a long-term secondary source of {sup 137}Cs in Swedish fish; Seesedimente als langfristige Sekundaerquelle von {sup 137}Cs in schwedischen Fischen

    Energy Technology Data Exchange (ETDEWEB)

    Meili, M. [Uppsala Univ. (Sweden). Inst. of Earth Sciences; Konitzer, K. [Uppsala Univ. (Sweden). Inst. of Earth Sciences; Braf, L. [Uppsala Univ. (Sweden). Dept. of Limnology; Baines, S.B. [McGill Univ., Montreal, PQ (Canada). Limnological Research Centre; Andersson, T. [Umeaa Univ. (Sweden). Dept. of Physical Geography

    1993-12-31

    Thousands of Swedish lakes were heavily affected by the radioactive fallout from the Chernobyl nuclear accident in 1986. The initially high concentrations of {sup 137}Cs in small fish have declined since 1987, but this decline has slowed down since 1989. The recovery of the lakes is probably delayed by substantial mixing and resuspension of bottom sediments, which usually contain >90% of a lake`s {sup 137}Cs. Primarily in shallow near-shore sediments, mixing processes carry buried contaminated particles back to the surface, where they are frequently resuspended. Subsequently, they are distributed in the whole water mass and settle at random. This has resulted in a pronounced focusing of {sup 137}Cs towards deeper lake areas. The significance of resuspension is supported by comparisons of {sup 137}Cs concentrations in vertical sediment profiles, in surficial sediments, and in settling matter. Resuspended a well as deposited particles are taken up by planktonic or benthic invertebrates transferring {sup 137}Cs to the fish community. The observed slow burial of contaminated particles thus suggests that the effects of the Chernobyl accident will remain a major problem in Swedish lakes for several decades. (orig.)

  19. 借助137Cs估算滇池沉积量%Sediment accumulation of Dianchi Lake determined by 137Cs dating

    Institute of Scientific and Technical Information of China (English)

    张燕; 高翔; 钟振宇; 陈捷; 彭补拙

    2009-01-01

    The water quality of Dianchi Lake declines quickly and the eutrophication is getting serious. To identify the internal pollution load of Dianchi Lake it is necessary to evaluate its sediment accumulation. Sedimentation rates of Dianchi Lake are determined by 137Cs dating. However, 137Cs vertical distribution in sediment cores of Dianchi Lake has special character-istics because Dianchi Lake is located on the southeast of the Qinghai-Tibet Plateau, the Kunming quasi-stationary front is over the borders of Yunnan and Guizhou where the specific precipitation is distributed. Besides 1954, 1963 and 1986 137Cs marks can be determined in sediment cores, a 137Cs mark of 1976 representing the major period of 137Cs released from China unclear test can be determined and used for an auxiliary dating mark. Meanwhile Di-anchi Lake is divided into seven sections based on the water depth, basin topography, hy-drological features and supplies of silt and the lakebed area of each section is calculated. The mean annual sedimentation rates for seven sections are 0.0810, 0.1352, 0.1457, 0.1333, 0.0904, 0.1267 and 0.1023 g/cm2 a in 1963-2003, respectively. The gross sediment accu-mulation of the lake is 26.18×104 t/a in recent 17 years and 39.86×104 t/a in recent 50 years.

  20. Estimation of radioactive 137-cesium transportation by litterfall, stemflow and throughfall in the forests of Fukushima.

    Science.gov (United States)

    Endo, Izuki; Ohte, Nobuhito; Iseda, Kohei; Tanoi, Keitaro; Hirose, Atsushi; Kobayashi, Natsuko I; Murakami, Masashi; Tokuchi, Naoko; Ohashi, Mizue

    2015-11-01

    Since the Fukushima Dai-ichi Nuclear Power Plant accident in March 2011, large areas of the forests around Fukushima have become highly contaminated by radioactive nuclides. To predict the future dynamics of radioactive cesium ((137)Cs) in the forest catchment, it is important to measure each component of its movement within the forest. Two years after the accident, we estimated the annual transportation of (137)Cs from the forest canopy to the floor by litterfall, throughfall and stemflow. Seasonal variations in (137)Cs transportation and differences between forests types were also determined. The total amount of (137)Cs transported from the canopy to the floor in two deciduous and cedar plantation forests ranged between 3.9 and 11.0 kBq m(-2) year(-1). We also observed that (137)Cs transportation with litterfall increased in the defoliation period, simply because of the increased amount of litterfall. (137)Cs transportation with throughfall and stemflow increased in the rainy season, and (137)Cs flux by litterfall was higher in cedar plantation compared with that of mixed deciduous forest, while the opposite result was obtained for stemflow.

  1. {sup 137}Cs inventory in sedimentary columns from continental shelf of Sao Paulo state

    Energy Technology Data Exchange (ETDEWEB)

    Figueira, Rubens C.L.; Cordero, Luisa M.; Mahiques, Michel M. de; Tessler, Moyses G., E-mail: rfigueira@usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Inst. Oceanografico. Dept. de Oceanografia Fisica, Quimica e Geologica; Cruz, Jacson L.S. [Universidade Cruzeiro do Sul, Sao Paulo, SP (Brazil)

    2009-07-01

    {sup 137}Cs is an artificial radioactive isotope produced by {sup 235}U fission. This radionuclide has a high fission yield and a half-life of 30 years. It has been detected in the environment since 1945 and its principal contamination source has been nuclear tests in the atmosphere. There are other sources of {sup 137}Cs contamination in the environment, such as: release from nuclear and reprocessing plants, radioactive dumping and nuclear accidents (Chernobyl, for example). This paper presents an inventory of {sup 137}Cs on the Continental Shelf of Sao Paulo State, a region located between Cabo de Santa Marta Grande (Santa Catarina state) and Cabo Frio (Rio de Janeiro state). In this area, 9 cores were collected by the Instituto Oceanografico da Universidade de Sao Paulo (Sao Paulo University Institute of Oceanography). The cores were sliced at every 2 cm; sub-samples were lyophilized, grinded and stored in plastic containers. {sup 137}Cs was determined by 661 keV photopeak using a gamma spectrometry detector (Ge hyperpure). The analysis was performed by efficiency and background in different counting times. {sup 137}Cs concentration activities varied from 0.3 to 3.6 Bq kg{sup -1} with a mean value of 1.2+-0.6 Bq kg{sup -1}. The inventory of {sup 137}Cs in this area was 13+-7 Bq m-2. Values obtained are in agreement with the Southern Hemisphere, a region contaminated by atmospheric fallout due to past nuclear explosions. (author)

  2. Computational modeling of 137Cs contaminant transfer associated with sediment transport in Abukuma River.

    Science.gov (United States)

    Iwasaki, T; Nabi, M; Shimizu, Y; Kimura, I

    2015-01-01

    A numerical model capable of simulating the transfer of (137)Cs in rivers associated with transport of fine sediment is presented. The accident at Fukushima Dai-ichi Nuclear Power Plant (FDNPP) released radionuclides into the atmosphere, and after fallout several radionuclides in them, such as radiocesium ((134)Cs, (137)Cs) and radioiodine ((131)I) were adsorbed on surface soil particles around FDNPP and transported by surface water. To understand the transport and deposition of the radioactive contaminant along with surface soil particles and its flux to the ocean, we modeled the transport of the (137)Cs contaminant by computing the water flow and the associated washload and suspended load transport. We have developed a two-dimensional model to simulate the plane flow structure, sediment transport and associated (137)Cs contaminant transport in rivers by combining a shallow water flow model and an advection-diffusion equation for the transport of sediment. The proposed model has been applied to the lower reach of Abukuma River, which is the main river in the highly contaminated area around FDNPP. The numerical results indicate that most (137)Cs supplied from the upstream river reach with washload would directly reach to Pacific Ocean. In contrast, washload-oriented (137)Cs supplied from the upstream river basin has a limited role in the radioactive contamination in the river. The results also suggest that the proposed framework of computational model can be a potential tool for understanding the sediment-oriented (137)Cs behavior in rivers.

  3. Efficacy of Barium-Based Fecal Tagging for CT Colonography: a Comparison between the Use of High and Low Density Barium Suspensions in a Korean Population - a Preliminary Study

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Min Ju; Park, Seong Ho; Lee, Seung Soo; Byeon, Jeong Sik; Kim, Jung Hoon; Kim, Yeoung Nam; Kim, Ah Young; Ha, Hyun Kwon [University of Ulsan College of Medicine, Asan Medical Center, Seoul (Korea, Republic of); Choi, Eugene K. [University of California Los Angeles, Los Angeles (United States)

    2009-02-15

    This preliminarily study was designed to determine and to compare the efficacy of two commercially available barium-based fecal tagging agents for CT colonography (CTC) (high-density [40% w/v] and low-density [4.6% w/v] barium suspensions) in a population in Korea. In a population with an identified with an average-risk for colorectal cancer, 15 adults were administered three doses of 20 ml 40% w/v barium for fecal tagging (group I) and 15 adults were administered three doses of 200 ml 4.6% w/v barium (group II) for fecal tagging. Excluding five patients in group I and one patient in group II that left the study, ten patients in group I and 14 patients in group II were finally included in the analysis. Two experienced readers evaluated the CTC images in consensus regarding the degree of tagging of stool pieces 6 mm or larger. Stool pieces were confirmed with the use of standardized CTC criteria or the absence of matched lesions as seen on colonoscopy. The rates of complete fecal tagging were analyzed on a per-lesion and a per-segment basis and were compared between the patients in the two groups. Per-lesion rates of complete fecal tagging were 52% (22 of 42; 95% CI, 37.7-66.6%) in group I and 78% (28 of 36; 95% CI, 61.7-88.5%) in group II. The difference between the two groups did not reach statistical significance (p = 0.285). The per-segment rates of complete tagging were 33% (6 of 18; 95% CI, 16.1%-56.4%) in group I and 60% (9 of 15; 95% CI, 35.7%-80.3%) in group II; again, the difference between the two groups did not reach statistical significance (p = 0.171). Barium-based fecal tagging using both the 40% w/v and the 4.6% w/v barium suspensions showed moderate tagging efficacy. The preliminary comparison did not demonstrate a statistically significant difference in the tagging efficacy between the use of the two tagging agents, despite the tendency toward better tagging with the use of the 4.6% w/v barium suspension.

  4. Determination of free barium in barium sulphate by atomic absorption spectrometry%火焰原子吸收光谱法测定硫酸钡中的游离钡

    Institute of Scientific and Technical Information of China (English)

    张博丽

    2012-01-01

    关于硫酸钡中游离钡的含量,国标中没有规定分析方法,随着硫酸钡用途的增加,游离钡的含量已成为硫酸钡产品中一个重要的杂质指标.提出了用火焰原子吸收分光光度法分析硫酸钡中的游离钡,并对溶解试样过程中酸度的控制、燃气的流量控制、助燃气的选择等影响因素进行了讨论.在波长553.6 nm、氧化亚氮作助燃气的条件下进行实验,计算得到的相对标准偏差为1.6%~3.5%,加标回收率为99.13%~ 100.07%,灵敏度为0.2,钡的检出限为0.2 mg/L,该方法具有低干扰性和高准确性的特点,测定结果令人满意,能够满足工业化生产要求.%There isn't analysis method for free barium of barium sulphate in national standards.With the increasing use of barium sulfate.free barium content has become one of the important impurity indexes of barium sulphate product.Free barium was analyzed by flame atomic absorption spectrometry (AAS).The influencing factors,such as the acidity when sample was dissolved, the gas flow, and selection of combustion-supporting gas, in experiment were discussed.The experiment was carried out under the conditions of the wavelength of 553.6 nm and with nitrous oxide as combustion-supporting gas.Through calculation relative standard deviation was at 1.6%~3.5% .standard sample recovery rates was at 99.13%~100.07% , sensitivity was 0.2,and barium detect limit was 0.2 mg/L.The deter-mination by AAS had the features of low interference and high accuracy.The experimental results were quite satisfactory and this method could meet the industrialized production requirements.

  5. Long-term transport and dispersion of 137Cs released into ocean off Fukushima nuclear accident

    Science.gov (United States)

    Zhao, Chang; Qiao, Fangli; Wang, Guansuo; Xia, Changshui; Jung, KyungTae

    2014-05-01

    In the following days after the Fukushima nuclear accident which happened in 11th March 2011, significant amounts of radioactive materials (131I, 134Cs and 137Cs) had been leaking into the terrestrial and marine environments. The radionuclides model was used to study the distribution of the 137Cs in the Pacific and the Indian Ocean released from the Fukushima accident. The simulation on the distribution of 137Cs agrees well with the the observed profiles in the 9th November 2011, which proved the validaty of the model. In the first year of our model run, the 137Cs is carried eastward by the Kuroshio and its extension, spreading southward and northword meanwhile. Four or five years after the accident, the 137Cs reaches the US coast with the surface waters of the Pacific Ocean; its concentration is no higher than 3 Bq/m3. Ten years after the accident, all the North Pacific Ocean is labeled with the 137Cs from the Fukushima. The concentration is less than 1 Bq/m3 at that time. Thirty years after the accident, the concentration of 137Cs in both the Pacific and the Indian Ocean is below 0.1 Bq/m3. Since the spreading path of 137Cs from the Fukushima nuclear accident is just the migration route of the Pacific tuna, a kind of fish inhabit the western and eastern North Pacific, it may cause radioactive contamination to the fish. In the offshore seas of China, the 137Cs from Fukushima nuclear accident is very low (<0.2 Bq/m3) .

  6. 42 CFR 137.68 - May funds from a statutorily mandated grant added to a funding agreement be reallocated?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false May funds from a statutorily mandated grant added to a funding agreement be reallocated? 137.68 Section 137.68 Public Health PUBLIC HEALTH SERVICE... SELF-GOVERNANCE Statutorily Mandated Grants § 137.68 May funds from a statutorily mandated grant...

  7. 42 CFR 137.16 - What if more than 50 Indian Tribes apply to participate in self-governance?

    Science.gov (United States)

    2010-10-01

    ... participate in self-governance? 137.16 Section 137.16 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF...-GOVERNANCE Selection of Indian Tribes for Participation in Self-Governance § 137.16 What if more than 50 Indian Tribes apply to participate in self-governance? The first Indian Tribes who apply and...

  8. 42 CFR 137.299 - Are Federal funds available to cover the cost of Self-Governance Tribes carrying out...

    Science.gov (United States)

    2010-10-01

    ... Self-Governance Tribes carrying out environmental responsibilities? 137.299 Section 137.299 Public... OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Construction Nepa Process § 137.299 Are Federal funds available to cover the cost of Self-Governance Tribes carrying out environmental...

  9. CT colonography: optimisation, diagnostic performance and patient acceptability of reduced-laxative regimens using barium-based faecal tagging

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, Stuart A. [University College Hospital, Department of Specialist Radiology, London (United Kingdom); University College Hospital, Department of Imaging, London (United Kingdom); Slater, Andrew [John Radcliffe Hospital, Oxford (United Kingdom); Burling, David N.; Tam, Emily; Gartner, Louise; Scarth, Julia; Bassett, Paul [St Mark' s Hospital, Northwick Park (United Kingdom); Greenhalgh, Rebecca; Pearce, Robert; Halligan, Steve [University College Hospital, Department of Specialist Radiology, London (United Kingdom)

    2008-01-15

    To establish the optimum barium-based reduced-laxative tagging regimen prior to CT colonography (CTC). Ninety-five subjects underwent reduced-laxative (13 g senna/18 g magnesium citrate) CTC prior to same-day colonoscopy and were randomised to one of four tagging regimens using 20 ml 40%w/v barium sulphate: regimen A: four doses, B: three doses, C: three doses plus 220 ml 2.1% barium sulphate, or D: three doses plus 15 ml diatriazoate megluamine. Patient experience was assessed immediately after CTC and 1 week later. Two radiologists graded residual stool (1: none/scattered to 4: >50% circumference) and tagging efficacy for stool (1: untagged to 5: 100% tagged) and fluid (1: untagged, 2: layered, 3: tagged), noting the HU of tagged fluid. Preparation was good (76-94% segments graded 1), although best for regimen D (P = 0.02). Across all regimens, stool tagging quality was high (mean 3.7-4.5) and not significantly different among regimens. The HU of layered tagged fluid was higher for regimens C/D than A/B (P = 0.002). Detection of cancer (n = 2), polyps {>=}6 mm (n = 21), and {<=}5 mm (n = 72) was 100, 81 and 32% respectively, with only four false positives {>=}6 mm. Reduced preparation was tolerated better than full endoscopic preparation by 61%. Reduced-laxative CTC with three doses of 20 ml 40% barium sulphate is as effective as more complex regimens, retaining adequate diagnostic accuracy. (orig.)

  10. Removal efficiency of water purifier and adsorbent for iodine, cesium, strontium, barium and zirconium in drinking water.

    Science.gov (United States)

    Sato, Itaru; Kudo, Hiroaki; Tsuda, Shuji

    2011-01-01

    The severe incident of Fukushima Daiichi Nuclear Power Station has caused radioactive contamination of environment including drinking water. Radioactive iodine, cesium, strontium, barium and zirconium are hazardous fission products because of the high yield and/or relatively long half-life. In the present study, 4 pot-type water purifiers and several adsorbents were examined for the removal effects on these elements from drinking water. Iodide, iodate, cesium and barium were removed by all water purifiers with efficiencies about 85%, 40%, 75-90% and higher than 85%, respectively. These efficiencies lasted for 200 l, which is near the recommended limits for use of filter cartridges, without decay. Strontium was removed with initial efficiencies from 70% to 100%, but the efficiencies were slightly decreased by use. Zirconium was removed by two models, but hardly removed by the other models. Synthetic zeolite A4 efficiently removed cesium, strontium and barium, but had no effect on iodine and zirconium. Natural zeolite, mordenite, removed cesium with an efficiency as high as zeolite A4, but the removal efficiencies for strontium and barium were far less than those of zeolite A4. Activated carbon had little removal effects on these elements. In case of radioactive contamination of tap water, water purifiers may be available for convenient decontamination of drinking water in the home.

  11. Introducing Barium in Transition Metal Oxide Frameworks: Impact upon Superconductivity, Magnetism, Multiferroism and Oxygen Diffusion and Storage.

    Science.gov (United States)

    Raveau, Bernard

    2016-11-25

    The role of barium in the structural chemistry of some transition metal oxides of the series "Cu, Mn, Fe,Co" is reviewed, based on its size effect and its particular chemical bonding. Its impact upon various properties, superconductivity, magnetism, multiferroism, oxygen storage is emphasized.

  12. A one-dimensional barium(II) coordination polymer with a coordinated nitro group of 2-nitrobenzoate

    Indian Academy of Sciences (India)

    Bikshandarkoil R Srinivasan; Santosh Y Shetgaonkar; Pallepogu Raghavaiah

    2008-03-01

    The aqueous reaction of barium carbonate with 2-nitrobenzoic acid (2-nbaH) results in the formation of a one-dimensional coordination polymer, catena-poly[[hexa(aqua)dibarium(II)]bis[(2-2-nitrobenzoate-O,O,O-NO2)(2-2-nitrobenzoate-O,O,O')

  13. Experimental investigation of the effect of titanium dioxide and barium titanate additives on DC transient currents in low density polyethylene

    DEFF Research Database (Denmark)

    Khalil, M.S; Henk, Peter O; Henriksen, Mogens

    1988-01-01

    The effect of titanium dioxide as a semiconductive additive and barium titanate as a highly polar additive on the DC transient currents in low-density polyethylene is investigated. Experiments were made using thick specimens under a high electric field (>25×106 V/m) and a constant temperature of 40...

  14. The effect of timing of intravenous muscle relaxant on the quality of double-contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Elson, E.M.; Campbell, D.M.; Halligan, S.; Shaikh, I.; Davitt, S.; Bartram, C.I

    2000-05-01

    AIM: To determine whether the timing of buscopan administration during double-contrast barium enema examination (DCBE) affects diagnostic quality. MATERIALS AND METHODS: In a prospective setting, 100 consecutive adult out-patients referred for DCBE received 20 mg buscopan (hyoscine-N-butylbromide) intravenously, either before infusion of barium suspension (Group A) or after barium infusion and gas insufflation (Group B). A subjective assessment of ease of contrast medium infusion was made at the time of examination and the films subsequently analysed by two radiologists unaware of the mode of relaxant administration, who noted the quality of mucosal coating and made subjective and objective measurements of segmental distension. RESULTS: There was no significant difference in screening times, infusion difficulty or colonic contrast medium coating between the two groups. Subjective assessment of distension of the caecum, ascending colon, transverse colon and rectum were not significantly different. Patients receiving intravenous relaxant after barium and gas infusion had less subjective descending (P = 0.05) and sigmoid (P = 0.04) colon distension, but there was no significant difference with respect to maximal bowel diameter in any of the segments measured. CONCLUSION: The timing of intravenous administration during DCBE is likely to have no significant effect on the diagnostic quality of the study. Elson, E.M. (2000)

  15. /sup 137/Cs and /sup 40/K levels in marine species caught in Malaysian waters

    Energy Technology Data Exchange (ETDEWEB)

    Dougherty, G.; Ng, C.E. (Universiti Sains Malaysia, Penang (Malaysia). School of Physics)

    1982-12-01

    Activity levels of /sup 137/Cs and /sup 40/K in a variety of marine species caught in the Indian Ocean and S. China Seas, between Jan. 1980 - Sept. 1981, have been monitored, using gamma spectroscopy. Samples were dried to constant weight, powdered, and a constant volume used for gamma spectroscopy. Radioactivity levels and concentration factors for /sup 40/K and /sup 137/Cs are presented. /sup 137/Cs concentration factors are found to vary greatly between species caught in the same area, possibly due to different feeding patterns and levels.

  16. Atmospheric deposition of {sup 137}Cs between 1994 and 2002 at Cienfuegos, Cuba

    Energy Technology Data Exchange (ETDEWEB)

    Alonso-Hernandez, C.M. [Centro de Estudios Ambientales de Cienfuegos, AP 5. Ciudad Nuclear, Cienfuegos (Cuba)]. E-mail: carlos@ceac.perla.inf.cu; Cartas-Aguila, H. [Centro de Estudios Ambientales de Cienfuegos, AP 5. Ciudad Nuclear, Cienfuegos (Cuba); Diaz-Asencio, M. [Centro de Estudios Ambientales de Cienfuegos, AP 5. Ciudad Nuclear, Cienfuegos (Cuba); Munoz-Caravaca, A. [Centro de Estudios Ambientales de Cienfuegos, AP 5. Ciudad Nuclear, Cienfuegos (Cuba); Martin-Perez, J. [Centro de Estudios Ambientales de Cienfuegos, AP 5. Ciudad Nuclear, Cienfuegos (Cuba); Sibello-Hernandez, R. [Centro de Estudios Ambientales de Cienfuegos, AP 5. Ciudad Nuclear, Cienfuegos (Cuba)

    2006-07-01

    Levels of {sup 137}Cs in total atmospheric deposition have been measured in the Cienfuegos region (Cuba) between 1994 and 2002. Samples were collected every three months, evaporated to dryness to obtain residual samples, and measured by gamma spectrometry. The {sup 137}Cs mean concentration in total deposition was 0.24 Bq m{sup -2} and data ranged between <0.05 and 0.62 Bq m{sup -2}. Precipitation rates and raintime have proved to be the most important factors controlling the concentration and depositional flux of {sup 137}Cs in the atmosphere over Cienfuegos, showing a high correlation coefficient (R = 0.93)

  17. Monte Carlo estimation of radiation doses during paediatric barium meal and cystourethrography examinations

    Energy Technology Data Exchange (ETDEWEB)

    Dimitriadis, A; Gialousis, G; Karlatira, M; Karaiskos, P; Georgiou, E; Yakoumakis, E [Medical Physics Department, Medical School, University of Athens, 75 Mikras Asias Str., Goudi 11527, Athens (Greece); Makri, T; Papaodysseas, S, E-mail: anestisdim@yahoo.com [Radiological Imaging Department, Ag. Sofia Hospital, Lebadias and Thibon, Goudi 11527, Athens (Greece)

    2011-01-21

    Organ doses are important quantities in assessing the radiation risk. In the case of children, estimation of this risk is of particular concern due to their significant radiosensitivity and the greater health detriment. The purpose of this study is to estimate the organ doses to paediatric patients undergoing barium meal and micturating cystourethrography examinations by clinical measurements and Monte Carlo simulation. In clinical measurements, dose-area products (DAPs) were assessed during examination of 50 patients undergoing barium meal and 90 patients undergoing cystourethrography examinations, separated equally within three age categories: namely newborn, 1 year and 5 years old. Monte Carlo simulation of photon transport in male and female mathematical phantoms was applied using the MCNP5 code in order to estimate the equivalent organ doses. Regarding the micturating cystourethrography examinations, the organs receiving considerable amounts of radiation doses were the urinary bladder (1.87, 2.43 and 4.7 mSv, the first, second and third value in the parentheses corresponds to neonatal, 1 year old and 5 year old patients, respectively), the large intestines (1.54, 1.8, 3.1 mSv), the small intestines (1.34, 1.56, 2.78 mSv), the stomach (1.46, 1.02, 2.01 mSv) and the gall bladder (1.46, 1.66, 2.18 mSv), depending upon the age of the child. Organs receiving considerable amounts of radiation during barium meal examinations were the stomach (9.81, 9.92, 11.5 mSv), the gall bladder (3.05, 5.74, 7.15 mSv), the rib bones (9.82, 10.1, 11.1 mSv) and the pancreas (5.8, 5.93, 6.65 mSv), depending upon the age of the child. DAPs to organ/effective doses conversion factors were derived for each age and examination in order to be compared with other studies.

  18. The utilization of caesium 137 in studying soil degradation; L`utilisation du cesium 137 pour la connaissance de la degradation des sols

    Energy Technology Data Exchange (ETDEWEB)

    Wicherek, S.; Veyret, Y. [Centre de Biogeographie-Ecologie, 92 - Saint -Cloud (France); Bernard, C. [Ministere de l`Agriculture, des Pecheries et de l`Alimentation, Quebec (Canada)

    1994-12-31

    The caesium 137 isotope is distributed in the atmosphere during nuclear explosions, and is absorbed in the upper horizons of the soil on reaching the ground. When it is incorporated in the fine fraction of the soil, caesium 137 measurement allows movements affecting cultivated lands (mass movements, runoff effects, wind action) and rate of soil degradation over half a century to be evaluated. Vegetal cover and techniques of soil utilization must be considered; this method has been tested on a watershed in the Parisian Basin. 5 figs., 26 refs.

  19. Barium chloride induces redox status unbalance, upregulates cytokine genes expression and confers hepatotoxicity in rats-alleviation by pomegranate peel.

    Science.gov (United States)

    Elwej, Awatef; Grojja, Yousri; Ghorbel, Imen; Boudawara, Ons; Jarraya, Raoudha; Boudawara, Tahia; Zeghal, Najiba

    2016-04-01

    The present study was performed to establish the therapeutic efficacy of pomegranate peel against barium chloride induced liver injury. Adult rats were divided into four groups of six animals each: group I, serving as controls, received distilled water; group II received by their drinking water 67 ppm of BaCl2; group III received both 67 ppm of BaCl2 by the same way than group II and 5 % of pomegranate peel (PP) via diet; group IV received 5 % of PP. Analysis by HPLC/MS of PP showed its rich composition in flavonoids such as gallic acid, castalin, hyperin, quercitrin, syringic acid, and quercetin. The protective effects of pomegranate peel against hepatotoxicity induced by barium chloride were assessed using biochemical parameters and histological studies. Exposure of rats to barium caused oxidative stress in the liver as evidenced by an increase in malondialdehyde (MDA), lipid hydroperoxides (LOOHs), H2O2 and advanced oxidation protein product (AOPP) levels, and lactate dehydrogenase (LDH), gamma glutamyl transpeptidase (GGT), alanine aminotransferase (AST) and aspartate aminotransferase (ALT) activities, a decrease in catalase (CAT) and glutathione peroxidase (GPx) activities, glutathion (GSH), non-protein thiol (NPSH), vitamin C levels, and Mn-SOD gene expression. Liver total MT levels, MT-1, and MT-2 and pro-inflammatory cytokine genes expression like TNF-α, IL-1β and IL-6 were increased. Pomegranate peel, supplemented in the diet of barium-treated rats, showed an improvement of all the parameters indicated above.The present work provided ethnopharmacological relevance of pomegranate peel against the toxic effects of barium, suggesting its beneficial role as a potential antioxidant.

  20. Contamination of terrestrial gastropods Helix aspersa maxima with {sup 137}Cs, {sup 85}Sr, {sup 133}Ba and {sup 123m}Te by direct and trophic pathways

    Energy Technology Data Exchange (ETDEWEB)

    Madoz-Escande, C.; Querrec, N.; Bonhomme, T.; Poncet-Bonnard, D. [CEA Cadarache (DEI/SECRE/LRE), Laboratory of Radioecology and Ecotoxicology, Institute for Radioprotection and Nuclear Safety, 13 - Saint-Paul-lez-Durance (France)

    2004-07-01

    Contaminations of terrestrial gastropod Helix aspersa Maxima by direct deposition or labelled food ingestion of {sup 137}Cs, {sup 85}Sr, {sup 133}Ba and {sup 123m}Te were carried out in laboratory conditions. This study was performed to compare the two pathways of contamination: direct and trophic in terms of individual mortality and, radionuclide uptake, depuration and tissular distribution. A first group of 30 snails (2-year old) was exposed to radioactive aerosols during a twenty-hour period. These aerosols were supposed to be representative of those produced during a nuclear accident occurring on a PWR. A second group of 40 snails (same ages) was submitted to twice-a-week ingestion of food during 10 days (flour at a feeding rate of about 0,2 g) contaminated by these same aerosols. During the 21 days observation period, comparison among the two groups and a reference group (not contaminated by radionuclides) was performed. No significant difference between the three groups was observed neither on the growth nor on the mortality. One day after the deposit, the cesium was the most bioavailable element, distributed homogeneously within the whole body (from 15 to 25% of total Cs respectively in shell and muscle). The strontium accumulated in the shell (about 70%). The barium was found in the muscle (20%) and the shell (65%). Tellurium was mainly present in the shell (70%) and in digestive gland (20%), Later, this element was mostly present in faeces. As regards the contamination by ingestion, it was mainly accumulated in digestive gland. (author)