... series; Colorectal cancer - lower GI series; Colorectal cancer - barium enema; Crohn disease - lower GI series; Crohn disease - barium enema; Intestinal blockage - lower GI series; Intestinal blockage - ...
Dynamical symmetry breaking in barium isotopes
International Nuclear Information System (INIS)
Rawat, Bir Singh; Chattopadhyay, P.K.
1997-01-01
The isotopes of Xe with mass numbers 124, 126, 128, 130 and the isotopes of barium with mass numbers 128, 130, 132, 134 were shown to correspond to the O(6) dynamical symmetry of IBM. In the investigation of the dynamical symmetry breaking in this region, the barium isotopes for departures from O(6) symmetry have been studied
... uses a computer to put together x-ray images to create cross-sectional or three dimensional pictures of the inside of the body). Barium sulfate is in a class of medications called radiopaque contrast media. It works by coating the esophagus, stomach, or ...
Johnson, Craig A.; Piatak, Nadine M.; Miller, M. Michael; Schulz, Klaus J.; DeYoung,, John H.; Seal, Robert R.; Bradley, Dwight C.
2017-12-19
Barite (barium sulfate, BaSO4) is vital to the oil and gas industry because it is a key constituent of the mud used to drill oil and gas wells. Elemental barium is an additive in optical glass, ceramic glazes, and other products. Within the United States, barite is produced mainly from mines in Nevada. Imports in 2011 (the latest year for which complete data were available) accounted for 78 percent of domestic consumption and came mostly from China.Barite deposits can be divided into the following four main types: bedded-sedimentary; bedded-volcanic; vein, cavity-fill, and metasomatic; and residual. Bedded-sedimentary deposits, which are found in sedimentary rocks with characteristics of high biological productivity during sediment accumulation, are the major sources of barite production and account for the majority of reserves, both in the United States and worldwide. In 2013, China and India were the leading producers of barite, and they have large identified resources that position them to be significant producers for the foreseeable future. The potential for undiscovered barite resources in the United States and in many other countries is considerable, however. The expected tight supply and rising costs in the coming years will likely be met by increased production from such countries as Kazakhstan, Mexico, Morocco, and Vietnam.Barium has limited mobility in the environment and exposed barium in the vicinity of barite mines poses minimal risk to human or ecosystem health. Of greater concern is the potential for acidic metal-bearing drainage at sites where the barite ores or waste rocks contain abundant sulfide minerals. This risk is lessened naturally if the host rocks at the site are acid-neutralizing, and the risk can also be lessened by engineering measures.
Blanco, R.E.
1959-07-21
A method of separating barium from nuclear fission products is described. In accordance with the invention, barium may be recovered from an acidic solution of neutron-irradiated fissionable material by carrying ihe barium cut of solution as a sulfate with lead as a carrier and then dissolving the barium-containing precipitate in an aqueous solution of an aliphatic diamine chelating reagent. The barium values together with certain other metallic values present in the diamine solution are then absorbed onto a cation exchange resin and the barium is selectively eluted from the resin bed with concentrated nitric acid.
A barium enema is performed to examine the walls of the colon. During the procedure, a well lubricated enema tube is inserted gently into the rectum. The barium, a radiopaque (shows up on X-ray) contrast ...
Fuentes Santos, Cristina; Steen, Bárbara
2014-01-01
The aspiration of barium contrast is a rare complication that may occur during studies of the digestive tract. Barium is an inert material that can cause anywhere from an asymptomatic mechanical obstruction to serious symptoms of respiratory distress that can result in patient death. We present the case of a 79-year-old male patient in whom we observed the presence of contrast medium residue in the lung parenchyma as an incidental finding during hospitalization. When the patient’s medical fil...
Barium granuloma of the rectum: case report
International Nuclear Information System (INIS)
Kim, Dae Jin; Kim, Se Hyung; Jeoung, Ah Young; Lee, Kyoung Ho; Choi, Byung Ihn; Han, Joon Koo
2003-01-01
Barium granulomas usually occur after barium enema within 8 cm of the anal verge probably due to minute laceration of rectal wall by enema tip and extravasation of barium during barium enema. We report a case of barium granuloma of rectum in a 47-year-old man, who did not have history of barium enema. In rare instance, barium granuloma can occur without a history of barium enema and careful interpretation of radiologic image is essential to make a correct diagnosis
Modeling and minimization of barium sulfate scale
Alan W. Rudie; Peter W. Hart
2006-01-01
The majority of the barium present in the pulping process exits the digester as barium carbonate. Barium carbonate dissolves in the bleach plant when the pH drops below 7 and, if barium and sulfate concentrations are too high, begins to precipitate as barium sulfate. Barium is difficult to control because a mill cannot avoid this carbonate-to-sulfate transition using...
Directory of Open Access Journals (Sweden)
Cristina Fuentes Santos
2014-01-01
Full Text Available The aspiration of barium contrast is a rare complication that may occur during studies of the digestive tract. Barium is an inert material that can cause anywhere from an asymptomatic mechanical obstruction to serious symptoms of respiratory distress that can result in patient death. We present the case of a 79-year-old male patient in whom we observed the presence of contrast medium residue in the lung parenchyma as an incidental finding during hospitalization. When the patient’s medical file was reviewed, images were found of a barium swallow study that the patient had undergone months earlier, and we were able to observe the exact moment of the aspiration of the contrast material. The patient had been asymptomatic since the test.
Observed Barium Emission Rates
Stenbaek-Nielsen, H. C.; Wescott, E. M.; Hallinan, T. J.
1993-01-01
The barium releases from the CRRES satellite have provided an opportunity for verifying theoretically calculated barium ion and neutral emission rates. Spectra of the five Caribbean releases in the summer of 1991 were taken with a spectrograph on board a U.S. Air Force jet aircraft. Because the line of sight release densities are not known, only relative rates could be obtained. The observed relative rates agree well with the theoretically calculated rates and, together with other observations, confirm the earlier detailed theoretical emission rates. The calculated emission rates can thus with good accuracy be used with photometric observations. It has been postulated that charge exchange between neutral barium and oxygen ions represents a significant source for ionization. If so. it should be associated with emissions at 4957.15 A and 5013.00 A, but these emissions were not detected.
Lower GI Series (Barium Enema)
... uses x-rays and a chalky liquid called barium to view your large intestine . The barium will make your large intestine more visible on ... single-contrast lower GI series, which uses only barium a double-contrast or air-contrast lower GI ...
Isotopic exchange reaction between barium ion and tri barium phosphate
International Nuclear Information System (INIS)
Bilgin, G.B.; Cetin, I.
1982-01-01
Heterogeneous exchange reaction of tri barium phosphate in barium chloride solution has been studied using 133 Ba as a tracer. The results show that the exchange fraction increases as barium chloride concentration increases for different mole ratio of the exchange ion on the solid surface and in the solution. The phenomenon was studied with respect to the previous treatment of the precipitate leading to different crystal sizes and the effect of reaction time. (author)
International Nuclear Information System (INIS)
Pinsonneault, M.H.; Sneden, C.
1984-01-01
New high-resolution spectra of the lithium resonance doublet have provided lithium abundances or upper limits for 26 classical and mild barium stars. The lithium lines always are present in the classical barium stars. Lithium abundances in these stars obey a trend with stellar masses consistent with that previously derived for ordinary K giants. This supports the notion that classical barium stars are post-core-He-flash or core-He-burning stars. Lithium contents in the mild barium stars, however, often are much smaller than those of the classical barium stars sometimes only upper limits may be determined. The cause for this difference is not easily understood, but may be related to more extensive mass loss by the mild barium stars. 45 references
Freeze cast porous barium titanate for enhanced piezoelectric energy harvesting
Roscow, J. I.; Zhang, Y.; Kraśny, M. J.; Lewis, R. W. C.; Taylor, J.; Bowen, C. R.
2018-06-01
Energy harvesting is an important developing technology for a new generation of self-powered sensor networks. This paper demonstrates the significant improvement in the piezoelectric energy harvesting performance of barium titanate by forming highly aligned porosity using freeze casting. Firstly, a finite element model demonstrating the effect of pore morphology and angle with respect to poling field on the poling behaviour of porous ferroelectrics was developed. A second model was then developed to understand the influence of microstructure-property relationships on the poling behaviour of porous freeze cast ferroelectric materials and their resultant piezoelectric and energy harvesting properties. To compare with model predictions, porous barium titanate was fabricated using freeze casting to form highly aligned microstructures with excellent longitudinal piezoelectric strain coefficients, d 33. The freeze cast barium titanate with 45 vol.% porosity had a d 33 = 134.5 pC N‑1 compared to d 33 = 144.5 pC N‑1 for dense barium titanate. The d 33 coefficients of the freeze cast materials were also higher than materials with uniformly distributed spherical porosity due to improved poling of the aligned microstructures, as predicted by the models. Both model and experimental data indicated that introducing porosity provides a large reduction in the permittivity () of barium titanate, which leads to a substantial increase in energy harvesting figure of merit, , with a maximum of 3.79 pm2 N‑1 for barium titanate with 45 vol.% porosity, compared to only 1.40 pm2 N‑1 for dense barium titanate. Dense and porous barium titanate materials were then used to harvest energy from a mechanical excitation by rectification and storage of the piezoelectric charge on a capacitor. The porous barium titanate charged the capacitor to a voltage of 234 mV compared to 96 mV for the dense material, indicating a 2.4-fold increase that was similar to that
Barium and radium radiopolarography
International Nuclear Information System (INIS)
Fourest, B.
1979-01-01
Radiopolarography has been applied to the study of two elements (barium and radium) which is difficult by classical polarography because of their strong electropositivity. Various parameters have been considered: nature, concentration and pH of supporting electrolyte. In any case of investigated mediums, the reduction to the metallic state reaction appeared to be reversible. An important variation of the barium half-wave potential E 1/2 with the ionic strength μ of the solution, imposed by LiCl used as supporting electrolyte, has been observed. It gives the possibility to estimate, for μ = 0, E 1/2 (Ba) = - 1.916 V/S.C.E. and E 1/2(Ra) = - 1.852 V/S.C.E. The values of barium and radium half wave potentials, obtained with a good accuracy in LiCl (or LiClO 4 ) 0.1 M medium, have been used to establish the amalgamation energy Δ 2 (M) of these elements. A linear variation of Δ 2 (M) with the metallic radius of the 2a elements has been obtained. On the other hand, by making the concentration of the complex forming agent (Cit 3- ) vary in the solution, we have a shift in the half wave potential from which we can deduce the stability constant of the complexe and its composition (BaCit - ; pK 1 =2). At last, nature and concentration of the supporting electrolyte (between 5.10 -2 M and 5M) have a determining influence on the extent of the polarogram plateau. This plateau is limited by an 'hollow effect' preceding the supporting electrolyte discharge. An interpretation of this effect is suggested which is based on the Stern model [fr
Energy Technology Data Exchange (ETDEWEB)
Nelson, Anna-Gay D., E-mail: nelsoa@umich.edu [Department of Civil Engineering and Geological Sciences and Department of Chemistry and Biochemistry, University of Notre Dame, Notre Dame, IN 46556 (United States); Department of Earth and Environmental Sciences, University of Michigan, Ann Arbor, MI 48109-1005 (United States); Alekseev, Evgeny V. [Institute of Energy and Climate Research (IEK-6), Forschungszentrum Juelich Wilhelm-Johnen-Strasse, Juelich 52428 (Germany); Ewing, Rodney C. [Department of Earth and Environmental Sciences, University of Michigan, Ann Arbor, MI 48109-1005 (United States); Albrecht-Schmitt, Thomas E. [Department of Civil Engineering and Geological Sciences and Department of Chemistry and Biochemistry, University of Notre Dame, Notre Dame, IN 46556 (United States)
2012-08-15
Three Ba{sup 2+}/UO{sub 2}{sup 2+} methylenediphosphonates have been prepared from mild hydrothermal treatment of uranium trioxide, methylendiphosphonic acid (C1P2) with barium hydroxide octahydrate, barium iodate monohydrate, and small aliquots of HF at 200 Degree-Sign C. These compounds, Ba[UO{sub 2}[CH{sub 2}(PO{sub 3}){sub 2}]{center_dot}1.4H{sub 2}O (Ba-1), Ba{sub 3}[(UO{sub 2}){sub 4}(CH{sub 2}(PO{sub 3}){sub 2}){sub 2}F{sub 6}]{center_dot}6H{sub 2}O (Ba-2), and Ba{sub 2}[(UO{sub 2}){sub 2}(CH{sub 2}(PO{sub 3}){sub 2})F{sub 4}]{center_dot}5.75H{sub 2}O (Ba-3) all adopt layered structures based upon linear uranyl groups and disphosphonate molecules. Ba-2 and Ba-3 are similar in that they both have UO{sub 5}F{sub 2} pentagonal bipyramids that are bridged and chelated by the diphosphonate moiety into a two-dimensional zigzag anionic sheet (Ba-2) and a one-dimensional ribbon anionic chain (Ba-3). Ba-1, has a single crystallographically unique uranium metal center where the C1P2 ligand solely bridges to form [UO{sub 2}[CH{sub 2}(PO{sub 3}){sub 2}]{sup 2-} sheets. The interlayer space of the structures is occupied by Ba{sup 2+}, which, along with the fluoride ion, mediates the structure formed and maintains overall charge balance. - Graphical abstract: Illustration of the stacking of the layers in Ba{sub 3}[(UO{sub 2}){sub 4}(CH{sub 2}(PO{sub 3}){sub 2}){sub 2})F{sub 6}]{center_dot}6H{sub 2}O viewed along the c-axis. The structure is constructed from UO{sub 7} pentagonal bipyramidal units, U(1)O{sub 7}=gray, U(2)O{sub 7}=yellow, barium=blue, phosphorus=magenta, fluorine=green, oxygen=red, carbon=black, and hydrogen=light peach. Highlights: Black-Right-Pointing-Pointer The polymerization of the UO{sub 2}{sup 2+} sites to form uranyl dimers leads to structural variations in compounds. Black-Right-Pointing-Pointer Barium cations stitch uranyl diphosphonate anionic layers together, and help mediate structure formation. Black-Right-Pointing-Pointer HF acts as both a
Adam, Fiona H; Noble, Peter J M; Swift, Simon T; Higgins, Brent M; Sieniawska, Christine E
2010-09-01
A 2-year-old 14.9-kg (32.8-lb) neutered female Shetland Sheepdog was admitted to the University of Liverpool Small Animal Teaching Hospital for evaluation of acute collapse. At admission, the dog was tachypneic and had reduced limb reflexes and muscle tone in all limbs consistent with diffuse lower motor neuron dysfunction. The dog was severely hypokalemic (1.7 mEq/L; reference range, 3.5 to 5.8 mEq/L). Clinical status of the dog deteriorated; there was muscle twitching, flaccid paralysis, and respiratory failure, which was considered a result of respiratory muscle weakness. Ventricular arrhythmias and severe acidemia (pH, 7.18; reference range, 7.35 to 7.45) developed. Intoxication was suspected, and plasma and urine samples submitted for barium analysis had barium concentrations comparable with those reported in humans with barium toxicosis. Analysis of barium concentrations in 5 control dogs supported the diagnosis of barium toxicosis in the dog. Fluids and potassium supplementation were administered IV. The dog recovered rapidly. Electrolyte concentrations measured after recovery were consistently unremarkable. Quantification of plasma barium concentration 56 days after the presumed episode of intoxication revealed a large decrease; however, the plasma barium concentration remained elevated, compared with that in control dogs. To our knowledge, this case represented the first description of barium toxicosis in the veterinary literature. Barium toxicosis can cause life-threatening hypokalemia; however, prompt supportive treatment can yield excellent outcomes. Barium toxicosis is a rare but important differential diagnosis in animals with hypokalemia and appropriate clinical signs.
The review of 134 cases colon and rectal carcinoma
Energy Technology Data Exchange (ETDEWEB)
Kim, Chung Kyu; Choi, Byung Sook [Yonsei University College of Medicine, Seoul (Korea, Republic of)
1971-10-15
Barium Enema study for colon examination is of great importance in the health care of our people and its value can be increased by a wide understanding of the attendant difficulties and limitation. Since the incidence of the colon and rectal carcinoma is increasing, the barium enema examination is more valuable. Radiologically diagnosed 134 cases of colon and rectal carcinoma from January 1964 to June 1970 have been reviewed at Yensei Univ., College of Medicine. Among the total admission during these years, the ratio of the colon and rectal carcinoma was 0.29 percent, and the incidence among barium enema examination was 5.3%. The peak age range was between 40 and 50 years. The average age of the patients was 46 years. It was more common in male. The clinical picture was rather vague in some cases, especially in the lesions of right colon. The large number of cases has bowel habit change, tarry or bloody stool and abdominal pain. About 60% of the lesions were located in rectum and 40% was proximal portion from the rectum, which could not be completely diagnosed only by digital examination and proctosigmoidoscopy. On roentgenogram, the most common form was encircling type, next was fungating. The positivity for accuracy of the barium enema examination was 90%. Majority of cancers of the colon, particularly those that produce symptoms are relative gross lesions. In daily practise we have to eager to find out small lesions by repeat and complete barium enema examination, including double contrast study. Early diagnosis is an aid immediate, logical objective in attempts to decrease the morbidity and mortality from carcinoma of colon.
The review of 134 cases colon and rectal carcinoma
International Nuclear Information System (INIS)
Kim, Chung Kyu; Choi, Byung Sook
1971-01-01
Barium Enema study for colon examination is of great importance in the health care of our people and its value can be increased by a wide understanding of the attendant difficulties and limitation. Since the incidence of the colon and rectal carcinoma is increasing, the barium enema examination is more valuable. Radiologically diagnosed 134 cases of colon and rectal carcinoma from January 1964 to June 1970 have been reviewed at Yensei Univ., College of Medicine. Among the total admission during these years, the ratio of the colon and rectal carcinoma was 0.29 percent, and the incidence among barium enema examination was 5.3%. The peak age range was between 40 and 50 years. The average age of the patients was 46 years. It was more common in male. The clinical picture was rather vague in some cases, especially in the lesions of right colon. The large number of cases has bowel habit change, tarry or bloody stool and abdominal pain. About 60% of the lesions were located in rectum and 40% was proximal portion from the rectum, which could not be completely diagnosed only by digital examination and proctosigmoidoscopy. On roentgenogram, the most common form was encircling type, next was fungating. The positivity for accuracy of the barium enema examination was 90%. Majority of cancers of the colon, particularly those that produce symptoms are relative gross lesions. In daily practise we have to eager to find out small lesions by repeat and complete barium enema examination, including double contrast study. Early diagnosis is an aid immediate, logical objective in attempts to decrease the morbidity and mortality from carcinoma of colon
On barium oxide solubility in barium-containing chloride melts
International Nuclear Information System (INIS)
Nikolaeva, Elena V.; Zakiryanova, Irina D.; Bovet, Andrey L.; Korzun, Iraida V.
2016-01-01
Oxide solubility in chloride melts depends on temperature and composition of molten solvent. The solubility of barium oxide in the solvents with barium chloride content is essentially higher than that in molten alkali chlorides. Spectral data demonstrate the existence of oxychloride ionic groupings in such melts. This work presents the results of the BaO solubility in two molten BaCl 2 -NaCl systems with different barium chloride content. The received data together with earlier published results revealed the main regularities of BaO solubility in molten BaO-BaCl 2 -MCl systems.
MR Colonography with fecal tagging: Barium vs. barium ferumoxsil
DEFF Research Database (Denmark)
Achiam, M.P.; Chabanova, E.; Logager, V.B.
2008-01-01
and Methods. Twenty patients referred to CC underwent dark lumen MRC prior to the colonoscopy. Two groups of patients received two different oral contrast agents (barium sulfate and barium sulfate/ferumoxsil) as a laxative-free fecal tagging prior to the MRC. After MRC, the contrast agent was rated...... qualitatively (with the standard method using contrast-to-wall ratio) and subjectively (using a visual analog scale [VAS]) by three different blinded observers. Results. Evaluated both qualitatively and subjectively, the tagging efficiency of barium sulfate/ferumoxsil was significantly better (P ... barium sulfate alone. The VAS method for evaluating the tagging efficiency of contrast agents showed a high correlation (observer 11, r = 0.91) to the standard method using contrast-to-wall ratio and also a high interclass correlation (observer 11 and III = 0.89/0.85). MRC found I of 22 (5%) polyps
Barium aluminate cement: its application
International Nuclear Information System (INIS)
Drozdz, M.; Wolek, W.
1975-01-01
The technology of manufacturing barium aluminate cement from barium sulfate and alumina, using a rotary kiln for firing the clinker is described. The method of granulation of the homogenized charge was used. Conditions of using the ''to mud'' method in industry were indicated. The physical and chemical properties of barium aluminate cement are determined and the quality of several batches of cement prepared on a semi-industrial scale and their suitability for making highly refractory concretes are tested. The optimal composition of the concretes is determined as a function of the mixing water and barium aluminate cement contents. Several experimental batches of concretes were used in the linings of furnaces in the steel industry. The suitability of these cements for use in fields other than steelmaking is examined. It is established that calcium aluminate cement has certain limited applications [fr
Statistical properties of barium stars
International Nuclear Information System (INIS)
Hakkila, J.E.
1986-01-01
Barium stars are G- and K-giant stars with atmospheric excesses of s-process elements, and a broadband spectral depression in the blue portion of the spectrum. The strength of the λ4554 Ball line is used as a classification parameter known as the Barium Intensity. They have a mean absolute magnitude of 1.0 and a dispersion of 1.2 magnitudes (assuming a Gaussian distribution in absolute magnitude) as measured from secular and statistical parallaxes. These stars apparently belong to a young-disk population from analyses of both the solar reflex motion and their residual velocity distribution, which implies that they have an upper mass limit of around three solar masses. There is no apparent correlation of barium intensity with either luminosity or kinematic properties. The barium stars appear to be preferentially distributed in the direction of the local spiral arm, but show no preference to associate with or avoid the direction of the galactic center. They do not appear related to either the carbon or S-stars because of these tendencies and because of the stellar population to which each type of star belongs. The distribution in absolute magnitude combined with star count analyses implies that these stars are slightly less numerous than previously believed. Barium stars show infrared excesses that correlate with their barium intensities
Barium light source method and apparatus
Curry, John J. (Inventor); MacDonagh-Dumler, Jeffrey (Inventor); Anderson, Heidi M. (Inventor); Lawler, James E. (Inventor)
2002-01-01
Visible light emission is obtained from a plasma containing elemental barium including neutral barium atoms and barium ion species. Neutral barium provides a strong green light emission in the center of the visible spectrum with a highly efficient conversion of electrical energy into visible light. By the selective excitation of barium ionic species, emission of visible light at longer and shorter wavelengths can be obtained simultaneously with the green emission from neutral barium, effectively providing light that is visually perceived as white. A discharge vessel contains the elemental barium and a buffer gas fill therein, and a discharge inducer is utilized to induce a desired discharge temperature and barium vapor pressure therein to produce from the barium vapor a visible light emission. The discharge can be induced utilizing a glow discharge between electrodes in the discharge vessel as well as by inductively or capacitively coupling RF energy into the plasma within the discharge vessel.
Barium and iron abundances in red giants
International Nuclear Information System (INIS)
Fernandez-Villacanas, J.L.; Rego, M.; Cornide, M.
1990-01-01
An intermediate-dispersion abundance analysis has been carried out on a sample of 21 barium and 14 comparison stars. The excess of barium over iron has been used as the most representative indicator of peculiarity. These excesses are higher in the peculiar stars than in the nonpeculiar stars. Particularly interesting is the case of HD 67447, included in the comparison stars, with an excess Ba/Fe abundance = 1.61, probably a new barium star. A trend indicating a possible anticorrelation between barium overabundance and metallicity favors the suggestion that the barium strong group is older than the barium weak one. 36 refs
International Nuclear Information System (INIS)
Sarswat, S.P.; Bharti, Arun; Khosa, S.K.
1996-01-01
The yrast spectra has been obtained in the variation-after-projection framework using pairing-plus-quadrupole- quadrupole model for the two body interaction. Besides the low-lying yrast spectra, the calculated values of intrinsic quadrupole moments of some of the barium isotopes i.e. 124-134 Ba are presented
International Nuclear Information System (INIS)
Carroll, E.; Brennan, P.C.
2001-01-01
Four hospitals have been studied, intra- and inter-hospital variations examined and the mean DAP values recorded for barium enemas and barium meals. Mean DAP values for barium meals and barium enemas at 11.4 Gy.cm 2 and 20.1 Gy.cm 2 respectively have been shown. Differences between individual examinations for barium meals varied by up to a factor of 185 and for barium enemas, up to a factor of 19, with hospital means for barium meal and enema examinations each differing by up to a factor of 3. The data provided by this study have suggested that large variations in patient dose do exist in Ireland for barium meal and barium enema examinations. Fluoroscopy time was shown to be a major contributor to the variations reported, with number of images playing a minor role. Results have demonstrated the need for standardisation of technique throughout the country for these examinations. (author)
13 CFR 134.402 - Appeal petition.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Appeal petition. 134.402 Section 134.402 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.402 Appeal petition. In addition to the requirements of § 134.203, an appeal petition must state...
Barium aspiration and alveolarisation of barium in an infant: A case report and review of management
Directory of Open Access Journals (Sweden)
Alan F. Isles
2014-05-01
Full Text Available We describe a case of bilateral inhalation and alveolarisation of barium in an infant following a barium swallow for investigation of dusky spells associated with feeds. A bronchoscopy subsequently revealed the presence of a mid-tracheal tracheo-oesophageal cleft. We review the literature on barium aspiration, its consequences and make recommendations for management.
Barium Depletion in Hollow Cathode Emitters
Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira
2009-01-01
The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the ow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.
Laser cooling and trapping of barium
De, Subhadeep
2008-01-01
Laser cooling and trapping of heavy alkaline-earth element barium have been demonstrated for the first time ever. For any possible cycling transition in barium that could provide strong cooling forces, the excited state has a very large branching probability to metastable states. Additional lasers
Analysis of barium by isotope mass spectrometry
International Nuclear Information System (INIS)
Long Kaiming; Jia Baoting; Liu Xuemei
2004-01-01
The isotopic abundance ratios for barium at sub-microgram level are analyzed by thermal surface ionization mass spectrometry (TIMS). Rhenium trips used for sample preparation are firstly treated to eliminate possible barium background interference. During the preparation of barium samples phosphoric acid is added as an emitting and stabilizing reagent. The addition of phosphoric acid increases the collection efficiency and ion current strength and stability for barium. A relative standard deviation of 0.02% for the isotopic abundance ratio of 137 Ba to 138 Ba is achieved when the 138 Ba ion current is (1-3) x 10 -12 A. The experimental results also demonstrate that the isotope fractionation effect is negligibly small in the isotopic analysis of barium
Böttcher, Michael E; Geprägs, Patrizia; Neubert, Nadja; von Allmen, Katja; Pretet, Chloé; Samankassou, Elias; Nägler, Thomas F
2012-09-01
In this study, we present the first experimental results for stable barium (Ba) isotope ((137)Ba/(134)Ba) fractionation during low-temperature formation of the anhydrous double carbonate BaMn[CO(3)](2). This investigation is part of an ongoing work on Ba fractionation in the natural barium cycle. Precipitation at a temperature of 21±1°C leads to an enrichment of the lighter Ba isotope described by an enrichment factor of-0.11±0.06‰ in the double carbonate than in an aqueous barium-manganese(II) chloride/sodium bicarbonate solution, which is within the range of previous reports for synthetic pure BaCO (3) (witherite) formation.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Settlement. 134.25 Section 134.25 Foreign... Considering Applications § 134.25 Settlement. The applicant and the Department of State may agree on a proposed settlement of the award before final action on the application, either in connection with a...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Settlement. 134.217 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.217 Settlement. At any... have settled the case, and may file with such motion a copy of the settlement agreement. If the Judge...
13 CFR 134.203 - The petition.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false The petition. 134.203 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.203 The petition. (a) A petition must contain the following: (1) The basis of OHA's jurisdiction; (2) A copy of the SBA...
19 CFR 134.53 - Examination packages.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination packages. 134.53 Section 134.53... TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.53 Examination packages. (a) Site of marking—(1) Customs custody. Articles (or containers) in examination packages may be marked by...
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Investigation. 13.4 Section 13.4 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.4 Investigation. (a) If an Investigating Official concludes that a subpoena pursuant to the Authority conferred by...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reports. 13.4 Section 13.4 Housing... PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 13.4 Reports. HUD shall compile and submit... report on its experience in implementing S. 1195 Official Mail Use in the Location and Recovery of...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.213 Section 134.213... OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.213 Discovery. (a) Motion. A party may obtain discovery only upon motion, and for good cause shown. (b) Forms. The forms of discovery...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.310 Section 134.310 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE... Designations § 134.310 Discovery. Discovery will not be permitted in appeals from size determinations or NAICS...
A new double contrast barium enema
International Nuclear Information System (INIS)
Park, Jun Sang; Cho, Won Sik; Lee, Sung Woo; Lee, Mun Gyu; Jeon, Jeong Dong; Jaun, Woo Ki; Han, Chung Yul
1987-01-01
A new technic of the barium enema was proposed for the better colonic double contrast study with the average 204ml of 50w/v% barium, applied to 109 serial patients. The barium was introduced to sigmoid colon, and then pushed to a mid transverse colon by the air insufflation through an enema syringe, a new device. An advance to cecum is accomplished by the air insufflation and/or the position change of the patient. The barium transfer method was developed for the best spot film exposure, through colon, by the position change of the patient, the tilting of the x-ray table and the air insufflation with the enema syringe. The mean angle of the x-ray table tilted was -10 .deg. at the beginning the barium enema till the barium sent past the splenic flexure, -15 . deg. for the best lateral view of rectum and -18 .deg. for the bet prone PA view of rectosigmoid colon. This was a simple, better and economic double contrast barium enema for the cooperative patients
Double contrast barium meal and acetylcysteine
International Nuclear Information System (INIS)
Kinnunen, J.; Pietilae, J.; Ahovuo, J.; Mankinen, P.; Tervahartiala, P.
1989-01-01
In a prospective double blind study, acetylcysteine, a local and systemic respiratory tract mucolytic agent, or a placebo, were given to 100 patients prior to a double contrast barium meal to decrease the gastric mucus viscosity and to make the mucus layer thinner, in order to permit barium to outline the furrows surrounding the areae gastricae instead of the overlying thick mucus. However, acetylcysteine failed to improve either visualization of the areae gastricae or the general quality of the double contrast barium meal. (orig.)
Atomization mechanisms for barium in furnace atomic absorption spectrometry
International Nuclear Information System (INIS)
Styris, D.L.
1984-01-01
Atomic absorption spectrometry and mass spectrometry are used simultaneously in order to elucidate atomization mechanisms of barium dichloride in pyrolytic graphite, vitreous carbon, and tantalum furnaces. Gas-phase barium dicarbide is observed to appear concurrently with the free barium. Barium oxide and barium dihydroxide precursors appear with the chlorides. Surface reactions involving species that are absorbed on the various furnaces are postulated to explain the appearances of the species that are observed in the gas phase. 49 references, 4 figures, 1 table
Time requirement for barium reduction in intussusception
International Nuclear Information System (INIS)
Hwang, Hye Eun; Kim, Seung Ho; Kang, In Young; Park, Byoung Lan; Kim, Byoung Geun
1988-01-01
During the period between January 1985 and December 1987, barium reduction was performed in 146 cases of intussusception who were admitted to Kwangju Christian Hospital. The results were as follows: 1. Success rate to the symptom duration is relatively constant. 2. The success rate in infants with severe dehydration was 50% but it was gradually increased in infants with moderate dehydration and in infants with mild dehydration, 83.3% and 100% respectively. 3. The success rate of 12 cases in severely dehydrated infants with positive dissection sign was 16.7%. 4. The success rate of 15 cases in moderately dehydrated infants with positive dissection sign was 66.7%. 5. The average time requirement for barium reduction was 58.3 minutes. No serious complications were noted during barium reduction, except mild vomiting. 6. With above results, it is desirable that barium reduction should be performed according to the patient's physical status and radiologic findings.
Barium Isotopes in Single Presolar Grains
Pellin, M. J.; Davis, A. M.; Savina, M. R.; Kashiv, Y.; Clayton, R. N.; Lewis, R. S.; Amari, S.
2001-01-01
Barium isotopic compositions of single presolar grains were measured by laser ablation laser resonant ionization mass spectrometry and the implications of the data for stellar processes are discussed. Additional information is contained in the original extended abstract.
Barium appendicitis after upper gastrointestinal imaging.
Novotny, Nathan M; Lillemoe, Keith D; Falimirski, Mark E
2010-02-01
Barium appendicitis (BA) is a rarely seen entity with fewer than 30 reports in the literature. However, it is a known complication of barium imaging. To report a case of BA in a patient whose computed tomography (CT) scan was initially read as foreign body ingestion. An 18-year-old man presented with right lower quadrant pain after upper gastrointestinal imaging 2 weeks prior. A CT scan was obtained of his abdomen and pelvis that revealed a finding that was interpreted as a foreign body at the area of the terminal ileum. A plain X-ray study of the abdomen revealed radiopaque appendicoliths. Pathology confirmed the diagnosis of barium appendicitis. BA is a rare entity and the pathogenesis is unclear. Shorter intervals between barium study and presentation with appendicitis usually correlate with fewer complications. Copyright (c) 2010 Elsevier Inc. All rights reserved.
Neutral barium cloud evolution at different altitudes
International Nuclear Information System (INIS)
Li Lei; Xu Ronglan
2002-01-01
Considering the joint effects of diffusion, collision, oxidation and photoionization, the authors study the evolution of the barium cloud at different altitudes in the space plasma active experiment. The results present the variation of the loss rate, number density distribution and brightness of the barium cloud over the range from 120 to 260 km. This can be divided into oxidation, oxidation plus photoionization and photoionization regions
Bacterial Reduction Of Barium Sulphate By Sulphate-Reducing Bacteria
Directory of Open Access Journals (Sweden)
Luptáková Alena
2015-12-01
Full Text Available Acid mine drainage (AMD is a worldwide problem leading to contamination of water sources. AMD are characterized by low pH and high content of heavy metals and sulphates. The barium salts application presents one of the methods for the sulphates removing from AMD. Barium chloride, barium hydroxide and barium sulphide are used for the sulphates precipitation in the form of barium sulphate. Because of high investment costs of barium salts, barium sulphide is recycled from barium sulphate precipitates. It can be recycled by thermic or bacterial reduction of barium sulphate. The aim of our study was to verify experimentally the possibility of the bacterial transformation of BaSO4 to BaS by sulphate-reducing bacteria. Applied BaSO4 came from experiments of sulphates removal from Smolnik AMD using BaCl2.
An experimental study on barium peritonitis in rats
International Nuclear Information System (INIS)
Kang, Heung Sik; Han, Man Chung; Kim, Chu Wan
1985-01-01
Barium sulfate is universally used contrast media in gastrointestinal roentgenology, and spillage of barium into peritoneal cavity can occur. The references on effect of barium sulfate in the peritoneal cavity have been scattered and the results are varied. In 80 rats, body weight of 130 gm to 150 gm, sterile pure barium, sterile commercial barium, intestinal content, and mixed pure barium and intestinal content were experimentally injected into the peritoneal cavity. Consecutive weekly laparotomy and microscopic examination were done for 4 weeks. The results are as followings: 1. Mind inflammatory reaction and mild adhesion after sterile pure barium injection. 2. Mild inflammatory reaction and moderate adhesion after sterile commercial barium injection. 3. Acute peritonitis and abscess formation after intestinal content injection. 4. High mortality due to severe acute peritonitis, and severe adhesion in survivors after injection of both pure barium and intestinal content.
Sulphate removal from sodium sulphate-rich brine and recovery of barium as a barium salt mixture.
Vadapalli, Viswanath R K; Zvimba, John N; Mulopo, Jean; Motaung, Solly
2013-01-01
Sulphate removal from sodium sulphate-rich brine using barium hydroxide and recovery of the barium salts has been investigated. The sodium sulphate-rich brine treated with different dosages of barium hydroxide to precipitate barium sulphate showed sulphate removal from 13.5 g/L to less than 400 mg/L over 60 min using a barium to sulphate molar ratio of 1.1. The thermal conversion of precipitated barium sulphate to barium sulphide achieved a conversion yield of 85% using coal as both a reducing agent and an energy source. The recovery of a pure mixture of barium salts from barium sulphide, which involved dissolution of barium sulphide and reaction with ammonium hydroxide resulted in recovery of a mixture of barium carbonate (62%) and barium hydroxide (38%), which is a critical input raw material for barium salts based acid mine drainage (AMD) desalination technologies. Under alkaline conditions of this barium salt mixture recovery process, ammonia gas is given off, while hydrogen sulfide is retained in solution as bisulfide species, and this provides basis for ammonium hydroxide separation and recovery for reuse, with hydrogen sulfide also recoverable for further industrial applications such as sulfur production by subsequent stripping.
Synthesis of barium mercaptides and application of antimony/barium mercaptides
Institute of Scientific and Technical Information of China (English)
瞿龙; 张露露; 舒万艮
2001-01-01
Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.
29 CFR 1915.134 - Abrasive wheels.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Abrasive wheels. 1915.134 Section 1915.134 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... wheels shall fit freely on the spindle and shall not be forced on. The spindle nut shall be tightened...
Coprecipitation of iron and silver with barium fluoride
International Nuclear Information System (INIS)
Kopilova, N.V.; Khamidov, B.O.; Kashina, Z.A.; Ikrami, D.D.
1986-01-01
Distribution of trace contaminants of iron and silver at coprecipitation of barium fluoride is studied in present work. It is defined that iron almost completely coprecipitated with barium fluoride in wide range of ph 5.5-12. Silver coprecipitated with barium fluoride in ph range 4-7. The value of coprecipitation varies from 94% to 100%.
40 CFR 721.10011 - Barium calcium manganese strontium oxide.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium calcium...
Barium ion beam. Annual progress report
International Nuclear Information System (INIS)
Lazar, N.; Dandl, R.; Rynn, N.; Wickham, M.
1985-01-01
The barium ion beam Zeeman diagnostic is an in situ nonperturbing diagnostic designed to measure both the plasma electric and magnetic fields in devices such as STM and EBT. The diagnostic satisfies the requirements of high precision, spatial resolution and nonperturbation of the plasma. The technique uses resonance absorption of light from a single moded laser in a beam of energetic barium ions to measure the Zeeman effect in the absorption spectrum (to measure changes in the magnetic field) and to observe the changes in beam velocity by the Doppler shift of the absorption lines
Printed Barium Strontium Titanate capacitors on silicon
Energy Technology Data Exchange (ETDEWEB)
Sette, Daniele [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg); Kovacova, Veronika [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Defay, Emmanuel, E-mail: emmanuel.defay@list.lu [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg)
2015-08-31
In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography.
International Nuclear Information System (INIS)
Kinnunen, J.; Toetterman, S.; Kaila, R.; Pietilae, J.; Linden, H.; Tervahartiala, P.
1983-01-01
The radiographic pattern of the areae gastricae is produced by barium lying in the intersecting furrows of the gastric mucosal surface. However, if the mucus layer on the gastric mucosa is thick, it interferes with the barium coating of the areae gastricae during double contrast barium meal. As sodium bicarbonate decreases the viscosity of mucus and thus may make the gastric mucus layer thinner, it was evaluated as a pretreatment agent in a routine double contrast upper-gastrointestinal study to improve the visualization of the areae gastricae. In a single blind study, 53 of 106 patients took sodium bicarbonate water mixtures at bedtime the day before and on the morning of the examination. According to the results of the present study mucolysis induced by the used doses of sodium bicarbonate does not significantly affect micromucosal visualization during double-contrast barium meal. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Kinnunen, J.; Toetterman, S.; Kaila, R.; Pietilae, J.; Linden, H.; Tervahartiala, P.
1983-08-01
The radiographic pattern of the areae gastricae is produced by barium lying in the intersecting furrows of the gastric mucosal surface. However, if the mucus layer on the gastric mucosa is thick, it interferes with the barium coating of the areae gastricae during double contrast barium meal. As sodium bicarbonate decreases the viscosity of mucus and thus may make the gastric mucus layer thinner, it was evaluated as a pretreatment agent in a routine double contrast upper-gastrointestinal study to improve the visualization of the areae gastricae. In a single blind study, 53 of 106 patients took sodium bicarbonate water mixtures at bedtime the day before and on the morning of the examination. According to the results of the present study mucolysis induced by the used doses of sodium bicarbonate does not significantly affect micromucosal visualization during double-contrast barium meal.
Enterogastroesophageal reflux during barium enema: Report of a case
International Nuclear Information System (INIS)
Shin, Hyoun Ja; Rhee, Hak Song
1972-01-01
Enterogastric reflux during barium enema examination has been ascribed to various causes including incompetence of the ilepcecal valve, shunt, fistula, excessive barium etc. Recently we have encountered a case of complete enterogastroesphageal regurgitation during barium enema examination performed for the reduction of the ileocolic intuosusception in 6 months old baby. The regurgitation occurred only in the first of two barium enema examinations conducted at one month interval for recurring intussusception. The barium-saline solution used in the present study was not more than 350 ml in quantity. No organic or physical causes of such a complete regurgitation could be determined
75 FR 19657 - Barium Chloride From China
2010-04-15
... China AGENCY: United States International Trade Commission. ACTION: Notice of Commission determination... China. SUMMARY: The Commission hereby gives notice that it will proceed with a full review pursuant to... antidumping duty order on barium chloride from China would be likely to lead to continuation or recurrence of...
Blood pressure changes during barium enema
International Nuclear Information System (INIS)
Roach, S.C.; Martin, O.J.D.; Owen, A.; Martin, D.F.
2001-01-01
AIMS: To document blood pressure changes during barium enema examination and to determine at what point in the examination changes are likely to occur. METHODS AND RESULTS: Blood pressure measurements were taken at seven points during the course of barium enema examination in 107 consecutive patients. We found that patients over the age of 60 years had statistically significant decreases in blood pressure when they were stood up during the course of the examination. Many of these patients were asymptomatic. Patients who had symptoms (15/107, 14%) when standing up had a degree of hypotension. The duration of barium enema examination is longer in those patients who experience symptoms. CONCLUSION: During a barium enema examination hypotension occurs at the point of standing up more frequently in patients over 60 years and in those who suffer symptoms at this time. Patients who fall into one of these groups should be considered at risk of fainting at this point in the examination. A modified technique to avoid standing should be considered in at-risk patients. Roach, S.C. et al. (2001)
High temperature impedance spectroscopy of barium stannate ...
Indian Academy of Sciences (India)
(M = Ba, Sr, Ca and Pb). ... Barium stannate (BaSnO3) is a cubic pervoskite oxide com- .... were gold-sputtered and scanned in different regions using .... de ions. Water insertion into the oxide structure can be re- presented as the process of ...
75 FR 20625 - Barium Chloride From China
2010-04-20
... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-149 (Third Review)] Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Revised schedule for the subject review. DATES: Effective Date: April 9, 2010. FOR FURTHER INFORMATION CONTACT: Amy Sherman (202-205-3289...
75 FR 33824 - Barium Chloride From China
2010-06-15
... China Determination On the basis of the record\\1\\ developed in the subject five-year review, the United... China would be likely to lead to continuation or recurrence of material injury to an industry in the... contained in USITC Publication 4157 (June 2010), entitled Barium Chloride from China: Investigation No. 731...
Thermal decomposition of barium valerate in argon
DEFF Research Database (Denmark)
Torres, P.; Norby, Poul; Grivel, Jean-Claude
2015-01-01
The thermal decomposition of barium valerate (Ba(C4H9CO2)(2)/Ba-pentanoate) was studied in argon by means of thermogravimetry, differential thermal analysis, IR-spectroscopy, X-ray diffraction and hot-stage optical microscopy. Melting takes place in two different steps, at 200 degrees C and 280...
Rheological properties of potassium barium borate glasses
Szwejda, K.A.; Vogel, D.L.; Stevels, J.M.
1973-01-01
Several series of potassium barium borate glasses have been investigated as to their rheological properties. It has been found, that all these glasses show deviations from ‘Newtonian’ behaviour below temperatures corresponding to viscosities of 1010 poises. The activation energies of viscous flow
Impurities in barium titanate posistor ceramics
Czech Academy of Sciences Publication Activity Database
Korniyenko, S. M.; Bykov, I. P.; Glinchuk, M. J.; Laguta, V. V.; Belous, A. G.; Jastrabík, Lubomír
2000-01-01
Roč. 239, - (2000), s. 1209-1218 ISSN 0015-0193 Institutional research plan: CEZ:AV0Z1010914 Keywords : barium titanate phase transition * ESR * positive temperature coefficient of resistivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.547, year: 2000
International Nuclear Information System (INIS)
Fernandes, J.P.; Duarte, G.W.; Caldart, C.; Kniess, C.T.; Montedo, O.R.K.; Rocha, M.R.; Riella, H.G.; Fiori, M.A.
2015-01-01
Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound
Energy Technology Data Exchange (ETDEWEB)
Fernandes, J.P. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Duarte, G.W. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Research Group in Technology and Information, Centro Universitário Barriga Verde (UNIBAVE), Santa Catarina, SC (Brazil); Caldart, C. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Kniess, C.T. [Post-Graduate Program in Professional Master in Management, Universidade Nove de Julho, São Paulo, SP (Brazil); Montedo, O.R.K.; Rocha, M.R. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Riella, H.G. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Fiori, M.A., E-mail: fiori@unochapeco.edu.br [Post-Graduate Program in Environmental Science, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil); Post-Graduate Program in Technology and Management of the Innovation, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil)
2015-11-15
Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound.
Oesophageal motility disorders - diagnosis with a barium-rice study
International Nuclear Information System (INIS)
Schwickert, H.C.; Schadmand-Fischer, S.; Klose, P.; Staritz, M.; Ueberschaer, B.; Thelen, M.
1993-01-01
The purpose of this study was to evaluate the role of a 'barium-rice' study for diagnosis of dysphagia and oesophageal motility disorders. Material and methods: 203 patients with oesophageal motility disorders of various aetiologies were examined by both conventional barium study and a 'barium-rice' study. During the latter, oesophageal clearance of a defined mixture of barium sulfate and boiled rice was measured. Results: The conventional barium study revealed prolonged transit time in only 15.8% (32 of 203 cases), whereas barium-rice study was pathological in 50.8% (103 of 203 cases). In 71 of 171 patients (41.5%) with a normal barium study, barium-rice passage was prolonged. In 23 patients, radiological results were confirmed by manometric measurements. Conclusion: Oesophageal motility disorders are detected by a barim-rice study with high sensitivity independent of the underlying disease. The barium-rice study offers a simple diagnostic tool revealing quantitative and reliable results. The barium-rice study is a suitable method for screening and follow-up of patients with dysphagia and oesophageal motility disorders. (orig.) [de
The R-134a energy efficiency problem
International Nuclear Information System (INIS)
Behrens, N.; Dekleva, T.W.; Hartley, J.G.; Murphy, F.T.; Powell, R.L.
1990-01-01
This paper examines the controversy over the relative energy efficiencies of R-134a and R-12, from a theoretical thermodynamic perspective. In this regard, the authors have used an in-house process flowsheeting program which allows to simulate the complete thermodynamic cycle, and investigate the effects of superheat and subcooling. Special attention is given to the suitable basis for comparing the energy efficiencies of different refrigerants calculated from thermodynamic data. Modelling experiments demonstrate the relative extent to which R-12 and R-134a respond differently to superheat and subcooling. With appropriate superheat and subcooling taken into consideration, such as applied in standard practice in the home appliance industry, R-134a can provide COP values essentially equivalent to that of R-12
Peng, Yaguang; Huang, Hongliang; Liu, Dahuan; Zhong, Chongli
2016-04-06
Highly efficient and irreversible capture of radioactive barium from aqueous media remains a serious task for nuclear waste disposal and environmental protection. To address this task, here we propose a concept of barium ion trap based on metal-organic framework (MOF) with a strong barium-chelating group (sulfate and sulfonic acid group) in the pore structures of MOFs. The functionalized MOF-based ion traps can remove >90% of the barium within the first 5 min, and the removal efficiency reaches 99% after equilibrium. Remarkably, the sulfate-group-functionalized ion trap demonstrates a high barium uptake capacity of 131.1 mg g(-1), which surpasses most of the reported sorbents and can selectively capture barium from nuclear wastewater, whereas the sulfonic-acid-group-functionalized ion trap exhibits ultrafast kinetics with a kinetic rate constant k2 of 27.77 g mg(-1) min(-1), which is 1-3 orders of magnitude higher than existing sorbents. Both of the two MOF-based ion traps can capture barium irreversibly. Our work proposes a new strategy to design barium adsorbent materials and provides a new perspective for removing radioactive barium and other radionuclides from nuclear wastewater for environment remediation. Besides, the concrete mechanisms of barium-sorbent interactions are also demonstrated in this contribution.
Nanoparticles of barium induce apoptosis in human phagocytes.
Mores, Luana; França, Eduardo Luzia; Silva, Núbia Andrade; Suchara, Eliane Aparecida; Honorio-França, Adenilda Cristina
2015-01-01
Nutrients and immunological factors of breast milk are essential for newborn growth and the development of their immune system, but this secretion can contain organic and inorganic toxins such as barium. Colostrum contamination with barium is an important issue to investigate because this naturally occurring element is also associated with human activity and industrial pollution. The study evaluated the administration of barium nanoparticles to colostrum, assessing the viability and functional activity of colostral mononuclear phagocytes. Colostrum was collected from 24 clinically healthy women (aged 18-35 years). Cell viability, superoxide release, intracellular Ca(2+) release, and phagocyte apoptosis were analyzed in the samples. Treatment with barium lowered mononuclear phagocyte viability, increased superoxide release, and reduced intracellular calcium release. In addition, barium increased cell death by apoptosis. These data suggest that nanoparticles of barium in colostrum are toxic to cells, showing the importance of avoiding exposure to this element.
Barium Titanate Nanoparticles for Biomarker Applications
International Nuclear Information System (INIS)
Matar, O; Hondow, N S; Brydson, R M D; Milne, S J; Brown, A P; Posada, O M; Wälti, C; Saunders, M; Murray, C A
2015-01-01
A tetragonal crystal structure is required for barium titanate nanoparticles to exhibit the nonlinear optical effect of second harmonic light generation (SHG) for use as a biomarker when illuminated by a near-infrared source. Here we use synchrotron XRD to elucidate the tetragonal phase of commercially purchased tetragonal, cubic and hydrothermally prepared barium titanate (BaTiO 3 ) nanoparticles by peak fitting with reference patterns. The local phase of individual nanoparticles is determined by STEM electron energy loss spectroscopy (EELS), measuring the core-loss O K-edge and the Ti L 3 -edge energy separation of the t 2g , e g peaks. The results show a change in energy separation between the t 2g and e g peak from the surface and core of the particles, suggesting an intraparticle phase mixture of the barium titanate nanoparticles. HAADF-STEM and bright field TEM-EDX show cellular uptake of the hydrothermally prepared BaTiO 3 nanoparticles, highlighting the potential for application as biomarkers. (paper)
Barium hexaferrite nanoparticles: Synthesis and magnetic properties
International Nuclear Information System (INIS)
Martirosyan, K.S.; Galstyan, E.; Hossain, S.M.; Wang Yiju; Litvinov, D.
2011-01-01
Carbon combustion synthesis is applied to rapid and energy efficient fabrication of crystalline barium hexaferrite nanoparticles with the average particle size of 50-100 nm. In this method, the exothermic oxidation of carbon nanoparticles with an average size of 5 nm with a surface area of 80 m 2 /g generates a self-propagating thermal wave with maximum temperatures of up to 1000 deg. C. The thermal front rapidly propagates through the mixture of solid reactants converting it to the hexagonal barium ferrite. Carbon is not incorporated in the product and is emitted from the reaction zone as a gaseous CO 2 . The activation energy for carbon combustion synthesis of BaFe 12 O 19 was estimated to be 98 kJ/mol. A complete conversion to hexagonal barium ferrite is obtained for carbon concentration exceeding 11 wt.%. The magnetic properties H c ∼3000 Oe and M s ∼50.3 emu/g of the compact sintered ferrites compare well with those produced by other synthesis methods.
BARIUM REDUCTION OF INTUSSUSCEPTION IN INFANCY
Denenholz, Edward J.; Feher, George. S.
1955-01-01
Barium enema reduction was used as the initial routine treatment in 29 infants with intussusception. In 22 of them the intussusception was reduced by this means. In three of eight patients operated upon the intussusception was found to be reduced. Four of the remaining five patients had clinical or x-ray evidence of complications before reduction by barium enema was attempted. Twenty-one of the patients, all of whom were observed in private practice, were treated without admission to the hospital. After reduction, these patients were observed closely by the clinician. None of these patients showed clinical or x-ray signs of complications before reduction. Certain clinical and roentgen criteria must be satisfied before it can be concluded that reduction by barium enema is complete. If there are clinical signs of complications with x-ray evidence of small bowel obstruction, only a very cautious attempt at hydrostatic reduction should be made. As the time factor is generally a reliable clinical guide to reducibility, the late cases should be viewed with greater caution. Long duration of symptoms, however, is not per se a contraindication to an attempt at hydrostatic reduction. PMID:13230908
Making of Magnet Barium Ferit Anisotropic
International Nuclear Information System (INIS)
Idayati, Novrita; Dedi
2003-01-01
Barium Hexa ferrite (BaFe 12 O 19 ) is ceramic and materials which usually used for making of permanent magnet. In this research Barium Hexa ferrite were made Anisotropic, and applied for loudspeaker, electro motors, dynamo, KWh metre, etc. this Magnet is commonly used due to its high Induction of Remanen (Br) and coercivity (high Hc). Besides it applies a more simple and easier process technology, cheaper raw material, and easy to find it, hence the magnetic component is much cheaper. Powder Metallurgy was used for the process technology, by reacting all materials in the powder (oxide), with a certain size distribution and a tight preparation step. The next step was mixing ferrite and Barium Carbonate (in the form of oxide), calcination, compaction, cantering and characterisation. The Anisotropic particle effects a high Induce Remanen (Br) and of koersifitas (high Hc). All the process steps will is determine physical and chemical characteristics of the magnet. The best Magnet characteristic of the magnet produced in this research is Induction of Remanen (Br) = 4,27 kg, Coercivity (Hc) = 1,745 kOe, Energy Product max (BHmaks) = 2,31 MGOe
19 CFR 134.34 - Certain repacked articles.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certain repacked articles. 134.34 Section 134.34... TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.34 Certain repacked articles. (a) Exception for repacked articles. An exception under § 134.32(d) may be authorized in the...
Kinematic and spatial distributions of barium stars - are the barium stars and Am stars related?
International Nuclear Information System (INIS)
Hakkila, J.
1989-01-01
The possibility of an evolutionary link between Am stars and barium stars is considered, and an examination of previous data suggests that barium star precursors are main-sequence stars of intermediate mass, are most likely A and/or F dwarfs, and are intermediate-mass binaries with close to intermediate orbital separations. The possible role of mass transfer in the later development of Am systems is explored. Mass transfer and loss from systems with a range of masses and orbital separations may explain such statistical peculiarities of barium stars as the large dispersion in absolute magnitude, the large range of elemental abundances from star to star, and the small number of stars with large peculiar velocities. 93 refs
Effects of Barium Concentration on Oropharyngeal Swallow Timing Measures
Stokely, Shauna L.; Molfenter, Sonja M.; Steele, Catriona M.
2013-01-01
Videofluoroscopy is commonly used for evaluating oropharyngeal swallowing but requires radiopaque contrast (typically barium). Prior studies suggest that some aspects of swallowing, including timing measures of oral and pharyngeal bolus transit, vary depending on barium concentration. The aim of our study was to identify timing differences in healthy swallowing between “thin” (40 % w/v concentration) and “ultrathin” (22 % w/v concentration) barium solutions. Twenty healthy adults (Ten women; ...
Contrast characteristics of barium preparations and the timing of exposure
渋谷, 光一; 中桐, 義忠; 東, 義晴; 杉田, 勝彦; 小橋, 高郎; 大倉, 保彦; 丹谷, 延義; 三上, 泰隆; 平木, 祥夫
1995-01-01
We studied the relationship between the contrast characteristics of barium suspension and timing of exposure. We poured several kinds of barium preparations on the phantom manufactured by ourselves, and took X-ray pictures continuously by a DSA system. We analyzed each of the characteris-tics of the contrast. The time which was reguired for the contrast to reach the peak (Contrast Peak Time ; CPT) was unrelated with the kind of barium preparations used. It depended on the viscosity of the con...
Barium peritonitis following upper gastrointestinal series: A case report
Energy Technology Data Exchange (ETDEWEB)
Ko, Su Jin; Hwang, Ji Young; Kim, Yong Jin; Hong, Seong Sook [Soonchunhyang University College of Medicine, Seoul Hospital, Seoul (Korea, Republic of)
2017-06-15
We report a rare case of barium peritonitis following an upper gastrointestinal (GI) series and its imaging findings in a 74-year-old female. Barium peritonitis is a rare but life-threatening complication of GI contrast investigation. Therefore, clinical awareness of barium peritonitis as a complication of GI tract contrast investigation would help to prevent such a complication and manage the patients properly.
Barium peritonitis following upper gastrointestinal series: A case report
International Nuclear Information System (INIS)
Ko, Su Jin; Hwang, Ji Young; Kim, Yong Jin; Hong, Seong Sook
2017-01-01
We report a rare case of barium peritonitis following an upper gastrointestinal (GI) series and its imaging findings in a 74-year-old female. Barium peritonitis is a rare but life-threatening complication of GI contrast investigation. Therefore, clinical awareness of barium peritonitis as a complication of GI tract contrast investigation would help to prevent such a complication and manage the patients properly
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT
Effects of barium concentration on oropharyngeal swallow timing measures.
Stokely, Shauna L; Molfenter, Sonja M; Steele, Catriona M
2014-02-01
Videofluoroscopy is commonly used for evaluating oropharyngeal swallowing but requires radiopaque contrast (typically barium). Prior studies suggest that some aspects of swallowing, including timing measures of oral and pharyngeal bolus transit, vary depending on barium concentration. The aim of our study was to identify timing differences in healthy swallowing between "thin" (40 % w/v concentration) and "ultrathin" (22 % w/v concentration) barium solutions. Twenty healthy adults (Ten women; mean age = 31 years) each performed a series of three noncued 5-ml swallows each of ultrathin and thin liquid barium solutions in videofluoroscopy. Timing measures were compared between barium concentrations using a mixed-model ANOVA. The measures of interest were stage transition duration, pharyngeal transit time, and duration of upper esophageal sphincter opening. Significant differences were observed in the timing measures of swallowing with respect to barium concentration. In all cases, longer durations were seen with the higher barium concentration. Barium concentration influences timing parameters in healthy swallowing, even between ultrathin and thin concentrations. Clinicians need to understand and control for the impact of different barium stimuli on swallowing physiology.
History and challenges of barium titanate: Part I
Directory of Open Access Journals (Sweden)
Vijatović M.M.
2008-01-01
Full Text Available Barium titanate is the first ferroelectric ceramics and a good candidate for a variety of applications due to its excellent dielectric, ferroelectric and piezoelectric properties. Barium titanate is a member of a large family of compounds with the general formula ABO3 called perovskites. Barium titanate can be prepared using different methods. The synthesis method depends on the desired characteristics for the end application. The used method has a significant influence on the structure and properties of barium titanate materials. In this review paper, Part I contains a study of the BaTiO3 structure and frequently used synthesis methods.
Lanthanide doped strontium-barium cesium halide scintillators
Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew
2015-06-09
The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.
2010-01-01
... Administrative Law Judge. The AA/OHA will assign all other cases before OHA to either an Administrative Law Judge... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.218 Judges. (a) Assignment. The AA...
13 CFR 134.405 - Jurisdiction.
2010-01-01
... Jurisdiction. (a) The Administrative Law Judge selected to preside over an appeal shall decline to accept... disadvantage, economic disadvantage, ownership or control; (2) The appeal is untimely filed under § 134.202 or... before a court of competent jurisdiction over such matters. (b) Once the Administrative Law Judge accepts...
42 CFR 410.134 - Provider qualifications.
2010-10-01
... after December 22, 2000: (a) Holds a bachelor's or higher degree granted by a regionally accredited college or university in the United States (or an equivalent foreign degree) with completion of the... PROGRAM SUPPLEMENTARY MEDICAL INSURANCE (SMI) BENEFITS Medical Nutrition Therapy § 410.134 Provider...
Binding and leakage of barium in alginate microbeads.
Mørch, Yrr A; Qi, Meirigeng; Gundersen, Per Ole M; Formo, Kjetil; Lacik, Igor; Skjåk-Braek, Gudmund; Oberholzer, Jose; Strand, Berit L
2012-11-01
Microbeads of alginate crosslinked with Ca(2+) and/or Ba(2+) are popular matrices in cell-based therapy. The aim of this study was to quantify the binding of barium in alginate microbeads and its leakage under in vitro and accumulation under in vivo conditions. Low concentrations of barium (1 mM) in combination with calcium (50 mM) and high concentrations of barium (20 mM) in gelling solutions were used for preparation of microbeads made of high-G and high-M alginates. High-G microbeads accumulated barium from gelling solution and contained higher concentrations of divalent ions for both low- and high-Ba exposure compared with high-G microbeads exposed to calcium solely and to high-M microbeads for all gelling conditions. Although most of the unbound divalent ions were removed during the wash and culture steps, leakage of barium was still detected during storage. Barium accumulation in blood and femur bone of mice implanted with high-G beads was found to be dose-dependent. Estimated barium leakage relevant to transplantation to diabetic patients with islets in alginate microbeads showed that the leakage was 2.5 times lower than the tolerable intake value given by WHO for high-G microbeads made using low barium concentration. The similar estimate gave 1.5 times higher than is the tolerable intake value for the high-G microbeads made using high barium concentration. To reduce the risk of barium accumulation that may be of safety concern, the microbeads made of high-G alginate gelled with a combination of calcium and low concentration of barium ions is recommended for islet transplantation. Copyright © 2012 Wiley Periodicals, Inc.
Chiu, Jennifer G; Shin, Yoona; Patel, Priti N; Mangione, Robert A
2014-01-01
To determine the availability and accuracy of information provided by hospitals, imaging centers, and manufacturers regarding gluten in barium sulfate suspensions. A total of 105 facilities were contacted via telephone to determine the gluten content of the contrast media used in those facilities. Manufacturers were contacted and their Web sites reviewed to determine the gluten content of their barium products. Thirty-nine percent of the hospitals and 52% of the imaging centers were not aware of the gluten content of the contrast media they used. Twenty-nine-and-a-half percent of the respondents provided the correct gluten content. The manufacturers noted that 5 products were tested and confirmed gluten free, 1 product was not tested but described as gluten free, 1 product's gluten content depended upon its flavor, and 1 product was reported to contain gluten. Clinicians caring for patients with celiac disease or patients who choose to restrict their gluten consumption must ensure that the barium sulfate suspension ingested is gluten free. It can be difficult to determine the gluten content of barium sulfate, as a majority of radiology departments and imaging centers did not know whether the product they use is gluten free. Educating staff members and improving product labeling would benefit the quality of care provided to patients with celiac disease.
Barium isotopes in cold-water corals
Hemsing, Freya; Hsieh, Yu-Te; Bridgestock, Luke; Spooner, Peter T.; Robinson, Laura F.; Frank, Norbert; Henderson, Gideon M.
2018-06-01
Recent studies have introduced stable Ba isotopes (δ 138 / 134Ba) as a novel tracer for ocean processes. Ba isotopes could potentially provide insight into the oceanic Ba cycle, the ocean's biological pump, water-mass provenance in the deep ocean, changes in activity of hydrothermal vents, and land-sea interactions including tracing riverine inputs. Here, we show that aragonite skeletons of various colonial and solitary cold-water coral (CWC) taxa record the seawater (SW) Ba isotope composition. Thirty-six corals of eight different taxa from three oceanic regions were analysed and compared to δ 138 / 134Ba measurements of co-located seawater samples. Sites were chosen to cover a wide range of temperature, salinity, Ba concentrations and Ba isotope compositions. Seawater samples at the three sites exhibit the well-established anti-correlation between Ba concentration and δ 138 / 134Ba. Furthermore, our data set suggests that Ba/Ca values in CWCs are linearly correlated with dissolved [Ba] in ambient seawater, with an average partition coefficient of DCWC/SW = 1.8 ± 0.4 (2SD). The mean isotope fractionation of Ba between seawater and CWCs Δ138/134BaCWC-SW is -0.21 ± 0.08‰ (2SD), indicating that CWC aragonite preferentially incorporates the lighter isotopes. This fractionation likely does not depend on temperature or other environmental variables, suggesting that aragonite CWCs could be used to trace the Ba isotope composition in ambient seawater. Coupled [Ba] and δ 138 / 134Ba analysis on fossil CWCs has the potential to provide new information about past changes in the local and global relationship between [Ba] and δ 138 / 134Ba and hence about the operation of the past global oceanic Ba cycle in different climate regimes.
Outcome of barium enema in patients with colorectal symptoms ...
African Journals Online (AJOL)
Background: For many years, double contrast barium enema has been an effective way to evaluate the large bowel. With the development of the colonoscope, the role of barium enema has been questioned. However it is still useful in investigating patients with colorectal symptoms especially in the developing world where ...
Synthesis and properties of barium diketonates as precursors for MOCVD
Energy Technology Data Exchange (ETDEWEB)
Drozdov, A.A. (Dept. of Chemistry, Moscow State Univ. (Russian Federation)); Troyanov, S.I. (Dept. of Chemistry, Moscow State Univ. (Russian Federation)); Kuzmina, N.P. (Dept. of Chemistry, Moscow State Univ. (Russian Federation)); Martynenko, L.I. (Dept. of Chemistry, Moscow State Univ. (Russian Federation)); Alikhanyan, A.S. (Dept. of Chemistry, Moscow State Univ. (Russian Federation)); Malkerova, I.P. (Dept. of Chemistry, Moscow State Univ. (Russian Federation))
1993-08-01
The structures of barium diketonates depend on the way in which they are synthesized. It is shown that there is a correlation between the volatility of these compounds and their crystal structures. A new volatile mononuclear adduct of barium dipivaloylmethanate suitable for MOCVD is suggested. (orig.).
Synthesis and properties of barium diketonates as precursors for MOCVD
International Nuclear Information System (INIS)
Drozdov, A.A.; Troyanov, S.I.; Kuzmina, N.P.; Martynenko, L.I.; Alikhanyan, A.S.; Malkerova, I.P.
1993-01-01
The structures of barium diketonates depend on the way in which they are synthesized. It is shown that there is a correlation between the volatility of these compounds and their crystal structures. A new volatile mononuclear adduct of barium dipivaloylmethanate suitable for MOCVD is suggested. (orig.)
Thermal reactions of some calcium, strontium, and barium chromates
International Nuclear Information System (INIS)
Piekarska-Piesse, B.; Gontarz, Z.; Ostrowski, A.; Kucharski, R.
2000-01-01
Thermal decomposition of calcium chromates and solid state reactions of barium and strontium chromates(VI) with barium and strontium hydroxides and carbonates, as well as the reduction of chromates by carbon and hydrogen, have been investigated. The mechanisms of individual stages of the thermal decomposition have been proposed on the basis of morphological classification. (author)
Charge distributions of barium isotopes from muonic X-rays
International Nuclear Information System (INIS)
Shera, E.B.; Wohlfahrt, H.D.; Hoehn, M.V.; Tanaka, Y.
1982-01-01
The results of a muonic X-ray study of the charge radii of stable barium isotopes are presented and compared with optical isotope shifts. The isotope shifts Δ 2 > of a wide range of barium isotopes are found to be in good agreement with the droplet model and with IBA calculations. (orig.)
Barium transport in the hot spot region of fluorescent lamps
International Nuclear Information System (INIS)
Sigeneger, F; Rackow, K; Uhrlandt, D; Ehlbeck, J; Lieder, G
2010-01-01
The transport of barium atoms and ions in the vicinity of the hot spot in fluorescent lamps operating at 25 kHz is investigated by a combined experimental and theoretical approach. By laser-induced fluorescence, the particle densities of barium atoms and ions were measured time-resolved at different distances from the spot centre. In addition, the time-dependent cathode fall voltage was measured using an improved band method. The model combines a kinetic part for the electrons with a fluid part for the barium atoms and ions. Both parts are spatially resolved in spherically symmetric geometry. The space-dependent electron Boltzmann equation yields the electron density and the ionization rate coefficient of barium as functions of the cathode fall voltage. These results are used to solve the time-dependent particle balance equations of barium atoms and ions which include the ionization of barium as gain and loss terms, respectively. Good agreement between the measured and calculated particle densities of barium atoms is obtained. A sensitive dependence of the ionization frequency and of the barium particle densities on the cathode fall voltage was found.
Barium enema findings of milk allergy in infants
International Nuclear Information System (INIS)
Kim, Gyoung Ju; Kim, Mi Jeong; Lee, Hee Jung
2006-01-01
We wanted to evaluate the barium enema findings of milk allergy in infants. Retrospective evaluation of the plain abdominal radiography and barium enema findings was performed in fifteen young infants suffering with milk allergy. The presence of gaseous distension, rectal gas, paralytic ileus and mechanical obstruction was evaluated on the plain radiography. The presence of spasm, a transitional zone, a reversed rectosigmoid index and mucosal irregularity was analyzed on the barium enema; the presence of barium retention was also evaluated on 24-hour-delayed plain radiography. Paralytic ileus was the most common finding on the plain radiography (93%). On the barium enema, continuous spasm of the colon, ranging from the rectum to the descending colon, was revealed in ten infants (67%). A transitional zone was observed in one infant and a reversed rectosigmoid index was revealed in four. Mucosal irregularity was observed in two infants. Barium retention was demonstrated in 11 of fifteen cases: throughout the entire colon (n = 3), from the rectum to the descending colon (n = 7), and up to the transverse colon (n = 1). The most common barium enema finding of milk allergy in infants was spasm of the distal colon. The other findings were a transitional zone, a reversed rectosigmoid index, mucosal irregularity and barium retention
INFLUENCE OF BARIUM OXIDE ADDITIONS ON PORTLAND CLINKER
Directory of Open Access Journals (Sweden)
Anezka Zezulova
2016-12-01
Full Text Available Nowadays, nuclear power plants are widespread around the world and research is of great interest. Together with nuclear research, shielding of different types of radiation is an important current topic of research aiming at their safety. Portland cement has been an elementary building material for centuries. Since barium is very efficient in shielding different types of radiation, it can be assumed that the radiation shielding capability of cement can be improved by incorporation of barium. This work deals with the influence of barium oxide, added in the form of barium carbonate and sulphate, on the formation and properties of Portland clinker. The structure of burnt clinkers and the ratio of clinker phases were studied by polarizing microscopy and by X-ray diffraction. With increasing barium content, the alite-belite ratio decreases and the content of free lime gradually increases. Moreover, sulphates induce the growth of alite crystals. The ability of barium to be a part of the clinker minerals was observed by scanning electron microscopy. Belite and clinker melt contain the highest amount of barium, but aggregates of barium oxide are formed in the clinker melt. Furthermore, the rate of alite crystallization was studied under isothermal conditions.
Application of magnesium hydroxide and barium hydroxide for the ...
African Journals Online (AJOL)
Application of magnesium hydroxide and barium hydroxide for the removal of metals and sulphate from mine water. ... equivalent to the Ba(OH)2 dosage. During CO2-dosing, CaCO3 is precipitated to the saturation level of CaCO3. Keywords: Magnesium hydroxide; barium hydroxide; sulphate removal; water treatment ...
Duodenal diverticula demonstrated by barium examination
Energy Technology Data Exchange (ETDEWEB)
Christiansen, T.; Thommesen, P.
An investigation for biliary tract calculi and food-stimulated gastro-oesophageal reflux was carried out in 37 patients with duodenal diverticula demonstrated by barium examination. Sixty per cent of the diverticula were located in the descending part of the duodenum. Biliary tract calculi were demonstrated in 38 per cent and food-stimulated gastro-oesophageal reflux in 81 per cent of the patients. The detection of a duodenal diverticulum should result in a supplementary investigation for gallstones and gastrooesophageal reflux and its sequelae.
Short-cavity squeezing in barium
Hope, D. M.; Bachor, H-A.; Manson, P. J.; Mcclelland, D. E.
1992-01-01
Broadband phase sensitive noise and squeezing were experimentally observed in a system of barium atoms interacting with a single mode of a short optical cavity. Squeezing of 13 +/- 3 percent was observed. A maximum possible squeezing of 45 +/- 8 percent could be inferred for out experimental conditions, after correction for measured loss factors. Noise reductions below the quantum limit were found over a range of detection frequencies 60-170 MHz and were best for high cavity transmission and large optical depths. The amount of squeezing observed is consistent with theoretical predictions from a full quantum statistical model of the system.
Behavior of cesium-134 in the tea tree
International Nuclear Information System (INIS)
Xu Yinliang; Chen Kaixuan; Chen Chuangqun
1996-01-01
The radioactivity changes of 134 Cs in the aged and the young leaves followed an exponential regression function after spraying 134 Cs in the tea trees. Contamination by spraying 134 Cs greatly harmed tea tree and by irrigating or mixing 134 Cs with soil resulted in a potential endangerment. The concentrating ability of tea leaves for 134 CS was very low and K value was 0.02. After the fresh tea leaves were processed to dry tea, the content of 134 Cs decreased by about 13.3%. When the tea leaves were soaked in hot water, the extraction ratio was around 83.6%
Evaluation of barium hydroxide treatment efficacy on a dolomitic marble.
Toniolo, L; Colombo, C; Realini, M; Peraio, A; Positano, M
2001-01-01
The Arch of Peace, by Luigi Cagnola, is one of the most famous neoclassical monuments in Milan. It has been subjected to conservative intervention in 1998. In the present paper the efficacy of the consolidation by means of barium hydroxide has been evaluated. The stone material showed severe degradation phenomena as: erosion, pulverisation, exfoliation. The analytical data acquired through X-ray diffraction (XRD), infrared spectrophotometry (FTIR) and scanning electron microscopy (SEM-EDX), allowed to compare the conditions of stone before and after the treatment with barium hydroxide. The presence of barium has been put in evidence mainly on the surface as barium sulphate, whereas barium is only sporadically present within the thickness of the decayed material. The treatment was judged not satisfying and its inefficacy is, most probably, due to a not suitable cleaning procedure carried out before the consolidation.
Barium and radium migration in unconsolidated Canadian geological materials
International Nuclear Information System (INIS)
Gillham, R.W.; Sharma, H.D.; Reddy, M.R.; Cooper, E.L.; Cherry, J.A.
1981-05-01
This report describes the results of laboratory studies on the distribution coefficients of radium and barium in samples of unconsolidated geologic materials. Graphs of Ksub(d) versus solution concentration for the respective elements showed constant Ksub(d) values in the low concentration range suggesting that, at low concentrations, a distribution coefficient is a valid means of representing the geochemical reactions of both barium and radium. The Ksub(d) values for barium range between 60 and 3500 ml/g. The values appear to be influenced by the amount of barium occurring naturally in the soil materials and thus there is little possiblility of using barium as an analog of radium in laboratory experiments. The Ksub(d) values of radium vary from 50 to 1000 ml/g indicating that a wide range of geological materials have a substantial capacity to retard the migration of radium
Aziz, A.; Izzudin; Mainil, A. K.
2017-09-01
The objective of this study is to compare the performance of refrigerator system using working fluid between R134a refrigerant and HCR134a as hydrocarbon refrigerant for substitution of R134a. The use of capillary tube (CT) 1.5 m with HCR134a showed that slightly better COP than among the others, due to the lower pressure of condenser, conversely thermostatic expansion valve (TEV) showed that better COP than among the others with R134a. COP of CT 1.25 m and CT 1.5 m using HCR134a increase about 42.89% and 18.09% compared to R134a, where the electric current of refrigerator system decrease about 11.63% and 10.98%. However, the COP of HCR134a with CT 2.7 m and TEV were obtained lower than R134a about 16.2% and 17.06% and the use of electric current is higher than R134a about 12.98% and 16.5%. The use of HCR134a provides a higher refrigeration effect than R134a about 66.71%-88.27% for various types of expansion devices. The results confirmed that HCR134a could be an alternative refrigerant for replacement of R134a refrigerant.
Zhang, Lin; Yang, Yi; Zhang, Ji; Zhou, Xiaowei; Dong, Hongmei; Zhou, Yiwu
2015-08-01
Barium contrast radiography is a conventional procedure aimed at revealing lesions of the alimentary tract using barium sulfate on X-ray irradiation. Although it is widely used in clinics, adverse effects and complications are observed, such as anaphylaxis, granuloma, fecalithes, abdomen-leaking, embolism, bacterial contamination, and aspiration. We report a case of death due to a massive barium sulfate aspiration resulted from an air-barium double contrast enema radiography. A 25-year-old female patient was hospitalized with symptoms of abdominal distention, nausea, vomiting and diarrhea for three days. A progressive respiratory distress presented only 1h after a small bowel air-barium double contrast enema. The patient died 11h later. The result of autopsy revealed the cause of death to be severe chemical pneumonitis induced by gastric fluid which was aspirated into her lungs. Barium sulfate is generally recognized to be chemically inert for the respiratory system, but a mixture of barium sulfate with gastric contents is fatal. Here we intend to suggest that, when determining the potential cause of death, medical examiners should consider a patient's status quo as well as the possible adverse effects and complications caused by the barium sulfate preparation during gastrointestinal radiography. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
NANOSCALE BARIUM HYDROSILICATES: CHOOSING THE SYNTHESIS TECHNOLOGY
Directory of Open Access Journals (Sweden)
GRISHINA Anna Nikolaevna
2013-08-01
Full Text Available Cement concretes are the most used materials in modern civil engineering. Due to that such materials draw great attention both in the Russian Federation and abroad. The possibility to enhance the manufacturability and operational properties of concretes results in significant reduction of overall operating costs. Many enhancement methods have been elaborated. Among them there is one based on introduction of calcium hydrosilicates into construction composition. The authors set up a hypothesis that similarity between properties and structures of different hydrosilicates (for example, alkaline earth metals and metals of the second group will provide similar increased operational characteristics. The specialists of Research and Educational Center «Nanotechnology» are developing cement composites nanomodification methods which include introduction of nanodimensional barium hydrosilicates particles. The synthesis of barium hydrosilicates particles can be done with the use of many technologies, different by energy consumption or performing complexity. Taking into account both these factors, one can assume that low-temperature sol-gel synthesis from diluted water solutions is the proper technology. The present paper shows that this assumption is correct. The selection of certain technology is made by the means of multiobjective optimization, which is in turn is performed by the means of linear scalarization. This method, while not always giving the Pareto optimal solutions, can be easily implemented. The particle size distribution is taken into consideration during selection of objectives and weights. It is shown that selected technology allows manufacturing nanoparticles with median size about 30 nm.
High resolution studies of barium Rydberg states
International Nuclear Information System (INIS)
Eliel, E.R.
1982-01-01
The subtle structure of Rydberg states of barium with orbital angular momentum 0, 1, 2 and 3 is investigated. Some aspects of atomic theory for a configuration with two valence electrons are reviewed. The Multi Channel Quantum Defect Theory (MQDT) is concisely introduced as a convenient way to describe interactions between Rydberg series. Three high-resolution UV studies are presented. The first two, presenting results on a transition in indium and europium serve as an illustration of the frequency doubling technique. The third study is of hyperfine structure and isotope shifts in low-lying p states in Sr and Ba. An extensive study of the 6snp and 6snf Rydberg states of barium is presented with particular emphasis on the 6snf states. It is shown that the level structure cannot be fully explained with the model introduced earlier. Rather an effective two-body spin-orbit interaction has to be introduced to account for the observed splittings, illustrating that high resolution studies on Rydberg states offer an unique opportunity to determine the importance of such effects. Finally, the 6sns and 6snd series are considered. The hyperfine induced isotope shift in the simple excitation spectra to 6sns 1 S 0 is discussed and attention is paid to series perturbers. It is shown that level mixing parameters can easily be extracted from the experimental data. (Auth.)
Three barium diphosphonates with 3-D structures
Tuikka, Matti; Haukka, Matti; Ahlgrén, Markku
2007-06-01
The gel crystallization method was exploited in this work in order to study the 3-D solid state structures of barium diphosphonates. This technique proved to be an effective tool for the growth of single crystals of diphosphonates for structure analysis. By using this approach, three barium diphosphonates, Ba[HO 3P(CH 2) 2PO 3H] ( 1), Ba 2[O 3P(CH 2) 3PO 3]·3H 2O ( 2) and Ba[HO 3P(CH 2) 4PO 3H] ( 3), with different three dimensional structures, were synthesized and characterized. The structures of compounds 1 and 2 were determined by single crystal X-ray diffraction and the structure of 3 by the powder diffraction method. In the structure of 1, the diphosphonate ligand is completely surrounded by the Ba atoms, which is an unusual arrangement in a diphosphonate system. The structures of 2 and 3 are more conventional. They are organized in typical pillared layers in which the separation of the layers can be adjusted by varying the length of the hydrocarbon chain.
The Novel Formation of Barium Titanate Nanodendrites
Directory of Open Access Journals (Sweden)
Chien-Jung Huang
2014-01-01
Full Text Available The barium titanate (BaTiO3 nanoparticles with novel dendrite-like structures have been successfully fabricated via a simple coprecipitation method, the so-called BaTiO3 nanodendrites (BTNDs. This method was remarkable, fast, simple, and scalable. The growth solution is prepared by barium chloride (BaCl2, titanium tetrachloride (TiCl4, and oxalic acid. The shape and size of BaTiO3 depend on the amount of added BaCl2 solvent. To investigate the influence of amount of BaCl2 on BTNDs, the amount of BaCl2 was varied in the range from 3 to 6 mL. The role of BaCl2 is found to have remarkable influence on the morphology, crystallite size, and formation of dendrite-like structures. The thickness and length of the central stem of BTND were ~300 nm and ~20 μm, respectively. The branchings were found to occur at irregular intervals along the main stem. Besides, the formation mechanism of BTND is proposed and discussed.
The 134Cs uptake by sunflower (Helianthus anuus, Less) cultivated on soil contaminated with 134Cs
International Nuclear Information System (INIS)
Poppy Intan Tjahaja; Putu Sukmabuana
2008-01-01
One of the methods for remediation of contaminated environment is phytoremediation techniques, i.e. the environmental remediation using plants. In this research the bioavailability of sunflower plant (Helianthus anuus, Less) in radiocaesium uptake from soil was studied for being considered as a phytoremediator later. Sunflower plants were cultivated on soil contaminated with 134 Cs with the concentrations of 29,3 kBq/kg ; 117,2 kBq/kg ; 557 kBq/kg for 45 days. As control the sunflowers were also cultivated on non contaminated soil. Observation was carried out every 5 days by sampling 3 plants and soils. The plant and soil samples were dried using infra red lamp for 24 hours, and then counted using gamma spectrometer. The counting results i.e. 134 Cs concentration on soil and plant parts were then analyzed to obtain transfer factor (TF) values. The highest TF values was reached on 26 th day, i.e. 0,87; 1,89 ; 2,82 for initial soil 134 Cs concentrations of 29,3 Bq/g ; 117,2 Bq/g ; 557 Bq/g, respectively. The TF values obtained expressed the capability of plants to accumulate 134 Cs from soils. The observation to the plants growth showed that the plants grew normally on the 134 Cs contaminated soil until the concentration of 557 Bq/g. The sunflower can be considered to be phytoremediator of andosol soil contaminated with Cs radionuclides. (author)
13 CFR 134.409 - Decision on appeal.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision on appeal. 134.409 Section 134.409 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.409 Decision on appeal. (a) A decision of the Administrative Law Judge under this subpart is the...
13 CFR 134.404 - Decision by Administrative Law Judge.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision by Administrative Law Judge. 134.404 Section 134.404 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... 8(a) Program § 134.404 Decision by Administrative Law Judge. Appeal proceedings brought under this...
19 CFR 134.14 - Articles usually combined.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles usually combined. 134.14 Section 134.14... TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.14 Articles usually combined. (a) Articles combined before delivery to purchaser. When an imported article is of a kind which is usually...
29 CFR 2570.134 - Consequences of default.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Consequences of default. 2570.134 Section 2570.134 Labor Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR... ERISA Section 502(c)(7) § 2570.134 Consequences of default. For 502(c)(7) civil penalty proceedings...
12 CFR 13.4 - Recommendations to customers.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Recommendations to customers. 13.4 Section 13.4... PRACTICES § 13.4 Recommendations to customers. In recommending to a customer the purchase, sale or exchange... reasonable grounds for believing that the recommendation is suitable for the customer upon the basis of the...
49 CFR 195.134 - CPM leak detection.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.134 Section 195.134... PIPELINE Design Requirements § 195.134 CPM leak detection. This section applies to each hazardous liquid... computational pipeline monitoring (CPM) leak detection system and each replaced component of an existing CPM...
Radiation doses to patients undergoing barium meal and barium enema examinations
International Nuclear Information System (INIS)
Delichas, M. G.; Hatziioannou, K.; Papanastassiou, E.; Albanopoulou, P.; Chatzi, E.; Sioundas, A.; Psarrakos, K.
2004-01-01
The radiation doses received by patients during 41 barium meal (BM) and 42 barium enema (BE) examinations in two Greek hospitals are presented. Radiation dose was measured in terms of the dose area product (DAP). The effective dose and doses to certain organs were estimated using the ODS-60 software. Mean total DAP values were found to be 25 ± 11 Gy cm 2 for BM and 60 ± 35 Gy cm 2 for BE examinations, whereas the estimated mean values of effective dose were 8.6 ± 4.0 and 24 ± 16 mSv respectively. DAP to effective dose conversion coefficients were estimated to be 0.34 mSv per Gy cm 2 for BM and 0.41 mSv per Gy cm 2 for BE. (authors)
Hydrolytic enzyme activity enhanced by Barium supplementation
Directory of Open Access Journals (Sweden)
Camilo Muñoz
2016-10-01
Full Text Available Hydrolysis of polymers is a first and often limiting step during the degradation of plant residues. Plant biomass is generally a major component of waste residues and a major renewable resource to obtain a variety of secondary products including biofuels. Improving the performance of enzymatic hydrolysis of plant material with minimum costs and limiting the use of additional microbial biomass or hydrolytic enzymes directly influences competitiveness of these green biotechnological processes. In this study, we cloned and expressed a cellulase and two esterases recovered from environmental thermophilic soil bacterial communities and characterize their optimum activity conditions including the effect of several metal ions. Results showed that supplementing these hydrolytic reactions with Barium increases the activity of these extracellular hydrolytic enzymes. This observation represents a simple but major improvement to enhance the efficiency and competitiveness of this process within an increasingly important biotechnological sector.
STS-134 Re-Rendezvous Design History
Stuit, Timothy D.
2011-01-01
In preparation to provide the capability for the Orion spacecraft to rendezvous with the International Space Station (ISS), a new suite of relative navigation sensors are in development and will be tested on one of the final Space Shuttle missions to ISS. The National Aeronautics and Space Administration (NASA) commissioned a flight test of prototypes of the instruments on STS-134, in order to test their performance in the space environment during the nominal rendezvous and docking, as well as a re-rendezvous dedicated to testing the prototype sensors following the undocking of the Space Shuttle Orbiter at the end of the mission. Unlike the initial rendezvous and docking, the re-rendezvous profile would replicate the newly designed Orion coelliptic approach trajectory, something never before attempted with the Shuttle Orbiter. Therefore, there were a number of new parameters that needed to be conceived of, designed, and tested for this re-rendezvous to make the flight test successful. And all of this work had to be integrated with the normal operations of the ISS and Shuttle and had to conform to the constraints of the mission and vehicles. The result of this work is a separation and re-rendezvous trajectory design that will prove not only the design of the relative navigation sensors for the Orion vehicle, but also will serve as a proof of concept for the Orion rendezvous trajectory itself. This document presents the analysis and decision making process involved in attaining the final STS-134 re-rendezvous design.
The Karlsruhe 4π barium fluoride detector
International Nuclear Information System (INIS)
Wisshak, K.; Guber, K.; Kaeppeler, F.; Krisch, J.; Mueller, H.; Rupp, G.; Voss, F.
1989-12-01
A new experimental approach has been implemented for accurate measurements of neutron capture cross sections in the energy range from 5 to 200 keV. The Karlsruhe 4π Barium Fluoride Detector consists of 42 crystals shaped as hexagonal and pentagonal truncated pyramids forming a spherical shell with 10 cm inner radius and 15 cm thickness. All crystals are supplied with reflector and photomultiplier, thus representing independent gamma-ray detectors. Each detector module covers the same solid angle with respect to a gamma-ray source located in the centre. The energy resolution of the 4π detector is 14% at 662 keV and 7% at 2.5 MeV gamma-ray energy, the overall time reslution is 500 ps and the peak efficiency 90% at 1 MeV. The detector allows to register capture cascades with 95% probability above a threshold energy of 2.5 MeV in the sum energy spectrum. Neutrons are produced via the 7 Li(p,n) 7 Be reaction using the pulsed proton beam of a Van de Graaff accelerator. The neutron spectrum can be taylored according to the experimental requirements in an energy range from 5 to 200 keV by choosing appropriate proton energies. A collimated neutron beam is passing through the detector and hits the sample in the centre. The energy of captured neutrons is determined via time of flight, the primary flight path being 77 cm. The combination of short primary flight path, a 10 cm inner radius of the spherical BaF 2 shell, and the low capture cross section of barium allows to discriminate background due to capture of sample scattered neutrons in the scintillator by time of flight, leaving part of the neutron energy range completely undisturbed. (orig./HSI) [de
Solar Twins and the Barium Puzzle
International Nuclear Information System (INIS)
Reddy, Arumalla B. S.; Lambert, David L.
2017-01-01
Several abundance analyses of Galactic open clusters (OCs) have shown a tendency for Ba but not for other heavy elements (La−Sm) to increase sharply with decreasing age such that Ba was claimed to reach [Ba/Fe] ≃ +0.6 in the youngest clusters (ages < 100 Myr) rising from [Ba/Fe] = 0.00 dex in solar-age clusters. Within the formulation of the s -process, the difficulty to replicate higher Ba abundance and normal La−Sm abundances in young clusters is known as the barium puzzle. Here, we investigate the barium puzzle using extremely high-resolution and high signal-to-noise spectra of 24 solar twins and measured the heavy elements Ba, La, Ce, Nd, and Sm with a precision of 0.03 dex. We demonstrate that the enhanced Ba ii relative to La−Sm seen among solar twins, stellar associations, and OCs at young ages (<100 Myr) is unrelated to aspects of stellar nucleosynthesis but has resulted from overestimation of Ba by standard methods of LTE abundance analysis in which the microturbulence derived from the Fe lines formed deep in the photosphere is insufficient to represent the true line broadening imposed on Ba ii lines by the upper photospheric layers from where the Ba ii lines emerge. Because the young stars have relatively active photospheres, Ba overabundances most likely result from the adoption of a too low value of microturbulence in the spectrum synthesis of the strong Ba ii lines but the change of microturbulence in the upper photosphere has only a minor affect on La−Sm abundances measured from the weak lines.
Solar Twins and the Barium Puzzle
Energy Technology Data Exchange (ETDEWEB)
Reddy, Arumalla B. S.; Lambert, David L., E-mail: bala@astro.as.utexas.edu [W.J. McDonald Observatory and Department of Astronomy, The University of Texas at Austin, Austin, TX 78712-1205 (United States)
2017-08-20
Several abundance analyses of Galactic open clusters (OCs) have shown a tendency for Ba but not for other heavy elements (La−Sm) to increase sharply with decreasing age such that Ba was claimed to reach [Ba/Fe] ≃ +0.6 in the youngest clusters (ages < 100 Myr) rising from [Ba/Fe] = 0.00 dex in solar-age clusters. Within the formulation of the s -process, the difficulty to replicate higher Ba abundance and normal La−Sm abundances in young clusters is known as the barium puzzle. Here, we investigate the barium puzzle using extremely high-resolution and high signal-to-noise spectra of 24 solar twins and measured the heavy elements Ba, La, Ce, Nd, and Sm with a precision of 0.03 dex. We demonstrate that the enhanced Ba ii relative to La−Sm seen among solar twins, stellar associations, and OCs at young ages (<100 Myr) is unrelated to aspects of stellar nucleosynthesis but has resulted from overestimation of Ba by standard methods of LTE abundance analysis in which the microturbulence derived from the Fe lines formed deep in the photosphere is insufficient to represent the true line broadening imposed on Ba ii lines by the upper photospheric layers from where the Ba ii lines emerge. Because the young stars have relatively active photospheres, Ba overabundances most likely result from the adoption of a too low value of microturbulence in the spectrum synthesis of the strong Ba ii lines but the change of microturbulence in the upper photosphere has only a minor affect on La−Sm abundances measured from the weak lines.
Experimental evaluation of automotive air-conditioning using HFC-134a and HC-134a
Nasution, Henry; Zainudin, Muhammad Amir; Aziz, Azhar Abdul; Latiff, Zulkarnain Abdul; Perang, Mohd Rozi Mohd; Rahman, Abd Halim Abdul
2012-06-01
An experimental study to evaluate the energy consumption of an automotive air conditioning is presented. In this study, these refrigerants will be tested using the experimental rig which simulated the actual cars as a cabin complete with a cooling system component of the actual car that is as the blower, evaporator, condenser, radiators, electric motor, which acts as a vehicle engine, and then the electric motor will operate the compressor using a belt and pulley system, as well as to the alternator will recharge the battery. The compressor working with the fluids HFC-134a and HC-134a and has been tested varying the speed in the range 1000, 1500, 2000 and 2500 rpm. The measurements taken during the one hour experimental periods at 2-minutes interval times for temperature setpoint of 20°C with internal heat loads 0, 500, 700 and 1000 W. The final results of this study show an overall better energy consumption of the HFC-134a compared with the HC-134a.
Barium isotope composition of altered oceanic crust from the IODP Site 1256 at the East Pacific Rise
Nan, X.; Yu, H.; Gao, Y.
2017-12-01
To understand the behavior of Ba isotopes in the oceanic crust during seawater alteration, we analyzed Ba isotopes for altered oceanic crust (AOC) from the IODP Site 1256 at the East Pacific Rise (EPR). The samples include 33 basalts, 5 gabbros, and 1 gabbronorite. This drill profile has four sections from top to bottom, including the volcanic section, transition zone, sheeted dyke complex, and plutonic complex. They display various degrees of alteration with obviously variable temperatures and water/rock ratios (Gao et al., 2012). The volcanic section is slightly to moderately altered by seawater at 100 to 250°; the transition zone is a mixing zone between upwelling hydrothermal fluids and downwelling seawater; and the sheeted dyke complex and plutonic complex are highly altered by hydrothermal fluids (˜250°). Ba isotopes were analyzed on a Neptune Plus MC-ICP-MS at the University of Science and Technology of China. The long-term precision of δ137/134Ba is better than 0.04‰ (2SD). The δ137/134Ba of the volcanic section and the top of the transition zone range between -0.01 and 0.30‰, higher than the δ137/134Ba of fresh MORB and upper mantle (0.020 ± 0.021‰, 2SE, Huang et al., 2015). Similarly, the δ137/134Ba of the sheeted dyke complex ranges from 0.05 to 0.28‰. The plutonic section has δ137/134Ba from -0.17 to -0.05‰, which is lower than the upper mantle, with one exception that has δ137/134Ba of 0.19‰. No correlation exists between Ba contents and δ137/134Ba. The weighted average δ137/134Ba of the AOC samples is 0.13±0.04‰ (2SE), significantly higher than that of the upper mantle. In all, our AOC data reveal obvious Ba isotopic fractionation, reflecting alteration of the AOC by hydrothermal fluids and seawater. The obvious difference of Ba isotope composition between the AOC and the upper mantle further indicates that recycling of the AOC could result in Ba isotope heterogeneity of the mantle. References: Gao Y, Vils F, Cooper K M, et
Barium ferrite nanoparticles prepared by self-propagating low ...
Indian Academy of Sciences (India)
Administrator
Kubo et al 1982; Lucchini et al 1983), hydrothermal. (Barb et al 1986), microemulsion ... combustion route employing metal oxalate precursors. In search of a suitable ... heptahydrate/barium nitrate and oxalic acid were dis- solved in minimum ...
Late changes in barium sulfate aspiration: HRCT features
International Nuclear Information System (INIS)
Voloudaki, A.; Ergazakis, N.; Gourtsoyiannis, N.
2003-01-01
Aspiration of barium sulfate occurs accidentally. Lung reaction is usually mild in the early phase due to inert character of the substance and long-term reactions or late toxicities are not expected. Little if any fibrotic response is speculated. We present a case with barium aspiration, studied by high-resolution computed tomography (HRCT) 1 year after the event, as late pulmonary sequelae studied by CT have not been described yet, to the best of our knowledge. The HRCT revealed thickened interlobular septa, subpleural lines, subpleural cysts, and centrilobular micronodules along with barium particles in a subpleural distribution. Those findings indicated that barium is capable of producing mild though silent clinically fibrosis. (orig.)
Synthesis, photoluminescence and magnetic properties of barium vanadate nanoflowers
International Nuclear Information System (INIS)
Xu, Jing; Hu, Chenguo; Xi, Yi; Peng, Chen; Wan, Buyong; He, Xiaoshan
2011-01-01
Graphical abstract: The flower-shaped barium vanadate was obtained for the first time. The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. Research highlights: → In the paper, the flower-shaped barium vanadate were obtained for the first time. The CHM method used here is new and simple for preparation of barium vanadate. → The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. The strong bluish-green emission was observed. → The ferromagnetic behavior of the barium vanadate nanoflowers was found with saturation magnetization of about 83.50 x 10 -3 emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10 -3 emu/g. → The mechanisms of PL and magnetic property of barium vanadate nanoflowers have been discussed. -- Abstract: The flower-shaped barium vanadate has been obtained by the composite hydroxide mediated (CHM) method from V 2 O 5 and BaCl 2 at 200 o C for 13 h. XRD and XPS spectrum of the as-synthesized sample indicate it is hexagonal Ba 3 V 2 O 8 with small amount of Ba 3 VO 4.8 coexistence. Scan electron microscope and transmission electron microscope display that the flower-shaped crystals are composed of nanosheets with thickness of ∼20 nm. The UV-visible spectrum shows that the barium vanadate sample has two optical gaps (3.85 eV and 3.12 eV). Photoluminescence spectrum of the barium vanadate flowers exhibits a visible light emission centered at 492 and 525 nm which might be attributed to VO 4 tetrahedron with T d symmetry in Ba 3 V 2 O 8 . The ferromagnetic behavior of the barium vanadate nanoflowers has been found with saturation magnetization of about 83.50 x 10 -3 emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10 -3 emu/g, which is mainly due to the presence of a non-orthovanadate phase with spin S = 1/2.
Cost-effectiveness of barium enemas performed by radiographers
International Nuclear Information System (INIS)
Brown, Lorraine; Desai, Sharad
2002-01-01
AIM: To assess the cost-effectiveness of barium enemas performed by radiographers compared to those performed by consultant radiologists. METHOD: Prospective study of 200 barium enemas carried out by a senior radiographer and a consultant radiologist. The sample was a consecutive sample of adult out-patients over a 3-month period, with no exclusion. The length of time of the enema and the numbers and grades of staff involved in the procedure were recorded. This was translated into staffing costs using the appropriate pay scales. RESULTS: The barium enemas performed by the superintendent radiographer were more cost-effective than those performed by the consultant radiologist (1406 pounds for 100 radiographer-performed barium enemas compared to 1787 pounds for 100 carried out by the consultant radiologist). CONCLUSION: In terms of staffing costs, radiographers performing barium enemas not only liberates radiologist time, it is also a cost-effective method of providing an out-patient barium enema service. Brown, L. and Desai, S. (2002)
Jabłońska, M; Kramarczyk, M; Smieja-Król, B; Janeczek, J
2016-03-01
Concentrations of Ba, Zn, Pb, Fe, and Mn were determined by atomic absorption spectroscopy in freshly cast antlers from male roe deer of different ages (2 to 4 years old and older than 4 years) collected in Balin near Chrzanów and in the vicinity of Żywiec, S Poland. Barium content ranged from 124 to 196 ppm (mean 165 ppm) in the Balin 12 samples and from 207 to 351 ppm (mean 287 ppm) in 3 antlers from Żywiec. The concentration of Ba was comparable to that of Zn (134-275 ppm, mean 169 ppm). Elevated concentrations of Ba in antlers most probably originated from direct uptake of airborne barite nanocrystals through the respiratory system and/or by digestion of barite-rich dust particles deposited on plants. Burning of Ba-enriched coals is regarded as the principal source of Ba in the investigated areas inhabited by roe deer. Increased concentrations of Ba in antlers from the Żywiec area compared to Balin reflect particularly high air pollution caused by coal-burning mostly for domestic purposes combined with an unfavorable topography that impedes efficient air circulation.
Kitajima, Toshihiro; Tomizawa, Kenji; Hanaoka, Yutaka; Toda, Shigeo; Matoba, Shuichiro; Kuroyanagi, Hiroya; Oota, Yasunori
2014-11-01
Anastomotic stricture reportedly often recurs following barium peritonitis, regardless of whether the anastomotic diameter is initially sufficient. However, the causes of repetitive stricture have not been clarified. We report a case that suggests the pathophysiology of recurrent anastomotic strictures following barium peritonitis. The patient was a 39-year-old Japanese man with idiopathic perforation of the descending colon after undergoing an upper gastrointestinal barium contrast study. After emergency peritoneal lavage and diverting colostomy, created using the perforated region, the patient recovered uneventfully and 3 months later, the colostomy was closed and the perforated colon was resected. However, 7 months after colostomy closure, abdominal distention gradually developed, and colonoscopy revealed an anastomotic stricture. The patient was referred to our hospital where he underwent resection of the anastomotic stricture. The surgical specimen exhibited barium granulomas not only in the subserosa of the entire specimen, but also in the submucosa and lamina propria localized in the anastomotic site. These findings suggest that barium was embedded in the submucosa and lamina propria with manipulation of the stapled anastomosis and that the barium trapped in the anastomotic site caused persistent inflammation, resulting in an anastomotic stricture.
International Nuclear Information System (INIS)
Ducharme, S.; Feinberg, J.; Neurgaonkar, R.R.
1987-01-01
The authors measured the low-frequency (''unclamped'') electrooptic and piezoelectric coefficients in undoped BaTiO/sub 3/ and Sr/sub x/Ba/sub 1-x/Nb/sub 2/O/sub 6/ (chi - 0.61) crystals using interferometric techniques. The contribution of the piezoelectric effect to the Pockels measurement is discussed. For an applied ac electric field in the range 0.1-200 V/cm, the electrooptic and piezoelectric effects are linear in the magnitude of of the applied field and independent of its frequency in the range of 10 Hz-100 kHz. The unclamped electrooptic coefficients of poled BaTiO/sub 3/ single crystals are r/sub 13/ = 19.5 +- 1 pm/V and r/sub 33/ = 97 +- 7 pm/V, and for strontium barium niobate are r/sub 13/ = 47 +- 5 pm/V and r/sub 33/ = 235 +- 21 pm/V, all measured at a wavelength of 514.5 nm and at T = 23 0 C. For the barium titanate samples the measured Pockels coefficient r/sub c/ identical to r/sub 33/ - (n/sub 1//n/sub 3/)/sup 3/r/sub 13/ = 79 +- 6 pm/V in good agreement with the value r/sub c/ = 76 +- 7 pm/V computed from the above values of r/sub 13/ and r/sub 33/, where n/sub 1/ and n/sub 3/ are the ordinary and extraordinary indexes of refraction, respectively. The measured piezoelectric coefficient is d/sub 23/ = +28.7 +- 2 pm/V for barium titanate, and is d/sub 23/ = +24.6 +- 2 pm/V for strontium barium niobate. They also measured the photoreflective coupling of two optical beams in the crystals, and they show that the dependence of the coupling strength on beam polarization is in fair agreement with the measured values of the Pockels coefficients
Barium low concentration determination in solutions using X rays energy spectrometry
International Nuclear Information System (INIS)
Barbosa, Joao Batista Santos; Pereira, Jose dos Santos Jorge
1999-01-01
This work was proposed to establish an analytical methodology for barium determination in samples from the Waste Supervision of CDTN. Barium is the focus here because it has the same chemical behaviour as radium. Therefore, barium can replace it as an inactive tracer in contention matrix studies. The methodology is made up of two phases; physical concentration and barium determination by an Energy Dispersive Spectrometer using an Am 241 photon excitation system. A very good set of results is found when Am 241 is used in fluorescing barium atoms. This fact, in addition to the physical concentration process, allows to detect up 12 ppb of elementary barium. (author)
Directory of Open Access Journals (Sweden)
Hirofumi Kojima
2017-01-01
Conclusion: Residual barium in the intraperitoneal cavity causes persistent inflammatory reaction in patients with barium peritonitis. The use of steroids is effective for postoperative persistent inflammation due to the residual barium.
High H⁻ ionic conductivity in barium hydride.
Verbraeken, Maarten C; Cheung, Chaksum; Suard, Emmanuelle; Irvine, John T S
2015-01-01
With hydrogen being seen as a key renewable energy vector, the search for materials exhibiting fast hydrogen transport becomes ever more important. Not only do hydrogen storage materials require high mobility of hydrogen in the solid state, but the efficiency of electrochemical devices is also largely determined by fast ionic transport. Although the heavy alkaline-earth hydrides are of limited interest for their hydrogen storage potential, owing to low gravimetric densities, their ionic nature may prove useful in new electrochemical applications, especially as an ionically conducting electrolyte material. Here we show that barium hydride shows fast pure ionic transport of hydride ions (H(-)) in the high-temperature, high-symmetry phase. Although some conductivity studies have been reported on related materials previously, the nature of the charge carriers has not been determined. BaH2 gives rise to hydride ion conductivity of 0.2 S cm(-1) at 630 °C. This is an order of magnitude larger than that of state-of-the-art proton-conducting perovskites or oxide ion conductors at this temperature. These results suggest that the alkaline-earth hydrides form an important new family of materials, with potential use in a number of applications, such as separation membranes, electrochemical reactors and so on.
Barium enema in frail elderly patients.
Segal, R; Khahil, A; Leibovitz, A; Gil, I; Annuar, M; Habot, B
2000-01-01
Barium enema (BE) examinations for the investigation of suspected colonic disease are often unsuccessful in elderly patients. The purpose of this study was to evaluate the success rate of BE in hospitalized frail elderly patients. Four hundred and seventy-two elderly patients hospitalized for different reasons underwent BE examinations. The medical charts and radiological reports were retrospectively reviewed. One hundred and ninety-two (41%) BE examinations were considered inadequate; mostly (32%) because of inappropriate preparation. Sixty-seven patients (14%) were not cooperative and could not retain the contrast material, and in 25 patients (5%), the examination failed due to both these reasons. The characteristics associated with unsuccessful BE examination were the mean number of medical problems (p < 0.001), the mean number of scheduled medications (p < 0.05) and in particular the long-term use of laxatives (p < 0.01) or antiparkinsonian drugs (p < 0.01). Of great significance in predicting an inadequate BE were the patient's functional status (p < 0.001) and the presence of dementia (p < 0.001). The high percentage of unsuccessful BEs in the frail elderly suggests that clinicians should carefully consider the need for that examination in these patients. We suggest that only in patients where there is a clear suspicion of a bleeding or obstructing tumor should a BE examination be performed, and even in these cases, colonoscopy or CT may be preferable as the initial examination in the frail elderly. Copyright 2000 S. Karger AG, Basel
Optical properties of calcium barium niobate
Energy Technology Data Exchange (ETDEWEB)
Heine, Urs; Betzler, Klaus [Department of Physics, University of Osnabrueck (Germany); Burianek, Manfred; Muehlberg, Manfred [Institute of Crystallography, University of Cologne (Germany)
2010-07-01
We report on optical measurements on the novel tungsten bronze type calcium barium niobate. [001]-oriented transparent and colorless single crystals were grown by the Czochralski method with dimensions of 12 mm in diameter and about 80 mm in length. With its relatively high Curie temperature of about 538 K for the congruently melting composition of 28.1 mole% calcium and its high nonlinear coefficients, CBN is a promising material for future applications. Recent experiments revealed, that the application of an external electric field of several kV/cm to CBN at room temperature leads to an increasing opacity of the sample. This might be a drawback considering the future usability of CBN in optical systems. We present investigations on the transmittance behaviour of CBN under external electric fields, demonstrating the erasement of the clouding without affecting the polarization. Experiments have been performed at temperatures ranging from room temperature to approximately 480 K. When heating up the sample, its colorless appearance changes to a light yellow, which can be attributed to a shift of the band edge to longer wavelengths with increasing temperature. To further investigate the transmittance properties of CBN, measurements of the band edge under various temperatures up to the ferroelectric phase transition have been performed.
Effectiveness of therapeutic barium enema for diverticular hemorrhage.
Matsuura, Mizue; Inamori, Masahiko; Nakajima, Atsushi; Komiya, Yasuhiko; Inoh, Yumi; Kawasima, Keigo; Naitoh, Mai; Fujita, Yuji; Eduka, Akiko; Kanazawa, Noriyoshi; Uchiyama, Shiori; Tani, Rie; Kawana, Kennichi; Ohtani, Setsuya; Nagase, Hajime
2015-05-14
To evaluate the effectiveness of barium impaction therapy for patients with colonic diverticular bleeding. We reviewed the clinical charts of patients in whom therapeutic barium enema was performed for the control of diverticular bleeding between August 2010 and March 2012 at Yokohama Rosai Hospital. Twenty patients were included in the review, consisting of 14 men and 6 women. The median age of the patients was 73.5 years. The duration of the follow-up period ranged from 1 to 19 mo (median: 9.8 mo). Among the 20 patients were 11 patients who required the procedure for re-bleeding during hospitalization, 6 patients who required it for re-bleeding that developed after the patient left the hospital, and 3 patients who required the procedure for the prevention of re-bleeding. Barium (concentration: 150 w%/v%) was administered per the rectum, and the leading edge of the contrast medium was followed up to the cecum by fluoroscopy. After confirmation that the ascending colon and cecum were filled with barium, the enema tube was withdrawn, and the patient's position was changed every 20 min for 3 h. Twelve patients remained free of re-bleeding during the follow-up period (range: 1-19 mo) after the therapeutic barium enema, including 9 men and 3 women with a median age of 72.0 years. Re-bleeding occurred in 8 patients including 5 men and 3 women with a median age of 68.5 years: 4 developed early re-bleeding, defined as re-bleeding that occurs within one week after the procedure, and the remaining 4 developed late re-bleeding. The DFI (disease-free interval) decreased 0.4 for 12 mo. Only one patient developed a complication from therapeutic barium enema (colonic perforation). Therapeutic barium enema is effective for the control of diverticular hemorrhage in cases where the active bleeding site cannot be identified by colonoscopy.
The diagnostic value of barium enema in acute appendicitis
International Nuclear Information System (INIS)
Kim, Yong Ga; Chung, Duck Soo; Kim, Ok Dong
1986-01-01
Acute appendicitis is the most common acute surgical condition of the abdomen. When the clinical presentation is atypical, barium enema has proven to be safe and useful in confirming the diagnosis and reducing the negative surgical exploration. However, the performance of barium enema in acute appendicitis has known contraindication primarily because of fear of leakage by perforation of the inflamed appendix. This study using barium enema as a diagnostic aid in acute appendicitis with atypical clinical presentation was performed to further support the previously noted efficacy and safety of this procedure. The results were as followings: 1. In case of acute appendicitis with atypical clinical presentation, the use of barium enema as a diagnostic aid increased the accuracy of diagnosis and decreased the negative surgical exploration. In women between 11 to 50 years old age, especially, it played important role differentiating appendicitis from nonsurgical acute abdomen. 2. The results of the study were 92.31% in sensitivity, 7.69% in false positive, 6.9% in false negative, and 10.26% in negative appendectomy. 3. None of case of leakage of barium by perforation of the inflamed appendix was noted, therefore, barium enema was thought to be safe as a diagnostic aid in acute appendicitis. 4. A simple partial or non filling of appendix without other associated positive finding could not exclude appendicitis, therefore, close clinical observation was necessary. 5. The positive findings of barium enema and their sensitivity were as followings: 1. Non filling of appendix: 90% 2. Partial filling of appendix: 91.7% 3. Displacement or a local impression on terminal ileum: 100%
Fabry-Perot measurements of barium temperature in fluorescent lamps
International Nuclear Information System (INIS)
Hadrath, S; Garner, R
2010-01-01
A scanning Fabry-Perot interferometer (FPI) is used to determine the temperature of barium atoms that are liberated from the electrodes of fluorescent lamps during their steady-state operation. Barium, a constituent of the work function lowering emitter material that is placed on the tungsten coil that forms the electrode, is liberated primarily by evaporation from the hot (∼1300 K) thermionic electrode. However, there may be situations or modes of operation in which barium is, in addition, sputtered, a condition which may lead to increased end-darkening, shortened life and increased mercury consumption in the lamp. Using the FPI diagnostic, the occurrence of sputtering is inferred when barium temperatures are much greater than the electrode temperature. The FPI diagnostic senses resonance radiation (λ = 553 nm) emitted by barium atoms excited in the low pressure discharge environment, and infers temperature from the Doppler broadened linewidth. The diagnostic has proven to be successful in a number of situations. Measurements have been made on rare gas discharges and on Hg-argon discharges for different discharge currents, gas pressures and auxiliary coil currents. Measurements are phase resolved for ac-driven discharges.
Air (CO2) double-contrast barium enteroclysis.
Maglinte, Dean D T; Kohli, Marc D; Romano, Stefania; Lappas, John C
2009-09-01
In the 1980s and 1990s in North America and Europe, air (CO(2)) double-contrast barium enteroclysis took a back seat to biphasic methylcellulose double-contrast enteroclysis in the investigation of small-bowel diseases. The widespread application of capsule endoscopy in the 21st century has identified a number of limitations of radiologic examinations in the investigation of mucosal diseases of the small intestine. Evidence-based studies comparing barium, computed tomographic (CT), and magnetic resonance (MR) enteroclysis have shown that in spite of improvements in small-bowel examination methods using CT and MR, barium examinations remain superior in the depiction of mucosal abnormalities, particularly the apthoid lesions of early Crohn disease. Barium small-bowel examinations have been recommended in the patient with a negative CT or MR enteroclysis study where the pretest probability of Crohn disease is high. A recent prospective comparison of methylcellulose double-contrast barium enteroclysis to capsule endoscopy with review of the literature has shown that air enteroclysis depicts mucosal details better than does methylcellulose double-contrast enteroclysis because of the "washout" effect of methylcellulose on superficial mucosal features. Recent articles have shown that air enteroclysis compares favorably with wireless capsule endoscopy and double-balloon endoscopy in the diagnosis of mucosal abnormalities of the small bowel. This article describes the authors' technique of performing air double-contrast enteroclysis, its clinical indications, and its pitfalls.
Creating unstable velocity-space distributions with barium injections
International Nuclear Information System (INIS)
Pongratz, M.B.
1983-01-01
Large Debye lengths relative to detector dimensions and the absence of confining walls makes space an attractive laboratory for studying fundamental theories of plasma instabilities. However, natural space plasmas are rarely found displaced from equilibrium enough to permit isolation and diagnosis of the controlling parameters and driving conditions. Furthermore, any plasma or field response to the departure from equilibrium can be masked by noise in the natural system. Active experiments provide a technique for addressing the chicken or egg dilemma. Early thermite barium releases were generally conducted at low altitudes from sounding rockets to trace electric fields passively or to study configuration-space instabilities. One can also study velocity-space instabilities with barium releases. Neutral barium vapor releases wherein a typical speed greatly exceeds the thermal speed can be used to produce barium ion velocity-space distributions that should be subject to a number of microinstabilities. We examine the ion velocity-space distributions resulting from barium injections from orbiting spacecraft and shaped-charges
Barium Depletion in the NSTAR Discharge Cathode After 30,000 Hours of Operation
Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira
2010-01-01
Dispenser hollow cathodes rely on a consumable supply of barium released by impregnant materials in the pores of a tungsten matrix to maintain a low work function surface. Examinations of cathode inserts from long duration ion engine tests show deposits of tungsten at the downstream end that appear to block the flow of barium from the interior. In addition, a numerical model of barium transport in the insert plasma indicates that the barium partial pressure in the insert may exceed the equilibrium vapor pressure of the dominant barium-producing reaction, and it was postulated previously that this would suppress barium loss in the upstream part of the insert. New measurements of the depth of barium depletion from a cathode insert operated for 30,352 hours reveal that barium loss is confined to a narrow region near the downstream end, confirming this hypothesis.
Controlling Barium Sulphate Scale Deposition Problems in an unbleached Kraft Paper Mill
CSIR Research Space (South Africa)
Sithole, Bruce
2015-06-01
Full Text Available Troubleshooting of scale deposits and defects in paper samples showed that the problem was caused by barium sulphate and calcium sulphate scales. However, it was ascertained that barium sulphate was more of a concern than calcium sulphate...
19 CFR 134.43 - Methods of marking specific articles.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Methods of marking specific articles. 134.43...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.43 Methods of marking specific articles. (a) Marking previously required by certain provisions of the...
19 CFR 134.54 - Articles released from Customs custody.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles released from Customs custody. 134.54...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.54 Articles... value of the articles not properly marked or redelivered. (b) Failure to petition for relief. A written...
40 CFR 86.134-96 - Running loss test.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Running loss test. 86.134-96 Section... Heavy-Duty Vehicles; Test Procedures § 86.134-96 Running loss test. (a) Overview. Gasoline- and methanol-fueled vehicles are to be tested for running loss emissions during simulated high-temperature urban...
Behaviour of 134Cs in the aquatic ecosystems
International Nuclear Information System (INIS)
Xu Yinliang; Chen Chuanqun
1992-07-01
The diminution of 134 Cs in the aquatic phases and the absorption of 134 Cs by aquatic lives observe the exponential expression. i.e. Y Ae be . The relationships between the enrichment factor of 134 Cs(K) and the time(t) in the aquatic lives can be represented by a linear equation, K A + Bt. The value of K in the Alternanthera philoxeroides was about 560. That can be used for monitoring and purifying the water phase contaminated by 134 Cs. Fish can absorb 134 Cs from water phase and store it in liver and kidney. The specific activity of 134 Cs in fish flesh was low but the percentage of radioactivity was high that was about 30% of total radioactivity in the fish. River mud can strongly absorb 134 Cs and reduce the absorption by aquatic lives. It is a good adsorbent and purifying agent with low cost for treatment of 134 Cs. The K + can prevent aquatic lives from absorbing Cs + because of antagonistic function
41 CFR 105-53.134 - Office of Administration.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office of Administration. 105-53.134 Section 105-53.134 Public Contracts and Property Management Federal Property Management... Associate Administrator for Administration, participates in the executive leadership of the agency...
2010-01-01
... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false [Reserved] 3.134-3.135 Section 3.134-3.135 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...
42 CFR 84.134 - Respirator containers; minimum requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.134... Respirators § 84.134 Respirator containers; minimum requirements. Supplied-air respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type and...
13 CFR 134.209 - Requirement of signature.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Requirement of signature. 134.209 Section 134.209 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... of signature. Every written submission to OHA, other than evidence, must be signed by the party...
13 CFR 134.713 - When is the record closed?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When is the record closed? 134.713 Section 134.713 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...
13 CFR 134.702 - Who may appeal?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who may appeal? 134.702 Section 134.702 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...
Direct and indirect contamination of tree crops with Cs-134
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Arapis, G.; Haidouti, C.
1996-01-01
A long term glasshouse pot experiment was established in 1994 to study the transfer factors of Cs-134 from soil to olive and orange trees for which no relevant data are available. A calcareous-heavy textured and an acid-light textured soil were used in this experiment. Results from two year's experimentation are considered in this study. The ability of the studied plant species for Cs-134 root uptake seems to be significantly influenced by soil type. The contamination of both tree species grown on calcareous and heavy soil was very low and did not change much with the time. On the contrary, trees grown on acid and light soil showed much higher Cs-134 concentration (up to 34 times for orange and 23 for olive trees) which significantly increased with the time. Both olive and orange trees showed a similar behaviour in the studied soils. Effort was also made to study the long term consequences of the direct contamination in a field experiment where an olive tree was contaminated by dry deposition with Cs-134. Six months after contamination 5 % of the Cs-134 deposited on the leaves was measured in the first olive production. However, very small quantities (= 0.5 %) of the olive Cs-134 was detected in the unprocessed olive oil. The following year 15 % of the Cs-134 remained in the leaves while extremely low quantities of Cs-134 were detected in either olives or olive oil. (author)
22 CFR 134.30 - Payment of award.
2010-04-01
... will pay the amount awarded to the applicant within 60 days, unless judicial review of the award or of... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Payment of award. 134.30 Section 134.30 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS EQUAL ACCESS TO JUSTICE ACT; IMPLEMENTATION Procedures for...
Selectivity in biomineralization of barium and strontium.
Krejci, Minna R; Wasserman, Brian; Finney, Lydia; McNulty, Ian; Legnini, Daniel; Vogt, Stefan; Joester, Derk
2011-11-01
The desmid green alga Closterium moniliferum belongs to a small number of organisms that form barite (BaSO(4)) or celestite (SrSO(4)) biominerals. The ability to sequester Sr in the presence of an excess of Ca is of considerable interest for the remediation of (90)Sr from the environment and nuclear waste. While most cells dynamically regulate the concentration of the second messenger Ca(2+) in the cytosol and various organelles, transport proteins rarely discriminate strongly between Ca, Sr, and Ba. Herein, we investigate how these ions are trafficked in C. moniliferum and how precipitation of (Ba,Sr)SO(4) crystals occurs in the terminal vacuoles. Towards this goal, we simultaneously visualize intracellular dynamics of multiple elements using X-ray fluorescence microscopy (XFM) of cryo-fixed/freeze-dried samples. We correlate the resulting elemental maps with ultrastructural information gleaned from freeze-fracture cryo-SEM of frozen-hydrated cells and use micro X-ray absorption near edge structure (micro-XANES) to determine sulfur speciation. We find that the kinetics of Sr uptake and efflux depend on external Ca concentrations, and Sr, Ba, and Ca show similar intracellular localization. A highly ion-selective cross-membrane transport step is not evident. Based on elevated levels of sulfate detected in the terminal vacuoles, we propose a "sulfate trap" model, where the presence of dissolved barium leads to preferential precipitation of (Ba,Sr)SO(4) due to its low solubility relative to SrSO(4) and CaSO(4). Engineering the sulfate concentration in the vacuole may thus be the most direct way to increase the Sr sequestered per cell, an important consideration in using desmids for phytoremediation of (90)Sr. Copyright © 2011 Elsevier Inc. All rights reserved.
Occupational doses in pediatric barium meal procedures
International Nuclear Information System (INIS)
Filipov, D.; Schelin, H.R.; Denyak, V.; Legnani, A.; Ledesma, J.A.; Paschuk, S.A.; Sauzen, J.; Yagui, A.; Hoff, G.; Khoury, H.J.
2015-01-01
Ionizing radiation has become an indispensable tool when it comes to diagnosis and therapy. However, its use should happen in a rational manner, taking into account the risks to which the staff is being exposed. Barium meal (BM), or upper gastrointestinal (GI) studies, using fluoroscopy, are widely used for gastroesophageal reflux disease diagnostic in children and professionals are required to stay inside the examination room to position and immobilize pediatric patients during the procedure. Therefore, it is very important that proffessionals strictly follow the technical standards of radiation protection. According to the ICRP and the NCRP recommendations, the annual limit equivalent doses for eyes, thyroid and hands are, espectively, 20 mSv, 150 mSv and 500 mSv. Based on those data, the aim of the current study is to estimate the annual equivalent dose for eyes, thyroid and hands of professionals who perform BM procedures in children. This was done using properly package LiF:Mg,Cu,P thermoluminescent dosimeters in 37 procedures; 2 pairs were positioned near each staff´s eye, 2 pairs on each professional´s neck (on and under the lead protector) and 2 pairs on both staff´s hands. The range of the estimative annual equivalent doses, for eyes, thyroid and hands, are, respectively: 14 – 36 mSv, 7 – 22 mSv and 14 – 58 mSv. Only the closest staff to the patient exceeded the annual equivalent doses in the eyes (around 80% higher than the limit set by ICRP). However, the results from this study, for hands and thyroid, compared to similar studies, show higher values. Therefore, the optimization implementation is necessary, so that the radiation levels can be reduced. (authors)
Fabrication and properties of yttrium doped barium titanate film by RF sputtering
International Nuclear Information System (INIS)
Igarashi, H.; Yuasa, M.; Okazaki, K.
1985-01-01
Semiconductive barium titanate films were fabricated by RF sputtering on fused quartz, alumina and barium titanate ceramic substrates using barium titanate ceramic with a small amount of yttria as a target. The films on the barium titanate substrates turned blue color and showed a small PTC effect by heat-treating at 1000 0 C in the air after deposition at the substrate temperature of 600 0 C
TV observations of the Barium-GEOS ion jet experiment
International Nuclear Information System (INIS)
Hapgood, M.A.; Collin, H.L.; Rothwell, P.
1980-01-01
The barium jet released by the Barium-GEOS rocket was observed by low light television cameras at Skibotn, Norway and Esrange, Sweden. The release produced a single well-defined jet containing barium ions with initial velocities between 7 and 12 km s -1 systematically slower than the velocities reported in previous experiments. Accurate data on the motion of the jet has been obtained for the first two minutes after release (up to a height of 2000 km). The orientation of the jet was close to that of an IGRF1975 model field line but was significantly different from that predicted by the Barraclough and Olson field model. The motion of the jet across the field lines was southwards with a velocity of about 150 m s -1 . (Auth.)
Barium-borate-flyash glasses: As radiation shielding materials
International Nuclear Information System (INIS)
Singh, Sukhpal; Kumar, Ashok; Singh, Devinder; Thind, Kulwant Singh; Mudahar, Gurmel S.
2008-01-01
The attenuation coefficients of barium-borate-flyash glasses have been measured for γ-ray photon energies of 356, 662, 1173 and 1332 keV using narrow beam transmission geometry. The photon beam was highly collimated and overall scatter acceptance angle was less than 3 o . Our results have an uncertainty of less than 3%. These coefficients were then used to obtain the values of mean free path (mfp), effective atomic number and electron density. Good agreements have been observed between experimental and theoretical values of these parameters. From the studies of the obtained results it is reported here that from the shielding point of view the barium-borate-flyash glasses are better shields to γ-radiations in comparison to the standard radiation shielding concretes and also to the ordinary barium-borate glasses
Barium titanate thick films prepared by screen printing technique
Directory of Open Access Journals (Sweden)
Mirjana M. Vijatović
2010-06-01
Full Text Available The barium titanate (BaTiO3 thick films were prepared by screen printing technique using powders obtained by soft chemical route, modified Pechini process. Three different barium titanate powders were prepared: i pure, ii doped with lanthanum and iii doped with antimony. Pastes for screen printing were prepared using previously obtained powders. The thick films were deposited onto Al2O3 substrates and fired at 850°C together with electrode material (silver/palladium in the moving belt furnace in the air atmosphere. Measurements of thickness and roughness of barium titanate thick films were performed. The electrical properties of thick films such as dielectric constant, dielectric losses, Curie temperature, hysteresis loop were reported. The influence of different factors on electrical properties values was analyzed.
Diagnostic role of barium enema in carcinoma rectum
International Nuclear Information System (INIS)
Asghar, M.
2003-01-01
Objective: The main aim of this barium enema study was to evaluate its role in patients suspected to have rectal pathologies with complaints of change in bowel habit, anorexia/weight loss, bleeding per rectum and acute/sub-acute colonic obstruction. Results: barium enema study as screening test for colo-rectal carcinoma was undertaken. Contrast outlined the colonic growth in 35 cases, out of which the cases of carcinoma colon were 24 including 13 patients suffering from carcinoma rectum. The percentage of carcinoma colon to total colonic growth was 68% while, carcinoma rectum to total carcinoma colon was 54%. Conclusion: On the basis of these investigations, it is concluded that patient's compliance is important factor in the early detection of colonic neoplasia. Though results of colonoscopy are more reliable but in practice, barium enema (double contrast) is performed initially to outline the lesion and then colonoscopy for biopsy purpose. (author)
Oliva, M R; Erturk, S M; Ichikawa, T; Rocha, T; Ros, P R; Silverman, S G; Mortele, K J
2012-01-01
When examining patients with contrast-enhanced multidetector-row CT, we determined if the stomach and small bowel were visualized and distended better with a neutral barium sulphate suspension than with positive barium sulphate suspension or water. After obtaining approval from our institutional review board, 156 patients (women: 84; mean age: 54 yrs) with no history of gastrointestinal tract disease were randomized prospectively to receive orally either 900 ml of neutral (0.1% w/v) barium sulphate suspension (n = 53), 900 ml of positive (2.1% w/v) barium sulphate suspension (n = 53), or 900 ml of water (n = 50), prior to undergoing contrast-enhanced abdominal and pelvic multidetector-row CT. Two independent radiologists evaluated the stomach, and small bowel, for luminal distension and wall visualization, using a five point scale. Results were compared using Kruskal-Wallis and Mann-Whitney U tests. The walls of the stomach, and small bowel were visualized better in patients who were administered neutral barium sulphate suspension than those who were administered either positive barium sulphate suspension (p barium sulphate suspension, the stomach and small bowel were distended better compared to patients administered water (p barium sulphate suspension (p contrast-enhanced abdominal and pelvic multidetector-row CT, orally administered neutral barium sulphate suspension allows the gastrointestinal tract to be visualized and distended better than either positive barium sulphate suspension, or water.
21 CFR 201.304 - Tannic acid and barium enema preparations.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished liver...
49 CFR 173.182 - Barium azide-50 percent or more water wet.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or more...
40 CFR 721.10010 - Barium manganese oxide (BaMnO3).
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN P-00...
The diagnosis of gastro-esophageal reflux disease cannot be made with barium esophagograms
Saleh, C. M. G.; Smout, A. J. P. M.; Bredenoord, A. J.
2015-01-01
For over 50 years, barium studies have been used to diagnose gastro-esophageal reflux disease (GERD), but the value of this test is controversial. Our study aimed to determine if barium esophagograms can be used to diagnose GERD. Barium esophagograms and pH-impedance measurement were performed in 20
Barium Tagging from nEXO Using Resonance Ionization Spectroscopy
Twelker, K.; Kravitz, S.
nEXO is a 5-ton liquid enriched-xenon time projection chamber (TPC) to search for neutrinoless double-beta decay, designed to have the sensitivity to completely probe the inverted mass hierarchy of Majorana neutrinos. The detector will accommodate-as a background reduction technique-a system to recover and identify the barium decay product. This upgrade will allow a background-free measurement of neutrinoless double-beta decay and increase the half-life sensitivity of the experiment by at least one order of magnitude. Ongoing research and development includes a system to test barium extraction from liquid xenon using surface adsorption and Resonance Ionization Spectroscopy (RIS).
Electronic and chemical properties of barium and indium clusters
International Nuclear Information System (INIS)
Onwuagba, B.N.
1992-11-01
The ground state electronic and chemical properties of divalent barium and trivalent indium are investigated in a self-consistent manner using the spin-polarized local density approximation in the framework of Density Functional Theory. A jellium model is adopted in the spirit of Gunnarsson and Lundqvist exchange and correlation energies and the calculated properties primarily associated with the s-p orbitals in barium and p orbitals in indium provide deepened insight towards the understanding of the mechanisms to the magic numbers in both clusters. (author). 21 refs, 5 figs
Comparison of endoscopy and barium swallow with marshmallow in dysphagia.
Somers, S; Stevenson, G W; Thompson, G
1986-06-01
Forty-four patients with dysphagia were examined both by endoscopy and by barium swallow with a marshmallow bolus. In these patients 36 stenoses were found: 34 by radiology and 30 by endoscopy. The radiologic criteria for stenosis included arrest of the marshmallow in a manner to support a column of barium and reproduction of the patient's symptoms at the time this occurred. Radiologic false negative findings were partly due to an inability by patients to swallow an adequate marshmallow bolus; endoscopic failures were associated with small endoscopes and mild stenoses.
Esophageal intramural pseudodiverticulosis characterized by barium esophagography: a case report
LENUS (Irish Health Repository)
O'Connor, Owen J
2010-05-21
Abstract Introduction Esophageal intramural pseudodiverticulosis is a rare condition characterized by the dilatation of the submucosal glands. Case presentation We present a case of esophageal intramural pseudodiverticulosis in a 72-year-old Caucasian man who presented with dysphagia and with a background history of alcohol abuse. An upper gastrointestinal endoscopy of our patient showed an esophageal stricture with abnormal mucosal appearances, but no malignant cells were seen at biopsy. Appearances on a barium esophagram were pathognomonic for esophageal intramural pseudodiverticulosis. Conclusion We demonstrate the enduring usefulness of barium esophagography in the characterization of abnormal mucosal appearances at endoscopy.
Barium atoms and N20 molecular agregates reaction
International Nuclear Information System (INIS)
Visticot, J.P.; Mestdagh, J.M.; Alcaraz, C.; Cuvellier, J.; Berlande, J.
1988-06-01
The collisions between a barium atom and N20 molecular agregates are studied, for a better understanding of the solvation part in a chemical reaction. The experiments are carried out in a crossed molecular beam device. The light coming from the collision zone is scattered, and analysed by means of a photon detector. A time-of-flight technique is applied in the investigation of the beam's polymer concentration. The results show a nearly negligible chemiluminescent effect in the reaction between barium and N20 polymer. A solvated BaO formation mechanism is proposed to justify the experimental results [fr
Reaction between barium and nitrogen in liquid sodium
International Nuclear Information System (INIS)
Addison, C.C.; Pulham, R.J.; Trevillion, E.A.
1975-01-01
Nitrogen in increasing amounts has been added to separate solutions of barium in sodium of constant composition (ca.4.40 mol % Ba) at 300 0 C. After rendering each mixture homogenous using an electromagnetic pump, filtration, and nitrogen analysis, all the N 2 added has been found in solution up to a solution composition approximating to Ba 4 N (i.e. 1.1 mol % N) beyond which the quantity of dissolved N 2 decreases progressively due to precipitation of the nitride Ba 2 N. The solubilization is interpreted in terms of strong preferential solvation of the nitride ion by barium cations. (author)
The Kerr nonlinearity of the beta-barium borate crystal
DEFF Research Database (Denmark)
Bache, Morten; Guo, Hairun; Zhou, Binbin
2013-01-01
A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond experime......A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond...
Preparation and characterization of antimony barium composite oxide photocatalysts
Han, X. P.; Yao, B. H.; Pan, Q. H.; Pen, C.; Zhang, C. L.
2018-01-01
In this paper, two kinds of antimony barium composite oxide photocatalysts have been prepared by two methods and characterized by XRD and SEM. The photocatalytic activity was evaluated by a photocatalytic reactor and an ultraviolet spectrophotometer. The results showed that-BaSb2O5•4H2O, BaSb2O6 two kinds of antimony barium composite oxide photocatalysts were successfully prepared in this experiment and they showed good photocatalytic properties. In addition, BaSb2O6 morphology showed more regular, microstructure and better catalytic performance.
Low temperature fabrication of barium titanate hybrid films and their dielectric properties
International Nuclear Information System (INIS)
Kobayashi, Yoshio; Saito, Hirobumi; Kinoshita, Takafumi; Nagao, Daisuke; Konno, Mikio
2011-01-01
A method for incorporating BT nano-crystalline into barium titanate (BT) films is proposed for a low temperature fabrication of high dielectric constant films. BT nanoparticles were synthesized by hydrolysis of a BT complex alkoxide in 2-methoxyethanol (ME)/ethanol cosolvent. As the ME volume fraction in the cosolvent (ME fraction) increased from 0 to 100%, the particle and crystal sizes tended to increase from 13.4 to 30.2 nm and from 15.8 to 31.4 nm, respectively, and the particle dispersion in the solution became more improved. The BT particles were mixed with BT complex alkoxide dissolved in an ME/ethanol cosolvent for preparing a precursor solution that was then spin-coated on a Pt substrate and dried at 150 o C. The dielectric constant of the spin-coated BT hybrid film increased with an increase in the volume fraction of the BT particles in the film. The dissipation factor of the hybrid film tended to decrease with an increase in the ME fraction in the precursor solution. The hybrid film fabricated at a BT fraction of 30% and an ME fraction of 25% attained a dielectric constant as high as 94.5 with a surface roughness of 14.0 nm and a dissipation factor of 0.11.
Measurement limits to 134Cs concentration in soil
International Nuclear Information System (INIS)
Ahn, J.K.; Kim, J.S.; Lee, H.M.; Kim, H.; Kim, T.H.; Park, J.N.; Kang, Y.S.; Lee, H.S.; Kim, S.J.; Park, J.Y.; Ryu, S.Y.; Kim, H.-Ch.; Kang, W.G.; Kim, S.K.
2011-01-01
We investigate the caesium concentrations in soils in mountain areas near Gori nuclear power plant in Korea, focusing on the measurement limits to the 134 Cs. In order to lower the minimum detectable amount (MDA) of activity for the 134 Cs, we have used the ammonium molybdophosphate (AMP) precipitation method to get rid of the 40 K existing in natural radioactivity, which reduces the MDA activity about 10 times smaller than those without the AMP precipitation method. The MDA results for the 134 Cs were found to be in the range between 0.015 and 0.044 Bq/kg-dry weight. In order to diminish the background, we also have measured a part of the soil samples in Yangyang, a small town in the east coast of Korea. However, it turns out that in order to detect the 134 Cs in the samples the MDA should be reduced to the level of mBq/kg-dry weight. - Highlights: → We study the caesium concentrations in soils in mountain areas near Gori NPT in Korea. → We use the AMP precipitation method to lower the minimum detectable amount (MDA) of activity for the 134 Cs. → The results of the MDA for the 134 Cs turn out to be in the range between 0.015 and 0.044. → In order to detect the 134 Cs in the samples, the MDA should be reduced to the level of mBq/kg-dry weight.
MicroRNA-134 regulates poliovirus replication by IRES targeting
Bakre, Abhijeet A.; Shim, Byoung-Shik; Tripp, Ralph A.
2017-01-01
Global poliovirus eradication efforts include high vaccination coverage with live oral polio vaccine (OPV), surveillance for acute flaccid paralysis, and OPV “mop-up” campaigns. An important objective involves host-directed strategies to reduce PV replication to diminish viral shedding in OPV recipients. In this study, we show that microRNA-134-5p (miR-134) can regulate Sabin-1 replication but not Sabin-2 or Sabin-3 via direct interaction with the PV 5′UTR. Hypochromicity data showed miR-134 ...
134Cs emission probabilities determination by gamma spectrometry
de Almeida, M. C. M.; Poledna, R.; Delgado, J. U.; Silva, R. L.; Araujo, M. T. F.; da Silva, C. J.
2018-03-01
The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of 134Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. 134Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration. The gamma emission probabilities (Pγ) were determined mainly for some energies of the 134Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1).
Status of barium studies in the present era of oncology: Are they a history?
Mahajan, Abhishek; Desai, Subash; Sable, Nilesh Pandurang; Thakur, Meenakshi Haresh
2016-01-01
With the advent of the modern imaging technologies, the present era of oncology is seeing steady decline in requests for barium studies due to the many reasons. It is prudent to mention here, that, barium examinations cannot be made obsolete! Our aim to preserve the age old technique of barium studies not only to keep it going on but also for the betterment and appropriate management of the patient. Our goal is not to "save" barium studies simply to keep this technology alive, per se, but rather to preserve barium radiology for the quality in patient care.
SEPARATION OF BARIUM VALUES FROM URANYL NITRATE SOLUTIONS
Tompkins, E.R.
1959-02-24
The separation of radioactive barium values from a uranyl nitrate solution of neutron-irradiated uranium is described. The 10 to 20% uranyl nitrate solution is passed through a flrst column of a cation exchange resin under conditions favoring the adsorption of barium and certain other cations. The loaded resin is first washed with dilute sulfuric acid to remove a portion of the other cations, and then wash with a citric acid solution at pH of 5 to 7 to recover the barium along with a lesser amount of the other cations. The PH of the resulting eluate is adjusted to about 2.3 to 3.5 and diluted prior to passing through a smaller second column of exchange resin. The loaded resin is first washed with a citric acid solution at a pH of 3 to elute undesired cations and then with citric acid solution at a pH of 6 to eluts the barium, which is substantially free of undesired cations.
Characterization of Barium Borate Frameworks Using Raman Spectroscopy.
Gharavi-Naeini, Jafar; Yoo, Kyung W; Stump, Nathan A
2018-04-01
Systematic micro-Raman scattering investigations have been carried out on Sm +2 doped 2(BaO)-n(B 2 O 3 ) matrices for n = 4, 5, 8, and 2(BaO)-(Na 2 O)-9(B 2 O 3 ) using the 364 nm excitation of an Ar + laser. The Raman results have been compared with the known structures of barium tetraborate, barium pentaborate, barium octaborate, and barium sodium nonaborate. An excellent correlation has been found between the BO 4 /BO 3 composition ratios for each product and intensity ratios of the designated BO 4 and BO 3 Raman peaks. Furthermore, the Raman frequencies of both BO 4 and BO 3 groups undergo a systematic blueshift as n increases from four to nine. The shift results from a decrease of the B-O bond lengths for both BO 4 and BO 3 groups as the samples transition from the tetraborate to nonaborate structures. Linear relations (with negative slopes) have been determined between the measured Raman frequencies and B-O bond lengths in the frameworks.
Dynamics of a barium release in the magnetospheric tail
Mende, S. B.; Swenson, G. R.; Geller, S. P.; Doolittle, J. H.; Haerendel, G.
1989-01-01
The late time behavior of the May 13, 1985 magnetotail barium cloud is examined. The bulk dynamics of the cloud are studied based on triangulated data and data from Fabry-Perot Doppler velocity measurements. The changes in cloud morphology in relation to the in situ measurements made by the Ion Release Module satellite are discussed.
Barium titanate inverted opals-synthesis, characterization, and optical properties
Energy Technology Data Exchange (ETDEWEB)
Soten, I.; Miguez, H.; Yang, S.M.; Petrov, S.; Coombs, N.; Tetreault, N.; Ozin, G.A. [Toronto Univ., ON (Canada). Dept. of Chemistry; Matsuura, N.; Ruda, H.E. [Toronto Univ., ON (Canada). Dept. of Metallurgy and Materials Science
2002-01-01
The engineering of cubic or tetragonal polymorphs of nanocrystalline barium titanate inverted opals has been achieved by thermally induced transformations. Optical characterization demonstrated photonic crystal behavior of the opals. The tuning of the ferroelectric-paraelectric transition around the Curie temperature is shown in this paper. (orig.)
Electrical transport properties of calcium and barium aluminates
Metselaar, R.; Hoefsloot, A.M.
1987-01-01
Electrical conductivity and ionic transport numbers have been measured of barium and calcium aluminates with composition CaO·nAl2O3 (n=7/12, 1, 2, 6) and 0.82 BaO·6Al2O3. At room temperatures these compounds are insulators, but at high temperatures mixed conductivity is observed. Ionic transport
ORIGINAL ARTICLE ORIG ORIG Comparison of barium and ...
African Journals Online (AJOL)
SA JOURNAL OF RADIOLOGY • June 2007. ORIG. Abstract. Background. Simulation of patients with carcinoma of the oesophagus using radio-opaque contrast is a standard step in treatment planning prior to delivering radiation therapy. Various contrast mediums such as barium, gastrograffin and hexabrix have been used ...
Synthesis and surface properties of submicron barium sulfate particles
International Nuclear Information System (INIS)
Zhang Ming; Zhang Bao; Li Xinhai; Yin Zhoulan; Guo Xueyi
2011-01-01
Barium sulfate particles were synthesized in the presence of EDTA at room temperature. X-ray diffractometry (XRD), Fourier transform infrared resonance (FTIR) and scanning electron microscopy (SEM) were used to characterize the structure and morphology of BaSO 4 particles. The effect of the preparation parameters on the particle size distribution and morphology was investigated. The conditional formation constants of Ba-EDTA at different pH values were calculated. The results show that the size and morphology of BaSO 4 particles can be effectively controlled by adding EDTA in the precipitation process. Among all the operation conditions, the pH value has significant effect on the particle size. The obtained barium sulfate particles are spherical and well dispersed at pH = 9-10. Zeta potentials of BaSO 4 were measured at different pH. The isoelectric point (IEP) of barium sulfate colloid appears at pH 6.92. The model of the solid-solution interface at a particle of BaSO 4 was presented. The FTIR result indicates that the surface of the prepared BaSO 4 absorbs the functional groups of EDTA, which lower the IEP of the barium sulfate particles.
Synthesis and surface properties of submicron barium sulfate particles
Energy Technology Data Exchange (ETDEWEB)
Zhang Ming, E-mail: csu.light@yahoo.com.cn [College of Chemistry and Chemical Engineering, Zhaoqing University, Zhaoqing 526061 (China); School of Chemistry and Chemical Engineering, Central South University, Changsha 410083 (China); Zhang Bao; Li Xinhai [School of Metallurgical Science and Engineering, Central South University, Changsha 410083 (China); Yin Zhoulan [School of Chemistry and Chemical Engineering, Central South University, Changsha 410083 (China); Guo Xueyi [School of Metallurgical Science and Engineering, Central South University, Changsha 410083 (China)
2011-10-15
Barium sulfate particles were synthesized in the presence of EDTA at room temperature. X-ray diffractometry (XRD), Fourier transform infrared resonance (FTIR) and scanning electron microscopy (SEM) were used to characterize the structure and morphology of BaSO{sub 4} particles. The effect of the preparation parameters on the particle size distribution and morphology was investigated. The conditional formation constants of Ba-EDTA at different pH values were calculated. The results show that the size and morphology of BaSO{sub 4} particles can be effectively controlled by adding EDTA in the precipitation process. Among all the operation conditions, the pH value has significant effect on the particle size. The obtained barium sulfate particles are spherical and well dispersed at pH = 9-10. Zeta potentials of BaSO{sub 4} were measured at different pH. The isoelectric point (IEP) of barium sulfate colloid appears at pH 6.92. The model of the solid-solution interface at a particle of BaSO{sub 4} was presented. The FTIR result indicates that the surface of the prepared BaSO{sub 4} absorbs the functional groups of EDTA, which lower the IEP of the barium sulfate particles.
Pressure-assisted sintering of high purity barium titanate
van den Cruijsem, S.; Varst, van der P.G.T.; With, de G.; Bortzmeyer, D.; Boussuge, M.; Chartier, Th.; Hausonne, J.M.; Mocellin, A.; Rousset, A.; Thevenot, F.
1997-01-01
The dielectric behaviour of High Purity Barium titanate (HPB) ceramics is strongly dependent on the grain size and porosity. For applications, control of grain size and porosity is required. Pressure-assisted sintering techniques at relatively low temperatures meet these requirements. In this study,
Iatrogen perforation of the rectum following barium enema
International Nuclear Information System (INIS)
Eggum, R.; Kressner, U.; Haffner, J.
1998-01-01
Perforation of the rectum following barium enema is relatively rare, occurring in 1 of 3,000 procedures. Colorectal perforation is a serious condition and early diagnosis is of paramount importance in order to avoid any delay in treating the patient. Direct suture of the perforation, lavage, presacral drainage and stomia are the preferred methods of primary surgical treatment. 10 refs., 1 fig
Effectiveness of therapeutic barium enema for diverticular hemorrhage
Matsuura, Mizue; Inamori, Masahiko; Nakajima, Atsushi; Komiya, Yasuhiko; Inoh, Yumi; Kawasima, Keigo; Naitoh, Mai; Fujita, Yuji; Eduka, Akiko; Kanazawa, Noriyoshi; Uchiyama, Shiori; Tani, Rie; Kawana, Kennichi; Ohtani, Setsuya; Nagase, Hajime
2015-01-01
AIM: To evaluate the effectiveness of barium impaction therapy for patients with colonic diverticular bleeding. METHODS: We reviewed the clinical charts of patients in whom therapeutic barium enema was performed for the control of diverticular bleeding between August 2010 and March 2012 at Yokohama Rosai Hospital. Twenty patients were included in the review, consisting of 14 men and 6 women. The median age of the patients was 73.5 years. The duration of the follow-up period ranged from 1 to 19 mo (median: 9.8 mo). Among the 20 patients were 11 patients who required the procedure for re-bleeding during hospitalization, 6 patients who required it for re-bleeding that developed after the patient left the hospital, and 3 patients who required the procedure for the prevention of re-bleeding. Barium (concentration: 150 w%/v%) was administered per the rectum, and the leading edge of the contrast medium was followed up to the cecum by fluoroscopy. After confirmation that the ascending colon and cecum were filled with barium, the enema tube was withdrawn, and the patient’s position was changed every 20 min for 3 h. RESULTS: Twelve patients remained free of re-bleeding during the follow-up period (range: 1-19 mo) after the therapeutic barium enema, including 9 men and 3 women with a median age of 72.0 years. Re-bleeding occurred in 8 patients including 5 men and 3 women with a median age of 68.5 years: 4 developed early re-bleeding, defined as re-bleeding that occurs within one week after the procedure, and the remaining 4 developed late re-bleeding. The DFI (disease-free interval) decreased 0.4 for 12 mo. Only one patient developed a complication from therapeutic barium enema (colonic perforation). CONCLUSION: Therapeutic barium enema is effective for the control of diverticular hemorrhage in cases where the active bleeding site cannot be identified by colonoscopy. PMID:25987779
Comparison of pressure between barium reduction and air reduction of the intussusception in children
Energy Technology Data Exchange (ETDEWEB)
Lee, Kyung Hwan; Park, Sang Gyu; Park, Choong Ki; Yoon, Jong Sup [Hallym University College of Medicine, Seoul (Korea, Republic of)
1989-08-15
There are many method of treatment of the intussusception in children, including surgery, barium reduction, air reduction, and saline enema under ultrasonographic monitoring. Among them, barium reduction and air reduction have been used widely as nonsurgical method of treatment in radiologic department. During barium reduction, the bottle filled with barium solution must not be elevated over a 3 feet from the operating table. In air reduction, diagnostic pressure is about 60 mmHg and pressure during reduction usually is maintained between 90 mmHg and 130 mmHg. The authors have studied about pressure difference of barium solution by changing height of the bottle filled with barium solution, and have compared with pressure in air reduction. The results are as follows; 1. Pressure of 20 w/v % barium solution at the 60 cm height is 44.4 mmHg, and 69.6 mmHg at the 90 cm height. 2. Pressure of 40 w/v % barium solution at the 60 cm height is 51.4 mmHg, and 80.1 mmHg at the 90 cm height. 3. Pressure of 40 w/v % barium solution at the 90cm height is much lower than the pressure maintained during air reduction, and this difference in pressure may be one of the causes of low reduction rate in barium reduction then air reduction. 4. The pressure gradient per 10 cm height is about 8.45 mmHg in 20 w/v % barium solution, about 9.21 mmHg in 30 w/v % barium solution, and about 9.72 mmHg 40 w/v % barium solution. 5. Intraluminal pressure difference between the barium reduction and the air reduction is probably of the major causes of rapid diagnosis and high reduction rate in the air reduction.
Comparison of pressure between barium reduction and air reduction of the intussusception in children
International Nuclear Information System (INIS)
Lee, Kyung Hwan; Park, Sang Gyu; Park, Choong Ki; Yoon, Jong Sup
1989-01-01
There are many method of treatment of the intussusception in children, including surgery, barium reduction, air reduction, and saline enema under ultrasonographic monitoring. Among them, barium reduction and air reduction have been used widely as nonsurgical method of treatment in radiologic department. During barium reduction, the bottle filled with barium solution must not be elevated over a 3 feet from the operating table. In air reduction, diagnostic pressure is about 60 mmHg and pressure during reduction usually is maintained between 90 mmHg and 130 mmHg. The authors have studied about pressure difference of barium solution by changing height of the bottle filled with barium solution, and have compared with pressure in air reduction. The results are as follows; 1. Pressure of 20 w/v % barium solution at the 60 cm height is 44.4 mmHg, and 69.6 mmHg at the 90 cm height. 2. Pressure of 40 w/v % barium solution at the 60 cm height is 51.4 mmHg, and 80.1 mmHg at the 90 cm height. 3. Pressure of 40 w/v % barium solution at the 90cm height is much lower than the pressure maintained during air reduction, and this difference in pressure may be one of the causes of low reduction rate in barium reduction then air reduction. 4. The pressure gradient per 10 cm height is about 8.45 mmHg in 20 w/v % barium solution, about 9.21 mmHg in 30 w/v % barium solution, and about 9.72 mmHg 40 w/v % barium solution. 5. Intraluminal pressure difference between the barium reduction and the air reduction is probably of the major causes of rapid diagnosis and high reduction rate in the air reduction
Effects of chemesthetic stimuli mixtures with barium on swallowing apnea duration.
Todd, J Tee; Butler, Susan G; Plonk, Drew P; Grace-Martin, Karen; Pelletier, Cathy A
2012-10-01
This study tested the hypotheses that swallowing apnea duration (SAD) will increase given barium versus water, chemesthetic stimuli (i.e., water barium, age (older > younger), and genetic taste differences (supertasters > nontasters). Prospective group design. University Medical Center. Eighty healthy women were identified as nontasters and supertasters, equally comprising two age groups: 18 to 35 years and 60+ years. The KayPentax Swallowing Signals Lab was used to acquire SAD via nasal cannula during individually randomized swallows of 5 mL barium, 2.7% w/v citric acid with barium, carbonation with barium, and 50:50 diluted ethanol with barium. Data were analyzed using path analysis, with the mediator of chemesthetic perception, adjusted for repeated measures. Significant main effects of age (P = .012) and chemesthetic stimuli (P = .014) were found, as well as a significant interaction between chemesthetic stimuli and age (P = .028). Older women had a significantly longer SAD than younger women. Post hoc analyses revealed that barium mixed with ethanol elicited a significantly longer SAD than other bolus conditions, regardless of age group. There were no significant differences in SAD between barium and water conditions, and no significant effect of chemesthetic perception (P > .05). Ethanol added to barium elicited longer SAD compared to plain barium, but not the other chemesthetic conditions. Older women had a longer SAD than younger women in all conditions. These findings may influence design of future studies examining effects of various stimuli on SAD. Copyright © 2012 The American Laryngological, Rhinological, and Otological Society, Inc.
Gas thermodesorption study of barium and strontium cerates
International Nuclear Information System (INIS)
Aksenova, T.I.; Khromushin, I.V.; Zhotabaev, Zh.R.; Bukenov, K.D.; Medvedeva, Z.V.; Berdauletov, A.K.
2002-01-01
Kinetic of water, oxygen, hydrogen and carbon dioxide molecules release from doped and undoped samples of barium cerates and doped strontium cerates during vacuum heating was studied. The samples were prepared by inductive melting method. The following two kinds of preliminary samples treatments were used: annealing in air (650-750 deg. C) and wet nitrogen atmosphere (625 deg.C). Main results of thermodesorption studies of barium and strontium cerates are represented in the table. The samples of doped LaSrMnO were investigated also. It was found that the initial doped samples (without preliminary annealing) did not show any gas release in temperature range of 20-1100 deg. C. This fact indicates on high stability of compositions and strong bond of 'host' oxygen in their lattice. A significant amount of water and oxygen molecules were released from BaCe 0.9 Nd 0.1 O 3 samples whereas water and hydrogen molecules desorption from SrCe 0.95 Y 0.05 O 3 samples took place. Hydrogen molecules desorption was found for strontium cerates samples; no hydrogen molecules release was observed for doped and pure barium cerate samples.Intensive water molecules release from doped samples confirms the necessity of oxygen vacancies creation in these compounds to get properties of proton conductivity, since it was not found any water molecules release from annealed undoped samples of BaCeO 3 It is necessary to notice that oxygen molecules release from these samples took place at ∼1000 deg. C that is significantly higher then from BaCeNdO samples. Forms of high temperatures part of oxygen and low temperature part of water spectra indicate that phase transformations are responsible for oxygen and water molecules desorption in this cases. These results are in good agreement with literature data. Desorption of water molecules from barium and strontium cerates took place. Oxygen desorption took place only from barium cerates. It can be explained as the following: doped barium cerates have
Exposure to low-dose barium by drinking water causes hearing loss in mice.
Ohgami, Nobutaka; Hori, Sohjiro; Ohgami, Kyoko; Tamura, Haruka; Tsuzuki, Toyonori; Ohnuma, Shoko; Kato, Masashi
2012-10-01
We continuously ingest barium as a general element by drinking water and foods in our daily life. Exposure to high-dose barium (>100mg/kg/day) has been shown to cause physiological impairments. Direct administration of barium to inner ears by vascular perfusion has been shown to cause physiological impairments in inner ears. However, the toxic influence of oral exposure to low-dose barium on hearing levels has not been clarified in vivo. We analyzed the toxic influence of oral exposure to low-dose barium on hearing levels and inner ears in mice. We orally administered barium at low doses of 0.14 and 1.4 mg/kg/day to wild-type ICR mice by drinking water. The doses are equivalent to and 10-fold higher than the limit level (0.7 mg/l) of WHO health-based guidelines for drinking water, respectively. After 2-week exposure, hearing levels were measured by auditory brain stem responses and inner ears were morphologically analyzed. After 2-month exposure, tissue distribution of barium was measured by inductively coupled plasma mass spectrometry. Low-dose barium in drinking water caused severe hearing loss in mice. Inner ears including inner and outer hair cells, stria vascularis and spiral ganglion neurons showed severe degeneration. The Barium-administered group showed significantly higher levels of barium in inner ears than those in the control group, while barium levels in bone did not show a significant difference between the two groups. Barium levels in other tissues including the cerebrum, cerebellum, heart, liver and kidney were undetectably low in both groups. Our results demonstrate for the first time that low-dose barium administered by drinking water specifically distributes to inner ears resulting in severe ototoxicity with degeneration of inner ears in mice. Copyright © 2012 Elsevier Inc. All rights reserved.
CSIR Research Space (South Africa)
Mulopo, J
2012-01-01
Full Text Available Batch regeneration of barium carbonate (BaCO3) from barium sulphide (BaS) slurries by passing CO2 gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO3 recovery in the Alkali...
Forman, R.
1976-01-01
Surface studies have been made of multilayer and monolayer films of barium and barium oxide on a tungsten substrate. The purpose of the investigation was to synthesize the surface conditions that exist on an activated impregnated tungsten cathode and obtain a better understanding of the mechanism of operation of such cathodes. The techniques employed in these measurements were Auger spectroscopy and work-function measurements. The results of this study show that the surface of an impregnated cathode is identical to that observed for a synthesized monolayer or partial monolayer of barium on oxidized tungsten by evaluating Auger spectra and work-function measurements. Data obtained from desorption studies of barium monolayers on a tungsten substrate in conjunction with Auger and work-function results have been interpreted to show that throughout most of its life an impreganated cathode has a partial monolayer, rather than a monolayer, of barium on its surface.
Łukasik-Głębocka, Magdalena; Sommerfeld, Karina; Hanć, Anetta; Grzegorowski, Adam; Barałkiewicz, Danuta; Gaca, Michał; Zielińska-Psuja, Barbara
2014-01-01
A serious case of barium intoxication from suicidal ingestion is reported. Oral barium chloride poisoning with hypokalemia, neuromuscular and cardiac toxicity, treated with intravenous potassium supplementation and hemodialysis, was confirmed by the determination of barium concentrations in gastric contents, blood, serum and urine using the inductively coupled plasma mass spectrometry method. Barium concentrations in the analyzed specimens were 20.45 µg/L in serum, 150 µg/L in blood, 10,500 µg/L in urine and 63,500 µg/L in gastric contents. Results were compared with barium levels obtained from a non-intoxicated person. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
NASA/Max Planck Institute Barium Ion Cloud Project.
Brence, W. A.; Carr, R. E.; Gerlach, J. C.; Neuss, H.
1973-01-01
NASA and the Max Planck Institute for Extraterrestrial Physics (MPE), Munich, Germany, conducted a cooperative experiment involving the release and study of a barium cloud at 31,500 km altitude near the equatorial plane. The release was made near local magnetic midnight on Sept. 21, 1971. The MPE-built spacecraft contained a canister of 16 kg of Ba CuO mixture, a two-axis magnetometer, and other payload instrumentation. The objectives of the experiment were to investigate the interaction of the ionized barium cloud with the ambient medium and to deduce the properties of electric fields in the proximity of the release. An overview of the project is given to briefly summarize the organization, responsibilities, objectives, instrumentation, and operational aspects of the project.
Attainment of barium hexaferrite nanoparticles by a Pechini Method
International Nuclear Information System (INIS)
Galvao, S.B.; Timoteo, Jr.J.F.; Melo, G.M.; Souto, K.K.O.; Florioto, N.T.; Paskocimas, C.A.
2009-01-01
The barium hexaferrites (BaFe 12 O 19 ) are used as a compound of materials applied in electronic devices, as medical devices, satellites, dada servers systems, wireless systems and others. The general properties are strongly related to the microstructure and morphology, and the particles size decrease results in advantages to the majority applications, mainly the high-tech thumbnail devices. These magnetic ceramic materials, with perovskite structure, are traditionally prepared my conventional oxide mixture synthesis. In this work was studied the nanoparticle synthesis of BaFe 12 O 19 by the precursors polymeric method (Pechini), using as precursors the barium carbonate and the iron nitrate, under different thermal treatment conditions. The samples were characterized by XRD, SEM, BET, DTA and TGA. The results presented the attainment of a monophasic powder with particles size around 100 nm. (author)
Influence of Magnetron Effect on Barium Hexaferrite Thin Layers
International Nuclear Information System (INIS)
Hassane, H.; Chatelon, J.P.; Rousseau, J.J; Siblini, A.; Kriga, A.
2011-01-01
In this paper, we study the effects of a magnet, located in the cathode, on barium hexaferrite thin films deposited by RF magnetron sputtering technique. During the process, these effects can modify thickness, roughness and stress of coatings. The characteristics of the deposited layers depend on the substrate position that is located opposite of magnetron cathode. In the m agnetron area , one can observe that the high stress can produce cracks or detachment of layers and the increasing of both depositing rate and surface roughness. After sputtering elaboration, barium hexaferrite films are in a compressive stress mode. But, after the post-deposition heat treatment these films are in a tensile stress mode. To improve the quality of BaM films, the subsrtate has to be set outside the magnetron area. (author)
Electromagnetic properties of carbon black and barium titanate composite materials
International Nuclear Information System (INIS)
Wang Guiqin; Chen Xiaodong; Duan Yuping; Liu Shunhua
2008-01-01
Nanocrystalline carbon black/barium titanate compound particle (CP) was synthesized by sol-gel method. The phase structure and morphology of compound particle were investigated by X-ray diffraction (XRD), transmission electron microscope (TEM) and Raman spectrum measurements, the electroconductivity was test by trielectrode arrangement and the precursor powder was followed by differential scanning calorimetric measurements (DSC) and thermal gravimetric analysis (TGA). In addition, the complex relative permittivity and permeability of compound particle were investigated by reflection method. The compound particle/epoxide resin composite (CP/EP) with different contents of CP were measured. The results show barium titanate crystal is tetragonal phase and its grain is oval shape with 80-100 nm which was coated by carbon black film. As electromagnetic (EM) complex permittivity, permeability and reflection loss (RL) shown that the compound particle is mainly a kind of electric and dielectric lossy materials and exhibits excellent microwave absorption performance in the X- and Ku-bands
Attainment of barium hexa ferrite nanoparticles by a Pechini method
International Nuclear Information System (INIS)
Galvao, Sheila B.; Timoteo, Flavio Junior J.; Machado, Tercio G.; Souto, Kesia K.O.; Floreoto, Neide T.; Paskocimas, Carlos A.
2009-01-01
The barium hexa ferrites (BaFe 12 O 19 ) are used as a compound of materials applied in electronic devices, as medical devices, satellites, dada servers systems, wireless systems and others. The general properties are strongly related to the microstructure and morphology, and the particles size decrease results in advantages to the majority applications, mainly the high-tech thumbnail devices. These magnetic ceramic materials, with perovskite structure, are traditionally prepared my conventional oxide mixture synthesis. In this work was studied the nanoparticle synthesis of BaFe 12 O 19 by the precursors polymeric method (Pechini), using as precursors the barium carbonate and the iron nitrate, under different thermal treatment conditions. The samples were characterized by XRD, Raman spectroscopy, SEM, BET, DTA and TGA. The results presented the attainment of a monophasic powder with particles size around 100 nm. (author)
Electromagnetic properties of photodefinable barium ferrite polymer composites
Sholiyi, Olusegun; Lee, Jaejin; Williams, John D.
2014-07-01
This article reports the magnetic and microwave properties of a Barium ferrite powder suspended in a polymer matrix. The sizes for Barium hexaferrite powder are 3-6 μm for coarse and 0.8-1.0 μm for the fine powder. Ratios 1:1 and 3:1 (by mass) of ferrite to SU8 samples were characterized and analyzed for predicting the necessary combinations of these powders with SU8 2000 Negative photoresist. The magnetization properties of these materials were equally determined and were analyzed using Vibrating Sample Magnetometer (VSM). The Thru, Reflect, Line (TRL) calibration technique was employed in determining complex relative permittivity and permeability of the powders and composites with SU8 between 26.5 and 40 GHz.
Electromagnetic properties of photodefinable barium ferrite polymer composites
Directory of Open Access Journals (Sweden)
Olusegun Sholiyi
2014-07-01
Full Text Available This article reports the magnetic and microwave properties of a Barium ferrite powder suspended in a polymer matrix. The sizes for Barium hexaferrite powder are 3–6 μm for coarse and 0.8–1.0 μm for the fine powder. Ratios 1:1 and 3:1 (by mass of ferrite to SU8 samples were characterized and analyzed for predicting the necessary combinations of these powders with SU8 2000 Negative photoresist. The magnetization properties of these materials were equally determined and were analyzed using Vibrating Sample Magnetometer (VSM. The Thru, Reflect, Line (TRL calibration technique was employed in determining complex relative permittivity and permeability of the powders and composites with SU8 between 26.5 and 40 GHz.
Radium and thorium with barium in micronodules of cattle thyroids
International Nuclear Information System (INIS)
Van Middlesworth, L.
1980-01-01
Radium isotopes were found concentrated in thyroid glands of cattle. The incidence of measurable radium varied from 80% to less than 0.1% in thyroids from different abattoirs. The radium was concentrated in microscopic bodies containing predominantly barium and sulfur and lying within the storage of thyroglobulin, adjacent to follicular cells. Some thyroid cells may receive biologically significant doses of alpha radiation from these sources
Preparation of barium and uranium targets on thick backings
International Nuclear Information System (INIS)
Sletten, G.
1982-01-01
Targets of 135 Ba and 235 U have been prepared by the technique of heavy ion sputtering. Rolled foils of 208 Pb and 197 Au were used to support 250-500 μg/cm 2 layers of barium. Uranium films have been prepared by sputtering UO 2 onto 1 mg/cm 2 titanium foils. Uranium deposit thicknesses of 300 to 1800 μg/cm 2 have been prepared. (orig.)
Barium enema and CT findings of Douglas pouch metastasis
International Nuclear Information System (INIS)
Miyakawa, Kunihisa; Uchiyama, Nachiko; Iinuma, Hajime; Moriyama, Noriyuki
1999-01-01
We retrospectively reviewed barium enema and CT findings of Douglas pouch metastasis in 170 patients. The findings were divided into three types: Anterior compression type, anterior fixed folds type, and stenosis type. Patients with gastric cancer usually showed a stenosis type, especially in those with poorly differentiated adenocarcinoma. Patients with colon and ovary cancer usually showed an anterior compression type. In patients with gastric cancer, those who showed a stenosis type had the most favorable prognosis among these three types. (author)
Synthesis and characterization of barium ferrite–silica nanocomposites
International Nuclear Information System (INIS)
Aguilar-González, M.A.; Mendoza-Suárez, G.; Padmasree, K.P.
2013-01-01
In this work, we prepared barium ferrite-silica (BaM-SiO 2 ) nanocomposites of different molar ratios by high-energy ball milling, followed by heat-treatment at different temperatures. The microstructure, morphology and magnetic properties were characterized for different synthesis conditions by using X-ray diffraction (XRD), scanning electron microscopy (SEM) and vibrating sample magnetometry (VSM). The results indicate that 15 h of milling was enough to avoid the generation of hematite phase and to get a good dispersion of barium ferrite particles in the ceramic matrix. For milling periods beyond 15 h and heat treatment above 900 °C, the XRD patterns showed the presence of hematite phase caused by the decomposition of BaM. The agglomerate size observed through SEM analysis was around 150 nm with a good BaM dispersion into the SiO 2 matrix. The highest saturation magnetization (Ms) value obtained was 43 emu/g and the corresponding coercivity (Hc) value of 3.4 kOe for the composition 60BaM-40SiO 2 milled for 15 h and heat treated at 900 °C. This coercivity value is acceptable for the application in magnetic recording media. Highlights: • Barium ferrite–silica nanocomposites were prepared by high energy ball milling. • Optimal processing time is 15 h milling and heat treatment at 900 °C. • This is enough to avoid the generation of hematite phase. • Obtain good dispersion of barium ferrite particles in the ceramic matrix • Above this processing time shows the presence of increased amount of hematite
Optical and luminescent properties of the lead and barium molybdates
Energy Technology Data Exchange (ETDEWEB)
Spassky, D.A. E-mail: dima@opts.phys.msu.ru; Ivanov, S.N.; Kolobanov, V.N.; Mikhailin, V.V.; Zemskov, V.N.; Zadneprovski, B.I.; Potkin, L.I
2004-12-01
Time-resolved luminescence as well as excitation and reflectivity spectra of the oriented lead and barium molybdate single crystals were studied using synchrotron radiation. Features in reflectivity spectra in the fundamental absorption region were analyzed. The contribution of electronic states of lead cation to the formation of the bandgap in PbMoO{sub 4} is supposed. The role of lead states in the intrinsic luminescence of PbMoO{sub 4} is discussed.
Clinical efficacy of a new barium sulfate for abdominal CT
International Nuclear Information System (INIS)
Yamada, Tatuya; Kohno, Mitio; Uematsu, Sadao; Nisitani, Hiromu; Tanaka, Takao.
1988-01-01
Computed Tomography of the abdomen requires that the intestines are filled with contrast medium so that the gut is not misinterpreted as a pathologic process. Besides, normal structures may be difficult to delimit in patients with scanty intra-abdominal fat. In Japan, up to date, only a single contrast medium has been available for this purpose, Gastrografin and thus identical with the intravasculaly used Urografin or Angiografin. A new Barium Sulfate suspention (Fusimi Seiyaku, Kagawa) for computed tomographic use has been dilute solution (4.77 %) and with suspending agents that prevent a rapid sedimentation of the Barium Sulfate. The aim of this investigation was to compare Gastrografin with a new barium regarding patients tolerance, side effects and diagnostic information. The investigation comprised 146 patients who were reffered for abdominal CT and was carried out by 5 facilities; National Cancer Center, Kobe University, Chiba University, Kyushu University and Juntendo University. Diagnostic information was judged with respect to the filling of the stomach and intestines, the presence of imaging artifacts and finally clinical estimation. Patients tolerance was investigated as regards taste and side effects. Good filling of the stomach and intestines was obtained in this investigation. However, imaging artifacts occured in only a few cases. The imaging artifacts appeared almost exclusively to arise in the boundary layer between the bowel gas and contrast medium, and were most common in the stomach. However, the contrasting effect of this medium did not in itself appear to cause any imaging artifacts. Fushimi's new barium seems to be preffered because of its lesser tendency to arise artifacts and better tendency to make good filling of the stomach and intestines. Moreover, this investigation did not have any side effects. (J.P.N.)
Structure and multiferroic properties of barium hexaferrite ceramics
International Nuclear Information System (INIS)
Tan, Guolong; Chen, Xiuna
2013-01-01
Simultaneous occurrence of large ferroelectricity and strong ferromagnetism have been observed in barium hexaferrite ceramics. Barium hexaferrite (BaFe 12 O 19 ) powders with hexagonal crystal structure were successfully synthesized in a polymer precursor method using barium acetate and ferric acetylacetonate as the precursors. The powders were pressed into pellets which were sintered into ceramics at 1200 °C and 1300 °C for 1 h. The structure and morphology of the ceramics were examined using X-ray diffraction and field emission scanning electron microscopy. Large spontaneous polarization was observed in the BaFe 12 O 19 ceramics at room temperature, revealing a clear ferroelectric hysteresis loop. The maximum remanent polarization of the BaFe 12 O 19 ceramic was estimated approximately 11.8 μC cm −2 . The FeO 6 octahedron in its perovskite-like hexagonal unit cell and the shift of Fe 3+ off the center of octahedron are suggested to be the origin of the polarization in BaFe 12 O 19 . The BaFe 12 O 19 ceramics also showed strong ferromagnetism at room temperature. - Graphical abstract: Ferroelectric hysteresis loops of BaFe 12 O 19 ceramics measured at a frequency of 120 Hz, which shows that the ceramics sintered at 1200 °C is ferroelectric with P r ∼11.8 μC/cm 2 . Highlights: ► Large ferroelectricity and strong ferromagnetism were observed in barium hexaferrite ceramics. ► The maximum remanent polarization of the BaFe 12 O 19 ceramic was estimated to be 11.8 μC cm −2 . ► The FeO 6 octahedron and off-center shift of Fe 3+ are suggested to be the origin of the polarization.
International Nuclear Information System (INIS)
Wuest, C.R.
1992-01-01
Lawrence Livermore National Laboratory (LLNL) has begun a program of study on barium fluoride scintillating crystals for the Barium Fluoride Electromagnetic Calorimeter Collaboration. This program has resulted in a number of significant improvements in the mechanical processing, polishing and coating of barium fluoride crystals. Techniques have been developed using diamond-loaded pitch lapping that can produce 15 angstrom RMS surface finishes over large areas. These lapped surfaces have been shown to be crystalline using Rutherford Back-scattering (RBS). Also, special polishing fixtures have been designed based on mounting technology developed for the 1.1 m diameter optics used in LLNL's Nova Laser. These fixtures allow as many as five 25--50 cm long barium fluoride crystals to be polished and lapped at a time with the necessary tolerances for the 16,000 crystal Barium Fluoride Calorimeter. In addition, results will be presented on coating barium fluoride with UV reflective layers of magnesium fluoride and aluminum
{sup 134}Cs emission probabilities determination by gamma spectrometry
Energy Technology Data Exchange (ETDEWEB)
Almeida, M.C.M. de, E-mail: candida@cnen.gov.br [Comissão Nacional de Energia Nuclear (DINOR/CNEN), Riode Janeiro, RJ (Brazil); Poledna, R.; Delgado, J.U.; Silva, R.L.; Araujo, M.T.; Silva, C.J. da [Instituto de Radioproteção e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)
2017-07-01
The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of {sup 134}Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. {sup 134}Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration.The gamma emission probabilities (Pγ) were determined mainly for some energies of the {sup 134}Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1). (author)
Early colon cancer : findings on double contrast barium enema
International Nuclear Information System (INIS)
Kim, Seung Kwon; Lim, Jae Hoon; Lee, Soon Jin; Lim, Hyo Keun
1998-01-01
The purpose of this study is to describe the radiologic findings of early colon cancer on double-contrast barium enema. We retrospectively reviewed the double-contrast barium enemas of eight patients (M:F = 6:2; mean age : 67 yrs; range : 48-77 yrs) who were pathologically proven to be early colon cancer. The location, size and gross morphology of lesions was evaluated using double-contrast barium enema, while depth of invasion, degree of differentiation, precancerous lesions and lymph node metastasis were evaluated histopathologically. Early colon cancer was found in the rectum (n=4), sigmoid colon (n=3) and ascending colon (n=1). The size of mass ranged from 2.3 ∼ 8.3 (mean, 4.6) cm. And the polypoid type was most common (n=7); this was subdivided into sessile (Is, n=5), semipedunculated (Isp, n=1) and pedunculated type (Ip, n=1). Another mass was a sessile polypoid combined with a flat depressed lesion. In eight cases, four cancers were confined to the mucosa, while the remaining four had infiltrated the submucosa. Most cancers arose from villous and villotubular adenoma. All cases were well-differentiated adenocarcinoma and no metastasis to lymph nodes had occurred. In early colon cancer, lesions were mainly polypoid and large. Most arose from villous and villotubular adenoma. (author). 19 refs., 1 tab., 3 figs
Complications from radiographer-performed double contrast barium enemas
Energy Technology Data Exchange (ETDEWEB)
Vora, P.; Chapman, A. E-mail: anthony.chapman@leedsth.nhs.uk
2004-04-01
AIM: To determine the types and rates of complications encountered by radiographers when performing double contrast barium enemas (DCBE). MATERIALS AND METHODS: Seven hundred and forty-one questionnaires were posted to radiographers who had in the last 5 years attended one of the biannual barium enema training courses. RESULTS: Of 741 questionnaires posted 407 (54.9%) were returned completed. Approximately 348,000 barium enema examinations had been performed. Fifty-nine radiographers reported 89 complications, including 13 intra-peritoneal and 11 extra-peritoneal perforations. There were five deaths (mortality 1 in 70,000). Deaths resulted from two of 24 (10%) perforations, two of 45 (5%) cardiac events and one cerebrovascular accident that occurred during an examination. CONCLUSIONS: Radiographers have been regularly performing DCBEs for almost a decade. The mortality for radiographer-performed DCBE is similar to that previously reported for radiologists, although a slightly higher rate of perforation is noted and so this is an area where radiographer training should be targeted.
Complications from radiographer-performed double contrast barium enemas
International Nuclear Information System (INIS)
Vora, P.; Chapman, A.
2004-01-01
AIM: To determine the types and rates of complications encountered by radiographers when performing double contrast barium enemas (DCBE). MATERIALS AND METHODS: Seven hundred and forty-one questionnaires were posted to radiographers who had in the last 5 years attended one of the biannual barium enema training courses. RESULTS: Of 741 questionnaires posted 407 (54.9%) were returned completed. Approximately 348,000 barium enema examinations had been performed. Fifty-nine radiographers reported 89 complications, including 13 intra-peritoneal and 11 extra-peritoneal perforations. There were five deaths (mortality 1 in 70,000). Deaths resulted from two of 24 (10%) perforations, two of 45 (5%) cardiac events and one cerebrovascular accident that occurred during an examination. CONCLUSIONS: Radiographers have been regularly performing DCBEs for almost a decade. The mortality for radiographer-performed DCBE is similar to that previously reported for radiologists, although a slightly higher rate of perforation is noted and so this is an area where radiographer training should be targeted
Microwave-hydrothermal synthesis of barium strontium titanate nanoparticles
International Nuclear Information System (INIS)
Simoes, A.Z.; Moura, F.; Onofre, T.B.; Ramirez, M.A.; Varela, J.A.; Longo, E.
2010-01-01
Research highlights: → Barium strontium titanate nanoparticles were obtained by the Hydrothemal microwave technique (HTMW) → This is a genuine technique to obtain nanoparticles at low temperature and short times → Barium strontium titanate free of carbonates with tetragonal structure was grown at 130 o C. - Abstract: Hydrothermal-microwave method (HTMW) was used to synthesize crystalline barium strontium titanate (Ba 0.8 Sr 0.2 TiO 3 ) nanoparticles (BST) in the temperature range of 100-130 o C. The crystallization of BST with tetragonal structure was reached at all the synthesis temperatures along with the formation of BaCO 3 as a minor impurity at lower syntheses temperatures. Typical FT-IR spectra for tetragonal (BST) nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH- groups, commonly found in materials obtained by HTMW process. FE/SEM revealed that lower syntheses temperatures led to a morphology that consisted of uniform grains while higher syntheses temperature consisted of big grains isolated and embedded in a matrix of small grains. TEM has shown BST nanoparticles with diameters between 40 and 80 nm. These results show that the HTMW synthesis route is rapid, cost effective, and could serve as an alternative to obtain BST nanoparticles.
Spectrophotometry of barium, CH, and R-type carbon stars
International Nuclear Information System (INIS)
Gow, C.E.
1976-01-01
Observations of 35 barium, CH, R, and hydrogen-deficient carbon stars, along with ten comparison K giants, have been made with the Indiana rapid spectrum scanner and the Indiana SIT vidicon spectrometer. The scanner observations cover a wavelength range of 3300--7000 A at 30-A resolution, while the SIT vidicon observations cover a wavelength range of 3800--5000 A at 2.5-A resolution. The data have been used to form molecular indices for a quantitative measurement of the strength of molecular features appearing in this region of the spectrum, and to compare the spectral energy distribution of carbon and oxygen stars over the entire observed wavelength range. We find the C 2 Swan index correlated strongly with both the strength of an unidentified feature centered near 4000 A, and the barium-to-hydrogen ratio. A detailed comparison of the spectral energy distribution of the barium stars with normal K giants shows that this unidentified absorption feature consists of two shallows depressions, one at 4000 A and another at 4325 A
Effects of polyacrylic acid additive on barium sulfate particle morphology
Energy Technology Data Exchange (ETDEWEB)
Li, Jie; Liu, Dandan; Jiang, Hongkun; Wang, Jun; Jing, Xiaoyan; Chen, Rongrong [Key Laboratory of Superlight Material and Surface Technology of Ministry of Education, College of Material Science and Chemical Engineering, Harbin Engineering University, Harbin 150001 (China); Zhu, Wenting [Department of Gastroenterology, Harbin Medical University Cancer Hospital, Harbin 150081 (China); Han, Shihui [Key Laboratory of Superlight Material and Surface Technology of Ministry of Education, College of Material Science and Chemical Engineering, Harbin Engineering University, Harbin 150001 (China); Li, Wanyou [College of Power and Energy Engineering, Harbin Engineering University, Harbin 150001 (China); Wei, Hao, E-mail: weihao7512@126.com [Key Laboratory of Superlight Material and Surface Technology of Ministry of Education, College of Material Science and Chemical Engineering, Harbin Engineering University, Harbin 150001 (China); College of Power and Energy Engineering, Harbin Engineering University, Harbin 150001 (China)
2016-06-01
In this paper, polyacrylic acid (PAA) was used as a growth modifier to control micron-sized barium sulfate particles via a simple precipitation reaction between sodium sulfate and barium chloride at ambient temperature. The barium sulfate particles were exhibited various morphologies, such as monodisperse spheres, ellipsoids, rose-like aggregates, etc. To better understand the formation mechanisms of the various morphologies of these particles, scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD) and thermo-gravimetric analysis (TGA) were employed. It was found that the PAA concentration, pH, and Ba{sup 2+} and SO{sub 4}{sup 2−} ions concentrations were the most important parameters controlling the morphology of the BaSO{sub 4} particles. These parameters affected the BaSO{sub 4} morphology by influencing the interactions between the PAA carboxyl groups and inorganic ions and the conformation change of the PAA molecular chains. Moreover, this work attempts to provide a preliminary understanding of the formation of the spherical BaSO{sub 4} particles with the randomly coiled conformation of the polymer. - Highlights: • Polyacrylic acid (PAA) was used as a growth modifier to control micron-sized BaSO{sub 4} particles. • The PAA/BaSO{sub 4} particles were exhibited various morphologies. • Provide a preliminary understanding of the formation mechanism of BaSO{sub 4} particles.
Barium as a potential indicator of phosphorus in agricultural runoff.
Ahlgren, Joakim; Djodjic, Faruk; Wallin, Mats
2012-01-01
In many catchments, anthropogenic input of contaminants, and in particular phosphorus (P), into surface water is a mixture of agricultural and sewage runoff. Knowledge about the relative contribution from each of these sources is vital for mitigation of major environmental problems such as eutrophication. In this study, we investigated whether the distribution of trace elements in surface waters can be used to trace the contamination source. Water from three groups of streams was investigated: streams influenced only by agricultural runoff, streams influenced mainly by sewage runoff, and reference streams. Samples were collected at different flow regimes and times of year and analyzed for 62 elements using ICP-MS. Our results show that there are significant differences between the anthropogenic sources affecting the streams in terms of total element composition and individual elements, indicating that the method has the potential to trace anthropogenic impact on surface waters. The elements that show significant differences between sources are strontium (p barium (p barium shows the greatest potential as a tracer for an individual source of anthropogenic input to surface waters. We observed a strong relationship between barium and total P in the investigated samples (R(2) = 0.78), which could potentially be used to apportion anthropogenic sources of P and thereby facilitate targeting of mitigation practices. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.
Strontium-90 sorption from fresh waters in the process of barium manganite modification
International Nuclear Information System (INIS)
Ryzhen'kov, A.P.; Egorov, Yu.V.
1995-01-01
Strontium-90 extraction by barium manganite from fresh water (natural non-salty water in open ponds) may be increased adding to the solution the sulfate anion containing reagents that modify a sorbent and chemically bind a sorbate. Heterogeneous anion-exchanging reaction of barium manganite transformation into barium sulfate-manganese dioxide and simultaneous coprecipitation of strontium sulfate (microelement) occur as a result of it. 9 refs., 4 figs., 1 tab
Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium
Energy Technology Data Exchange (ETDEWEB)
Yuan, Weitang; Zhang, Zhiyong; Liu, Jinbo; Li, Zhen; Song, Junmin; Wu, Changcai [Department of Colorectal Surgery, The First Affiliated Hospital and Institute of Clinical Medicine, Zhengzhou University, 450052 Zhengzhou (China); Wang, Guixian, E-mail: guixianwang@hotmail.com [Department of Colorectal Surgery, The First Affiliated Hospital and Institute of Clinical Medicine, Zhengzhou University, 450052 Zhengzhou (China)
2012-09-15
Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation.
Zehra Durmus
2014-01-01
Nanocrystalline particles of barium hexaferrite were synthesized by a sol-gel combustion route using nitrate-citrate gels prepared from metal nitrates and citric acid solutions with Fe/Ba molar ratio 12. The present paper aims to study the effect of addition of polyethylene glycol (PEG) solutions with different molecular weights (MW: 400, 2000, and 10.000 g/mol) on magnetostructural properties of barium hexaferrite. The formation of the barium hexaferrite was inspected using X-ray diffractio...
Aspiration of barium contrast medium in an elderly man with disordered swallowing
Bağcı Ceyhan, B.; Çelikel, T.; Koç, M.; Ahıskalı, R.; Biren, T.; Ataizi Çelikel, Ç.
1995-01-01
The aspiration of contrast medium during the investigation of gastrointestinal diseases is a well recognized hazard, particularly in patients with swallowing disorders. A case is reported in which accidental aspiration of contrast barium occurred owing to disordered swallowing in an elderly man. The infiltration on chest x-ray persisted 2 years after barium contrast aspiration. Inflammatory reaction and retractile, granular material observed in lung biopsy specimens suggested barium-induced p...
Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium
International Nuclear Information System (INIS)
Yuan, Weitang; Zhang, Zhiyong; Liu, Jinbo; Li, Zhen; Song, Junmin; Wu, Changcai; Wang, Guixian
2012-01-01
Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation
Activity standardization of 134Cs and 137Cs
International Nuclear Information System (INIS)
Sochorová, Jana; Auerbach, Pavel
2014-01-01
The paper presents the results from a primary standardization of 137 Cs using two independent methods – efficiency tracing using PC-NaI coincidence and the TDCR method. The nuclides 60 Co and 134 Cs were used as the tracers. Primary standardization of the 134 Cs is also discussed. The efficiency extrapolation was carried out by measuring samples of varying mass and using the wet extrapolation method. The results obtained are in good agreement; the differences did not exceed 0.5%. The advantages, pitfalls and also possibilities for improvement of the procedures are discussed
Determination of Cs-134 and Cs-137 rain water samples
International Nuclear Information System (INIS)
Lima, M.F.; Mazzilli, B.
1988-01-01
In order to setting an environmental monitoring program at IPEN, was developed a fast and simple methodology for concentration of Cs-134 and Cs-137 in rain water. This procedure consists in the precipitation of cesium and others cathions of its family (NH 4 + , K + and Rb + ) by ammonium molybdophosphate. The measures of the desintegration rates of Cs-134 and Cs-137 was done by gamma spectrometry in a Ge(Li) detector. After setting up the ideal experimental conditions, the procedure was used to analyze four samples of rain water. (author) [pt
Results of a cooperative study for the evaluation of the barium meal Falibaryt HD
International Nuclear Information System (INIS)
Reisinger, W.; Liess, G.; Beckmann, D.; Block, H.G.; Dietze, R.; Grosche, N.; Hall, E.; Lasch, G.; Knoth, H.J.; Kroeger, W.
1986-01-01
The diagnostic capabilities of radiologic investigations of the stomach in double contrast can be significantly improved with high-density low-viscosity barium meals. In the GDR the barium meal Falibaryt HD with a barium sulfate content of 215 g per 100 ml suspension has been developed. In nearly 1,000 radiologic investigations of the stomach (81% in relaxation with spasmolytics, 66% without hypotony) all fine structures were well imaged and the preparation therefore is comparable with the best barium meals presently on the market. (author)
Barium titanate coated with magnesium titanate via fused salt method and its dielectric property
International Nuclear Information System (INIS)
Chen Renzheng; Cui Aili; Wang Xiaohui; Li Longtu
2003-01-01
Barium titanate fine particles were coated homogeneously with magnesium titanate via the fused salt method. The thickness of the magnesium titanate film is 20 nm, as verified by TEM and XRD. The mechanism of the coating is that: when magnesium chloride is liquated in 800 deg. C, magnesium will replace barium in barium titanate, and form magnesium titanate film on the surface of barium titanate particles. Ceramics sintered from the coated particles show improved high frequency ability. The dielectric constant is about 130 at the frequency from 1 to 800 MHz
Effects of powdered versus liquid barium on the viscosity of fluids used in modified swallow studies
International Nuclear Information System (INIS)
Baron, J.; Alexander, T.
2003-01-01
To determine if the viscosity of thickened juice mixtures used in modified barium swallow studies significantly changes with the addition of powdered barium. We also describe a test formulation created using liquid barium, which has a negligible effect on juice viscosity. The viscosities of water and standardized honey- and nectar-consistency juices mixed with different amounts of powdered barium were measured by timing the laminar flow of a given initial hydrostatic head of fluid under gravity though an orifice of fixed diameter. Standardized juices were then mixed with a liquid formulation of barium and with measured quantities of water to produce viscosities that more closely equated with those of the standardized juices. With the addition of powdered barium, viscosity increased in all fluids, most markedly with the nectar-consistency juice. Liquid barium formulations maintained the viscosities of the original thickened juices. Rendering juices radio-opaque with barium powder results in dramatic increases in the viscosity of the resulting mixture and compromises diagnostic accuracy. Liquid barium preparations have the advantage that they can be rapidly and accurately dispensed by syringe, and their use does not significantly increase the viscosity of the preparation. (author)
Effects of powdered versus liquid barium on the viscosity of fluids used in modified swallow studies
Energy Technology Data Exchange (ETDEWEB)
Baron, J.; Alexander, T. [Univ. of Alberta, Dept. of Radiology, Edmonton, Alberta (Canada)
2003-06-01
To determine if the viscosity of thickened juice mixtures used in modified barium swallow studies significantly changes with the addition of powdered barium. We also describe a test formulation created using liquid barium, which has a negligible effect on juice viscosity. The viscosities of water and standardized honey- and nectar-consistency juices mixed with different amounts of powdered barium were measured by timing the laminar flow of a given initial hydrostatic head of fluid under gravity though an orifice of fixed diameter. Standardized juices were then mixed with a liquid formulation of barium and with measured quantities of water to produce viscosities that more closely equated with those of the standardized juices. With the addition of powdered barium, viscosity increased in all fluids, most markedly with the nectar-consistency juice. Liquid barium formulations maintained the viscosities of the original thickened juices. Rendering juices radio-opaque with barium powder results in dramatic increases in the viscosity of the resulting mixture and compromises diagnostic accuracy. Liquid barium preparations have the advantage that they can be rapidly and accurately dispensed by syringe, and their use does not significantly increase the viscosity of the preparation. (author)
Barium and Tc-poor S stars: Binary masqueraders among carbon stars
Jorissen, A.; Van Eck, S.
1997-01-01
The current understanding of the origin of barium and S stars is reviewed, based on new orbital elements and binary frequencies. The following questions are addressed: (i) Is binarity a necessary condition to produce a barium star? (ii) What is the mass transfer mode (wind accretion or RLOF?) responsible for their formation? (iii) Do barium stars form as dwarfs or as giants? (iv) Do barium stars evolve into Tc-poor S stars? (v) What is the relative frequency of Tc-rich and Tc-poor S stars?
Prompt striations observed in a barium thermite release at 335 km
International Nuclear Information System (INIS)
Simons, D.J.; Pongratz, M.B.; Smith, G.M.; Barasch, G.E.; Fitzgerald, T.J.
1981-01-01
Three barium clouds have been released from a single rocket at altitudes of 335, 443, and 535 km. The releases were by means of barium thermite injection. Adding the different cross-field velocity components of the rocket at each of the releases resulted in barium clouds with different kinetic velocity distributions. The barium cloud with the most peaked velocity distribution striated promptly, in good agreement with theoretical predictions based on a kinetic plasma instability. Details of the data analysis and experiment are discussed
Radiogenotoxicological effect of signal nuclide 134Cs on somatic and germ cells
Institute of Scientific and Technical Information of China (English)
ZhuShou-Peng; XiaFen; 等
1997-01-01
Chromosome at aberation rates in bone marrow cells and micronucleus formation in bone marrow polychromatic erythrocytes both rise with increase in radioactivities of 134Cs,and can be fitted to power functions of radioactivities of 134Cs.In spermatogonia 134Cs mainly induced chromatid breakage,and abnormalities in sperm can also be experessed as power functions of radioactivities of 134 Cs.
International Nuclear Information System (INIS)
Kaur, Talwinder; Kumar, Sachin; Narang, S.B.; Srivastava, A.K.
2016-01-01
Nanocomposites of substituted barium hexaferrite and barium titanate embedded in a polymer were synthesized via emulsion polymerization. The study was performed by using X-ray diffraction, Fourier transform infrared spectroscopy, transmission electron microscopy, electron spin resonance spectroscopy, a vibrating sample magnetometer and a vector network analyzer. It is found that maximum radiation loss occur at 16.09 GHz (−14.23 dB) frequency owing to the combined effect of conducting polymer, suitable dielectric and magnetic material. This suggests that prepared material is suitable for radiation losses. Micro structural study reveals the presence of all the phases of the compounds comprises composite. Benzene ring absorption band (at 1183 cm"−"1) in FT-IR spectra illustrates the presence of polymer. Surface morphology reveals the presence of array of particles encapsulated by the polymer. - Highlights: • Composites having polymer, barium titanate and hexaferrite have been successfully prepared. • Effective radiation absorption and losses have been achieved. • Magnetic properties have made an impact on shielding effectiveness.
Energy Technology Data Exchange (ETDEWEB)
Kaur, Talwinder [Department of Physics, Lovely Professional University, Phagwara 144411 (India); Kumar, Sachin [Department of Chemistry, Guru Nanak Dev University, Amritsar 143005 (India); Narang, S.B. [Department of Electronics Technology, Guru Nanak Dev University, Amritsar 143005 (India); Srivastava, A.K., E-mail: srivastava_phy@yahoo.co.in [Department of Physics, Lovely Professional University, Phagwara 144411 (India)
2016-12-15
Nanocomposites of substituted barium hexaferrite and barium titanate embedded in a polymer were synthesized via emulsion polymerization. The study was performed by using X-ray diffraction, Fourier transform infrared spectroscopy, transmission electron microscopy, electron spin resonance spectroscopy, a vibrating sample magnetometer and a vector network analyzer. It is found that maximum radiation loss occur at 16.09 GHz (−14.23 dB) frequency owing to the combined effect of conducting polymer, suitable dielectric and magnetic material. This suggests that prepared material is suitable for radiation losses. Micro structural study reveals the presence of all the phases of the compounds comprises composite. Benzene ring absorption band (at 1183 cm{sup −1}) in FT-IR spectra illustrates the presence of polymer. Surface morphology reveals the presence of array of particles encapsulated by the polymer. - Highlights: • Composites having polymer, barium titanate and hexaferrite have been successfully prepared. • Effective radiation absorption and losses have been achieved. • Magnetic properties have made an impact on shielding effectiveness.
International Nuclear Information System (INIS)
Tran Duc Thiep; Truong Thi An; Phan Viet Cuong; Nguyen The Vinh
2012-01-01
We have determined the isomeric ratios in 130 Ba(γ, n) 129m,g Ba, 132 Ba(γ, n) 131m,g Ba and 134 Ba(γ, n) 133m,g Ba photonuclear reactions of natural barium induced by bremsstrahlungs with end-point energies in the giant dipole resonance region. The investigated samples were irradiated at electron accelerator Microtron MT-25 of the Flerov Laboratory of Nuclear Reaction, Joint Institute for Nuclear Research, Dubna, Russia. The gamma spectra of the samples irradiated were measured with spectroscopic system consisting of 8192 channel analyzer and high-energy resolution (180 keV at gamma ray 1332 keV of 60 Co) HP(Ge) semiconductor detector Canberra. The GENIE2000 (Canberra) computer program was used for data processing. The results were discussed and compared with those of other authors. (author)
Environmentally benign synthesis of sydnone containing 1,3,4 ...
Indian Academy of Sciences (India)
TECS
lop benign synthetic methods for sydnone deriva- tives,. 9 we report here a new series of sydnone containing 1,3,4-thiadiazines by microwave irradia- tion under solvent-free conditions. 2. Experimental. 2.1 General remarks. Melting points were determined by open capillary method and are uncorrected. All compounds were.
Physical properties of 134 soils in six northeastern states
A. R. Eschner; B. O. Jones; R. C. Moyle
1957-01-01
From June 1954 to July 1955 the Vicksburg Infiltration Project collected and analyzed samples from 134 sites in six Northeastern States; the samples included 79 soil series and 114 soil types. This work was done to supply the U. S. Army with information needed for specialized research on military traffic ability. The basic data are herein presented because of their...
Predicting heat transfer in long, R-134a filled thermosyphons
Grooten, M.H.M.; Geld, van der C.W.M.
2008-01-01
When traditional air-to-air cooling is too voluminous, heat exchangers with long thermosyphons offer a good alternative. Experiments with a single thermosyphon with a large length-to-diameter ratio (188) and filled with R-134a are presented and analyzed. Saturation temperatures, filling ratios, and
43 CFR 13.4 - Terms of permit.
2010-10-01
... § 13.4 Terms of permit. Every permit shall describe the location of the vending facilities and shall be... Interior bureau or office for each location. The head of the Interior bureau or office may require... efficiency as may be prescribed by the head of the Interior bureau or office. Such standards shall conform...
10 CFR 63.134 - Monitoring and testing waste packages.
2010-01-01
....134 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A... geologic repository operations area, the environment of the waste packages selected for the waste package monitoring program must be representative of the environment in which the wastes are to be emplaced. (c) The...
Calibration of the SH134-20 Standard Gain Horn
DEFF Research Database (Denmark)
Pivnenko, Sergey; Breinbjerg, Olav
This report documents the measurement of the linearly polarized SH134-20 Standard Gain Horn. The measurement comprises on-axis gain, on-axis polarization characteristics, and reflection coefficient at 111 frequencies in the frequency range from 22-33 GHz. The measurement was carried out at the DTU...
13 CFR 134.618 - How are awards paid?
2010-01-01
... CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Implementation of the Equal Access to Justice Act § 134... of Financial Operations, SBA, P.O. Box 205, Denver, CO 80201-0205. SBA will pay you the amount awarded within 60 days of receipt of your request unless it is notified that you or another party has...
EXPERIMENTAL INVESTIGATION OF R-134a AND R-600a ...
African Journals Online (AJOL)
Preet khandelwal
performance of blends of two existing refrigerant, R-134a and R-600a, blended together at ratios of 11%/89%, ... blending ratios, estimated GWPs ≤ 150 using Ali's model. .... series are less flammable among other HCs and its .... Figure 2: Variation of Evaporator Temperature with Time at an Ambient Temperature of 37oC.
19 CFR 134.35 - Articles substantially changed by manufacture.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles substantially changed by manufacture. 134... substantially changed by manufacture. (a) Articles other than goods of a NAFTA country. An article used in the United States in manufacture which results in an article having a name, character, or use differing from...
Böttcher, Michael E; Neubert, Nadja; von Allmen, Katja; Samankassou, Elias; Nägler, Thomas F
2018-06-01
In this study, we present the experimental results for stable barium (Ba) isotope fractionation ( 137 Ba/ 134 Ba) during the transformation of aragonite (CaCO 3 ) and gypsum (CaSO 4 ·2H 2 O) in Ba-bearing aqueous solution to witherite (BaCO 3 ) and barite (BaSO 4 ), respectively. The process was studied at three temperatures between 4 and 60 °C. In all cases, the transformation leads to a relative enrichment of the lighter 134 Ba isotope in the solid compared to the aqueous solution, with 137/134 Ba enrichment factors between -0.11 and -0.17 ‰ for BaCO 3 , and -0.21 and -0.26 ‰ for BaSO 4 . The corresponding mass-dependent 138/134 Ba enrichment factors are -0.15 to -0.23 ‰ for BaCO 3 , and -0.28 to -0.35 ‰ for BaSO 4 . The magnitude of isotope fractionation is within the range of recent reports for witherite and barite formation, as well as trace Ba incorporation into orthorhombic aragonite, and no substantial impact of temperature can be found between 4 and 80 °C. In previous studies, ion (de)solvation has been suggested to impact both the crystallization process of Ba-bearing solids and associated Ba isotope fractionation. Precipitation experiments of BaSO 4 and BaCO 3 using an methanol-containing aqueous solution indicate only a minor effect of ion and crystal surface (de)solvation on the overall Ba isotope fractionation process.
A review of the health impacts of barium from natural and anthropogenic exposure.
Kravchenko, Julia; Darrah, Thomas H; Miller, Richard K; Lyerly, H Kim; Vengosh, Avner
2014-08-01
There is an increasing public awareness of the relatively new and expanded industrial barium uses which are potential sources of human exposure (e.g., a shale gas development that causes an increased awareness of environmental exposures to barium). However, absorption of barium in exposed humans and a full spectrum of its health effects, especially among chronically exposed to moderate and low doses of barium populations, remain unclear. We suggest a systematic literature review (from 1875 to 2014) on environmental distribution of barium, its bioaccumulation, and potential and proven health impacts (in animal models and humans) to provide the information that can be used for optimization of future experimental and epidemiological studies and developing of mitigative and preventive strategies to minimize negative health effects in exposed populations. The potential health effects of barium exposure are largely based on animal studies, while epidemiological data for humans, specifically for chronic low-level exposures, are sparse. The reported health effects include cardiovascular and kidney diseases, metabolic, neurological, and mental disorders. Age, race, dietary patterns, behavioral risks (e.g., smoking), use of medications (those that interfere with absorbed barium in human organism), and specific physiological status (e.g., pregnancy) can modify barium effects on human health. Identifying, evaluating, and predicting the health effects of chronic low-level and moderate-level barium exposures in humans is challenging: Future research is needed to develop an understanding of barium bioaccumulation in order to mitigate its potential health impacts in various exposured populations. Further, while occupationally exposed at-risk populations exist, it is also important to identify potentially vulnerable subgroups among non-occupationally exposed populations (e.g., elderly, pregnant women, children) who are at higher risk of barium exposure from drinking water and food.
The diagnosis of gastro-esophageal reflux disease cannot be made with barium esophagograms.
Saleh, C M G; Smout, A J P M; Bredenoord, A J
2015-02-01
For over 50 years, barium studies have been used to diagnose gastro-esophageal reflux disease (GERD), but the value of this test is controversial. Our study aimed to determine if barium esophagograms can be used to diagnose GERD. Barium esophagograms and pH-impedance measurement were performed in 20 subjects with reflux symptoms. pH-impedance measurements were used as gold standard for the diagnosis of GERD. Gastro-esophageal reflux measured with the barium study was defined as a positive outcome. 50% of patients presented gastro-esophageal reflux on the barium esophagogram. No significant differences were observed in acid exposure time between subjects with (median: 7.4%; interquartile range, IQR: 8.4%) or without reflux at barium esophagography (median: 5.95%; IQR: 13.05%; p > 0.05). Nor did we find differences in median proximal extent of reflux measured with impedance monitoring between patients with a positive (median: 6.7%; IQR: 1.95%) and negative barium study (median: 7.1%; IQR: 0.68%; p > 0.05). Patients with reflux on barium esophagogram did not have a positive symptom association probability more often than those who did not have reflux at barium esophagography. Lastly, there were no differences in numbers of acid, weakly acidic or total reflux episodes between those with positive or negative barium esophagogram (p > 0.05). No correlations were found between the maximum proximal extent of gastro-esophageal reflux during esophagography and pH-impedance parameters. Presence or absence of gastro-esophageal reflux during barium esophagography does not correlate with incidence or extent of reflux observed during 24-h pH-impedance monitoring and is not of value for the diagnosis of GERD. © 2014 John Wiley & Sons Ltd.
Anion and cation diffusion in barium titanate and strontium titanate
International Nuclear Information System (INIS)
Kessel, Markus Franz
2012-01-01
Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO 3 single crystals has been studied by means of 18 O 2 / 16 O 2 isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial pressure and temperature. The
Thermal evolution of exchange interactions in lightly doped barium hexaferrites
Energy Technology Data Exchange (ETDEWEB)
Trukhanov, S.V., E-mail: truhanov@ifttp.bas-net.by [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Trukhanov, A.V. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Kostishyn, V.G.; Panina, L.V. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); Turchenko, V.A. [Joint Institute for Nuclear Research, Joliot-Curie Str., 141980 Dubna (Russian Federation); Donetsk Institute of Physics and Technology named after A.A. Galkin of the NAS of Ukraine, 72 R.Luxemburg Str., 83114 Donetsk (Ukraine); Kazakevich, I.S. [SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Trukhanov, An.V. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Trukhanova, E.L.; Natarov, V.O. [SSPA “Scientific and practical materials research centre of NAS of Belarus”, P. Brovki Str., 19, 220072 Minsk, Belorussia (Belarus); Balagurov, A.M. [Joint Institute for Nuclear Research, Joliot-Curie Str., 141980 Dubna (Russian Federation)
2017-03-15
The lightly doped BaFe{sub 12−x}D{sub x}O{sub 19} (D=Al{sup 3+}, In{sup 3+}; x=0.1 and 0.3) polycrystalline hexaferrite samples have been investigated by powder neutron diffractometry as well as by vibration sample magnetometry in a wide temperature range from 4 K up to 740 K and in magnetic field up to 14 T to establish the nature of Fe{sup 3+}(Al{sup 3+}, In{sup 3+}) – O{sup 2-} - Fe{sup 3+}(Al{sup 3+}, In{sup 3+}) indirect exchange interactions. The crystal structure features such as the ionic coordinates and lattice parameters have been defined and Rietveld refined. The Invar effect has been observed in low temperature range below 150 K. It was explained by the thermal oscillation anharmonicity of ions. It is established that the ferrimagnet-paramagnet phase transition is a standard second-order one. From the macroscopic magnetization measurement the Curie temperature and ordered magnetic moment per nominal iron ion are obtained. From the microscopic diffraction measurement the magnetic moments at all the nonequivalent ionic positions and total magnetic moment per iron ion have been obtained at different temperatures down to 4 K. The light diamagnetic doping mechanism and magnetic structure model are proposed. The effect of light diamagnetic doping on nature of Fe{sup 3+}(Al{sup 3+}, In{sup 3+}) – O{sup 2-} - Fe{sup 3+}(Al{sup 3+}, In{sup 3+}) indirect exchange interactions with temperature increase is discussed. - Highlights: • Crystal structure for lightly doped barium hexaferrites was investigated. • Atomic coordinates and lattice parameters were Rietveld refined. • Magnetic properties for lightly doped barium hexaferrites was investigated. • Magnetic structure for lightly doped barium hexaferrites was investigated. • Magnetic moments at different position and total moment per iron ion were defined.
Multiple electrical phase transitions in Al substituted barium hexaferrite
Kumar, Sunil; Supriya, Sweety; Kar, Manoranjan
2017-12-01
Barium hexaferrite is known to be a very good ferromagnetic material. However, it shows very good dielectric properties, i.e., the dielectric constant is comparable to that of the ferroelectric material. However, its crystal symmetry does not allow it to be a ferroelectric material. Hence, the electrical properties have revived the considerable research interest on these materials, not only for academic interest, but also for technological applications. There are a few reports on temperature dependent dielectric behavior of these materials. However, the exact cause of dielectric as well as electrical conductivity is yet to be established. Hence, Al (very good conducting material) substituted barium hexaferrite (BaFe12-xAlxO19, x = 0.0-4.0) has been prepared by following the modified sol-gel method to understand the ac and DC electrical properties of these materials. The crystal structure and parameters have been studied by employing the XRD and FTIR techniques. There are two transition temperatures, which have been observed in the temperature dependent ac dielectric and DC resistivity measurement. The response of dielectric behaviors to temperature is similar to that of the ferroelectric material; however, the dielectric polarization is due to the polaron hopping, which is evident from the DC resistivity analysis. Hence, the present observations lead to understand the electrical properties of barium hexaferrite. The frequency dependent dielectric dispersion can be understood by the modified Debye model. More interestingly, the dielectric constant decreases and DC resistivity increases with the increase in the Al concentration, which has the correlation between bond length modifications in the crystal due to substitution.
Influence of fuel ratios on auto combustion synthesis of barium ferrite ...
Indian Academy of Sciences (India)
Unknown
Influence of fuel ratios on auto combustion synthesis of barium ferrite nano particles. D BAHADUR*, S RAJAKUMAR and ANKIT KUMAR. Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology,. Mumbai 400 076 e-mail: dhirenb@iitb.ac.in. Abstract. Single-domain barium ferrite nano ...
New efficient catalyst for ammonia synthesis: barium-promoted cobalt on carbon
DEFF Research Database (Denmark)
Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus
2002-01-01
Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia......Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia...
Molaei, M.J.; Ataie, A.; Raygan, S.; Picken, S.J.
2011-01-01
In this research, barium ferrite /magnetite nanocomposites synthesized via a mechano-chemical route. Graphite was used in order to reduce hematite content of barium ferrite to magnetite to produce a magnetic nanocomposite. The effects of processing conditions on the powder characteristics were
Acute respiratory failure caused by aspiration of high density barium: A case report
International Nuclear Information System (INIS)
Park, Ki Soon; Jung, Eun A; Yang, Ik; Lee, Yul; Chung, Soo Young
1994-01-01
Accidental aspiration of barium contrast medium during the upper gastrointestinal study can occur in patients with swallowing disorder, especially in the elderly patients. We experienced a case of respiratory failure followed by death within a few hours in 85 year-old patient after barium aspiration
Complete sulphate removal from neutralised acidic mine drainage with barium carbonate
CSIR Research Space (South Africa)
Swanepoel, H
2012-03-01
Full Text Available -barium-calcium) Desalination process which uses barium salts to further reduce the sulphate concentration to acceptable levels with the added advantage that sulphate removal can be controlled due to the low solubility of BaSO4. This paper reports on the results...
Barium strontium titanate powders prepared by spray pyrolysis
International Nuclear Information System (INIS)
Brankovic, G.; Brankovic, Z.; Goes, M.S.; Paiva-Santos, C.O.; Cilense, M.; Varela, J.A.; Longo, E.
2005-01-01
Ultasonic spray pyrolysis (SP) has been investigated for the production of the barium strontium titanate (BST) powders from the polymeric precursors. The processing parameters, such as flux of aerosol and temperature profile inside the furnace, were optimized to obtain single phase BST. The powders were characterized by the methods of X-ray diffraction analysis, SEM, EDS and TEM. The obtained powders were submicronic, consisting of spherical, polycrystalline particles, with internal nanocrystalline structure. Crystallite size of 10 nm, calculated using Rietveld refinement, is in a good agreement with results of HRTEM
Macroscopic polarization and thermoluminescence of barium niobate - sodium niobate
International Nuclear Information System (INIS)
Gorban', I.S.; Gumenyuk, A.F.; Omel'yanenko, V.A.
1989-01-01
Thermoluminescence (TL) of initial and thermally treated purposely undoped crystals of barium niobate - sodium has been studied within 85-400 K. The TL intensity is found to depend on the temperature to which the sample has been heated. A conclusion is drawn that nonstationarity of the TL properties is due to slowly occuring processes of compensation of pyrocharge, which depend on the temperatural prehistory of the sample. A mechanism of the traps transformation in a strong pyrofield of high-impedance crystals is discussed
Radium and barium in the Amazon River system
International Nuclear Information System (INIS)
Moore, W.S.; Edmond, J.M.
1984-01-01
Data for 226 Ra and 228 Ra in the Amazon River system show that the activity of each radium isotope is strongly correlated with barium concentrations. Two trends are apparent, one for rivers which drain shield areas and another for all other rivers. These data suggest that there has been extensive fractionation of U, Th, and Ba during weathering in the Amazon basin. The 226 Ra data fit a flux model for the major ions indicating that 226 Ra behaves conservatively along the main channel of the Amazon River
Regularities of radium coprecipitation with barium sulfate from salt solutions
International Nuclear Information System (INIS)
Kudryavskij, Yu.P.; Rakhimova, O.V.
2007-01-01
Coprecipitation of radium with barium sulfate from highly concentrated NaCl solutions is studied, including the effects of the initial solution composition, alkaline reagent (CaO, NaOH), supporting electrolyte (NaCl) concentration, and pH. The process is promoted by high NaCl concentration in the initial solution, which is due to structural transformation and change in the sorption activity of the BaSO 4 precipitate in salt solutions. The results obtained were applied to recovery of radium from process solutions during the development and introduction of improved procedure for disinfection and decontamination of waste yielded by chlorination of loparite concentrates [ru
Zhang, Ying; Li, Yanchun; Wu, Gang; Feng, Bang; Yoell, Shanze; Yu, Zefen; Zhang, Keqin; Xu, Jianping
2012-12-01
This study examined barium concentrations in the mushroom Trogia venenata, the leading culprit for sudden unexpected deaths in Yunnan, southwest China. We found that barium concentrations in T. venenata from Yunnan were low and comparable to other foods, inconsistent with barium concentrations in this mushroom as a significant contributor to these deaths.
Irvine, E J; O'Connor, J; Frost, R A; Shorvon, P; Somers, S; Stevenson, G W; Hunt, R H
1988-01-01
Rectal bleeding often heralds serious colonic disease. The literature suggests that colonoscopy is superior to barium enema plus sigmoidoscopy, although no good comparative studies exist. Seventy one patients with overt rectal bleeding had prospectively flexible sigmoidoscopy, double contrast barium enema and colonoscopy completed independently. Against the gold standard, the sensitivity and specificity of colonoscopy were 0.69 and 0.78 respectively for a spectrum of colonic lesions, while fo...
Bloch, Rebecca A; Cronin, Kimberly; Hoover, John P; Pechman, Robert D; Payton, Mark E
2010-03-01
Barium impregnated polyethylene spheres (BIPS) are used in small animal medicine as an alternative to barium sulfate for radiographic studies of the gastrointestinal tract. To determine the usefulness of BIPS as an alternative to barium suspension in measuring gastrointestinal (GI) transit time for avian species, ventrodorsal radiographs were used to follow the passage of BIPS and 30% barium sulfate suspension through the GI tracts of domestic pigeons (Columba livia). Gastrointestinal transit times of thirty 1.5-mm BIPS administered in moistened gelatin capsules and 30% barium sulfate suspension gavaged into the crop were compared in 6 pigeons. Although the barium suspension passed out of the GI tract of all pigeons within 24 hours, the 1.5-mm BIPS remained in the ventriculus for 368.0 +/- 176.8 hours and did not clear the GI tract for 424.0 +/- 204.6 hours. Although the times for passage of BIPS and 30% barium sulfate suspension from the crop into the ventriculus were not significantly different (P = .14), the times for passage of BIPS from the ventriculus into the large intestine-cloaca and for clearance from the GI tract of the pigeons were significantly longer (P barium sulfate suspension. From the results of this study, we conclude that BIPS are not useful for radiographically evaluating GI transit times in pigeons and are unlikely to be useful in other avian species that have a muscular ventriculus. BIPS may or may not be useful for evaluating GI transit times in species that lack a muscular ventriculus.
Atomization of magnesium, strontium, barium and lead nitrates on surface of graphite atomizers
International Nuclear Information System (INIS)
Nagdaev, V.K.; Pupyshev, A.A.
1982-01-01
Modelling of the processes on graphite surface using differential-thermal analysis and graphite core with identification of decomposition products of magnesium, strontium, barium and lead nitrates by X-ray analysis has shown that carbon promotes the formation of strontium, barium and lead carbonates. The obtained temperatures of strontium and barium carbonate decomposition to oxides agree satisfactorily with calculation ones. Magnesium nitrate does not react with carbon. Formation of strontium and barium carbonates results in considerable slowing down of the process of gaseous oxide dissociation. Lead carbonate is unstable and rapidly decomposes to oxide with subsequent reduction to free metal. Formation of magnesium, strontium and barium free atoms is connected with appearance of gaseous oxides in analytical zone. Oxide and free metal lead are present on graphite surface simultaneously
Barium sulfate suspension as a negative oral contrast agent for MR imaging
International Nuclear Information System (INIS)
Li, K.C.P.; Tart, R.P.; Fitzsimmons, J.R.; Storm, B.; Mao, J.
1989-01-01
Proton spectroscopy with linewidth measurements and MR imaging were performed on various commercially available barium sulfate suspensions as well as inorganic sulfates and barium salts. Approximately 500 mL of 20%, 40%, 60%, and 70% wt/wt single-contrast oral barium sulfate suspensions were administered to four normal volunteers, and MR imaging was performed with both a 1.5-T and a 0.15-T MR imager. As much as 80% of the small bowel and the entire colon were well visualized with the 60% or 70% wt/wt single-contrast barium sulfate suspensions. The authors conclude that barium sulfate suspensions are useful as oral MR contrast agents
International Nuclear Information System (INIS)
Teoh Wah Tzu; Ahmad Fauzi Mohd Noor; Zainal Arifin Ahmad
2002-01-01
The unique electrical properties of large permittivity in Barium Strontium Titanate have been widely used to make capacitors; it can be produced by solid state reaction. In this study, the mixture of Barium Carbonate, Strontium Carbonate and Titanium Dioxide was calcined at 500 degree C, 1000 degree C, 1100 degree C , 1150 degree C, 1200 degree C, 1250 degree C and 1300 degree C. The results of the phases change in each stage were investigated via X ay Diffraction. The results show that the formation of Barium Strontium Titanate started at 1100 degree C with the presence of other phases. The mixture is fully reacted to form Barium Strontium Titanate at 1150 degree C. Only Barium Strontium Titanate was formed as the calcination temperature was set higher. (Author)
International Nuclear Information System (INIS)
Andrade, M.C.; Assis, J.T.; Pereira, F.R.
2009-01-01
A solid-reaction synthesis of doped barium titanate was done by employing barium carbonates, sodium, potassium and titanium oxides with classic procedures. Rietveld refining of X ray diffraction data of perovskite samples with tetragonal symmetry was applying and show good agreement. Besides, the treatment performed from 600 deg C produces nanocrystals of barium titanate with average size of 33 nm. The presence of endothermic peaks related to BaTiO 3 formation at relatively low temperatures was determined by thermal analysis. A pseudo-Voigt Thompson-Cox-Hastings function was used to fit the standard samples of barium titanate. The Rietveld method has showed be efficient to detect the influences of temperature and doping on barium titanate microstructures. (author)
International Nuclear Information System (INIS)
Xie Liang-Hai; Li Lei; Wang Jing-Dong; Tao Ran; Cheng Bing-Jun; Zhang Yi-Teng
2014-01-01
The barium release experiment is an effective method to explore the near-earth environment and to study all kinds of space physics processes. The first space barium release experiment in China was successfully carried out by a sounding rocket on April 5, 2013. This work is devoted to calculating the release efficiency of the barium release by analyzing the optical image observed during the experiment. First, we present a method to calibrate the images grey value of barium cloud with the reference stars to obtain the radiant fluxes at different moments. Then the release efficiency is obtained by a curve fitting with the theoretical evolution model of barium cloud. The calculated result is basically consistent with the test value on ground
Energy Technology Data Exchange (ETDEWEB)
Kessel, Markus Franz
2012-12-19
Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO{sub 3} single crystals has been studied by means of {sup 18}O{sub 2}/{sup 16}O{sub 2} isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial
Isotope ratios and chemical fractionation of CO in Lynds 134
International Nuclear Information System (INIS)
Dickman, R.L.; Langer, W.D.
1977-01-01
Mahoney, McCutcheon and Shuter (1976) reported observations of the J = 1 → 0 transition of three isotopes of CO in the dust cloud Lynds 134 using the 4.6 m telescope at Aerospace Corporation. In this paper a new observation of 12 C 17 O is discussed and the question of the ratio 13 C 16 O/ 12 C 18 O across the dust cloud is considered further. (Auth.)
Investigation of R-134a as a modeling fluid for supercritical water
International Nuclear Information System (INIS)
Jouvin, J.C.; Pioro, I.
2014-01-01
The objective of this paper is to investigate the feasibility of using Refrigerant-134a (R-134a) as a potential modeling fluid by comparing the thermophysical properties with those of water. Operating conditions of SuperCritical Water-cooled Reactors (SCWRs) are scaled into those of R-134a, in order to provide proper SCWR-equivalent conditions. The thermophysical properties for R-134a are obtained from NIST REFPROP software. The results indicate that the thermophysical properties of R-134a undergo significant changes within the critical and pseudocritical regions similar to that of supercritical water. An investigation into the pseudocritical region of R-134a was also conducted. (author)
miR-134: A Human Cancer Suppressor?
Directory of Open Access Journals (Sweden)
Jing-Yu Pan
2017-03-01
Full Text Available MicroRNAs (miRNAs are small noncoding RNAs approximately 20–25 nt in length, which play crucial roles through directly binding to corresponding 3′ UTR of targeted mRNAs. It has been reported that miRNAs are involved in numerous of diseases, including cancers. Recently, miR-134 has been identified to dysregulate in handles of human cancers, such as lung cancer, glioma, breast cancer, colorectal cancer, and so on. Increasing evidence indicates that miR-134 is essential for human carcinoma and participates in tumor cell proliferation, apoptosis, invasion and metastasis, drug resistance, as well as cancer diagnosis, treatment, and prognosis. Nevertheless, its roles in human cancer are still ambiguous, and its mechanisms are sophisticated as well, referring to a variety of targets and signal pathways, such as STAT5B, KRAS, MAPK/ERK signal pathway, Notch pathway, etc. Herein, we review the crucial roles of miR-134 in scores of human cancers via analyzing latest investigations, which might provide evidence for cancer diagnose, treatment, prognosis, or further investigations.
Implementation of R134a Thermophysical Properties for MARS Application
Energy Technology Data Exchange (ETDEWEB)
Son, Gyu Min; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)
2016-05-15
MARS requires 3 files for analysis: executable MARS file, input, and thermodynamic property file (tpf) for target fluids like light water or heavy water. Most experiments and scenarios were interested in behavior of water so original tpfs were sufficient enough for analysis. As MARS application became wider, needs for other fluid properties rose since MARS do not have extra function to interpret foreign materials that does not have tpf. One way of solving this problem is to generate external tpf file and if successfully implemented, this methodology could widen the application of MARS to other fields of engineering. Thus, this study aims for tpf generation of R134a. The reasons for its selection is because R134a is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. Generation methods of tpf were discussed. Conventional tpfh2o utilized Gibbs function to calculate the properties. However, since that method could not be applied to other fluids, fitting equation with temperature and pressure variables were applied from R134a property database. Direct implementation of theses equations simplified the structure of main program.
Placement of radium/barium sludges in tailings areas
International Nuclear Information System (INIS)
Murphy, K.L.; Multamaki, G.E.
1980-01-01
Currently radium is removed from uranium mining and milling effluents by the addition of barium chloride to precipitate the radium as radium/barium sulphate. The precipitate is allowed to settle in sedimentation basins prior to discharge of the effluent. The sedimentation basins are not suitable for final disposal of the sludge, and placement of the sludges in the tailings area has been proposed. The geochemical environment of fresh tailings areas was characterized as an acidic, oxidized surface zone underlain by an alkaline, reduced zone comprising the rest of the tailings. The quantity of sludge produced was estimated to be small relative to the quantity of tailings, and therefor a relatively small amount of radium would be added to the tailings disposal area by the addition of sludge. To confirm whether sludge addition affected radionuclide solubilization, laboratory leaching tests were conducted on slurries of acid leach tailings, and sludge-tailings mixtures. Radium in the (Ra,Ba)SO 4 sludge was at least as stable as radium in the tailings, and the sludge was able to absorb radium released from the tailings. The addition of sludge did not affect uranium and thorium solubilization. From these results it appears that the placement of sludge in tailings areas would not adversely affect the stability of radionuclides in the tailings or sludge. (auth)
Materials Synthesis Of Barium Hexa ferrite Used Local Natural Resources
International Nuclear Information System (INIS)
Ridwan; Sulungbudi, Grace Tj.; Mujamilah
2003-01-01
The magnetic materials of barium hexa ferrites, Ba O.6Fe 2 O 3 successfully synthesized by powder metallurgy method used local natural resources from materials waste of steel fabrication (HSM, CRM), waste of polymer fabrication (LK) as well as iron sands (PBA). These waste as well as iron sands were the main resources of iron oxide, Fe 2 O 3 . The barium oxide used in this experiments are from BaCO 3 product of Merck, and BaCO 4 which is commercially available in the market as barite. Phase identification by x-ray diffraction technique show the synthesized magnetic materials are agreed with the available commercial product, (SUMI). The energy product maximum (BH) max measured by vibrating sample magnetometer (VSM) for the samples used HSM-, CRM- and BaCO 3 as basic materials are 1.141 MGOe and 1.136 MGOe while SUMI is 1.142 MGOe. However for the samples made from LK-, PBA- used of BaCO 3 or CRM- with barite, the energy product maximum (BH) max are relatively lower than commercial product
Green Synthesis of Barium Sulfate Particles Using Plant Extracts
Directory of Open Access Journals (Sweden)
Chen Long
2016-01-01
Full Text Available The biological molecules in the extracts of four fruits or vegetables: kiwifruit, oranges, tomato and carrot, were used as templates to synthesize barium sulfate (BaSO4 particles. The products were characterized by scanning electron microscopy, Fourier transform infrared spectroscopy and X-ray power diffractometry. The results showed that, leaf-shaped barite BaSO4 crystals with toothed edge were obtained with kiwifruit extracts; thorn spherical barium sulfate crystals with diameter of 2-4 micrometers were produced with tomato extracts; rod-like or quasi-spherical BaSO4 crystals with size of several hundred nanometers to several micrometers were gained with orange extracts; while quasi-spherical BaSO4 nano-crystals were obtained with carrot extracts. The formation mechanism of BaSO4 is also discussed, showing that the proteins, carbohydrates, vitamins and organic acids in above four kinds of fruits or vegetables may provide nucleation sites, controlling the growth of BaSO4 crystals with different morphologies.
Study of barium bismuth titanate prepared by mechanochemical synthesis
Directory of Open Access Journals (Sweden)
Lazarević Z.Ž.
2009-01-01
Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.
Structural and optical study of tellurite-barium glasses
Grelowska, I.; Reben, M.; Burtan, B.; Sitarz, M.; Cisowski, J.; Yousef, El Sayed; Knapik, A.; Dudek, M.
2016-12-01
The goal of this work was to determine the effect of barium oxide on the structural, thermal and optical properties of the TeO2-BaO-Na2O (TBN) and TeO2-BaO-WO3 (TBW) glass systems. Raman spectra allow relating the glass structure and vibration properties (i.e. vibrational frequencies and Raman intensities) with the glass composition. Raman spectra show the presence of TeO4 and TeO3+1/TeO3 units that conform with the glass matrix. Differential thermal analysis DTA, XRD measurements have been considered in term of BaO addition. The spectral dependence of ellipsometric angles of the tellurite-barium glass has been studied. The optical measurements were conducted on Woollam M2000 spectroscopic ellipsometer in spectral range of 190-1700 nm. The reflectance and transmittance measurements have been done on spectrophotometer Perkin Elmer, Lambda 900 in the range of 200-2500 nm (UV-VIS-NIR). From the transmittance spectrum, the energy gap was determined.
International Nuclear Information System (INIS)
Curtius, A.J.; Couto, M.I.
1979-01-01
The interferences of several ions that are present in oifield water and sea water in the atomic absorption and emission of barium were investigated. It was verified that the interferences of sodium, potassium, calcium, strontium and chloride are the most important. The indirect method for the determination of sulfate by measuring barium by atomic absorption after precipitating barium sulfate with an excess of barium chloride, should not be used for highly salted matrix. To avoid the interferences that are not compensated by an ionization supressor, the measurement of barium by the standard addition method or a previous sulfate separation is recommended. (Author) [pt
International Nuclear Information System (INIS)
Puli, Venkata Sreenivas; Kumar, Ashok; Scott, J F; Katiyar, Ram S; Chrisey, Douglas B; Tomozawa, M
2011-01-01
Lead-free barium zirconate-titanate/barium calcium-titanate, [(BaZr 0.2 Ti 0.80 )O 3 ] 1-x -[(Ba 0.70 Ca 0.30 )TiO 3 ] x (x = 0.10, 0.15, 0.20) (BZT-BCT) ceramics with high dielectric constant, low dielectric loss and moderate electric breakdown field were prepared by the sol-gel synthesis technique. X-ray diffraction patterns revealed tetragonal crystal structure and this was further confirmed by Raman spectra. Well-behaved ferroelectric hysteresis loops and moderate polarizations (spontaneous polarization, P s ∼ 3-6 μC cm -2 ) were obtained in these BZT-BCT ceramics. Frequency-dependent dielectric spectra confirmed that ferroelectric diffuse phase transition (DPT) exists near room temperature. Scanning electron microscope images revealed monolithic grain growth in samples sintered at 1280 deg. C. 1000/ε versus (T) plots revealed ferroelectric DPT behaviour with estimated γ values of ∼1.52, 1.51 and 1.88, respectively, for the studied BZT-BCT compositions. All three compositions showed packing-limited breakdown fields of ∼47-73 kV cm -1 with an energy density of 0.05-0.6 J cm -3 for thick ceramics (>1 mm). Therefore these compositions might be useful in Y5V-type capacitor applications.
Energy Technology Data Exchange (ETDEWEB)
Puli, Venkata Sreenivas; Kumar, Ashok; Scott, J F; Katiyar, Ram S [SPECLAB, Department of Physics, University of Puerto Rico, San Juan, PR 00936 (Puerto Rico); Chrisey, Douglas B; Tomozawa, M, E-mail: rkatiyar@uprrp.edu [Department of Materials Science and Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180-3590 (United States)
2011-10-05
Lead-free barium zirconate-titanate/barium calcium-titanate, [(BaZr{sub 0.2}Ti{sub 0.80})O{sub 3}]{sub 1-x}-[(Ba{sub 0.70}Ca{sub 0.30})TiO{sub 3}]{sub x} (x = 0.10, 0.15, 0.20) (BZT-BCT) ceramics with high dielectric constant, low dielectric loss and moderate electric breakdown field were prepared by the sol-gel synthesis technique. X-ray diffraction patterns revealed tetragonal crystal structure and this was further confirmed by Raman spectra. Well-behaved ferroelectric hysteresis loops and moderate polarizations (spontaneous polarization, P{sub s} {approx} 3-6 {mu}C cm{sup -2}) were obtained in these BZT-BCT ceramics. Frequency-dependent dielectric spectra confirmed that ferroelectric diffuse phase transition (DPT) exists near room temperature. Scanning electron microscope images revealed monolithic grain growth in samples sintered at 1280 deg. C. 1000/{epsilon} versus (T) plots revealed ferroelectric DPT behaviour with estimated {gamma} values of {approx}1.52, 1.51 and 1.88, respectively, for the studied BZT-BCT compositions. All three compositions showed packing-limited breakdown fields of {approx}47-73 kV cm{sup -1} with an energy density of 0.05-0.6 J cm{sup -3} for thick ceramics (>1 mm). Therefore these compositions might be useful in Y5V-type capacitor applications.
Barium in produced water: Is it a toxicological hazard to the marine environment?
International Nuclear Information System (INIS)
Neff, J.M.
1993-01-01
Produced water is a complex aqueous mixture of organic and inorganic chemicals that often is generated in large volumes as a by-product of production of oil and gas. Produced water from offshore oil production platforms sometimes is treated to remove particulate oil and then discharged to the ocean. Barium often is the most abundant inorganic chemical, other than the dominant sea salts, in produced water. Some concern has been expressed that the large amounts of barium discharged to the ocean in produced water may have adverse effects on marine biological communities. The ecological risks associated with discharge to the ocean in produced water may have adverse effects on marine biological communities. The ecological risks associated with discharge to the ocean of barium in produced water were evaluated. Concentrations of barium in produced water from different sources range from less than 1.0 to about 2,000 mg/L, and are inversely correlated with concentrations of sulfate. Concentrations of barium in the ocean usually are in the range of 10 to 20 μg/L; the ocean is undersaturated with respect to barite (BaSO 4 ). During mixing and dilution of a produced water plume in the ocean, barium reacts with the abundant sulfate in seawater and precipitates as barite. Barite is completely nontoxic to marine organisms. Because of the high concentration of sulfate in the ocean, ionic barium can not reach concentrations high enough to be toxic to marine organisms
International Nuclear Information System (INIS)
Wang, Shanshan; Zhang, Chao; Guo, Ruisong; Liu, Lan; Yang, Yuexia; Li, Kehang
2015-01-01
Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m 1/2 . - Abstract: The effects of substitution of Ba 2+ by Sr 2+ on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba 1−x Sr x Fe 12 O 19 , x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m 1/2 for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase
Poddalgoda, Devika; Macey, Kristin; Assad, Henry; Krishnan, Kannan
2017-06-01
The objectives of the present work were: (1) to assemble population-level biomonitoring data to identify the concentrations of urinary and plasma barium across the general population; and (2) to derive biomonitoring equivalents (BEs) for barium in urine and plasma in order to facilitate the interpretation of barium concentrations in the biological matrices. In population level biomonitoring studies, barium has been measured in urine in the U.S. (NHANES study), but no such data on plasma barium levels were identified. The BE values for plasma and urine were derived from U.S. EPA's reference dose (RfD) of 0.2 mg/kg bw/d, based on a lower confidence limit on the benchmark dose (BMDL 05 ) of 63 mg/kg bw/d. The plasma BE (9 μg Ba/L) was derived by regression analysis of the near-steady-state plasma concentrations associated with the administered doses in animals exposed to barium chloride dihydrate in drinking water for 2-years in a NTP study. Using a human urinary excretion fraction of 0.023, a BE for urinary barium (0.19 mg/L or 0.25 mg/g creatinine) was derived for US EPA's RfD. The median and the 95 th percentile barium urine concentrations of the general population in U.S. are below the BE determined in this study, indicating that the population exposure to inorganic barium is expected to be below the exposure guidance value of 0.2 mg/kg bw/d. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.
33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...
24 CFR 17.134 - Procedures for salary offset: when deductions may begin.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Procedures for salary offset: when deductions may begin. 17.134 Section 17.134 Housing and Urban Development Office of the Secretary, Department... Government Salary Offset Provisions § 17.134 Procedures for salary offset: when deductions may begin. (a...
40 CFR 81.134 - Austin-Waco Intrastate Air Quality Control Region.
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Austin-Waco Intrastate Air Quality Control Region. 81.134 Section 81.134 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Quality Control Regions § 81.134 Austin-Waco Intrastate Air Quality Control Region. The Austin-Waco...
In vitro experiments for the development of a high density (HD) barium sulfate contrast medium
International Nuclear Information System (INIS)
Klein, J.
1986-01-01
In vitro experiments with the high-density (HD) barium meal Falibaryt HD are described. Several charges of BaSO 4 were tested together with certain additives influencing dispersion, stability of the suspension, flowability, surface tension etc. Particle size spectra were measured by the manufacturer, VEB Fahlberg-List. With a simple PVC test plate containing several grooves simulating small details (areae gastricae) the diagnostic capabilities of the HD contrast medium were evaluated in an in vitro test. The developed barium meal Falibaryt HD is in its physical and chemical parameters comparable with Prontobario-HD, one of the best HD barium meals. (author)
The effect of barium temperature on esophageal and castric motility in dogs: a fluoroscopic study
International Nuclear Information System (INIS)
Eville, P.; Ackerman, N.
1984-01-01
The influence of barium temperature on canine esophageal transit time and gastric motility were studied fluoroscopically. Micropulverized barium sulfate (30% wt/vol) at 35°F, 70°F, and 100°F was given orally to each of five dogs with a minimum of two hours between each temperature. Esophageal transit times ranged from 4 to 9.67 seconds, and gastric contractions average four per minute. Barium temperature had no significant effect on either esophageal transit time or gastric motility
Small bowel volvulus in children. Its appearance on the barium enema examination
Energy Technology Data Exchange (ETDEWEB)
Siegel, M.J.; Shackelford, G.D.; McAlister, W.H.
1980-01-01
Two children with small bowel volvulus diagnosed on barium enema examination are reported. In one patient the volvulus was associated with malrotation and in the other patient there was a post-operative peritoneal adhesion. In both cases the diagnosis was based on beaking of the head of the barium column at the site of volvulus. Radiographic demonstration of a beak sign in the small bowel on barium enema examination should suggest a diagnosis of small bowel volvulus, and indicates the need for immediate surgery.
Directory of Open Access Journals (Sweden)
Zehra Durmus
2014-01-01
Full Text Available Nanocrystalline particles of barium hexaferrite were synthesized by a sol-gel combustion route using nitrate-citrate gels prepared from metal nitrates and citric acid solutions with Fe/Ba molar ratio 12. The present paper aims to study the effect of addition of polyethylene glycol (PEG solutions with different molecular weights (MW: 400, 2000, and 10.000 g/mol on magnetostructural properties of barium hexaferrite. The formation of the barium hexaferrite was inspected using X-ray diffraction (XRD analysis, Fourier transform infrared (FT-IR analysis, thermogravimetric (TGA analysis, scanning electron microscopy (SEM analysis and vibrating sample magnetometer (VSM analysis for magnetic measurements.
134cs uptake by plants from soil applying different absorbents
International Nuclear Information System (INIS)
Oncsik, M.
1998-01-01
A study of isotope uptake by plants using different zeolite clay minerals (montmorillonite, mordenite, clinoptilolite) was started with a view to reducing the rate of isotope uptake by plants by applying additives given to the soil. In pot experiments, the 134 Cs activity of green peas was reduced by 16% in average as compared to the control in the soils enriched with zeolite (mordenite type). Under field conditions, the radioactivity of millet and carrot yields were investigated in soils ameliorated with montmorillonite clay mineral. The radioactive contamination of the yield in soil treated with zeolite was in average 10% lower for millet and 24% for carrot roots as compared to the control
Barium depletion study on impregnated cathodes and lifetime prediction
International Nuclear Information System (INIS)
Roquais, J.M.; Poret, F.; Doze, R. le; Ricaud, J.L.; Monterrin, A.; Steinbrunn, A.
2003-01-01
In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK)
Barium titanate nanocomposite capacitor FY09 year end report.
Energy Technology Data Exchange (ETDEWEB)
Stevens, Tyler E.; DiAntonio, Christopher Brian; Yang, Pin; Chavez, Tom P.; Winter, Michael R.; Monson, Todd C.; Roesler, Alexander William; Fellows, Benjamin D.
2009-11-01
This late start RTBF project started the development of barium titanate (BTO)/glass nanocomposite capacitors for future and emerging energy storage applications. The long term goal of this work is to decrease the size, weight, and cost of ceramic capacitors while increasing their reliability. Ceramic-based nanocomposites have the potential to yield materials with enhanced permittivity, breakdown strength (BDS), and reduced strain, which can increase the energy density of capacitors and increase their shot life. Composites of BTO in glass will limit grain growth during device fabrication (preserving nanoparticle grain size and enhanced properties), resulting in devices with improved density, permittivity, BDS, and shot life. BTO will eliminate the issues associated with Pb toxicity and volatility as well as the variation in energy storage vs. temperature of PZT based devices. During the last six months of FY09 this work focused on developing syntheses for BTO nanoparticles and firing profiles for sintering BTO/glass composite capacitors.
Quantitative radio-chemical separation of calcium, strontium and barium
International Nuclear Information System (INIS)
Dupuis, M.C.; Dupuis, M.; Le Nagard, M.; Michot, H.
1965-01-01
A method for separation of Ca 45 , Sr 89 and Ba 140 has been developed for the radiochemical determination of these isotopes in a solution of fission with a large concentration of mineral salts. After removal of most fission products by solvent extraction (TTA-MIBK) at different pH, the alkaline earths are extracted from the aqueous phase at pH 9. After recovery with diluted hydrochloric acid, the three elements are adsorbed on cationic resin Dowex 50 and eluted sequentially with ammonium α - Hydroxy iso-butyrate using gradient concentration and pH. Ca 45 and Sr 89 are measured by β - counting and Ba 140 by γ spectrometry. The chemical yield approximates 80 per cent for calcium, and 70 per cent for strontium and barium. The decontamination factor is 10 5 for most fission products. Four separations can be performed in twenty hours. (authors) [fr
Microscopic theory of the phonon frequencies in BCC barium
International Nuclear Information System (INIS)
Oli, B.A.
1988-09-01
The phonon dispersion frequencies are calculated from first principles for bbc barium using a resonance pseudopotential model which incorporates the effect of s-d hybridization. It was also possible using this scheme to account for the anomalous feature of the Ba dispersion curve observed experimentally in the (ξ,0,0) direction where the frequencies of the transverse branch are higher than the frequencies of the longitudinal branch. The frequencies obtained were also used to calculate the phonon density of states by the linear-analytic tetrahedra method of zone integration. The results of these calculations are qualitatively in good agreement with experimental data, and provide further support to the interpretation of the anomalous behaviour in the (ξ,0,0) direction as arising from s-d hybridization. (author). 27 refs, 4 figs, 3 tabs
X-ray and Moessbauer investigations of isotropic barium ferrites
International Nuclear Information System (INIS)
Kirichok, P.P.; Pashchenko, V.A.; Dem'yaniv, T.O.; Ryabova, G.N.; Lisovskij, A.M.
1984-01-01
Using the methods of X-ray and γ-resonance spectroscopy the crystal chemical and magnetic structure of isotropic barium hexaferrites is studied. compacting pressure the lattice parameter c of ferrite of the BaOx5.7Fe 2 O 3 is decreased and the diffraction line width on its X-ray p attern is increased. Due to increasing the isoststical compacting pressure quadrupole splitting of the γ-resonance absorption spectrum of 57 Fe nuclei in tetrahedral positions 4f 1 and in positions 2a decreases. The sintering temperature growth leads to increasing the lattice parameter c and diffraction line widths and decreasing the effeutive field values and isomeric s hifts on 57 Fe nuclei. Isostatical compacting pressure does not affect the electron configuration of iron ions
Structural and magnetic properties of barium-gadolinium hexaferrites
Litsardakis, G.; Manolakis, I.; Serletis, C.; Efthimiadis, K. G.
A series of Gd-substituted M-type barium hexaferrites has been prepared by the ceramic route, according to the formula (Ba 1-xGd x)O·5.25Fe 2O 3 ( x=0-0.30). XRD analysis revealed that all the samples present primarily an M-type structure. Samples x=0 and x=0.05 are single-phase. Hematite (Fe 2O 3) and GdFeO 3 were detected in the remaining samples. Coercivity ( Hc) shows remarkably high values, ˜293 kA/m for x=0.20 and 0.30 with a maximum of 322 kA/m for x=0.25. Specific saturation magnetization ( σsat) of the samples presents a small increase up to x=0.10. The microstructure examination indicates that Gd may act as a grain growth inhibitor.
Bronchography in dogs. Comparative study with two barium sulphate solutions
International Nuclear Information System (INIS)
Thibaut, J.; Gallardo, P.; Vargas, L.; Deppe, R.; Born, R.
1998-01-01
Two solutions of barium sulphate, 60 and 30% w/v, were compared with the ''overflow'' Bronchographic method. Two groups of eight healthy adult does of both sexes, weighing 7 to 18 kg were used for the study. The dogs were anaesthetised with thiopentone sodium 2% (20 mg/kg iv). After intubation, each dog received contrast medium by a catheter connected to a syringe, in a 9 mi dose. Two series of two x-rays plates were taken in left lateral recumbent, 3 and 6 min after administering the contrast medium and in ventrodorsal projection, 30 sec. later. The x-ray plates obtained were analysed and compared intra and inter group considering the advance speed of the contrast medium, the radiographic density and outlines. Adverse reactions were controlled
Assessment of patient exposure for barium enema examinations
International Nuclear Information System (INIS)
Bednarek, D.R.; Rudin, S.; Wong, R.
1983-01-01
Methods are described for the assessment of patient exposure during clinical fluoroscopic procedures. Values of the roentgen-area-product (RAP) and their distribution throughout the examination are presented for both single-contrast and double-contrast barium enema studies. The double-contrast procedure was measured to give 50% more radiation to the patient than the single-contrast procedure when the same size optical aperture is used between the intensifier and TV pick-up tube. However, it was possible to decrease the fluoroscopic RAP value by over a factor of two for the double-contrast procedure without an adverse clinical effect by increasing the area of the aperture diaphragm
Synthesis and characterization of barium fluoride substituted zinc tellurite glasses
Aishwarya, K.; Vinitha, G.; Varma, G. Sreevidya; Asokan, S.; Manikandan, N.
2017-12-01
Glasses in the TeO2-ZnO-BaF2 system were prepared by standard melt quenching technique and were characterized for their thermal, optical and structural properties. Samples were found to show good thermal stability with values ranging above 100 °C for all the compositions. Optical bandgap and refractive index values were calculated from linear optical measurements using UV-Vis spectroscopy. Infrared spectra showed the presence of hydroxyl groups in the glasses indicating that the effect of fluorine was negligible in removing the hydroxyl impurities for the experimental conditions and compositions used. Raman measurements showed the modification occurring in the glass network due to addition of barium fluoride in terms of increase in the formation of non-bridging oxygen atoms compared to strong Te-O-Te linkages in the glass matrix.
Analysis of barium hydroxide and calcium hydroxide slurry carbonation reactors
International Nuclear Information System (INIS)
Patch, K.D.; Hart, R.P.; Schumacher, W.A.
1980-05-01
The removal of CO 2 from air was investigated by using a continuous-agitated-slurry carbonation reactor containing either barium hydroxide [Ba(OH) 2 ] or calcium hydroxide [Ca(OH) 2 ]. Such a process would be applied to scrub 14 CO 2 from stack gases at nuclear-fuel reprocessing plants. Decontamination factors were characterized for reactor conditions which could alter hydrodynamic behavior. An attempt was made to characterize reactor performance with models assuming both plug flow and various degrees of backmixing in the gas phase. The Ba(OH) 2 slurry enabled increased conversion, but apparently the process was controlled under some conditions by phenomena differing from those observed for carbonation by Ca(OH) 2 . Overall reaction mechanisms are postulated
Microwave absorption properties of barium titanate/epoxide resin composites
International Nuclear Information System (INIS)
Chen Xiaodong; Wang Guiqin; Duan Yuping; Liu Shunhua
2007-01-01
Nano-barium titanate (BT) was prepared by a sol-gel method. The prepared powders were characterized by x-ray powder diffraction and transmission electron microscopy. The complex relative dielectric permittivity (ε = ε' - jε-prime) and magnetic permeability (μ = μ' - jμ-prime) of the BT powders were measured in the frequency range 8 ∼ 18 GHz. The BT/epoxide resin (EP) composite with different volume contents was investigated. The effects of thickness on the BT/EP composite were studied. It was found that an optimum thickness and contents of the absorber can yield the maximum reflection loss which could be obtained over a broad frequency region in the X and Ku bands. Our results indicate that BT could be a promising microwave absorption material
Structural and functional characterization of barium zirconium titanate / epoxy composites
Directory of Open Access Journals (Sweden)
Filiberto González Garcia
2011-12-01
Full Text Available The dielectric behavior of composite materials (barium zirconium titanate / epoxy system was analyzed as a function of ceramic concentration. Structure and morphologic behavior of the composites was investigated by X-ray Diffraction (XRD, Fourier transformed infrared spectroscopy (FT-IR, Raman spectroscopy, field emission scanning electron microscopy (FE-SEM and transmission electron microscopy (TEM analyses. Composites were prepared by mixing the components and pouring them into suitable moulds. It was demonstrated that the amount of inorganic phase affects the morphology of the presented composites. XRD revealed the presence of a single phase while Raman scattering confirmed structural transitions as a function of ceramic concentration. Changes in the ceramic concentration affected Raman modes and the distribution of particles along into in epoxy matrix. Dielectric permittivity and dielectric losses were influenced by filler concentration.
Effect of Nb on barium titanate prepared from citrate solutions
Directory of Open Access Journals (Sweden)
Stojanović Biljana D.
2002-01-01
Full Text Available The influence of the addition of dopants on the microstructure development and electrical properties of BaTiO3 doped with 0.2, 0.4, 0.6, 0.8 mol% of Nb and 0.01 mol% of Mn based compounds was studied. Doped barium titanate was prepared using the polymeric precursor method from citrate solutions. The powders calcined at 700°C for 4 hours were analysed by infrared (IR spectroscopy to verify the presence of carbonates, and by X-ray diffraction (XRD for phase formation. The phase composition, microstructure and dielectric properties show a strong dependence on the amount of added niobium.
Stark effect in Rydberg states of helium and barium
International Nuclear Information System (INIS)
Lahaije, C.T.W.
1989-01-01
This thesis, which deals with the effect of an electric field up to moderate field strengths on atoms with two valence electrons outside closed shells, in casu helium and barium, contains chapter in which the linear Stark effect in the 1 snp 1, 3 p Rydberg states of helium (n around 40) has been studied in a CW laser-atomic beam experiment. The evolution of the angular momentum manifolds into the n-mixing regime was followed and avoided level crossings were observed. Stark manifolds were also calculated by diagonalization of the complete energy matrix in the presence of an electric field. It turned out to be necessary to include up to five n-values in the calculations already at moderate values of the field to reproduce the data within the experimental accuracy (a few MHz), especially in the regime of the avoided crossings. (author). 147 refs.; 30 figs.; 8 tabs
Primary versus secondary achalasia: New signs on barium esophagogram
Gupta, Pankaj; Debi, Uma; Sinha, Saroj Kant; Prasad, Kaushal Kishor
2015-01-01
Aim: To investigate new signs on barium swallow that can differentiate primary from secondary achalasia. Materials and Methods: Records of 30 patients with primary achalasia and 17 patients with secondary achalasia were reviewed. Clinical, endoscopic, and manometric data was recorded. Barium esophagograms were evaluated for peristalsis and morphology of distal esophageal segment (length, symmetry, nodularity, shouldering, filling defects, and “tram-track sign”). Results: Mean age at presentation was 39 years in primary achalasia and 49 years in secondary achalasia. The mean duration of symptoms was 3.5 years in primary achalasia and 3 months in secondary achalasia. False-negative endoscopic results were noted in the first instance in five patients. In the secondary achalasia group, five patients had distal esophageal segment morphology indistinguishable from that of primary achalasia. None of the patients with primary achalasia and 35% patients with secondary achalasia had a length of the distal segment approaching combined height of two vertebral bodies. None of the patients with secondary achalasia and 34% patients with primary achalasia had maximum caliber of esophagus approaching combined height of two vertebral bodies. Tertiary contractions were noted in 90% patients with primary achalasia and 24% patients with secondary achalasia. Tram-track sign was found in 55% patients with primary achalasia. Filling defects in the distal esophageal segment were noted in 94% patients with secondary achalasia. Conclusion: Length of distal esophageal segment, tertiary contractions, tram-track sign, and filling defects in distal esophageal segment are useful esophagographic features distinguishing primary from secondary achalasia. PMID:26288525
Association between esophageal dysmotility and gastroesophaeal reflux on barium studies
Energy Technology Data Exchange (ETDEWEB)
Campbell, Craig [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Levine, Marc S. [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States)]. E-mail: marc.levine@uphs.upenn.edu; Rubesin, Stephen E. [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Laufer, Igor [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Redfern, Gina [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Katzka, David A. [Department of Medicine, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States)
2006-07-15
Objective: To determine whether there is an association between abnormal primary peristalsis in the esophagus and gastroesophageal reflux (GER) on barium studies. Methods: A computerized search of radiologic reports revealed 151 patients with esophageal dysmotility (characterized by intermittently decreased or absent peristalsis in the esophagus on upper gastrointestinal tract examinations) who fulfilled our study's entry criteria. These 151 patients were stratified into two groups depending on whether this dysmotility was associated with nonperistaltic contractions (NPCs): 92 patients had no NPCs (Dysmotility and No NPCs Group) and 59 had NPCs (Dysmotility and NPCs Group). An age-matched control group of 92 patients with normal motility was also generated from the radiologic reports. The reports were also reviewed for the presence and degree of GER and other complications of GER. The frequency and degree of GER were tabulated for each group, and the data were analyzed using a Pearson chi square test to determine if significant differences were present in the frequency and degree of GER or other findings among the groups. Results: The frequency of GER was significantly higher in patients with abnormal peristalsis and no NPCs than in controls (p = 0.02). When GER was stratified based on the degree of reflux, the frequency of moderate-to-marked GER was significantly higher in patients with abnormal peristalsis and no NPCs than in patients with abnormal peristalsis and NPCs (p = 0.01) or in controls (p = 0.0031). The frequency of reflux esophagitis also was significantly higher in patients with abnormal peristalsis and no NPCs than in controls (p = 0.04). Conclusion: Our findings suggest that patients with esophageal dysmotility characterized by intermittently decreased or absent peristalsis without NPCs have a significantly higher frequency and degree of GER than patients with normal motility. The presence of this specific form of esophageal dysmotility on
Idiopathic urolithiasis in Tunisian children: A report of 134 cases
Directory of Open Access Journals (Sweden)
A Alaya
2013-01-01
Full Text Available We evaluated the metabolic and the nutritional aspects of 134 urolithiasis children in order to outline the characteristics of idiopathic urolithiasis in children. This prospective study group of 134 children (56 females, 78 males with renal calculi was evaluated. The age range of the patients was six months to 16 years. A dietary survey was performed on every child. All patients were investigated with respect to stone localization and serum and urine risk factors. Statistical analysis of data was carried out using software SPSS 11.0 for Windows. Hypercalciuria was the most common risk factor detected in this group (28.3%. A decrease of water intake was noted in all age groups, especially in the rural area (549.6 mL/day vs. 1150.6 mL/day, and there was an increase in animal protein intake in 17 cases (mean: 1.9 g/kg. In addition, increased intake of starchy foods and food with high oxalate content (sorgum were detected in the ten to 16 years age group (51% of our study. Calcium oxalate monohydrate represents the principal component of idiopathic stone (58.2%, which is more frequent in children (68% than in infants (51.7% (P <0.02. The major etiology of idiopathic urolithiasis highlights the influence of dietary habit in stone formers in our country. The increased occurrence of calcium oxalate stones in school age children confirms the change in the etiology of urolithiasis according to age.
Clinical, ultrasonographic, and roentgenographic study in 134 asymptomatic gallstone carriers
International Nuclear Information System (INIS)
Lirussi, F.; Passera, D.; Iemmolo, R.M.; Nassuato, G.; Okolicsanyi, L.
1993-01-01
The authors investigated retrospectively the ultrasonographic and roentgenographic characteristics of the gallstones and the gallbladder in 134 symtom-free carriers and evaluated prospectively the outcome and side effects of 6 to 24 months' ursodeoxycholic acid (UDCA) therapy in 36 individuals with silent stones. Two-thirds of the 134 subjects had multiple stones, and 71 to 75% had stones less than 15 mm in diameter. Gallstone calcification was detected in 13%. A non-functioning gallbladder was observed in 19%, whereas gallbladder contraction was normal in 64 of 76 gallstone carriers. With regard to oral bile acid treatment, complete and partial dissolutions were achieved in 7 and 9 of 33 subjects, respectively (48.5%). Development of a non-functioning gallbladder occurred in 9%, and acquired gallstone calcification was seen in another 15%. It is concluded that: i) the characteristics of the gallstones and the gallbladder are similar to those observed in symptomatic patients, and ii) UDCA therapy may be given in selected symptom-free carriers for no more than 6 to 12 months. Thereafter, it does not appear to be cost-effective. 23 refs., 2 figs., 3 tabs
The absorption and distribution of Cesium-134 in rice-soil system
International Nuclear Information System (INIS)
Xu Yinliang; Chen Chuanqun; Chen Bin; Sun Zhiming
1991-01-01
Dynamics of absorption of 134 Cs by rice shows that absorption rate is the fastest at boot stage; absorption capacities of 134 Cs in soils are different with the different physical-chemical properties of soils; absorption amounts vary with the time of irrigating 134 Cs; the closer the irrigation time to mature stage is, the more the absorption amount of 134 Cs in rice will be; the more the irrigating times are, and the higher the radioactivity of 134 Cs in irrigating water is, the more the absorption amount in rice will be. After brown rice is polished, contamination of 134 Cs can be decreased by 22.6-45.6%. The order of specific activity in rice is: bran > root > straw > husk > polished rice. Percentage activity of straw, brown rice, root and husk is 51.4%, 28.4%, 11.8% and 8.4% respectively. The migration of 134 Cs is very slow in soil and 95.1% of 134 Cs is concentrated in surface soil (0-2.5 cm). The distribution ratio of 134 Cs in the rice and soil is 6.1%:93.9%. Potassium ion can inhibit the absorption of 134 Cs by rice. There is an exponential function between the concentration of potassium ion and specific activity of 134 Cs in rice
International Nuclear Information System (INIS)
Lee, Yong Suk; Ha, Hyun Kwon; Lee, Yang Seob; Kim, Jae Kyun; Yoon, Seong Eon; Kim, Jung Hoon; Chung, Dong Jin; Auh, Yong Ho
1998-01-01
To qualitatively analysed barium coating status in the intestinal mucosa, we used scanning electron microscopy to observe barium particles coated in the small intestinal mucosa of rabbit, and we attempted to assess the relationship between electron microscopic findings and radiographic densities. Six different combination of barium and methylcellulose suspensions were infused into the resected small intestines of 15 rabbits. Barium powders were mixed with water to make 40% and 70% w/v barium solutions, and also mixed with 0.5% methylcellulose solutions were used as a double contrast agent. After the infusion of barium suspensions, a mammography unit was used to obtain radiographs of the small intestine, and their optical densities were measured by a densitometer. Thereafter, photographs of barium-coated small intestinal mucosa were obtained using a scanning electron microscope (x 8,000), and the number of barium particles in the unit area were measured. To compare the relationship between the electron microscopic findings and optical densities, statistical analysis using Spearman correlation was performed. This study shows that by using scanning electron microscopy, barium particles coated on the small intestinal mucosa can be qualitatively analysed. It also shows that the number of small barium particles measured by scanning electron microscopy is related to optical densities. (author). 14 refs., 2 figs
Comparison of barium swallow and ultrasound in diagnosis of gastro-oesophageal reflux in children.
Naik, D R; Bolia, A; Moore, D J
1985-01-01
Fifty one infants and older children with suspected gastro-oesophageal reflux entered a study comparing the diagnostic accuracy of a standard barium swallow examination with that of ultrasound scanning. All children were examined by both techniques. In 40 cases there was unequivocal agreement between the examinations. Of the remaining patients, four had definite reflux by ultrasonic criteria but showed no evidence of reflux on barium swallow examination, four had positive findings on ultrasound but showed only minimal reflux on barium swallow, and one showed minimal reflux on ultrasound but had a negative barium meal result. In two children the ultrasound study was inconclusive. Ultrasound has an important role in the diagnosis and follow up of patients under the age of 5 years with gastro-oesophageal reflux. Images FIG 1 FIG 2 PMID:3924317
International Nuclear Information System (INIS)
Ganiev, I.; Mukhiddinov, G.N.; Kargapolova, T.V.; Mirsaidov, U.
1995-01-01
The purpose of present work is studying of influence of barium additionson electrochemical corrosion of casting aluminium-copper alloy Al-321,containing as base alloying components copper, chromium, manganese, titanium,zirconium, cadmium
International Nuclear Information System (INIS)
Eisele, J.A.; Bauer, D.J.
1974-01-01
A bench-scale investigation was made of a concentrated H 2 SO 4 reaction for recovering and separating rare earth elements, barium, and strontium from a bastnaesite ore and byproduct. Barium and strontium were dissolved in the concentrated acid and precipitated as a mixed product by water dilution. Separation of strontium from barium was effected by reaction with Na 2 CO 3 solution, followed by a dilute acid leach of the SrCO 3 formed. After removing the barium and strontium from bastnaesite ore, the rare-earth elements were roasted to water-soluble sulfates. The rare earth sulfate solution was subsequently processed by solvent extraction to produce rare-earth oxides low in lead and magnesium. (U.S.)
Zhang, Zhen-Hai; Wu, Ya-Guang; Qin, Cheng-Kun; Su, Zhong-Xue; Xu, Jian; Xian, Guo-Zhe; Wu, Shuo-Dong
2012-10-21
Endoscopic sphincterotomy (EST) is considered as a possible etiological factor for severe cholangitis. We herein report a case of severe cholangitis after endoscopic sphincterotomy induced by barium examination. An adult male patient presented with epigastric pain was diagnosed as having choledocholithiasis by ultrasonography. EST was performed and the stone was completely cleaned. Barium examination was done 3 d after EST and severe cholangitis appeared 4 h later. The patient was recovered after treated with tienam for 4 d. Barium examination may induce severe cholangitis in patients after EST, although rare, barium examination should be chosen cautiously. Cautions should be also used when EST is performed in patients younger than 50 years to avoid the damage to the sphincter of Oddi.
An experimental study on sterilized barium sulfate (BaSO4) for vertebroplasty
International Nuclear Information System (INIS)
Chen Long; Ni Caifang; Ding Yi; Wang Yijin
2005-01-01
Objective: To search the proper sterilization method of barium for vertebroplasty. Methods: Perfusion agents were classified into two groups with ratio of powder/liquid(g/ml) as 3:2, and the percentage of BsSO 4 in powder was 20%. The barium powder in one group was sterilized by dry-heat and by ethylene oxide in the other. The barium powder of each group was germicultured and the polymerization time, CT value, strength and stiffness were measured respectively including 6 samples. Two independent-samples t text was used for analysis. Results: The germiculture in each group was negative. The difference in polmerization time and CT value of each group were not significant (P>0.05), while the strength and stiffness were significantly different (P<0.05). Conclusions: Sterilized effects of two groups were satisfied but the dry-heat barium sulfate is superior, more suitable for vertebroplasty. (authors)
International Nuclear Information System (INIS)
Kaude, J.V.; Harty, R.F.
1982-01-01
The results of single contrast barium enema were retrospectively correlated with colonoscopically diagnosed colorectal disease in 54 patients (75 lesions). Altogether 66 lesions (88%) were correctly diagnosed. The sensitivity of barium enema for polyps was 81% (26/32). There were three perceptive errors and three polyps 5 mm or less in size were not demonstrated by barium enema. Twenty-nine cases of inflammatory disorders were all correctly diagnosed. One of 12 malignancies was missed by perceptive error. In two cases with vascular malformations the barium enema was normal. 4/9 (44%) of missed lesions were perceptive errors and could have been probably avoided by a second independent reading of films. (orig.)
Oxidation of Alcohols by Ferric Nitrate in the Presence of Barium ...
African Journals Online (AJOL)
NJD
Oxidation, ferric nitrate, barium chloride, silica sulphuric acid, heterogeneous or solvent-free conditions. 1. Introduction ... economic advantage and environment protection. ... by TLC. After completion, structure of the product was charac-.
How changes in a radiologist's technique can reduce patient dose in barium enema studies
International Nuclear Information System (INIS)
Corbett, R.H.
2001-01-01
Changes in a radiologist's technique, especially utilising digital technology, can lead to substantial dose savings in barium enema examinations. Data will be provided showing a 20% saving with only minimal change in technique. (author)
Calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid
International Nuclear Information System (INIS)
Kurbanov, A.R.; Sharipov, D.Sh.
1993-01-01
Present article is devoted to calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid. The calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid was carried out in order to determine the thermal effects of reactions. The results of interaction of Ba(OH) 4 ·8H 2 O with 5, 10, and 20% solution of hydrofluoric acid were considered.
Nin, Carlos Shuler; Marchiori, Edson; Irion, Klaus Loureiro; Paludo, Artur de Oliveira; Alves, Giordano Rafael Tronco; Hochhegger, Daniela Reis; Hochhegger, Bruno
2013-01-01
OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks) were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological...
Calculations of energy levels and lifetimes of low-lying states of barium and radium
International Nuclear Information System (INIS)
Dzuba, V. A.; Ginges, J. S. M.
2006-01-01
We use the configuration-interaction method and many-body perturbation theory to perform accurate calculations of energy levels, transition amplitudes, and lifetimes of low-lying states of barium and radium. Calculations for radium are needed for the planning of measurements of parity- and time-invariance-violating effects which are strongly enhanced in this atom. Calculations for barium are used to control the accuracy of the calculations
Role of Barium Swallow in Diagnosing Clinically Significant Anastomotic Leak following Esophagectomy
Directory of Open Access Journals (Sweden)
Simon Roh
2016-04-01
Full Text Available Background: Barium swallow is performed following esophagectomy to evaluate the anastomosis for detection of leaks and to assess the emptying of the gastric conduit. The aim of this study was to evaluate the reliability of the barium swallow study in diagnosing anastomotic leaks following esophagectomy. Methods: Patients who underwent esophagectomy from January 2000 to December 2013 at our institution were investigated. Barium swallow was routinely done between days 5–7 to detect a leak. These results were compared to clinically determined leaks (defined by neck wound infection requiring jejunal feeds and or parenteral nutrition during the postoperative period. The sensitivity and specificity of barium swallow in diagnosing clinically significant anastomotic leaks was determined. Results: A total of 395 esophagectomies were performed (mean age, 62.2 years. The indications for the esophagectomy were as follows: malignancy (n=320, high-grade dysplasia (n=14, perforation (n=27, benign stricture (n=7, achalasia (n=16, and other (n=11. A variety of techniques were used including transhiatal (n=351, McKeown (n=35, and Ivor Lewis (n=9 esophagectomies. Operative mortality was 2.8% (n=11. Three hundred and sixty-eight patients (93% underwent barium swallow study after esophagectomy. Clinically significant anastomotic leak was identified in 36 patients (9.8%. Barium swallow was able to detect only 13/36 clinically significant leaks. The sensitivity of the swallow in diagnosing a leak was 36% and specificity was 97%. The positive and negative predictive values of barium swallow study in detecting leaks were 59% and 93%, respectively. Conclusion: Barium swallow is an insensitive but specific test for detecting leaks at the cervical anastomotic site after esophagectomy.
Studies on phase evolution and electrical conductivity of barium doped gadolinium aluminate
International Nuclear Information System (INIS)
Sinha, Amit; Sharma, B.P.; Gopalan, P.
2012-01-01
Highlights: ► Barium doped GdAlO 3 compositions were prepared from citrate gel derived powders. ► The solid solubility of barium in GdAlO 3 was less than 4 mol%. ► The un-dissolved barium precipitated in the form of BaAl 2 O 4 phase. ► The conductivity of Ba-doped GdAlO 3 increased with increasing amounts of Ba. ► In Gd 1−x Ba x AlO 3−δ system, specimen with x = 0.02 exhibited maximum conductivity. - Abstract: The phase evolution and electrical conductivity of barium doped GdAlO 3 samples have been investigated. The Ba- doped compositions of GdAlO 3 were prepared through citrate gel process. Analysis of the phases was carried out using X-ray diffraction (XRD). The morphology of the calcined powders was studied by scanning electron microscopy. The electrical conductivity of Gd 1−x Ba x AlO 3−δ (x = 0–0.04) was measured using ac impedance spectroscopy as a function of temperature ranging from 300 to 1000 °C under air. The solid solubility of barium in GdAlO 3 was found to be less than 4 mol%. The undissolved barium precipitated in the form of BaAl 2 O 4 phase. The barium doped GdAlO 3 powders obtained after calcination at 1000 °C was found to be porous agglomerate composed of nanocrystalline grains. The total electrical conductivity of Ba-doped GdAlO 3 increased with increasing amounts of barium up to 2 mol% doping.
Barium isotopes in Allende meteorite - Evidence against an extinct superheavy element
Lewis, R. S.; Anders, E.; Shimamura, T.; Lugmair, G. W.
1983-01-01
Carbon and chromite fractions from the Allende meteorite that contain isotopically anomalous xenon-131 to xenon-136 (carbonaceous chondrite fission or CCF xenon) at up to 5 x 10 to the 11th atoms per gram show no detectable isotopic anomalies in barium-130 to barium-138. This rules out the possibility that the CCF xenon was formed by in situ fission of an extinct superheavy element. Apparently the CCF xenon and its carbonaceous carrier are relics from stellar nucleosynthesis.
Generation of sub-100-fs Stokes pulses upon SRS in a barium nitrate crystal
International Nuclear Information System (INIS)
Konyashchenko, Aleksandr V; Losev, Leonid L; Tenyakov, S Yu
2010-01-01
72-fs pulses are generated at the first Stokes component frequency upon stimulated Raman scattering in a barium nitrate crystal for the radiation of the Ti 3+ :Al 2 O 3 laser with the pulse duration of 50 fs. The energy efficiency of conversion is 20%. The barium nitrate crystal was optically pumped by two consecutive orthogonally polarised chirped pulses with the following time compression of the Stokes radiation pulse. (nonlinear optical phenomena)
Korolev, Konstantin A.; Wu, Chuanjian; Yu, Zhong; Sun, Ke; Afsar, Mohammed N.; Harris, Vincent G.
2018-05-01
Transmittance measurements have been performed on La-Co substituted barium hexaferrites in millimeter waves. Broadband millimeter-wave measurements have been carried out using the free space quasi-optical spectrometer, equipped with a set of high power backward wave oscillators covering the frequency range of 30 - 120 GHz. Strong absorption zones have been observed in the millimeter-wave transmittance spectra of all La-Co substituted barium hexaferrites due to the ferromagnetic resonance. Linear shift of ferromagnetic resonance frequency as functions of La-Co substitutions have been found. Real and imaginary parts of dielectric permittivity of La-Co substituted barium hexaferrites have been calculated using the analysis of recorded high precision transmittance spectra. Frequency dependences of magnetic permeability of La-Co substituted barium hexaferrites, as well as saturation magnetization and anisotropy field have been determined based on Schlömann's theory for partially magnetized ferrites. La-Co substituted barium hexaferrites have been further investigated by DC magnetization to assess magnetic behavior and compare with millimeter wave data. Consistency of saturation magnetization determined independently by both millimeter wave absorption and DC magnetization have been found for all La-Co substituted barium hexaferrites. These materials seem to be quite promising as tunable millimeter wave absorbers, filters, circulators, based on the adjusting of their substitution parameters.
Directory of Open Access Journals (Sweden)
Carlos Shuler Nin
2013-12-01
Full Text Available OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons.RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6% of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6% of the patients, whereas the treatment was ineffective in 1 (8.4%. We observed no complications related to barium swallow, such as contrast aspiration.CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.
The impact of digital imaging on patient doses during barium studies
International Nuclear Information System (INIS)
Broadhead, D.A.; Chapple, C.-L.; Faulkner, K.
1995-01-01
Barium studies performed on 10 digital and four non-digital fluoroscopic systems were monitored with dose-area product meters as part of a Regional Patient Dosimetry Audit programme. The data have been collected using a computer to read and reset the dose-area product meter and also to collect patient and examination details. A comparison of dose-area product measurements from digital and non-digital fluoroscopy units on over 10 000 barium studies is presented. The data have been corrected according to patient size. The mean size corrected dose-area product for a barium meal examination was found to be 7.62 Gy cm -2 for a digital set compared with 15.45 Gy cm -2 for a non-digital set with 2462 and 1308 patients included in each measurement series, respectively. Dose-area products were also a factor of approximately two lower for barium enema, barium swallow and barium follow-through examinations performed on digital systems. (author)
Experimental studies on 3D printing of barium titanate ceramics for medical applications
Directory of Open Access Journals (Sweden)
Schult Mark
2016-09-01
Full Text Available The present work deals with the 3D printing of porous barium titanate ceramics. Barium titanate is a biocompatible material with piezoelectric properties. Due to insufficient flowability of the starting material for 3D printing, the barium titanate raw material has been modified in three different ways. Firstly, barium titanate powder has been calcined. Secondly, flow additives have been added to the powder. And thirdly, flow additives have been added to the calcined powder. Finally, a polymer has been added to the three materials and specimens have been printed from these three material mixtures. The 3D printed parts were then sintered at 1320°C. The sintering leads to shrinkage which differs between 29.51–71.53% for the tested material mixtures. The porosity of the parts is beneficial for cell growth which is relevant for future medical applications. The results reported in this study demonstrate the possibility to fabricate porous piezoelectric barium titanate parts with a 3D printer that can be used for medical applications. 3D printed porous barium titanate ceramics can especially be used as scaffold for bone tissue engineering, where the bone formation can be promoted by electrical stimulation.
Nin, Carlos Shuler; Marchiori, Edson; Irion, Klaus Loureiro; Paludo, Artur de Oliveira; Alves, Giordano Rafael Tronco; Hochhegger, Daniela Reis; Hochhegger, Bruno
2013-01-01
To assess the routine use of barium swallow study in patients with chronic cough. Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks) were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons. The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6%) of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6%) of the patients, whereas the treatment was ineffective in 1 (8.4%). We observed no complications related to barium swallow, such as contrast aspiration. Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.
Virtual colonoscopy with electron beam CT: correlation with barium enema, colonoscopy and pathology
International Nuclear Information System (INIS)
Hong, Hye Suk; Kim, Min Jung; Chung, Jae Joon; Kim, Myeong Jin; Lee, Jong Tae; Yoo, Hyung Sik
1998-01-01
To perform virtual colonoscopy using electron beam tomography(EBT) in patients in whom a colonic mass was present, and to compare the results with those obtained using barium enema, colonoscopy and gross pathologic specimens. Materials and Methods : Ten patients in whom colonic masses were diagnosed by either barium enema or colonoscopy were involved in this study. There were nine cases of adenocarcinoma and one of tubulovillous adenoma. Using EBT preoperative abdominopelvic CT scans were performed. Axial scans were then three-dimensionally reconstructed to produce virtual colonoscopic images and were compared with barium enema, colonoscopy and gross pathologic specimens. Virtual colonoscopic images of the masses were classified as either 1)polyploid, 2)sessile,3)fungating, or 4)annular constrictive. We also determined whether ulcers were present within the lesions and whether there was obstruction. Results : After virtual colonoscopy, two lesions were classified as polyploid, one as sessile, five as fungating and two as annular constrictive. Virtual colonoscopic images showed good correlation with the findings of barium enema, colonoscopy and gross pathologic specimens. Three of six ulcerative lesions were observed on colonoscopy; in seven adenocarcinomas with partial or total luminal obstruction, virtual colonoscopy visualized the colon beyond the obstructed sites. In one case, barium contrast failed to pass through the obstructed portion and in six cases, the colonoscope similarly failed. Conclusion : Virtual colonoscopies correlated well with barium enema, colonoscopy and gross pathologic specimens. They provide three dimensional images of colonic masses and are helpful for the evaluation of obstructive lesions
Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu
2016-01-01
This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and calcium microcapsules maintained xenogenic dermal papilla cells in an immunoisolated environment and induced the formation of hair follicle structures. Calcium microcapsules showed better biocompatibility, permeability, and cell viability in comparison with barium microcapsules. Before 18 weeks, calcium microcapsules gathered together, with no substantial immune response. After 32 weeks, some microcapsules were near inflammatory cells and wrapped with fiber. A few large hair follicles were found. Control samples showed no marked changes at the implantation site. Barium microcapsules were superior to calcium microcapsules in structural and mechanical stability. The cells encapsulated in hydrogel barium microcapsules exhibited higher short-term viability. This study established a model to culture DPCs in 3D culture conditions. Barium microcapsules may be useful in short-term transplantation study. Calcium microcapsules may provide an effective scaffold for the development of artificial dermal papilla.
Barium ionization mechanisms in the CRRES G-1 and G-11b releases
International Nuclear Information System (INIS)
Hunton, D.E.
1993-01-01
The G-11b chemical release experiment form the Combined Release and Radiation Effects Satellite (CRRES) was conducted in darkness below the solar UV terminator to test the Critical Ionization Velocity (CIV) hypothesis. The Quadrupole Ion Mass Spectrometer (QIMS) aboard CRRES measured fluxes of barium ions from this darkness release that were only a factor of ten smaller than the G-1 release measurements in full sunlight. Possible mechanisms for this significant barium ionization in darkness include CIV, charge exchange with O + , collisional ionization and associative ionization. The authors have evaluated the relative contributions of the collisional mechanisms by constructing a simple model of barium ions from the darkness release seem to be consistent with recent measurements of the charge transfer cross section. A collective plasma ionization mechanism such as CIV does not seem to necessary in order to explain the large barium ion fluxes observed. However, QIMS could only detect barium ions formed several seconds after the initial detonation of the release canister. A CIV process could still have occurred very early in the expansion of the barium neutral cloud and the mass spectrometer would not have detected these ions
Preparation of porous nano barium ferrite and its adsorption properties on uranium
International Nuclear Information System (INIS)
Xiong Guoxuan; Huang Haiqing; Zhang Zhibin
2012-01-01
The porous nano barium ferrite was made of Fe(NO 3 ) 3 and Ba(NO 3 ) 2 as raw materials, CTAB as surfactant by method of sol-gel and self-propagating combustion. The composition, morphology and magnetic properties of nano-rod barium ferrite were characterized by XRD, SEM and vibrating sample magnetometer. The adsorption properties of porous nano barium ferrite on uranium were studied with static adsorption and the effects of pH, adsorption temperature and oscillation time on adsorption properties were discussed. The results indicate that the average particle size of porous nano barium ferrite is 45-65 nm, the saturation magnetization and coercivity are 62.83 emu/g and 5481.0 Oe, respectively. Under the condition of the porous nano barium ferrite amount of 0.02 g, pH of 6, adsorption temperature of 25℃ and oscillation time of 30 min, the adsorption capacity of uranium on the porous nano barium ferrite reaches 921 μg/g. (authors)
134Cs-transport in an experimental ecological system
International Nuclear Information System (INIS)
Mocsy, Ildiko; Uray, Ildiko; Salagean, Stefania
1986-01-01
An experimental aquatic ecosystem was developed consisting of river water, slurry, algae and crustaceans. The change of the cesium concentration factor (F c ) of two alga species were measured using 20 Bq/ml of 134 CsCl. Measurements were performed in the 6th, 12th, 24th, 48th and 72nd hour after irradiation. F c in crustaceans was found to be 1300 in the 12th hr, then decreased rapidly down to 275. The temporal dependence of cesium accumulation in slurry increased consistently. It was found that algae accumulated cesium variously. Owing to its high accumulation, Cladophora glomerata can be used as a biological indicator of cesium concentration in surface waters. (K.I.)
Effect of ionic strength on barium transport in porous media
Ye, Zi; Prigiobbe, Valentina
2018-02-01
Hydraulic fracturing (or fracking) is a well stimulation technique used to extract resources from a low permeability formation. Currently, the most common application of fracking is for the extraction of oil and gas from shale. During the operation, a large volume of brine, rich in hazardous chemicals, is produced. Spills of brine from wells or pits might negatively impact underground water resources and, in particular, one of the major concerns is the migration of radionuclides, such as radium (Ra2+), into the shallow subsurface. However, the transport behaviour of Ra2+ through a reactive porous medium under conditions typical of a brine, i.e., high salinity, is not well understood, yet. Here, a study on the transport behaviour of barium (Ba2+, congener of radium) through a porous medium containing a common mineral such as goethite (FeO(OH)) is presented. Batch and column flood tests were carried out at conditions resembling the produced brine, i.e., large values of ionic strength (I), namely, 1 to 3 mol/kg. The measurements were described with the triple layer surface complexation model coupled with the Pitzer activity coefficient method and a reactive transport model, in the case of the transport tests. The experimental results show that the adsorption of Ba2+ onto FeO(OH) increases with pH but decreases with I and it becomes negligible at the brine conditions. Moreover, even if isotherms show adsorption at large I, at the same conditions during transport, Ba2+ travels without retardation through the FeO(OH) porous medium. The triple layer model agrees very well with all batch data but it does not describe well the transport tests in all cases. In particular, the model cannot match the pH measurements at large I values. This suggests that the chemical reactions at the solid-liquid interface do not capture the mechanism of Ba2+ adsorption onto FeO(OH) at large salinity. Finally, this study suggests that barium, and potentially its congeners, namely, radium
Supramolecular curcumin-barium prodrugs for formulating with ceramic particles.
Kamalasanan, Kaladhar; Anupriya; Deepa, M K; Sharma, Chandra P
2014-10-01
A simple and stable curcumin-ceramic combined formulation was developed with an aim to improve curcumin stability and release profile in the presence of reactive ceramic particles for potential dental and orthopedic applications. For that, curcumin was complexed with barium (Ba(2+)) to prepare curcumin-barium (BaCur) complex. Upon removal of the unbound curcumin and Ba(2+) by dialysis, a water-soluble BaCur complex was obtained. The complex was showing [M+1](+) peak at 10,000-20,000 with multiple fractionation peaks of MALDI-TOF-MS studies, showed that the complex was a supramolecular multimer. The (1)H NMR and FTIR studies revealed that, divalent Ba(2+) interacted predominantly through di-phenolic groups of curcumin to form an end-to-end complex resulted in supramolecular multimer. The overall crystallinity of the BaCur was lower than curcumin as per XRD analysis. The complexation of Ba(2+) to curcumin did not degrade curcumin as per HPLC studies. The fluorescence spectrum was blue shifted upon Ba(2+) complexation with curcumin. Monodisperse nanoparticles with size less than 200dnm was formed, out of the supramolecular complex upon dialysis, as per DLS, and upon loading into pluronic micelles the size was remaining in similar order of magnitude as per DLS and AFM studies. Stability of the curcumin was improved greater than 50% after complexation with Ba(2+) as per UV/Vis spectroscopy. Loading of the supramloecular nanoparticles into pluronic micelles had further improved the stability of curcumin to approx. 70% in water. These BaCur supramolecule nanoparticles can be considered as a new class of prodrugs with improved solubility and stability. Subsequently, ceramic nanoparticles with varying chemical composition were prepared for changing the material surface reactivity in terms of the increase in, degradability, surface pH and protein adsorption. Further, these ceramic particles were combined with curcumin prodrug formulations and optimized the curcumin release
Optimization of multiroute synthesis for polyaniline-barium ferrite composites
Energy Technology Data Exchange (ETDEWEB)
Ben Ghzaiel, Tayssir, E-mail: tayssir.ben-ghzaiel@satie.ens-cachan.fr [Université de Tunis El Manar Faculté des Sciences de Tunis, UR11ES18 Unité de Recherche de Chimie Minérale Appliquée, 2092, Tunis (Tunisia); SATIE, ENS Cachan, CNRS, Université Paris-Saclay, 61 av du Président Wilson, F-94230, Cachan (France); Dhaoui, Wadia [Université de Tunis El Manar Faculté des Sciences de Tunis, UR11ES18 Unité de Recherche de Chimie Minérale Appliquée, 2092, Tunis (Tunisia); Pasko, Alexander; Mazaleyrat, Frédéric [SATIE, ENS Cachan, CNRS, Université Paris-Saclay, 61 av du Président Wilson, F-94230, Cachan (France)
2016-08-15
A comparative study of physicochemical and magnetic properties of Polyaniline-BaFe{sub 12}O{sub 19} composites prepared by Solid-Based Polymerization (SBP) and by Aqueous-Based Polymerization (ABP) is carried out. The composites obtained by the latter method underwent a grinding to study the influence of shear stress. Thus, in a systematic approach, an investigation of stirring effect was done by synthesizing these composites using aqueous-based polymerization but without mechanical stirring. Different mass ratio of BaFe{sub 12}O{sub 19} was used to explore their impact on composites properties. X-ray diffraction, FTIR, SEM, TGA, conductivity and vibrating sample magnetometer measurements were performed. Structural and morphological investigations confirmed the presence of polyaniline and barium hexaferrite phase, which were in interaction in the composites regardless the polymerization route. The powder obtained by solid-based pathway revealed distinct particles with uniform distribution for various compositions (wt. %) of BaFe{sub 12}O{sub 19} in Pani, while the composites obtained by aqueous-based polymerization presented agglomerated nanostructures. Thermogravimetric analysis exhibited an improved thermal stability for Pani-BaFe{sub 12}O{sub 19} obtained by solid-based route. The electric conductivity has displayed decreasing trend of DC conductivity with the increase of BaFe{sub 12}O{sub 19} particles in the polymer matrix. Magnetic studies showed a ferromagnetic behaviour for all composites. The saturation magnetization monotonously increased with the increasing of BaFe{sub 12}O{sub 19} amount. The magnetic properties of the powders were mainly related to the hexaferrite loading which was determined using measured magnetic data. These results revealed that magnetization saturation was dependant of volume fraction of ferrite in the composites which was significantly affected by the reaction medium and mechanical stirring. The powders obtained by solid
Monte Carlo estimation for pediatric barium meal procedures
International Nuclear Information System (INIS)
Filipov, D.; Schelin, H.R.; Denyak, V.; Legnani, A.; Ledesma, J.A.; Paschuk, S.A.; Sauzen, J.; Yagui, A.; Hoff, G.; Khoury, H.J.
2015-01-01
Fluoroscopic barium meal (BM) series involve an X-ray examination of the esophagus, stomach, and duodenum, by the use of a contrast media – the barium sulfate (BaSO4). They are widely used to observe digestive functions or to diagnose abnormalities such as ulcers; tumors; inflammation of the esophagus, stomach, and duodenum; malrotations; vascular rings; and gastroesophageal reflux disease (a common ailment in children). However, this procedure uses long fluoroscopy times and multiple radiographies, resulting in high effective doses to pediatric patients, whose radiosensitivity and life expectancy are higher than in adults. Based on those data, the aims of the current study are to: determine the P K,A (kerma-area product) values, on the patient chest area, and the effective doses to 5 and 10 years old children. Thirty-seven different pediatric patients were studied and stratified into two group sizes: 5 and 10 years old. For each procedure, the following data was recorded: sex, age and upper chest thickness, from the patients; technical parameters of the procedure (kV, fluoroscopy time and number of radiographies); distances (focus-detector and focus-table) and field size on the examination table. Three pairs of LiF:Mg,Ti thermoluminescent dosimeters were positioned at the center of the child´s sternum. After that, upper chest thickness was subtracted from focus-table distance, so focus-patient distance was obtained. Using the field size on the table and applying similar triangles concepts, the field size on the patient was measured, which was multiplied by the mean kerma (from the dosimeters), so that P K,A could be determined. To estimate the effective dose, P K,A and technical parameters of the procedure (kV, total filtration, focus-detector distance and field size on the patient) were written in a Monte Carlo software simulation. The results of P K,A and effective doses were higher than studies used for comparison, which shows the importance of an
International Nuclear Information System (INIS)
Devyatykh, G.G.; Gavrishchuk, E.M.; Gibin, A.M.; Dadanov, A.Yu.; Dzyubenko, N.G.; Kaul', A.R.; Nichiporuk, R.V.; Snezhko, N.T.; Ul'yanov, A.A.
1990-01-01
Heterogeneous oxidative decomposition of adduct of yttrium acetylacetonate with o-phenanthroline, copper acetylacetonate and barium dipivaloylmethanate in a flow-type reactor was carried out. The basic kinetic characteristics of chemical precipitation processes of films of yttrium, copper and barium oxides, which are components of high-temperature superconductors, were obtained. The values of activation energy of precipitation process of yttrium, copper and barium oxides constituted 76±10, 108±15, 81±12 (t 600 deg C) respectively
The accumulation of 134Cs in heart and skeletal muscle of healthy and dystrophic hamsters
International Nuclear Information System (INIS)
Szentkuti, L.; Breitrueck, H.; Giese, W.
1976-01-01
he accumulation of cesium-134 in heart and skeletal muscle of healthy and dystrophic hamsters was compared. It was lower in dystrophic hamsters than in normal ones after only a single dose of cesium-134. The 134 Cs-concentrations of heart and 'red' skeletal muscle were different between normal and dystrophic hamsters. When the isotope had equilibrated in the animals differences in 134 Cs-accumulation in muscle tissue between normal and dystrophic hamsters were even more obvious. The faster elimination of cesium-134 from the body as affected by muscular dystrophy was due to a reduction of 134 Cs-accumulation in muscle tissue. The reduced ability of damaged muscles to accumulate Cs-ions offers the possibility to use Cs-isotopes in diagnosis of skeletal muscle dystrophy. (author)
International Nuclear Information System (INIS)
Jitschin, W.
1977-01-01
A sensitive two-photon-laser spectrometer was constructed, that allowed to measure atomic states with an energy from 31 000 up to 37500 cm -1 with about 2 MHz resolution. The large energy range and the high resolution were reached by using a wide-wavelength tunable, narrow-band dye-laser. With this spectrometer transitions could be detected at barium from the electron ground-state 6s 2 1 S 0 to 10 upper states in the 5 most common isotopes 138 Ba, 137 Ba, 136 Ba, 135 Ba and 134 Ba. The transitions could be measured precisely. It was possible to derive lower limits of the life-time of these states from the widths of the recorded resonance lines (typically several nsec), that should in fact not be smaller than the actual lifetimes. From the measured hyper-fine splitting of the 6 transitions with angular momentum J = 2 at the oddnumbered isotopes 137 Ba and 135 Ba the parameters of the hyper-fine splitting could be determined. Hereby an accuracy of about IMH 2 could be reached at the A-factor and about 5MHz at the B-factor. At the measured transitions the isotopic shifts of the particular isotope could be determined with an accuracy of a few MHz. There was only a simple theory of the isotopic shift with only few parameters worked out for the theoretical interpretation of the measured data, that describes the data even at the experimentally reached high accuracy. Two parameters of this theory depending only from atomic nucleus properties, could be determined with a 0.5 % error. (orig./WB) [de
Properties of barium strontium titanate at millimeter wave frequencies
Energy Technology Data Exchange (ETDEWEB)
Osman, Nurul [Department of Physics, Universiti Putra Malaysia (Malaysia); Free, Charles [Department of Engineering and Design, University of Sussex (United Kingdom)
2015-04-24
The trend towards using higher millimetre-wave frequencies for communication systems has created a need for accurate characterization of materials to be used at these frequencies. Barium Strontium Titanate (BST) is a ferroelectric material whose permittivity is known to change as a function of applied electric field and have found varieties of application in electronic and communication field. In this work, new data on the properties of BST characterize using the free space technique at frequencies between 145 GHz and 155 GHz for both thick film and bulk samples are presented. The measurement data provided useful information on effective permittivity and loss tangent for all the BST samples. Data on the material transmission, reflection properties as well as loss will also be presented. The outcome of the work shows through practical measurement, that BST has a high permittivity with moderate losses and the results also shows that BST has suitable properties to be used as RAM for high frequency application.
Review on dielectric properties of rare earth doped barium titanate
International Nuclear Information System (INIS)
Ismail, Fatin Adila; Osman, Rozana Aina Maulat; Idris, Mohd Sobri
2016-01-01
Rare earth doped Barium Titanate (BaTiO_3) were studied due to high permittivity, excellent electrical properties and have wide usage in various applications. This paper reviewed on the electrical properties of RE doped BaTiO_3 (RE: Lanthanum (La), Erbium (Er), Samarium (Sm), Neodymium (Nd), Cerium (Ce)), processing method, phase transition occurred and solid solution range for complete study. Most of the RE doped BaTiO_3 downshifted the Curie temperature (T_C). Transition temperature also known as Curie temperature, T_C where the ceramics had a transition from ferroelectric to a paraelectric phase. In this review, the dielectric constant of La-doped BaTiO_3, Er-doped BaTiO_3, Sm-doped BaTiO_3, Nd-doped BaTiO_3 and Ce-doped BaTiO_3 had been proved to increase and the transition temperature or also known as T_C also lowered down to room temperature as for all the RE doped BaTiO_3 except for Er-doped BaTiO_3.
Colonic diverticulosis: evaluation with double contrast barium enema
International Nuclear Information System (INIS)
Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja
1997-01-01
To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west
Barium from a mini r-process in supernovae
Heymann, D.
1983-01-01
McCulloch and Wasserburg (1978) have reported nonlinear isotopic anomalies in barium for two Ca-Al-rich inclusions of the Allende carbonaceous chondrite, known as EK-1-4-1 and C-1. In an attempt to account for these anomalies, it has been proposed that Ba from an r-process of nucleosynthesis, containing Ba-135 and Ba-137, was injected into the primeval color system but was not totally homogenized. Questions arise in connection with the relations of Xe isotopes in carbonaceous chondrites. This has prompted Heymann and Dziczkaniec (1979, 1980, 1981) to study the formation of r-Xe, r-Kr, and r-Te by the mini r-process which is thought to occur in the O, Ne-rich shells of Type II supernovae. Lee et al. (1979) have studied the formation of r-Ba, r-Nd, and r-Sm by the same process. Certain differences regarding the approaches used by Lee et al. and by Heymann and Dziczkaniec make it necessary to restudy the work of Lee et al. Attention is given to the survival probabilities of nuclear species of interest, taking into accounts the elements Cs, Ba, I, and Xe.
Colonic diverticulosis: evaluation with double contrast barium enema
Energy Technology Data Exchange (ETDEWEB)
Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja [Korea Veterans Hospital, Seoul (Korea, Republic of)
1997-02-01
To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west.
Structural and magnetic properties of barium-gadolinium hexaferrites
Energy Technology Data Exchange (ETDEWEB)
Litsardakis, G. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)]. E-mail: Lits@eng.auth.gr; Manolakis, I. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Serletis, C. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Efthimiadis, K.G. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)
2007-03-15
A series of Gd-substituted M-type barium hexaferrites has been prepared by the ceramic route, according to the formula (Ba{sub 1-x}Gd{sub x})O.5.25Fe{sub 2}O{sub 3} (x=0-0.30). XRD analysis revealed that all the samples present primarily an M-type structure. Samples x=0 and x=0.05 are single-phase. Hematite (Fe{sub 2}O{sub 3}) and GdFeO{sub 3} were detected in the remaining samples. Coercivity (H{sub c}) shows remarkably high values, {approx}293kA/m for x=0.20 and 0.30 with a maximum of 322kA/m for x=0.25. Specific saturation magnetization ({sigma}{sub sat}) of the samples presents a small increase up to x=0.10. The microstructure examination indicates that Gd may act as a grain growth inhibitor.
Stability of cyclopentadienyl aryloxide complexes of calcium and barium
Energy Technology Data Exchange (ETDEWEB)
Harvey, Melanie J.; Burkey, David J.; Chmely, Stephen C. [Department of Chemistry, Vanderbilt University, Nashville, TN 37235 (United States); Hanusa, Timothy P., E-mail: t.hanusa@vanderbilt.ed [Department of Chemistry, Vanderbilt University, Nashville, TN 37235 (United States)
2009-12-04
The synthesis of mono(cyclopentadienyl)aryloxide complexes of calcium and barium has been investigated. The reaction of ICa(ODipp)(thf){sub 4} (Odipp = [2,6-iPr-OC{sub 6}H{sub 3}O]{sup -}) with K[C{sub 5}Me{sub 5}], (Cp{sup 3Si}){sub 2}Ca (Cp{sup 3Si} = C{sub 5}(SiMe{sub 3}){sub 3}H{sub 2}) with K[ODipp], and IBa(BHT)(thf){sub 3} (BHT = [2,6-tBu-4-Me-C{sub 6}H{sub 2}O]{sup -}) with K[C{sub 5}Me{sub 5}] in THF produces Cp*Ca(Odipp)(thf){sub 3}, (Cp{sup 3Si})Ca(Odipp)(thf){sub 2}, and Cp*Ba(BHT)(thf), respectively. The crystal structures of the two monomeric calcium complexes are reported. All three compounds are stable against Schlenk rearrangement in THF and aromatic solvents. DFT calculations suggest that the presence of THF has less of an effect on the thermodynamics of Schlenk rearrangements of the aryloxide systems than it does on comparable Cp'CaI compounds.
Barium variation in Acropora palmata and Montastrea annularis
Pingitore, Nicholas E.; Rangel, Yolanda; Kwarteng, Andrew
1989-06-01
The barium contents of Acropora palmata and Montastrea annularis are distinct both in their averages (6 and 9 ppm, respectively) and, more impressively, in their variability (5 to 7 ppm and 6 to 15 ppm). A. palmata contained about 50% more Ba2+ than M. annularis and exhibited more than three times as much variation, as measured by their respective coefficients of variation. In contrast, the means and coefficients of variation of Sr2+ in these groups differed by only 6% and 15%. No obvious environmental or post-depositional causes for the inter-and intra-specific variation of Ba2+ could be found. Previous experiments indicate that the partitioning of Ba2+ into aragonite depends directly on the rate of precipitation. This suggests that Ba2+ does not substitute for Ca2+ but instead is incorporated by occlusion. Since growth rates in A. palmata often exceed those of M. annularis, this appears to be the mechanism which generates higher and more variable concentrations of Ba2+ in A. palmata.
Medical and occupational dose reduction in pediatric barium meal procedures
Filipov, D.; Schelin, H. R.; Denyak, V.; Paschuk, S. A.; Ledesma, J. A.; Legnani, A.; Bunick, A. P.; Sauzen, J.; Yagui, A.; Vosiak, P.
2017-11-01
Doses received in pediatric Barium Meal procedure can be rather high. It is possible to reduce dose values following the recommendations of the European Communities (EC) and the International Commission on Radiological Protection (ICRP). In the present work, the modifications of radiographic techniques made in a Brazilian hospital according to the EC and the ICRP recommendations and their influence on medical and occupational exposure are reported. The procedures of 49 patients before and 44 after the optimization were studied and air kerma-area product (PK,A) values and the effective doses were evaluated. The occupational equivalent doses were measured next to the eyes, under the thyroid shield and on each hand of both professionals who remained inside the examination room. The implemented modifications reduced by 70% and 60% the PK,A and the patient effective dose, respectively. The obtained dose values are lower than approximately 75% of the results from similar studies. The occupational annual equivalent doses for all studied organs became lower than the limits set by the ICRP. The equivalent doses in one examination were on average below than 75% of similar studies.
Barium oxide, calcium oxide, magnesia, and alkali oxide free glass
Lu, Peizhen Kathy; Mahapatra, Manoj Kumar
2013-09-24
A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.
Obtaining of a barium compound by combustion chemistry and their evaluation as Co adsorbent
International Nuclear Information System (INIS)
Rosas G, N.
2008-01-01
In this work, barium carbonate synthesized by chemical combustion method using a chemical precursor prepared by the combination of barium nitrate and urea as a fuel, with a 1:1 molar ratio in aqueous solution, the chemical precursor was heated to evaporate excess water, producing a homogeneous viscous liquid, that when heated to 900 centi grades for 5 minutes an exothermic reaction was produced very quickly and abruptly, forming a white powder final product, fine porous, little spongy, dry and crystalline ready to be used as material adsorbent. Additionally, the effect of water on the synthesis by chemical combustion was studied. Simultaneously, and with the purpose of comparing the advantages and disadvantages of the method by chemical combustion, barium carbonate was synthesized by precipitation method using barium nitrate salts and sodium carbonate. Synthesized barium carbonate, was characterized by X-ray diffraction, thermal gravimetric analysis, infrared spectrometry and scanning electron microscopy. We studied the adsorption capacity of Co present in aqueous solution by static tests on materials synthesized at room temperature using the neutron activation analysis. It was found that the synthesis by chemical combustion provides an interesting alternative compared to the synthesis by precipitation because it offers simplicity of synthesis and speed to have a good adsorbent material. It was found that the barium carbonate synthesized by the chemical combustion method using in their synthesis 1.0 ml of water, was the one who achieved the maximum adsorption capacity of 95.6% compared with the barium carbonate prepared by precipitation, which reached a capacity adsorption of 51.48%. (Author)
Rapid and accurate determination of barium by instrumental neutron activation analysis
International Nuclear Information System (INIS)
Armelin, Maria Jose A.; Maihara, Vera A.; Saiki, Mitiko; Trevizam, Anderson R.
2013-01-01
Barium is an alkaline earth metal naturally present in soils. When available at a high level in the soil it can cause toxicity to plants and animals. Not all the barium is readily available to living organisms. Inorganic and organic barium compounds can be presented as soluble or insoluble forms in the soil. The soluble form of BaS is extremely toxic to humans, animals and plants. Researchers have noted a decrease of K absorption in the plant when Ba concentrations are increased and a change in overall plant growth. In case of animals, Ba tends to be concentrated in the bones which may compete with calcium, although only about 2% barium ingested in dietary is absorbed by the body. Another effect is that the Ba can interfere with the availability of sulfur in the soil due to the sulphate formation of low solubility. Barium and some other elements are considered palioclimatic proxies. For some researchers, barite is perhaps the most appropriate indicator of paleoproductivity because of a high resistance to dissolution. As explained about the barium effects in various situations, it was considered important to study the more appropriated experimental conditions for determination of this element by INAA. Conditions established for this analysis were: a) Irradiation time, 15 and 40 seconds, under thermal flux neutron about 4 x 10 12 n cm -2 s -1 , for determining barium in geological and biological matrices, respectively; b) Decay time, approximately of 4 minutes; c) Counting time of 30 minutes; d) Radionuclide measured 139 Ba. The quality of Ba results was evaluated from the analysis of certified reference materials. The performance of the method was satisfactory, according to the criterion of E.ζ score. Results obtained in this study indicate INAA is a good alternative for Ba determination in geological and biological samples. (author)
International Nuclear Information System (INIS)
Yamada, Takahiro; Koyama, Yasunori; Masui, Asami
2009-01-01
Small pulmonary lesions not previously seen on chest radiographs will likely be detected with increasing frequency because of the spread of CT screening. For the diagnosis and treatment of such lesions, we frequently perform resection by video-assisted thoracoscopic surgery (VATS). We performed fluoroscopy-guided barium marking for localization of small peripheral pulmonary lesions before VATS resection, and examined its reliability, safety, and usefulness. We studied 46 patients with peripheral pulmonary lesions 20 mm or less in diameter who were scheduled to undergo VATS resection. The average diameter of the lesions was 10.2±0.5 mm (mean±standard error), and the average distance from the pleural surface was 10.1±0.8 mm. The optimal site for the catheter tip was decided on chest radiographs using CT scans for reference beforehand, and a catheter was inserted bronchoscopically into the target segment and guided to the presumed lesion. A 50% (weight/volume) barium sulfate suspension was instilled into the bronchus through the catheter, and the site of barium marking was checked by CT scanning. The average instilled volume of barium was 0.36±0.03 ml. On CT scans, barium spots were superimposed on the target lesions in 35 of the 46 patients and were only 15 mm from the lesions in the other patients. Barium was well recognized in all patients at the time of VATS resection, and we could confirm the diagnosis in all patients. A mild cough persisted for about 1 week in 1 patient, but the other patients had no specific complications. Fluoroscopy-guided barium marking is a safe, convenient, and reliable method for localization of small pulmonary lesions before VATS resection. (author)
Wang, Chang-jian; Zhao, Guang-fa; Li, Qing-guo; Chen, Jing-gui; Zhu, Kai; Shi, Ying-qiang; Fu, Hong
2010-04-01
To investigate the value of preoperative barium contrast examination for the diagnosis and operative planning in gastric cancer. Clinical data of 229 gastric cancer patients were analyzed retrospectively. Lesions were divided into three parts: the cardiac, the body, and the antrum. The diagnostic accuracy of localization and the extent of tumor between gastroscopy alone and gastroscopy plus barium contrast were compared with the results of surgical findings. The diagnostic accuracy of localization and the extent of tumor for gastroscopy in the cardiac, the body and the antrum cancers were 100% and 78.4%, 94.6% and 86.5%, 98.1% and 84.6%, respectively, while for gastroscopy plus barium contrast were 100% and 84.8%, 100% and 91.9%, 99.0% and 90.4%, respectively. The diagnostic accuracy of both the localization and the extent of tumor were not significantly different between gastroscopy alone and gastroscopy plus barium contrast (P>0.05). Diagnostic accuracy of the length of esophagus infiltrated by cardiac cancer in gastroscopy was 60.6%, while in gastroscopy plus barium contrast was 90.9%, which was significantly different (Pbarium contrast was more accurate in predicting the possibility of thoracotomy in cardiac cancer infiltrating the lower esophagus. It is necessary to perform preoperative barium contrast examination in cardiac cancer patients, so as to identify whether the lower esophagus is infiltrated and to measure the length of lesion, which can provide evidences for making a decision of thoracotomy. For gastric body and antrum cancer, there is no indication for barium contrast examination if gastroscopy findings are satisfied.
Accelerating the transit time of barium sulphate suspensions in small bowel examinations
International Nuclear Information System (INIS)
Summers, David S.; Roger, Mark D.; Allan, Paul L.; Murchison, John T.
2007-01-01
Purpose: To determine whether hyperosmolar and effervescent agents proven individually to accelerate transit time in the barium small bowel examination have an additive effect when combined, surpassing that of either agent alone. Materials and methods: One hundred and forty-nine patients were randomised to four groups. Three hundred milliliters of barium sulphate alone was given to the first group. Fifteen milliliters of iodinated hyperosmolar contrast agent (Gastrografin, meglumine/sodium diatrizoate, Schering) was given in addition to barium sulphate to the second group while six packets of effervescent granules (Carbex, Ferring) were added for the third group. The final group was given a combination of both additives and barium sulphate. The time taken following ingestion for the contrast column to reach the caecum, as assessed by frequent interval fluoroscopy, was recorded. A subgroup of 32 patients were selected randomly from the four groups, 8 from each and assessed for quality of examination. Statistical assessments were made using Kruskal-Wallis and Mann-Whitney tests. Results: One hundred and nineteen patients were analysed after exclusions. The addition of accelerant to barium sulphate, both individually and in combination significantly reduced the small bowel transit time (p < 0.001). No significant difference existed between the additives when used with barium alone. The combined group had significantly faster transit times compared to the hyperosmolar group (p = 0.02). Differences between combined and effervescent groups tended towards significance (p = 0.09). No significant difference existed between groups when examination quality was assessed. Conclusion: These results suggest that the addition of combined effervescent and hyperosmolar agents to the barium suspension may significantly shorten the small bowel transit time without adversely affecting examination quality. This has implications for patient acceptability of the examination as well as
Barium inhibits arsenic-mediated apoptotic cell death in human squamous cell carcinoma cells.
Yajima, Ichiro; Uemura, Noriyuki; Nizam, Saika; Khalequzzaman, Md; Thang, Nguyen D; Kumasaka, Mayuko Y; Akhand, Anwarul A; Shekhar, Hossain U; Nakajima, Tamie; Kato, Masashi
2012-06-01
Our fieldwork showed more than 1 μM (145.1 μg/L) barium in about 3 μM (210.7 μg/L) arsenic-polluted drinking well water (n = 72) in cancer-prone areas in Bangladesh, while the mean concentrations of nine other elements in the water were less than 3 μg/L. The types of cancer include squamous cell carcinomas (SCC). We hypothesized that barium modulates arsenic-mediated biological effects, and we examined the effect of barium (1 μM) on arsenic (3 μM)-mediated apoptotic cell death of human HSC-5 and A431 SCC cells in vitro. Arsenic promoted SCC apoptosis with increased reactive oxygen species (ROS) production and JNK1/2 and caspase-3 activation (apoptotic pathway). In contrast, arsenic also inhibited SCC apoptosis with increased NF-κB activity and X-linked inhibitor of apoptosis protein (XIAP) expression level and decreased JNK activity (antiapoptotic pathway). These results suggest that arsenic bidirectionally promotes apoptotic and antiapoptotic pathways in SCC cells. Interestingly, barium in the presence of arsenic increased NF-κB activity and XIAP expression and decreased JNK activity without affecting ROS production, resulting in the inhibition of the arsenic-mediated apoptotic pathway. Since the anticancer effect of arsenic is mainly dependent on cancer apoptosis, barium-mediated inhibition of arsenic-induced apoptosis may promote progression of SCC in patients in Bangladesh who keep drinking barium and arsenic-polluted water after the development of cancer. Thus, we newly showed that barium in the presence of arsenic might inhibit arsenic-mediated cancer apoptosis with the modulation of the balance between arsenic-mediated promotive and suppressive apoptotic pathways.
19 CFR 122.134 - When airline does not have in-bond liquor storeroom.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false When airline does not have in-bond liquor storeroom. 122.134 Section 122.134 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Liquor Kits § 122.134 When airline does not have in-bond liquor storeroom. (a...
Preservation of renal blood flow by the antioxidant EUK-134 in LPS-treated pigs.
Magder, Sheldon; Parthenis, Dimitrios G; Ghouleh, Imad Al
2015-03-25
Sepsis is associated with an increase in reactive oxygen species (ROS), however, the precise role of ROS in the septic process remains unknown. We hypothesized that treatment with EUK-134 (manganese-3-methoxy N,N'-bis(salicyclidene)ethylene-diamine chloride), a compound with superoxide dismutase and catalase activity, attenuates the vascular manifestations of sepsis in vivo. Pigs were instrumented to measure cardiac output and blood flow in renal, superior mesenteric and femoral arteries, and portal vein. Animals were treated with saline (control), lipopolysaccharide (LPS; 10 µg·kg-1·h-1), EUK-134, or EUK-134 plus LPS. Results show that an LPS-induced increase in pulmonary artery pressure (PAP) as well as a trend towards lower blood pressure (BP) were both attenuated by EUK-134. Renal blood flow decreased with LPS whereas superior mesenteric, portal and femoral flows did not change. Importantly, EUK-134 decreased the LPS-induced fall in renal blood flow and this was associated with a corresponding decrease in LPS-induced protein nitrotyrosinylation in the kidney. PO2, pH, base excess and systemic vascular resistance fell with LPS and were unaltered by EUK-134. EUK-134 also had no effect on LPS-associated increase in CO. Interestingly, EUK-134 alone resulted in higher CO, BP, PAP, mean circulatory filling pressure, and portal flow than controls. Taken together, these data support a protective role for EUK-134 in the renal circulation in sepsis.
'Wash-out' of Cs-134 and Cs-137 from river sediment; 'Ispiranja' Cs-134 i Cs-137 iz recnog sedimenta
Energy Technology Data Exchange (ETDEWEB)
Skrbic, Z; Conkic, Lj; Bikit, I; Veskovic, M; Slivka, J; Marinkov, L [Institut za Fiziku, Novi Sad Univ. (Yugoslavia)
1988-07-01
Natural elimination and 'wash out' period of the Cs-134 and Cs-137 from the river sediment has been investigated. Obtained results suggest the possibility to describe these processes by exponential low and determination of the corresponding half lives. (author)
Barium isotope geochemistry of subduction-zone magmas
Yu, H.; Nan, X.; Huang, J.; Wörner, G.; Huang, F.
2017-12-01
Subduction zones are crucial tectonic setting to study material exchange between crust and mantle, mantle partial melting with fluid addition, and formation of ore-deposits1-3. The geochemical characteristics of arc lavas from subduction zones are different from magmas erupted at mid-ocean ridges4, because there are addition of fluids/melts from subducted AOC and its overlying sediments into their source regions in the sub-arc mantle4. Ba is highly incompatible during mantle melting5, and it is enriched in crust (456 ppm)6 relative to the mantle (7.0 ppm)7. The subducted sediments are also enriched in Ba (776 ppm of GLOSS)8. Moreover, because Ba is fluid soluble during subduction, it has been used to track contributions of subduction-related fluids to arc magmas9 or recycled sediments to the mantle10-11. To study the Ba isotope fractionation behavior during subduction process, we analyzed well-characterized, chemically-diverse arc lavas from Central American, Kamchatka, Central-Eastern Aleutian, and Southern Lesser Antilles. The δ137/134Ba of Central American arc lavas range from -0.13 to 0.24‰, and have larger variation than the arc samples from other locations. Except one sample from Central-Eastern Aleutian arc with obviously heavy δ137/134Ba values (0.27‰), all other samples from Kamchatka, Central-Eastern Aleutian, Southern Lesser Antilles arcs are within the range of OIB. The δ137/134Ba is not correlated with the distance to trench, partial melting degrees (Mg#), or subducting slab-derived components. The samples enriched with heavy Ba isotopes have low Ba contents, indicating that Ba isotopes can be fractionated at the beginning of dehydration process with small amount of Ba releasing to the mantle wedge. With the dehydration degree increasing, more Ba of the subducted slab can be added to the source of arc lavas, likely homogenizing the Ba isotope signatures. 1. Rudnick, R., 1995 Nature; 2. Tatsumi, Y. & Kogiso, T., 2003; 3. Sun, W., et al., 2015 Ore
Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE
Energy Technology Data Exchange (ETDEWEB)
Anderson, N.G. [University of Otago, Department of Radiology, Christchurch (New Zealand); Butler, A.P. [University of Otago, Department of Radiology, Christchurch (New Zealand); University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Scott, N.J.A. [University of Otago, Department of Medicine, Christchurch (New Zealand); Cook, N.J. [Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Butzer, J.S. [Karlsruhe Institute of Technology, Physics Department, Karlsruhe (Germany); Schleich, N. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Firsching, M. [Friedrich Alexander University, Physics Department, Erlangen (Germany); Grasset, R.; Ruiter, N. de [University of Canterbury, Hitlab NZ, Christchurch (New Zealand); Campbell, M. [European Organisation for Nuclear Research, Physics Section, Geneva (Switzerland); Butler, P.H. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand)
2010-09-15
Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 {mu}A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 {mu}m isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)
Determination of barium in surface and ground waters at Centro Experimental Aramar area
Energy Technology Data Exchange (ETDEWEB)
Matoso, Erika, E-mail: ematoso@hotmail.com [Centro Tecnologico da Marinha em Sao Paulo (CEA/CTMS), Ipero, SP (Brazil). Centro Experimental Aramar; Cadore, Solange, E-mail: cadore@iqm.unicamp.br [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Quimica. Departamento de Quimica Analica
2015-07-01
Barium can be found in waters up to 1 mg L{sup -1} and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L{sup -1} and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)
Energy Technology Data Exchange (ETDEWEB)
Fransson, S.G.; Soekjer, H.; Johansson, K.E.; Tibbling, L.
It has been proposed that the high density of ordinary barium suspension may complicate the radiologic diagnosis of gastro-oesophageal reflux. For this reason P-contrast was developed (Ferring AB); a contrast medium with the same density as water (1 g/cm/sup 3/). A comparison of P-contrast and barium (Mixobar Ventrikel 400 mg/ml) was performed in 82 patients. All patients were examined with both contrast media and the findings were compared with those at reflux test at manometry, endoscopy and 24-hour pH monitoring. Another 40 patients and 15 symptom-free controls were examined with two different amounts of barium, 100 ml and 200 ml, to study if the radiologic diagnosis of reflux varied with the volume of contrast medium administered. P-contrast was found to have no advantages over barium for the diagnosis of gastro-oesophageal reflux. The outcome of the radiologic examination was not influenced by the different volumes of barium used.
Benefits of Barium Enema in Patients with Incomplete Colonoscopy. Prospective Study of 45 Cases
International Nuclear Information System (INIS)
Gispert, S.; Mayolas, N.; Hidalgo, A.
2003-01-01
To evaluate the usefulness of barium enema in patients with incomplete colonoscopy. There was carried out a prospective 10-month study of 45 patients with incomplete colonoscopy (27 men and 18 women), who were later examined by means of barium enema (33 conventional, 12 double-contrast) in order to check for additional pathology in portions of the colon not visualized by colonoscopy. Barium enema diagnosed six possible additional lesions (13.3%) in portions of the colon not visualized by incomplete colonoscopy (four neoplasia and two non-neoplasia). Regarding the neoplasia two were true positives and two false positives. Both true positives were adenocarcinomas (one synchronous caecum, and another in splenic angle). The two false positives corresponded to fecal matter stuck to the intestinal wall. Regarding the non-neoplasia, multiple stenosis was detected in a patient with Crohn's disease and an enterocolic fistula was found in a patient with sigmoid colon neoplasia. The diagnostic yield of barium enema in the detection of additional pathology in colon portions not visualized by colonoscopy was of 9%. Barium enema following incomplete colonoscopy permits a complete colon evaluation in most cases, and it offers additional diagnostic information. (Author) 21 refs
Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE.
Anderson, N G; Butler, A P; Scott, N J A; Cook, N J; Butzer, J S; Schleich, N; Firsching, M; Grasset, R; de Ruiter, N; Campbell, M; Butler, P H
2010-09-01
Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 microA). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications.
Effect of barium sulfate contrast medium on rheology and sensory texture attributes in a model food.
Ekberg, O; Bulow, M; Ekman, S; Hall, G; Stading, M; Wendin, K
2009-03-01
The swallowing process can be visualized using videoradiography, by mixing food with contrast medium, e.g., barium sulfate (BaSO(4)), making it radiopaque. The sensory properties of foods may be affected by adding this medium. To evaluate if and to what extent sensory and rheological characteristics of mango purée were altered by adding barium sulfate to the food. This study evaluated four food samples based on mango purée, with no or added barium sulfate contrast medium (0%, 12.5%, 25.0%, and 37.5%), by a radiographic method, and measured sensory texture properties and rheological characteristics. The sensory evaluation was performed by an external trained panel using quantitative descriptive analysis. The ease of swallowing the foods was also evaluated. The sensory texture properties of mango purée were significantly affected by the added barium in all evaluated attributes, as was the perception of particles. Moreover, ease of swallowing was significantly higher in the sample without added contrast medium. All samples decreased in extensional viscosity with increasing extension rate, i.e., all samples were tension thinning. Shear viscosity was not as dependent on the concentration of BaSO(4) as extensional viscosity. Addition of barium sulfate to a model food of mango purée has a major impact on perceived sensory texture attributes as well as on rheological parameters.
Determination of barium in surface and ground waters at Centro Experimental Aramar area
International Nuclear Information System (INIS)
Matoso, Erika; Cadore, Solange
2015-01-01
Barium can be found in waters up to 1 mg L -1 and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L -1 and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)
Colonoscopy can miss diverticula of the left colon identified by barium enema.
Niikura, Ryota; Nagata, Naoyoshi; Shimbo, Takuro; Akiyama, Junichi; Uemura, Naomi
2013-04-21
To identify the diagnostic value of colonoscopy for diverticulosis as determined by barium enema. A total of 65 patients with hematochezia who underwent colonoscopy and barium enema were analyzed, and the diagnostic value of colonoscopy for diverticula was assessed. The receiver operating characteristic area under the curve was compared in relation to age (barium enema. Colonoscopy had a sensitivity of 91% and specificity of 90%. No significant differences were found in the receiver operating characteristic area under the curve (ROC-AUC) for age group or sex. The ROC-AUC of the left colon was significantly lower than that of the right colon (0.81 vs 0.96, P = 0.02). Colonoscopy identified 486 colonic diverticula, while barium enema identified 1186. The detection ratio for the entire colon was therefore 0.41 (486/1186). The detection ratio in the left colon (0.32, 189/588) was significantly lower than that of the right colon (0.50, 297/598) (P barium enema, only half the number of colonic diverticula can be detected by colonoscopy in the entire colon and even less in the left colon.
Directory of Open Access Journals (Sweden)
Marcio Osvaldo Lima Magalhães
2014-01-01
Full Text Available To evaluate the possible solubilization of barium sulfate in soils under reducing conditions and its effects on barium bioavailability, an Oryza sativa pot trial was established. Increasing barium doses and two redox potential conditions were evaluated. The geochemical fractionation data demonstrated that reducing conditions led to an increase in the levels of more labile forms of barium and a reduction in more stable forms. Furthermore, higher doses of barium were found to have a negative impact on grain production. The highest levels of barium accumulation in the leaves, roots, and grains were observed with the highest barium dose under reducing conditions. These results demonstrate that reducing conditions increased barium bioavailability and absorption by rice plants.
DIAGNOSTIC ACCURACY OF BARIUM ENEMA FINDINGS IN HIRSCHSPRUNG'S DISEASE.
Peyvasteh, Mehran; Askarpour, Shahnam; Ostadian, Nasrollah; Moghimi, Mohammad-Reza; Javaherizadeh, Hazhir
2016-01-01
Hirschsprung's disease is the most common cause of pediatric intestinal obstruction. Contrast enema is used for evaluation of the patients with its diagnosis. To evaluate sensitivity, specificity, positive predictive value, and negative predictive value of radiologic findings for diagnosis of Hirschsprung in patients underwent barium enema. This cross sectional study was carried out in Imam Khomeini Hospital for one year starting from 2012, April. Sixty patients were enrolled. Inclusion criteria were: neonates with failure to pass meconium, abdominal distention, and refractory constipation who failed to respond with medical treatment. Transitional zone, delay in barium evacuation after 24 h, rectosigmoid index (maximum with of the rectum divided by maximum with of the sigmoid; abnormal if de Hirschsprung é a causa mais comum de obstrução intestinal pediátrica. Enema baritado é usado para a avaliação dos pacientes com o diagnóstico . Avaliar a sensibilidade, especificidade, valor preditivo positivo e valor preditivo negativo de achados radiológicos para diagnóstico de Hirschsprung em pacientes submetidos ao enema opaco. Este estudo transversal foi realizado em Imam Khomeini Hospital por um ano a partir de abril de 2012. Sessenta pacientes foram incluídos. Os critérios de inclusão foram: recém-nascidos com insuficiência de passagem de mecônio, distensão abdominal, e constipação refratária sem resposta ao tratamento médico. Foram avaliadas no enema zona de transição, atraso na evacuação de bário após 24 h, índice retossigmoide (máximo do diâmetro do reto dividido pelo máximo do sigmóide; anormal se casos com a doença de Hirschsprung e sem foi 17,90±18,29 meses e 17,8±18,34 meses, respectivamente (p=0,983). Confirmou-se em 30 (M=20, F=10) dos casos. Falha no mecônio foi encontrada em 21 (70%) casos. Sensibilidade, especificidade, VPP e VPN foram de 90%, 80%, 81,8% e 88,8%, respectivamente, para a zona de transição no enema
Nanofunctionalized zirconia and barium sulfate particles as bone cement additives
Directory of Open Access Journals (Sweden)
Riaz Gillani
2009-12-01
Full Text Available Riaz Gillani1, Batur Ercan1, Alex Qiao3, Thomas J Webster1,21Division of Engineering, 2Department of Orthopaedics, Brown University, Providence, RI, USA; 3G3 Technology Innovations, LLC, Pittsford, NY, USAAbstract: Zirconia (ZrO2 and barium sulfate (BaSO4 particles were introduced into a methyl methacrylate monomer (MMA solution with polymethyl methacrylate (PMMA beads during polymerization to develop the following novel bone cements: bone cements with unfunctionalized ZrO2 micron particles, bone cements with unfunctionalized ZrO2 nanoparticles, bone cements with ZrO2 nanoparticles functionalized with 3-(trimethoxysilylpropyl methacrylate (TMS, bone cements with unfunctionalized BaSO4 micron particles, bone cements with unfunctionalized BaSO4 nanoparticles, and bone cements with BaSO4 nanoparticles functionalized with TMS. Results demonstrated that in vitro osteoblast (bone-forming cell densities were greater on bone cements containing BaSO4 ceramic particles after four hours compared to control unmodified bone cements. Osteoblast densities were also greater on bone cements containing all of the ceramic particles after 24 hours compared to unmodified bone cements, particularly those bone cements containing nanofunctionalized ceramic particles. Bone cements containing ceramic particles demonstrated significantly altered mechanical properties; specifically, under tensile loading, plain bone cements and bone cements containing unfunctionalized ceramic particles exhibited brittle failure modes whereas bone cements containing nanofunctionalized ceramic particles exhibited plastic failure modes. Finally, all bone cements containing ceramic particles possessed greater radio-opacity than unmodified bone cements. In summary, the results of this study demonstrated a positive impact on the properties of traditional bone cements for orthopedic applications with the addition of unfunctionalized and TMS functionalized ceramic nanoparticles
TWO BARIUM STARS IN THE OPEN CLUSTER NGC 5822
Energy Technology Data Exchange (ETDEWEB)
Katime Santrich, O. J.; Pereira, C. B.; De Castro, D. B., E-mail: osantrich@on.br, E-mail: claudio@on.br, E-mail: denise@on.br [Observatorio Nacional/MCT, Rua Gen. Jose Cristino, 77, 20921-400 Rio de Janeiro (Brazil)
2013-08-01
Open clusters are very useful examples to explain the constraint of the nucleosynthesis process with the luminosities of stars because the distances of the clusters are better known than those of field stars. We carried out a detailed spectroscopic analysis to derive the chemical composition of two red giants in the young open cluster NGC 5822, NGC 5822-2, and NGC 5822-201. We obtained abundances of C, N, O, Na, Mg, Al, Ca, Si, Ti, Ni, Cr, Y, Zr, La, Ce, and Nd. The atmospheric parameters of the studied stars and their chemical abundances were determined using high-resolution optical spectroscopy. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. The abundances of the light elements were derived using the spectral synthesis technique. We found that NGC 5822-2 and -201 have, respectively, a mean overabundance of the elements created by the s-process, ''s'', with the notation [s/Fe] of 0.77 {+-} 0.12 and 0.83 {+-} 0.05. These values are higher than those for field giants of similar metallicity. We also found that NGC 5822-2 and -201 have, respectively, luminosities of 140 L{sub Sun} and 76 L{sub Sun }, which are much lower than the luminosity of an asymptotic giant branch star. We conclude that NGC 5822-2 and NGC 5822-201 are two new barium stars first identified in the open cluster NGC 5822. The mass transfer hypothesis is the best scenario to explain the observed overabundances.
EPR dosimetric properties of nano-barium sulfate
International Nuclear Information System (INIS)
Aboelezz, E.; Hassan, G.M.; Sharaf, M.A.; El-Khodary, A.
2015-01-01
Nano/micro BaSO 4 were prepared through the co-precipitation method to measure ionizing radiation doses using electron paramagnetic resonance (EPR). The nano-BaSO 4 sample was characterized using X-ray diffraction (XRD), and transmission electron microscopy (TEM) techniques. The dose response and fading properties of nano- and micro-phase BaSO 4 were compared in EPR spectra. The prepared nano- and micro-BaSO 4 samples have the same hole and electron centers, which may be attributed to SO 4 − and SO 3 − , respectively. The dosimetric signals for prepared nano- and micro-BaSO 4 have spectroscopic splitting factor (g) with values 2.0025±0.0006 and 2.0027±0.0006, respectively. The nanocrystalline sample has a linear γ-ray dose response over the range 0.4 Gy–1 kGy. The performance parameters which including detection limit and critical level calculated from weighted and unweighted least-squares fitting. The sensitivity of nano-BaSO 4 to γ-ray is one and a half times more than alanine. The lifetime and activation energy for nano-BaSO 4 were estimated by conducting a thermal stability study, and were 5.7±1.1×10 4 years and 0.73±0.14 eV, respectively. The combined and expanded uncertainties accompanying measurements were ±3.89% and ±7.78%, respectively. - Highlights: • Preparation of nano-BaSO 4 using the co-precipitation method. • Study of the dosimetric properties of nano-barium sulfate using the EPR technique. • Comparison between a new EPR dosimeter using nano-materials and standard alanine. • Calculation of the uncertainty budget for nano-BaSO 4
Extended analysis of six-times ionized barium (Ba VII)
International Nuclear Information System (INIS)
Sharma, M.K.; Tauheed, A.; Rahimullah, K.
2013-01-01
The seventh spectrum of barium (Ba VII) has been investigated using experimental recordings made on a 3-m normal incidence vacuum spectrograph in Canada in the wavelength region 300–2000 Å. The data below 350 Å was supplemented from the spectrograms recorded on a 10.7-m grazing incidence spectrograph of NIST laboratory USA. The sources used to excite the spectra in both the cases were triggered spark. Previously reported levels of 5s 2 5p 2 , 5s5p 3 , 5s 2 5p5d and 5s 2 5p6s in Ba VII have been confirmed except the 1 P 1 level of 5s 2 5p5d. The analysis has been extended considerably to include new configurations 5s 2 5p6d and 5s 2 5p7s in odd parity configuration and doubly excited configurations 5s 2 5p6p, 5s 2 5p4f, 5s 2 5p5f, 5p 4 , 5s5p 2 5d and 5s5p 2 6s in even parity configuration. The 3 F 4 level of 5s 2 5p5d configuration has now been established through the identification of transitions from 5s 2 5p6p. In all, one hundred twenty-two levels have been established in this spectrum out of which ninety-two are new. A configuration interaction Hartree–Fock calculation supports the analysis. -- Highlights: ► The spectrum of Ba was recorded on a 3-m spectrograph with triggered spark source. ► Atomic transitions for Ba VII were identified to established new energy levels. ► CI calculations with relativistic corrections were made for theoretical predictions. ► Weighted oscillator strength (gf) and transition probabilities (gA) were calculated
Extended analysis of four-times ionized barium: (Ba V)
International Nuclear Information System (INIS)
Sharma, M.K.; Rahimullah, K.; Tauheed, A.
2014-01-01
The fifth spectrum of barium (Ba V) has been investigated with the aid of experimental recordings made on a 3-m normal incidence vacuum spectrograph at the Antigonish laboratory (Canada) in the wavelength region 300–2080 Å using triggered spark as an excitation source. The spectral analysis has been extended considerably to include new configuration 5s 2 5p 3 6p in even parity configuration and, 5s 2 5p 3 6d and 5s 2 5p 3 7s in odd parity configuration. Previously reported levels of the ground configuration and three lowest excited configurations 5s5p 5 , 5s 2 5p 3 5d and 5s 2 5p 3 6s in Ba V have been confirmed and all the J≥4 unknown levels of 5s 2 5p 3 5d configuration have now been established through the identification of transitions from the levels of 5s 2 5p 3 6p configuration. All the levels of 5s 2 5p 3 6p configuration and thirty seven out of forty eight levels of the 5s 2 5p 3 6d and 5s 2 5p 3 7s configurations have now been established. A configuration interaction Hartree–Fock calculation supports the analysis. -- Highlights: • The spectrum of Ba was recorded on a 3-m spectrograph with triggered spark source. • CI calculations with relativistic corrections were made for theoretical predictions. • Atomic transitions for Ba V were identified to established new energy levels. • Weighted oscillator strength (gf) and transition probabilities (gA) were calculated
Radiation doses to children during modified barium swallow studies
International Nuclear Information System (INIS)
Weir, Kelly A.; McMahon, Sandra M.; Long, Gillian; Bunch, Judith A.; Pandeya, Nirmala; Coakley, Kerry S.; Chang, Anne B.
2007-01-01
There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 ± 0.0544 mSv, screening time 2.48 ± 0.81 min, and DAP 28.79 ± 41.72 cGy cm 2 . Significant differences were found across three age groups (≤1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)
Dose optimisation of double-contrast barium enema examinations.
Berner, K; Båth, M; Jonasson, P; Cappelen-Smith, J; Fogelstam, P; Söderberg, J
2010-01-01
The purpose of the present work was to optimise the filtration and dose setting for double-contrast barium enema examinations using a Philips MultiDiagnost Eleva FD system. A phantom study was performed prior to a patient study. A CDRAD phantom was used in a study where copper and aluminium filtration, different detector doses and tube potentials were examined. The image quality was evaluated using the software CDRAD Analyser and the phantom dose was determined using the Monte Carlo-based software PCXMC. The original setting [100 % detector dose (660 nGy air kerma) and a total filtration of 3.5 mm Al, at 81 kVp] and two other settings identified by the phantom study (100 % detector dose and additional filtration of 1 mm Al and 0.2 mm Cu as well as 80 % detector dose and added filtration of 1 mm Al and 0.2 mm Cu) were included in the patient study. The patient study included 60 patients and up to 8 images from each patient. Six radiologists performed a visual grading characteristics study to evaluate the image quality. A four-step scale was used to judge the fulfillment of three image quality criteria. No overall statistical significant difference in image quality was found between the three settings (P > 0.05). The decrease in the effective dose for the settings in the patient study was 15 % when filtration was added and 34 % when both filtrations was added and detector dose was reduced. The study indicates that additional filtration of 1 mm Al and 0.2 mm Cu and a decrease in detector dose by 20 % from the original setting can be used in colon examinations with Philips MultiDiagnost Eleva FD to reduce the patient dose by 30 % without significantly affecting the image quality. For 20 exposures, this corresponds to a decrease in the effective dose from 1.6 to 1.1 mSv.
Relaxor properties of barium titanate crystals grown by Remeika method
Roth, Michel; Tiagunov, Jenia; Dul'kin, Evgeniy; Mojaev, Evgeny
2017-06-01
Barium titanate (BaTiO3, BT) crystals have been grown by the Remeika method using both the regular KF and mixed KF-NaF (0.6-0.4) solvents. Typical acute angle "butterfly wing" BT crystals have been obtained, and they were characterized using x-ray diffraction, scanning electron microscopy (including energy dispersive spectroscopy), conventional dielectric and acoustic emission methods. A typical wing has a triangular plate shape which is up to 0.5 mm thick with a 10-15 mm2 area. The plate has a (001) habit and an atomically smooth outer surface. Both K+ and F- solvent ions are incorporated as dopants into the crystal lattice during growth substituting for Ba2+ and O2- ions respectively. The dopants' distribution is found to be inhomogeneous, their content being almost an order of magnitude higher (up to 2 mol%) at out surface of the plate relatively to the bulk. A few μm thick surface layer is formed where a multidomain ferroelectric net is confined between two≤1 μm thick dopant-rich surfaces. The layer as a whole possess relaxor ferroelectric properties, which is apparent from the appearance of additional broad maxima, Tm, in the temperature dependence of the dielectric permittivity around the ferroelectric phase transition. Intense acoustic emission responses detected at temperatures corresponding to the Tm values allow to observe the Tm shift to lower temperatures at higher frequencies, or dispersion, typical for relaxor ferroelectrics. The outer surface of the BT wing can thus serve as a relaxor thin film for various electronic application, such as capacitors, or as a substrate for BT-based multiferroic structure. Crystals grown from KF-NaF fluxes contain sodium atoms as an additional impurity, but the crystal yield is much smaller, and while the ferroelectric transition peak is diffuse it does not show any sign of dispersion typical for relaxor behavior.
Noise characteristics of barium ferrite particulate rigid disks
Kodama, Naoki; Inoue, Hitoshi; Spratt, Geoffrey; Uesaka, Yasutaro; Katsumoto, Masayuki
1991-04-01
This paper discusses the relationship between the noise characteristics and magnetic properties of longitudinal barium ferrite (Ba-F) rigid disks with different switching field distributions (SFD). The magnetomotive force dependencies of reverse dc-erase (RDC) noise are measured and compared with SFD values. Coated disks with acicular magnetic particles have dips and thin-film disks peaks in the RDC. In Ba-F disks, both cases are observed depending on the SFD values, though the depths or heights of the RDC noise are much smaller than those of coated disks with acicular particles or thin-film disks. Disks with small SFD values have peaks, and disks with large SFD values have dips. In order to find the relationship between noise properties and magnetic properties, interparticle interactions in Ba-F disks are investigated. Reverse dc remanence Id(H) and ac-demagnetized isothermal remanence Ir(H) are measured. Both are normalized by the saturation remanence. The deviation from the noninteracting system, ΔM = Id(H) - [1ΔM=Id(H)-[1- 2Ir(H)] and an interaction field factor (IFF) given by (H'r - Hr)/Hc, are derived from these remanent properties. Here, H'r is the field corresponding to 50% of the remanent magnetization, Hr is remanence coercivity. In Ba-F disks, ΔM shows positive interactions, and the peak heights of ΔM increase and IFF decrease with decreasing SFD values. Positive interactions between Ba-F particles seem to be caused by particle stacking. Therefore, particle stacking results in small SFD values and peak-type RDC noise.
FIRST DIRECT EVIDENCE THAT BARIUM DWARFS HAVE WHITE DWARF COMPANIONS
International Nuclear Information System (INIS)
Gray, R. O.; McGahee, C. E.; Griffin, R. E. M.; Corbally, C. J.
2011-01-01
Barium II (Ba) stars are chemically peculiar F-, G-, and K-type objects that show enhanced abundances of s-process elements. Since s-process nucleosynthesis is unlikely to take place in stars prior to the advanced asymptotic giant branch (AGB) stage, the prevailing hypothesis is that each present Ba star was contaminated by an AGB companion which is now a white dwarf (WD). Unless the initial mass ratio of such a binary was fairly close to unity, the receiving star is thus at least as likely to be a dwarf as a giant. So although most known Ba stars appear to be giants, the hypothesis requires that Ba dwarfs be comparably plentiful and moreover that they should all have WD companions. However, despite dedicated searches with the IUE satellite, no WD companions have been directly detected to date among the classical Ba dwarfs, even though some 90% of those stars are spectroscopic binaries, so the contamination hypothesis is therefore presently in some jeopardy. In this paper, we analyze recent deep, near-UV and far-UV Galaxy Evolution Explorer (GALEX) exposures of four of the brightest of the class (HD 2454, 15360, 26367, and 221531), together with archived GALEX data for two newly recognized Ba dwarfs: HD 34654 and HD 114520 (which also prove to be spectroscopic binaries). The GALEX observations of the Ba dwarfs as a group show a significant far-UV excess compared to a control sample of normal F-type dwarfs. We suggest that this ensemble far-UV excess constitutes the first direct evidence that Ba dwarfs have WD companions.
Sputtered Modified Barium Titanate for Thin-Film Capacitor Applications
Directory of Open Access Journals (Sweden)
Robert Mamazza
2012-04-01
Full Text Available New apparatus and a new process for the sputter deposition of modified barium titanate thin-films were developed. Films were deposited at temperatures up to 900 °C from a Ba0.96Ca0.04Ti0.82Zr0.18O3 (BCZTO target directly onto Si, Ni and Pt surfaces and characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray photoelectron spectroscopy (XPS. Film texture and crystallinity were found to depend on both deposition temperature and substrate: above 600 °C, the as-deposited films consisted of well-facetted crystallites with the cubic perovskite structure. A strongly textured Pt (111 underlayer enhanced the (001 orientation of BCZTO films deposited at 900 °C, 10 mtorr pressure and 10% oxygen in argon. Similar films deposited onto a Pt (111 textured film at 700 °C and directly onto (100 Si wafers showed relatively larger (011 and diminished intensity (00ℓ diffraction peaks. Sputter ambients containing oxygen caused the Ni underlayers to oxidize even at 700 °C: Raising the process temperature produced more diffraction peaks of NiO with increased intensities. Thin-film capacitors were fabricated using ~500 nm thick BCZTO dielectrics and both Pt and Ni top and bottom electrodes. Small signal capacitance measurements were carried out to determine capacitance and parallel resistance at low frequencies and from these data, the relative permittivity (er and resistivity (r of the dielectric films were calculated; values ranged from ~50 to >2,000, and from ~104 to ~1010 Ω∙cm, respectively.
Garboś, Sławomir; Swiecicka, Dorota
2013-01-01
A method of the classification of natural mineral and spring waters and maximum admissible concentration (MAC) levels of metals present in such types of waters are regulated by Commission Directive 2003/40/EC, Directive 2009/54/EC of the European Parliament and of the Council and Ordinance of Minister of Health of 30 March 2011 on the natural mineral waters, spring waters and potable waters. MAC of barium in natural mineral and spring waters was set at 1.0 mg/l, while World Health Organization determined the Ba guideline value in water intended for human consumption at the level of 0.7 mg/l. The aims of the study were: the determination of barium in natural mineral and spring waters (carbonated, non-carbonated and medium-carbonated waters) produced and bottled on the area of Poland, and assessment of human exposure to this metal presents in the above-mentioned types of waters. The study concerning barium determinations in 23 types of bottled natural mineral waters and 15 types of bottled spring waters (bought in Polish retail outlets) was conducted in 2010. The analyses were performed by validated method of determination of barium in water based on inductively coupled plasma optical emission spectrometry, using modern internal quality control scheme. Concentrations of barium determined in natural mineral and spring waters were in the ranges from 0.0136 mg/l to 1.12 mg/l and from 0.0044 mg/l to 0.43 mg/l, respectively. Only in the single case of natural mineral water the concentration of barium (1.12 mg/l), exceeded above-mentioned MAC for this metal, which is obligatory in Poland and the European Union - 1.0 mg/l. The long-term monitoring of barium concentration in another natural mineral water (2006 - 2010), in which incidental exceeding MAC was observed in 2006, was conducted. All measured barium concentrations in this water were lower than 1.0 mg/l and therefore, it is possible to state that the proper method of mixing waters taken from six independent
Gafni, Rachel I; Guthrie, Lori C; Kelly, Marilyn H; Brillante, Beth A; Christie, C Michele; Reynolds, James C; Yovetich, Nancy A; James, Robert; Collins, Michael T
2015-11-01
Synthetic human PTH 1-34 (hPTH 1-34) replacement therapy in hypoparathyroidism maintains eucalcemia and converts quiescent bone to high-turnover bone. However, the skeletal and metabolic effects of drug discontinuation have not been reported. Nine subjects with hypoparathyroidism received subcutaneous injections of hPTH 1-34 two to three times daily for 19.8 to 61.3 months and then transitioned back to calcium and calcitriol. Biochemistries and bone mineral density (BMD) by dual-energy X-ray absorptiometry (DXA) were assessed at baseline, while on treatment, and at follow-up 3 to 12 months after drug discontinuation. Two subjects developed hypocalcemia when hPTH 1-34 was abruptly discontinued. Thus, to avoid hypocalcemia, subjects were slowly weaned from hPTH 1-34 over several weeks. When hPTH 1-34 was stopped, subjects were requiring two to three times pretreatment doses of calcitriol and calcium to maintain blood calcium levels. Doses were gradually reduced over many weeks until calcium levels were stable on doses similar to baseline. Bone-specific alkaline phosphatase (BSAP), N-telopeptide (NTX), and osteocalcin (OC) increased significantly with hPTH 1-34; at follow-up, BSAP and NTX had returned to baseline while OC was still slightly elevated. During treatment, BMD was unchanged at the hip and lateral spine but declined at the anterior-posterior (AP) spine, radius, and total body. During weaning, BMD increased, with the hip and lateral spine exceeding pre-hPTH 1-34 values and the whole body returning to baseline. AP spine was increased non-significantly compared to baseline at follow-up. hPTH 1-34 must be gradually weaned in hypoparathyroid patients with high doses of oral medications given to avoid hypocalcemia. The transient increased requirements accompanied by increased BMD after long-term hPTH 1-34 therapy suggest a reversal of the expanded remodeling space favoring bone formation as the skeleton returns to a low-turnover state, reminiscent of the hungry
International Nuclear Information System (INIS)
Eliseeva, O.V.; Abakshin, V.A.; Barannikov, V.P.; Krestov, G.A.
1994-01-01
The investigation into phase equilibriums diagrams in the barium (strontium) nitrate-water-dimethylsulfoxide and barium nitrate-water dimethylformamide systems has been pursued at 298, 15 K for the estimation of outlook for use of mixed aqua-organic solvents during the production of mixture form high temperature superconductors by means of coprecipitation or crystallization. 4 refs., 3 figs., 2 tabs
Energy Technology Data Exchange (ETDEWEB)
Xu Huimin [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Department of General Surgery, Weifang People' s Hospital, ShanDong Province 261041 (China); Han Jiagang [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Na Ying [Department of Medical Imaging, Weifang People' s Hospital, ShanDong Province 261041 (China); Zhao Bo; Ma Huachong [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Wang Zhenjun, E-mail: wang3zj@sohu.com [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China)
2011-08-15
Background: Colonic transit study provides valuable information before surgical treatment is considered for patient with constipation. The radiopaque markers method is the most common way for evaluating colon transit time. The aim of this study is to compare the barium suspension with the radiopaque makers to assess the colonic mobility in patient with constipation. Methods: Colonic transit time was measured in 11 female patients with slow-transit constipation using both radiopaque markers and barium suspension method. In radiopaque markers method, the patient ingested 20 markers on the first day, and an abdominal radiograph was performed every 24 h until 80% markers were excreted. In barium suspension method, the patient swallowed up to 50 ml of 200% (w/v) barium meal. The abdominal radiographs were taken at the same time point as the former. Results: The total or segmental colonic transit time were obviously prolonged in all patients. Segmental transits time spent in the right colon, left colon and rectosigmoid for radiopaque markers and barium suspension method was, respectively, 30 {+-} 6 h and 34 {+-} 7 h; 38 {+-} 9 h and 32 {+-} 6 h; 40 {+-} 8 h and 38 {+-} 10 h. In the radiopaque markers method, total colonic transit time was 108 {+-} 14 h and it was 103 {+-} 13 h in the barium suspension method (P > 0.05). Conclusion: The barium suspension and radiopaque markers gave the similar results for colonic transit time. The barium suspension was a simple and cheap method for evaluating the colonic mobility.
The role of the Ganges-Brahmaputra mixing zone in supplying barium and 226Ra to the Bay of Bengal
International Nuclear Information System (INIS)
Carroll, J.; Falkner, K.K.; Brown, E.T.; Moore, W.S.
1993-01-01
The Ganges-Brahmaputra river system is ranked fourth among world rivers as a source of freshwater to the oceans and is believed to supply more sediment to the ocean than any other; 1.5 x 10 12 kg/yr (Milliman and Meade, 1983). Barium and 226 Ra are typically enriched in waters where sediment-laden rivers enter the ocean. As such, the Ganges-Brahmaputra is likely to produce globally significant barium and 226 Ra fluxes to the ocean. Water samples for barium and 226 Ra were collected within four major channels of the Ganges-Brahmaputra mixing zone during a period of low sediment and freshwater discharge. The data suggest that in addition to suspended sediments supplied directly from rivers, river sediments deposited during high discharge in mangroves and on islands are desorbing barium and 226 Ra to seawater. The release of barium and 226 Ra from these sediment deposits is out-of-phase with the direct supply of sediments from the rivers. Estimates of the annual fluxes of barium and 226 Ra from the Ganges-Brahmaputra mixing zone were also derived. The fluxes of barium and 226 Ra are 5.3 x 10 8 mol barium/yr and 9.5 x 10 14 dpm radium/yr. The first silicate and phosphate mixing profiles for this system are reported. 29 refs., 6 figs., 3 tabs
International Nuclear Information System (INIS)
Xu Huimin; Han Jiagang; Na Ying; Zhao Bo; Ma Huachong; Wang Zhenjun
2011-01-01
Background: Colonic transit study provides valuable information before surgical treatment is considered for patient with constipation. The radiopaque markers method is the most common way for evaluating colon transit time. The aim of this study is to compare the barium suspension with the radiopaque makers to assess the colonic mobility in patient with constipation. Methods: Colonic transit time was measured in 11 female patients with slow-transit constipation using both radiopaque markers and barium suspension method. In radiopaque markers method, the patient ingested 20 markers on the first day, and an abdominal radiograph was performed every 24 h until 80% markers were excreted. In barium suspension method, the patient swallowed up to 50 ml of 200% (w/v) barium meal. The abdominal radiographs were taken at the same time point as the former. Results: The total or segmental colonic transit time were obviously prolonged in all patients. Segmental transits time spent in the right colon, left colon and rectosigmoid for radiopaque markers and barium suspension method was, respectively, 30 ± 6 h and 34 ± 7 h; 38 ± 9 h and 32 ± 6 h; 40 ± 8 h and 38 ± 10 h. In the radiopaque markers method, total colonic transit time was 108 ± 14 h and it was 103 ± 13 h in the barium suspension method (P > 0.05). Conclusion: The barium suspension and radiopaque markers gave the similar results for colonic transit time. The barium suspension was a simple and cheap method for evaluating the colonic mobility.
13 CFR 134.407 - Evidence beyond the record and discovery.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence beyond the record and discovery. 134.407 Section 134.407 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF..., the Administrative Law Judge may not admit evidence beyond the written administrative record nor...
32 CFR 13.4 - Duties and responsibilities of the defense.
2010-07-01
... COMMISSIONS RESPONSIBILITIES OF THE CHIEF DEFENSE COUNSEL, DETAILED DEFENSE COUNSEL, AND CIVILIAN DEFENSE COUNSEL § 13.4 Duties and responsibilities of the defense. (a) Regular duties. The Defense shall perform... 32 National Defense 1 2010-07-01 2010-07-01 false Duties and responsibilities of the defense. 13.4...
Stage dependent expression and tumor suppressive function of FAM134B (JK1) in colon cancer.
Islam, Farhadul; Gopalan, Vinod; Wahab, Riajul; Smith, Robert A; Qiao, Bin; Lam, Alfred King-Yin
2017-01-01
The aims of the present study are to investigate sub-cellular location, differential expression in different cancer stages and functional role of FAM134B in colon cancer development. FAM134B expression was studied and quantified at protein and mRNA levels in cell lines using immunocytochemistry, Western blot and real-time PCR. In vitro functional assays and an in vivo xenotransplantation mouse models were used to investigate the molecular role of FAM134B in cancer cell biology in response to FAM134B silencing with shRNA lentiviral particles. FAM134B protein was noted in both cytoplasm and nuclei of cancer cells. In cancer cells derived from stage IV colon cancer, FAM134B expression was remarkably reduced when compared to non-cancer colon cells and cancer cells derived from stage II colon cancer. FAM134B knockdown significantly (P colon cancer cells following lentiviral transfection. Furthermore, FAM134B suppression significantly increased (34-52%; P cancer suppressor gene in colon cancer. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
40 CFR 61.134 - Standard: Naphthalene processing, final coolers, and final-cooler cooling towers.
2010-07-01
... coolers, and final-cooler cooling towers. 61.134 Section 61.134 Protection of Environment ENVIRONMENTAL... Standard: Naphthalene processing, final coolers, and final-cooler cooling towers. (a) No (“zero”) emissions are allowed from naphthalene processing, final coolers and final-cooler cooling towers at coke by...
10 CFR 60.134 - Design of seals for shafts and boreholes.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Design of seals for shafts and boreholes. 60.134 Section....134 Design of seals for shafts and boreholes. (a) General design criterion. Seals for shafts and... closure. (b) Selection of materials and placement methods. Materials and placement methods for seals shall...
13 CFR 134.711 - Will the Judge permit discovery and oral hearings?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Will the Judge permit discovery and oral hearings? 134.711 Section 134.711 Business Credit and Assistance SMALL BUSINESS...
13 CFR 134.712 - What are the limitations on new evidence?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the limitations on new evidence? 134.712 Section 134.712 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
13 CFR 134.705 - What are the requirements for an appeal petition?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for an appeal petition? 134.705 Section 134.705 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...
13 CFR 134.714 - When must the Judge issue his or her decision?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must the Judge issue his or her decision? 134.714 Section 134.714 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...
13 CFR 134.709 - When will a Judge dismiss an appeal?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When will a Judge dismiss an appeal? 134.709 Section 134.709 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
13 CFR 134.706 - What are the service and filing requirements?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the service and filing requirements? 134.706 Section 134.706 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
13 CFR 134.708 - What is the standard of review?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What is the standard of review? 134.708 Section 134.708 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
13 CFR 134.715 - Can a Judge reconsider his decision?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Can a Judge reconsider his decision? 134.715 Section 134.715 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF....715 Can a Judge reconsider his decision? (a) The Judge may reconsider an appeal decision within 20...
27 CFR 17.134 - Determination of unfitness for beverage purposes.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Determination of unfitness for beverage purposes. 17.134 Section 17.134 Alcohol, Tobacco Products and Firearms ALCOHOL AND... an alcoholic concentration of 15% and tasted. Sale or use for beverage purposes is indicative of...
Laser-Induced Fluorescence diagnostic of barium ion plasmas in the Paul Trap Simulator Experiment
International Nuclear Information System (INIS)
Chung, Moses; Gilson, Erik P.; Davidson, Ronald C.; Efthimion, Philip C.; Majeski, Richard; Startsev, Edward A.
2005-01-01
The Paul Trap Simulator Experiment (PTSX) is a cylindrical Paul trap whose purpose is to simulate the nonlinear dynamics of intense charged particle beam propagation in alternating-gradient magnetic transport systems. To investigate the ion plasma microstate in PTSX, including the ion density profile and the ion velocity distribution function, a laser-induced fluorescence diagnostic system is being developed as a nondestructive diagnostic. Instead of cesium, which has been used in the initial phase of the PTSX experiment, barium has been selected as the preferred ion for the laser-induced fluorescence diagnostic. A feasibility study of the laser-induced fluorescence diagnostic using barium ions is presented with the characterization of a tunable dye laser. The installation of the barium ion source and the development of the laser-induced fluorescence diagnostic system are also discussed
CuO and Ag2O effect on electrical properties of barium vanadate glasses
International Nuclear Information System (INIS)
Bogomolova, L.D.; Glasova, M.N.; Kalygina, V.M.; Spasibkina, S.N.; Khorikov, A.A.
1987-01-01
Effect of CuO on barium vanadate glass (BVG) conductivity on direct and alternating currents in the frequency range (10 2 -10 4 )Hz has been studied. Effect of Ag 2 O has been also studied for comparison, as Ag and Cu have idendical structure of external electron shells (d 10 , S 1 ). CuO introduction to binary barium vanadate glasses as a modificator results in the conductivity improvement on direct and alternating currents conditioned with reducing activation energy of small radius polaron jump, apparently, owing to exchange (ferromagnetic) interaction between V(IV) and Cu(II). Jump activation energy in barium vanadate glasses with Ag 2 O increases and conductivity drops due to the distance increase between vanadium atoms
International Nuclear Information System (INIS)
Gelfand, D.W.; Chen, Y.M.; Ott, D.J.; Munitz, H.A.
1986-01-01
Single-contrast studies account for 75% of barium enema examinations and are often performed in the elderly. By optimizing all factors, the following results were obtained: for polyps of less than 1 cm, 40 of 57 were detected (sensitivity, 70.2%); for polyps of 1 cm or larger, 33 of 35 were detected (sensitivity, 94%). Overall, 73 of 92 polyps were detected (sensitivity, 79.3%). These sensitivities result from meticulous preparation and the use of compression filming, low-density barium, moderate kilovoltages, high-resolution screens, remote control apparatus, and high-bandpass TV fluoroscopy. The authors conclude that an optimal single-contrast barium enema examination detects colonic polyps with a sensitivity approaching that of the double-contrast study and may be employed in elderly patients who cannot undergo the double-contrast study
Double contrast with technique of Insufflated Barium Meal in the radiological study of the esophagus
International Nuclear Information System (INIS)
Gallina, F.; Piga, V.; Gallina, M.S.
1985-01-01
The results are reported of the esophagus double contrast examination with Insufflated Barium Meal technique as first part of the routine upper digestive system radiological examination. This technique gives good double contrast without those artifacts using effervescent powders and without modifying the normal radiological alimentary tract examination established way. The double contrast is administered by a special container with a built-in mouthpiece which allows the simultaneous ingestion of barium suspension and air. The esophageal mucosa can be examined as far as the distal tract where frequently the barium contrast stops using different techniques. Good results in 90% of patients have been obtained. The early detection of inflammatory and tumoral lesions has taken particular advantage in patients sometimes asymptomatic
International Nuclear Information System (INIS)
Anderson, W.; Harthill, J.E.; James, W.B.; Montgomery, D.
1980-01-01
Physical properties relevant to upper gastrointestinal radiology have been compared for five barium sulphate preparations and related to radiographic results. Evaluation of particles (size and stability) and whole suspension (dispersibility and fluidity) resulted in ranking of the preparations generally in accord with that based on radiological experience in double contrast examinations of the stomach. Experiments with extirpated pig stomach revealed a tendency for large particles in a low viscosity barium sulphate suspension to settle in mucosal grooves. This is believed to contribute to good radiographic definition of both the areae gastricae and small lesions. Particle size is therefore important and susceptibility to flocculation, a possible cause of random change in size during use, was assessed by measuring particle electrophoretic mobility under varying conditions; quantitative differences in suspension flow and dispersibility were also demonstrated. Fluidity and dispersibility together with rapid sedimentation of suitably sized particles resistant to flocculation underlie the successful use of low viscosity high density barium sulphate suspensions. (U.K.)
Imaging diagnosis--duodenobiliary reflux of barium sulfate during esophagogastrography in a dog.
Shaikh, Layla; Sharma, Ajay; Secrest, Scott
2015-01-01
A 4-year-old Australian cattle dog presented for regurgitation, 2 months after duodenal resection and anastomosis for a perforated duodenal ulcer. Duodenobiliary reflux of barium sulfate suspension was detected during fluoroscopic esophagogastrography. Follow-up radiography 2 hours later demonstrated persistence of the barium in the gallbladder and biliary tree. Ultrasonography showed an open sphincter of Oddi but no other morphological abnormalities with the gallbladder or biliary system. No side effects or bloodwork abnormalities were noted. This is the first case report of duodenobiliary reflux of barium in a dog. The pathophysiology of this phenomenon and its incidence and significance in human medicine are discussed. © 2014 American College of Veterinary Radiology.
Double contrast with technique of Insufflated Barium Meal in the radiological study of the esophagus
Energy Technology Data Exchange (ETDEWEB)
Gallina, F; Piga, V; Gallina, M.S. and others
1985-01-01
The results are reported of the esophagus double contrast examination with Insufflated Barium Meal technique as first part of the routine upper digestive system radiological examination. This technique gives good double contrast without those artifacts using effervescent powders and without modifying the normal radiological alimentary tract examination established way. The double contrast is administered by a special container with a built-in mouthpiece which allows the simultaneous ingestion of barium suspension and air. The esophageal mucosa can be examined as far as the distal tract where frequently the barium contrast stops using different techniques. Good results in 90% of patients have been obtained. The early detection of inflammatory and tumoral lesions has taken particular advantage in patients sometimes asymptomatic.
The reaction between barium and nitrogen in liquid sodium: resistivity studies
International Nuclear Information System (INIS)
Addison, C.C.; Creffield, G.K.; Hubberstey, P.; Pulham, R.J.
1976-01-01
The reaction of nitrogen with solutions of barium (between 0.34 and 6.89 mol % Ba) in liquid sodium at 573 K has been followed by changes in the electrical resistivity of the liquid. The capillary method has been employed, continuous sampling during reaction being achieved by electromagnetic pumping. The initial solution of nitrogen in the metal, followed by precipitation of barium and nitrogen from sodium as the nitride Ba 2 N, are reflected in the resistivity changes. The solubility of nitrogen in the alloy is a linear function of the barium concentration: S(mol % N) = x/4 (0 <= x <= 6.89 mol % Ba). This and the decrease in resistivity which invariably occurs during the solution process, provides additional information on the nature of solvation of nitrogen in solution in the liquid metal. (author)
International Nuclear Information System (INIS)
Baştürka, Emre; Madakbaş, Seyfullah; Kahraman, Memet Vezir
2016-01-01
In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)
Observation of a barium xenon exciplex within a large argon cluster.
Briant, M; Gaveau, M-A; Mestdagh, J-M
2010-07-21
Spectroscopic measurements provide fluorescence and excitation spectra of a single barium atom codeposited with xenon atoms on argon clusters of average size approximately 2000. The spectra are studied as a function of the number of xenon atoms per cluster. The excitation spectrum with approximately 10 xenon atoms per cluster is qualitatively similar to that observed when no xenon atom is present on the cluster. It consists of two bands located on each side of the 6s6p (1)P-6s(2) (1)S resonance line of the free barium. In contrast, the fluorescence spectrum differs qualitatively since a barium-xenon exciplex is observed, which has no counterpart in xenon free clusters. In particular an emission is observed, which is redshifted by 729 cm(-1) with respect to the Ba(6s6p (1)P-6s(2) (1)S) resonance line.
Energy Technology Data Exchange (ETDEWEB)
Baştürka, Emre; Madakbaş, Seyfullah; Kahraman, Memet Vezir, E-mail: smadakbas@marmara.edu.tr [Department of Chemistry, Marmara University, Istanbul (Turkey)
2016-03-15
In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)
Measurements of barium photocathode quantum yields at four excimer laser wavelengths
International Nuclear Information System (INIS)
Van Loy, M.D.; Young, A.T.; Leung, K.N.
1992-06-01
The electron quantum yields from barium cathodes excited by excimer laser radiation at 193, 248, 308, and 351 nm have been determined. Experiments with different cathode surface preparation techniques reveal that deposition of barium film a few microns thick on a clean copper surface under moderate vacuum conditions achieves relatively high quantum efficiencies. Quantum yields measured from surfaces prepared in this manner are 2.3 x 10 -3 at 193 nm, 7.6 x 10 - 4 at 248 nm, 6.1 x 10 -4 at 308 nm, and 4.0 x 10 -4 at 351 nm. Other preparation techniques, such as laser cleaning of a solid barium surface, produced quantum yields that were at least an order of magnitude lower than these values
SAD phasing with in-house cu Ka radiation using barium as anomalous scatterer.
Dhanasekaran, V; Velmurugan, D
2011-12-01
Phasing of lysozyme crystals using co-crystallized barium ions was performed using single-wavelength anomalous diffraction (SAD) method using Cu Ka radiation with in-house source of data collection. As the ion binding sites vary with respect to the pH of the buffer during crystallization, the highly isomorphic forms of lysozyme crystals grown at acidic and alkaline pH were used for the study. Intrinsic sulphur anomalous signal was also utilized with anomalous signal from lower occupancy ions for phasing. The study showed that to solve the structure by SAD technique, 2.8-fold data redundancy was sufficient when barium was used as an anomalous marker in the in-house copper X-ray radiation source for data collection. Therefore, co-crystallization of proteins with barium containing salt can be a powerful tool for structure determination using lab source.
Energy Technology Data Exchange (ETDEWEB)
Liu, D. [Department of Mechanical Engineering, University of Houston, 4800 Calhoun Road, Houston, TX 77204 (United States)]. E-mail: duo.liu@mail.uh.edu; Chelf, M. [Department of Mechanical Engineering, University of Houston, 4800 Calhoun Road, Houston, TX 77204 (United States); White, K.W. [Department of Mechanical Engineering, University of Houston, 4800 Calhoun Road, Houston, TX 77204 (United States)
2006-10-15
The plastic behaviors of barium titanate (001) and (110) single crystals are studied with atomic force microscopy and piezoresponse force microscopy (PFM) following nanoindendation damage. Plastic deformation mechanisms of ferroelectric barium titanate single crystals are discussed with a focus on the interaction between PFM response and dislocation activities. Nanoindentation tests indicate that the theoretical strength is approached prior to the first pop-in event, consistent with the creation of dislocation nucleation sites required for the onset of plasticity. Surface topographic and piezoelectric analyses indicate that pile-ups around indents result from dislocation activities on the primary slip system, {l_brace}110{r_brace}{sub pc}<11-bar 0>{sub pc}. The more complex indentation-induced domain patterns observed on (110) barium titanate are also discussed.
International Nuclear Information System (INIS)
Liu, D.; Chelf, M.; White, K.W.
2006-01-01
The plastic behaviors of barium titanate (001) and (110) single crystals are studied with atomic force microscopy and piezoresponse force microscopy (PFM) following nanoindendation damage. Plastic deformation mechanisms of ferroelectric barium titanate single crystals are discussed with a focus on the interaction between PFM response and dislocation activities. Nanoindentation tests indicate that the theoretical strength is approached prior to the first pop-in event, consistent with the creation of dislocation nucleation sites required for the onset of plasticity. Surface topographic and piezoelectric analyses indicate that pile-ups around indents result from dislocation activities on the primary slip system, {110} pc pc . The more complex indentation-induced domain patterns observed on (110) barium titanate are also discussed
Huelga-Suarez, Gonzalo; Moldovan, Mariella; Garcia-Valiente, America; Garcia-Vazquez, Eva; Alonso, J Ignacio Garcia
2012-01-03
The present study focuses on the development and evaluation of an individual-specific transgenerational marking procedure using two enriched barium isotopes, (135)Ba and (137)Ba, mixed at a given and selectable molar ratio. The method is based on the deconvolution of the isotope patterns found in the sample into four molar contribution factors: natural xenon (Xe nat), natural barium (Ba nat), Ba135, and Ba137. The ratio of molar contributions between Ba137 and Ba135 is constant and independent of the contribution of natural barium in the sample. This procedure was tested in brown trout ( Salmo trutta ) kept in captivity. Trout were injected with three different Ba137/Ba135 isotopic signatures ca. 7 months and 7 days before spawning to compare the efficiency of the marking procedure at long and short term, respectively. The barium isotopic profiles were measured in the offspring by means of inductively coupled plasma mass spectrometry. Each of the three different isotopic signatures was unequivocally identified in the offspring in both whole eggs and larvae. For 9 month old offspring, the characteristic barium isotope signatures could also be detected in the otoliths even in the presence of a high and variable amount of barium of natural isotope abundance. In conclusion, it can be stated that the proposed dual-isotope marking is inheritable and can be detected after both long-term and short-term marking. Furthermore, the dual-isotope marking can be made individual-specific, so that it allows identification of offspring from a single individual or a group of individuals within a given fish group. © 2011 American Chemical Society
How does esophagus look on barium esophagram in pediatric eosinophilic esophagitis?
Al-Hussaini, Abdulrahman; AboZeid, Amany; Hai, Abdul
2016-08-01
The clinical, endoscopic, and histologic findings of eosinophilic esophagitis (EoE) are well characterized; however, there have been very limited data regarding the radiologic findings of pediatric EoE. We report on the radiologic findings of pediatric EoE observed on barium esophagram and correlate them with the endoscopic findings. We identified children diagnosed with EoE in our center from 2004 to 2015. Two pediatric radiologists met after their independent evaluations of each fluoroscopic study to reach a consensus on each case. Clinical and endoscopic data were collected by retrospective chart review. Twenty-six pediatric EoE cases (age range 2-13 years; median 7.5 years) had barium esophagram done as part of the diagnostic approach for dysphagia. Thirteen children had abnormal radiologic findings of esophagus (50%): rings formation (n = 4), diffuse irregularity of mucosa (n = 8), fixed stricture formation (n = 3), and narrow-caliber esophagus (n = 10). Barium esophagram failed to show one of 10 cases of narrow-caliber esophagus and 10 of 14 cases of rings formation visualized endoscopically. The mean duration of symptoms prior to diagnosis of EoE was longer (3.7 vs. 1.7 year; p value 0.019), and the presentation with intermittent food impaction was commoner in the group with abnormal barium esophagram as compared to the group with normal barium esophagram (69% vs. 8%; p value 0.04). Barium swallow study is frequently normal in pediatric EoE. With the exception of narrow-caliber esophagus, our data show poor correlation between radiologic and endoscopic findings.
Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea
International Nuclear Information System (INIS)
Zhu Cong; Guo Jiangfeng
2008-01-01
Deinococcus radiodurans was inoculated into the soil which was spiked with 134 Cs to investigate its effect on chemical speciation of 134 Cs. The relationship between chemical speciation of 134 Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134 Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134 Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)
134Cs in heather seed plants grown with and without mycorrhiza
International Nuclear Information System (INIS)
Strandberg, M.; Johansson, M.
1988-01-01
Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of 134 Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of 134 Cs to the shoots than heather without mycorrhiza. As an average the concentration of 134 Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of 134 Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of 134 Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)
{sup 134}Cs in heather seed plants grown with and without mycorrhiza
Energy Technology Data Exchange (ETDEWEB)
Strandberg, M. [Risoe National Laboratory, DK-4000 Roskilde (Denmark); Johansson, M. [Department of Mycology, Botanical Institute, University of Copenhagen, Oester Farimagsgade 2D, DK-1353 Copenhagen K. (Denmark)
1988-08-01
Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of {sup 134}Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of {sup 134}Cs to the shoots than heather without mycorrhiza. As an average the concentration of {sup 134}Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of {sup 134}Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of {sup 134}Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)
Choi, Mihyun; Lee, Namsoon; Kim, Junyoung; Yi, Kangjae; Jung, Joohyun; Yoon, Junghee; Choi, Mincheol
2011-01-01
A modified double contrast barium enema using carboxymethylcellulose was evaluated in beagle dogs and compared with dogs receiving a conventional barium enema. The experimental group was divided into three groups (1, 2, and 3) and given 30 ml/kg of different volume ratios of a barium vs. carboxymethylcellulose mixture. Each group underwent sonography following radiography. The volume ratio of one part barium to three parts carboxymethylcellulose was judged to be the optimal mixture, resulting in a general distribution of contrast and bowel radiolucency on radiographs and adequate postradiography sonography. The modified barium enema using carboxymethylcellulose is useful for assessing the general morphology and mucosal layers of the colon simultaneously on radiographs and ultrasonographs.
Production of autoionizing di-excited states of barium with high angular momentum
International Nuclear Information System (INIS)
Roussel, F.; Breger, P.; Gounand, F.; Spiess, G.
1988-01-01
Autoionizing di-excited states Ba(6p 1/2 27l) with 7 ≤l≤26, have been experimentally detected. They have been produced by a method combining excitation by two lasers and l-mixing collisions between barium and xenon. Results show that a long delay between the two laser excitation steps is favourable to the production of these states. The method has proved to be very efficient (measured cross-section: σ = 3.1 . 10 -13 cm 2 ) for populating high-angular-momentum autoionizing states of barium
Synthesis and characterization of nickel oxide doped barium strontium titanate ceramics
Energy Technology Data Exchange (ETDEWEB)
Banerjee, M. [Dept. of Electrical Engineering, Bengal Institute of Technology Kolkata (India); Mukherjee, S. [Dept. of Metallurgical Engineering, Jadavpur University, Kolkata (India); Maitra, S. [Govt. College of Engg. and Ceramic Technology, Kolkata (India)
2012-01-15
Barium strontium titanate (BST) ceramics (Ba{sub 0.6}Sr{sub 0.4})TiO{sub 3} were synthesized by solid state sintering using barium carbonate, strontium carbonate and rutile as the precursor materials. The samples were doped with nickel oxide in different proportions. Different phases present in the sintered samples were determined from X-ray diffraction investigation and the distribution of different phases in the microstructure was assessed from scanning electron microscopy study. It was observed that the dielectric properties of BST were modified significantly with nickel oxide doping. These ceramics held promise for applications in tuned circuits. (author)
Mapping of strain mechanisms in barium titanate by three-dimensional X-ray diffraction
DEFF Research Database (Denmark)
Majkut, Marta
This thesis presents an in-situ three-dimensional study of the grain-scale response of a prototypical piezoelectric ceramic, barium titanate (BT), to an exernally applied electric field. Piezoceramics take advantage of the coupling of electrical and mechanical energies for use in sensors and actu......This thesis presents an in-situ three-dimensional study of the grain-scale response of a prototypical piezoelectric ceramic, barium titanate (BT), to an exernally applied electric field. Piezoceramics take advantage of the coupling of electrical and mechanical energies for use in sensors...
Effect of mucolytic pretreatment on gastric mucosal coating with barium sulfate in the rat
International Nuclear Information System (INIS)
Lindgren, I.; Nevalainen, T.; Maeki, J.; Soederstroem, K.-O.
1980-01-01
Freshly prepared isolated rat stomachs were used to examine the adherence of barium sulfate particles to the mucosal surface by scanning electron microscopy. The stomachs were pretreated with sodium bicarbonate alone or in connection with N-acetyl-L-cysteine and then treated with barium sulfate specially designed for double contrast examination of the stomach. The best adhesion of the contrast medium was obtained when the mucosa was pretreated with both the alkaline and mucolytic agent indicating that, for the optimum adherence of the contrast medium, the mucosal surface must be as clean as possible. (Auth.)
International Nuclear Information System (INIS)
Manfredini, J.P.; Paulin Filho, P.I.; Gheno, S.M.
2011-01-01
A composition of PTCR ceramic based in barium titanate with isovalent replacement of part of barium by strontium using lanthanum and manganese as additives was investigated. The transition temperature, typical of these materials, was shifted below the room temperature by the presence of strontium, whose behavior was detected by tests of DC resistivity and impedance spectroscopy. The observation of potential barriers at grain boundaries was possible through the technique of electrostatic force microscopy (EFM). The results also showed the presence of space charges in regions inside grains, possibly at subgrain boundaries. (author)
H- Enhancement Process in a Multicusp Ion Source Operated with a Barium Insert Structure
Energy Technology Data Exchange (ETDEWEB)
Leung, K.N.; Van Os, C.F.A.; Kunkel, W.B.
1990-05-01
It has been demonstrated that the H{sup -} output current from a small multicusp source can be substantially enhanced if the hydrogen plasma is seeded with barium. Operating with a barium washer insert at the extraction aperture, it is found that the extractable H{sup -} current is increased by a factor of three if the insert bias potential is optimized. By use of a mixture of xenon and hydrogen gas, it is further demonstrated that the positive hydrogen ions are responsible for the observed H{sup -} enhancement.
Elevated Z line: a new sign of Barrett's esophagus on double-contrast barium esophagograms.
Levine, Marc S; Ahmad, Nuzhat A; Rubesin, Stephen E
2015-01-01
We describe an elevated Z line as a new radiographic sign of Barrett's esophagus characterized by a transversely oriented, zigzagging, barium-etched line extending completely across the circumference of the midesophagus. An elevated Z line is rarely seen in other patients, so this finding should be highly suggestive of Barrett's esophagus on double-contrast barium esophagograms. If the patient is a potential candidate for surveillance, endoscopy and biopsy should be performed to confirm the presence of Barrett's esophagus. Copyright © 2015 Elsevier Inc. All rights reserved.
M series resonant x-ray lines of barium for near threshold electron excitation
International Nuclear Information System (INIS)
Morgon, D.V.
1992-01-01
An investigation of the M series resonant x-ray emission lines of barium for near threshold electron excitation was undertaken with a vacuum double crystal spectrometer equipped with potassium acid phthalate crystals. X-ray continuum isochromats were obtained for barium samples using the double crystal spectrometer as a monochrometer set to pass 532 eV photons. The rotatable anode allowed the samples to be observed by either the double crystal spectrometer or a soft x-ray appearance potential spectrometer, which was used for monitoring the surface of the varium sample for contamination, and to provide a cross-check for the double crystal spectrometer data. Barium M series characteristic x-ray spectra for 2.0 keV electron excitation were obtained for a variety of samples, and it was discovered that the fluorescent and resonant x-ray emission line energies remained virtually the same, regardless of the chemical condition of the sample. The continuum resonance effect was observed for near-threshold energy electron excitation, but it was significantly weaker than the same effect observed previously for lanthanum or cerium. The electron excitation energy and intensity of this effect were strongly dependent on the chemical condition of the barium sample. X-ray continuum isochromats were observed for pure and contaminated barium samples at a photon energy of 532 eV. For pure metallic barium, a peak associated with 4f electronic states was observed at an energy of about 10.2 eV above the Fermi level. When the sample was exposed to 1.5 x 10 4 Langmuir of air, the 4f structure became more sharply peaked, and shifted to an energy of about 12.0 eV above the Fermi level. A continuum isochromat of barium oxide was also observed. Chemical shifts in barium M IV and M V appearance potential spectra are therefore caused soley by shifts in the energy position of the empty 4f electronic states relative to the Fermi level
Environmental consequences of the placement of radium-barium sludge in tailings areas
International Nuclear Information System (INIS)
Huck, P.M.; Brown, J.R.; Multimaki, G.; Murphy, K.L.
1982-01-01
A preliminary evaluation was made of the implications of placing radium-barium sludge in tailings areas. The study was restricted to a consideration of possible increases in the quantities of radionuclides escaping to the environment through either groundwater or surface water, considering the types of tailings treated and the effluent treatment systems currently operating in Canada. It was concluded that the placement of radium/barium sludge in tailings areas should not adversely affect the long-term stability of the radionuclides in the tailings or sludge, based on geochemical inorganic reactions
Energy Technology Data Exchange (ETDEWEB)
Lee, Nyoung Keun; Park, Chang Min; Kang, Chang Hyun; Jeon, Yoon Kyung; Choo, Ji Yung; Lee, Hyun Ju; Goo, Jin Mo [Seoul National University College of Medicine, Seoul (Korea, Republic of)
2012-11-15
To describe our initial experience with CT-guided percutaneous barium marking for the localization of small pulmonary nodules prior to video-assisted thoracoscopic surgery (VATS). From October 2010 to April 2011, 10 consecutive patients (4 men and 6 women; mean age, 60 years) underwent CT-guided percutaneous barium marking for the localization of 10 small pulmonary nodules (mean size, 7.6 mm; range, 3-14 mm): 6 pure ground-glass nodules, 3 part-solid nodules, and 1 solid nodule. A 140% barium sulfate suspension (mean amount, 0.2 mL; range, 0.15-0.25 mL) was injected around the nodules with a 21-gauge needle. The technical details, surgical findings and pathologic features associated with barium localizations were evaluated. All nodules were marked within 3 mm (mean distance, 1.1 mm; range, 0-3 mm) from the barium ball (mean diameter, 9.6 mm; range, 8-16 mm) formed by the injected barium suspension. Pneumothorax occurred in two cases, for which one needed aspiration. However, there were no other complications. All barium balls were palpable during VATS and visible on intraoperative fluoroscopy, and were completely resected. Both the whitish barium balls and target nodules were identifiable in the frozen specimens. Pathology revealed one invasive adenocarcinoma, five adenocarcinoma-in-situ, two atypical adenomatous hyperplasias, and two benign lesions. In all cases, there were acute inflammations around the barium balls which did not hamper the histological diagnosis of the nodules. CT-guided percutaneous barium marking can be an effective, convenient and safe pre-operative localization procedure prior to VATS, enabling accurate resection and diagnosis of small or faint pulmonary nodules.
International Nuclear Information System (INIS)
Shin, Ji Hoon; Ha, Hyun Kwon; Park, Sung Tae; Yoon, Soo Woong; Kim, Ho Sung; Kim, Sun Mi
1998-01-01
To compare modified small bowel follow-through (SBFT) using methylcellulose after the administration of barium suspension with a conventional series. Materials and Methods : In order to evaluate small bowel pathology, modified SBFT was performed in 155 patients during a 15 month period. All patients received 600 mL of methylcellulose ; 98 had taken 250 mL of 40% wt/vol barium suspension and 57 had taken 150 mL of 70% barium. For the group of 98, the barium suspension was prepared by mixing barium powder with water (n=46) or with methylcellulose in(n=52). For comparison with a modified series, 49 patients who underwent conventional SBFT using 500 mL of 40 %wt/vol barium were lso included. Image quality was rated by three radiologists as p oor , f air , g ood , or e xcellent . We analyzed the relationship between image quality, transit time and small bowel pathology;the sensitivity and specificity of each technique was also determined. Results : Among the four techniques, modified SBFT with 250 mL of 40% wt/vol barium suspension, prepared by mixing barium powder with methylcellulose, showed the best image quality ['excellent' result in 33 of the 52 patients (63%)] and shortest transit time to the cecum. The high image quality of this technique was not affected by the presence of small bowel pathology;its use resulted in the lowest incidence and slowest development of flocculation. The sensitivity (91-95%) of the three modified SBFT procedures was superior to that of a conventional series(76%), but there was no difference in specificity.Conclusion : Modified SBFT using methylcellulose after administering barium suspension with barium powder as a mixing agent is a simple technique. Its use easily improves the image quality and diagnostic accuracy of peroral SBFT
International Nuclear Information System (INIS)
Lee, Nyoung Keun; Park, Chang Min; Kang, Chang Hyun; Jeon, Yoon Kyung; Choo, Ji Yung; Lee, Hyun Ju; Goo, Jin Mo
2012-01-01
To describe our initial experience with CT-guided percutaneous barium marking for the localization of small pulmonary nodules prior to video-assisted thoracoscopic surgery (VATS). From October 2010 to April 2011, 10 consecutive patients (4 men and 6 women; mean age, 60 years) underwent CT-guided percutaneous barium marking for the localization of 10 small pulmonary nodules (mean size, 7.6 mm; range, 3-14 mm): 6 pure ground-glass nodules, 3 part-solid nodules, and 1 solid nodule. A 140% barium sulfate suspension (mean amount, 0.2 mL; range, 0.15-0.25 mL) was injected around the nodules with a 21-gauge needle. The technical details, surgical findings and pathologic features associated with barium localizations were evaluated. All nodules were marked within 3 mm (mean distance, 1.1 mm; range, 0-3 mm) from the barium ball (mean diameter, 9.6 mm; range, 8-16 mm) formed by the injected barium suspension. Pneumothorax occurred in two cases, for which one needed aspiration. However, there were no other complications. All barium balls were palpable during VATS and visible on intraoperative fluoroscopy, and were completely resected. Both the whitish barium balls and target nodules were identifiable in the frozen specimens. Pathology revealed one invasive adenocarcinoma, five adenocarcinoma-in-situ, two atypical adenomatous hyperplasias, and two benign lesions. In all cases, there were acute inflammations around the barium balls which did not hamper the histological diagnosis of the nodules. CT-guided percutaneous barium marking can be an effective, convenient and safe pre-operative localization procedure prior to VATS, enabling accurate resection and diagnosis of small or faint pulmonary nodules.
Richey, J. N.; Reynolds, C. E.; Fehrenbacher, J. S.
2017-12-01
The Ba/Ca of planktic foraminifera in marine sediment cores has been used primarily to track changes in riverine input over time, and thus may be a potentially powerful proxy for reconstructing past changes in the terrestrial hydrologic cycle. Using Ba/Ca as a proxy for riverine freshwater input requires the assumption that Ba/Ca in foraminiferal calcite reflects the Ba/Ca of seawater, and that the partition coefficient for barium between seawater and foraminiferal calcite is independent of the influence of temperature, salinity, pH, alkalinity and light availability. Although it has been shown that this partition coefficient is nearly identical for common species of spinose planktic foraminifera (e.g., Globigerinoides ruber, Orbulina universa, Globigerinoides sacculifer), some non-spinose species have been demonstrated to have Ba/Ca ratios that are much higher than that of co-occurring spinose specimens. We investigate environmental controls on Ba/Ca in the tests of Globorotalia truncatulinoides, a planktic species of foraminifera with a unique life history in the Gulf of Mexico (GoM). G. truncatulinoides experiences 92% of its annual flux to the sediment trap during winter (JFM) in the GoM. The Mg/Ca and ∂18O of the ontogenetic calcite suggests that primary calcification occurs within the surface mixed layer (0-150 meters), and a thick secondary crust is added at depths below the thermocline. We use LA-ICP-MS to analyze the Ba/Ca of both encrusted and non-encrusted G. truncatulinoides from a sediment trap time series in the GoM and find that the Ba/Ca in ontogenetic calcite of non-encrusted specimens varies between 10 and 200 mmol/mol, while the Ba/Ca of the secondary crust varies between 0 and 3 mmol/mol. The Ba/Ca of the non-encrusted G. truncatulinoides specimens is two to three orders of magnitude higher than that of co-occurring spinose planktic foraminifera (O. universa and G. ruber) in the GoM sediment trap, while the secondary crust has Ba/Ca similar to
Synthesis and colloidal properties of anisotropic hydrothermal barium titanate
Yosenick, Timothy James
2005-11-01
Nanoparticles of high dielectric constant materials, especially BaTiO3, are required to achieve decreased layer thickness in multilayer ceramic capacitors (MLCCs). Tabular metal nanoparticles can produce thin metal layers with low surface roughness via electrophoretic deposition (EPD). To achieve similar results with dielectric layers requires the synthesis and dispersion of tabular BaTiO3 nanoparticles. The goal of this study was to investigate the deposition of thin BaTiO3 layers using a colloidal process. The synthesis, interfacial chemistry and colloidal properties of hydrothermal BaTiO3 a model particle system, was investigated. After characterization of the material system particulates were deposited to form thin layers using EPD. In the current study, the synthesis of BaTiO3 has been investigated using a hydrothermal route. TEM and AFM analyses show that the synthesized particles are single crystal with a majority of the particle having a zone axis and {111} large face. The particles have a median thickness of 5.8 +/- 3.1 nm and face diameter of 27.1 +/- 12.3 nm. Particle growth was likely controlled by the formation of {111} twins and the synthesis pH which stabilizes the {111} face during growth. With limited growth in the direction, the particles developed a plate-like morphology. Physical property characterization shows the powder was suitable for further processing with high purity, low hydrothermal defect concentration, and controlled stoichiometry. TEM observations of thermally treated powders indicate that the particles begin to loose the plate-like morphology by 900 °C. The aqueous passivation, dispersion, and doping of nanoscale BaTiO 3 powders was investigated. Passivation BaTiO3 was achieved through the addition of oxalic acid. The oxalic acid selectively adsorbs onto the particle surface and forms a chemically stable 2-3 nm layer of barium oxalate. The negative surface charge of the oxalate effectively passivated the BaTiO3 providing a surface
Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J
2012-01-01
Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3).
Rockey, Don C; Koch, Johannes; Yee, Judy; McQuaid, Kenneth R; Halvorsen, Robert A
2004-12-01
The utility of air-contrast barium enema and colonoscopy for evaluation of the colon has been debated. Air-contrast barium enema is less expensive and invasive than colonoscopy, but it also is less sensitive and specific. Further, although air-contrast barium enema may be less painful than colonoscopy, it often is poorly tolerated by patients. Thus, this study compared the sensitivity and the specificity of air-contrast barium enema and colonoscopy for detection of colonic lesions in patients with fecal occult blood. Over a 30-month period, patients with fecal occult blood were recruited. Patients underwent standard air-contrast barium enema, followed by colonoscopy 7 to 14 days later. Colonoscopists were blinded to the results of air-contrast barium enema until the colonoscopy was completed, after which the results were disclosed. If the findings were discrepant, colonoscopy was repeated. A total of 100 patients were evaluated. Nine air-contrast barium enemas were reported to be inadequate, and the cecum was not intubated at colonoscopy in two patients. In the remaining patients, 5 cancers were identified (1 each cecum, transverse colon, descending colon, sigmoid colon, and rectum) by both studies. Sixty-six polypoid lesions were identified in 30 patients. Diverticula were identified in 42 patients by air-contrast barium enema and in 18 patients by colonoscopy. Air-contrast barium enema detected 3 of 36 polypoid lesions 5 mm or less in diameter, 5 of 15 adenomas 6 to 9 mm in size, and 4 of 15 adenomas 10 mm or greater in diameter (sensitivity 8%, 33%, and 27%, respectively). After excluding patients with diverticula, air-contrast barium enema detected 3 of 7 adenomas 10 mm or greater in size. Overall, 12 polypoid lesions or filling defects were identified by air-contrast barium enema that could not be verified by colonoscopy. The specificity of air-contrast barium enema for lesions 1.0 cm or greater in size was 100%; for those 6 mm or greater, it was 97%. Air
Foliar uptake of 134Cs and 85Sr in strawberry as function by leaf age
International Nuclear Information System (INIS)
Fortunati, P.; Brambilla, M.; Speroni, F.; Carini, F.
2004-01-01
In this paper a study of the foliar uptake and translocation of 134 Cs and 85 Sr in a herbaceous fruit plant is presented. In particular, absorption, translocation and loss of these radionuclides in strawberry plants have been studied in relation to the age of contaminated leaves. Strawberry plants were contaminated by distributing droplets of an aqueous solution containing 134 CsCl and 85 SrCl 2 on the surface of two leaves per plant. One half of the plants was contaminated through two young leaves, a second half through two old leaves. Sets of plants were collected 1 day, 7 days and 15 days after contamination. One half of them was rinsed with double distilled water before gamma analysis. Rinsing contaminated leaves removes on average 55% of the applied 134 Cs and 45% of 85 Sr. The activity removed decreases during the 15 days of the experimental study, both for 134 Cs and for 85 Sr, suggesting an increase in foliar absorption during this period. The activity removed does not differ between old and young leaves. 'External loss' is lower for young than old contaminated leaves. 'Internal loss' through translocation occurs mainly for 134 Cs. Translocation coefficients from contaminated leaves to fruits are two orders of magnitude higher for 134 Cs (4.0%), than for 85 Sr (0.05%). Leaf to fruit translocation coefficients for 134 Cs are higher from young leaves (5.8%), than from old leaves (2.3%)
Plant uptake of 134Cs in relation to soil properties and time
International Nuclear Information System (INIS)
Massas, I.; Skarlou, V.; Haidouti, C.
2002-01-01
134 Cs uptake by sunflower and soybean plants grown on seven different soils and its relation to soil properties were studied in a greenhouse pot experiment. Soil in each pot was contaminated by dripping the 134 Cs in layers, and sunflower and soybean plants were grown for three and two successive periods, respectively. 134 Cs plant uptake was expressed as the transfer factor (TF) (Bq kg -1 plant/Bq kg -1 soil) and as the daily plant uptake (flux) (Bq pot -1 day -1 ) taking into account biomass production and growth time. For the studied soils and for both plants, no consistent trend of TFs with time was observed. The use of fluxes, in general, provided less variable results than TFs and stronger functional relationships. A negative power functional relationship between exchangeable potassium plus ammonium cations expressed as a percentage of cation exchange capacity of each soil and 134 Cs fluxes was found for the sunflower plants. A similar but weaker relationship was observed for soybean plants. The significant correlation between sunflower and soybean TFs and fluxes, as well as the almost identical highest/lowest 134 Cs flux ratios, in the studied soils, indicated a similar effect of soil characteristics on 134 Cs uptake by both plants. In all the studied soils, sunflower 134 Cs TFs and fluxes were significantly higher than the respective soybean values, while no significant difference was observed in potassium content and daily potassium plant uptake (flux) of the two plants
Energy Technology Data Exchange (ETDEWEB)
Giuliani, G.; Marchesi Donati, F.; Polonara, F. [Ancona Univ. (Italy). Dip. di Energetica; Hewitt, N.J. [University of Ulster at Coleraine, Northern Ireland (United Kingdom). NICERT
1999-09-01
The ability of zeotropic mixtures with a remarkable temperature glide to operate in liquid-recirculation systems is investigated and the results of an experimental comparison between the performances of the pure fluid R134a and the zeotropic mixture R32/134a (25/75% by mass) are presented. R134a performs slightly better in the liquid-recirculation mode than in the traditional dry-expansion mode; on the other hand, liquid-recirculation configuration has a detrimental effect on the zeotropic mixture's performance. The reason for this detrimental effect is the mixture component separation which occurs at the liquid/vapor separator. The effect of this separation is investigated using gas chromatograph analysis.
Rate constants for the reactions of OH with HFC-134a (CF3CH2F) and HFC-134 (CHF2CHF2)
Demore, W. B.
1993-01-01
Measurements of rate constants for HFC-134 (CF2HCF2H) relative to CH3CCl3, HFC-125, and HFC-134a are reported. The measurements were made in a slow-flow, temperature controlled photochemical reactor, and were based on relative rates of disappearance of the parent compounds as measured by FTIR spectroscopy. Hydroxyl radicals were generated by 254-nm photolysis of O3 in the presence of water vapor. NASA/JPL rate constants for the reference compounds are used to derive temperature-dependent rate constants of both compounds. Rate constants obtained from the different reference compounds are in excellent agreement. The presently recommended rate constant for HFC-134a is about 25 percent too high.
Transfer factors of 134Cs for olive and orange trees grown on different soils
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.; Papanicolaou, E.
1999-01-01
Transfer factors (TF) of 134 Cs to olive and citrus trees grown on two different soils, were determined for a 3-year greenhouse experiment. Two-year-old trees were transplanted with their entire rootball into large pots containing the contaminated soil (110 kg pot -1 ). The soil was transferred to each pot in layers on the top of which 134 Cs as CsCl was dripped (18.5 MBq pot -1 ). For both evergreen trees, soil type significantly influenced radiocaesium transfer. 134 Cs concentration was lower for the calcareous-heavy soil than for the acid-light soil. Transfer factors of orange trees were higher than those of olive trees in the acid-light soil. Although a significant amount of 134 Cs was measured in olives grown on the acid-light soil, no 134 Cs was detected in the unprocessed olive oil when an oil fraction (5% f.w.) was extracted. On the contrary the edible part of the oranges showed the highest 134 Cs concentration of all plant parts. The relationship between 134 Cs uptake and potassium content in the different plant compartments was also studied when selected trees were cut down. The potassium concentration in the plants was not significantly different between the trees growing in the two types of soil in spite of the big differences in the 134 Cs uptake in the two soils. TF values and potassium content in the different plant compartments of each tree were highly correlated. For both crops transfer factors as well as potassium content were the highest in the developing plant parts (new leaves and branches, flowers). The transfer factors of 134 Cs for the studied trees are in the same order of magnitude as the values of annual crops grown under similar conditions. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)
2010-06-28
... People's Republic of China: Continuation of Antidumping Duty Order AGENCY: Import Administration... Commission (``ITC'') that revocation of the antidumping duty order on barium chloride from the People's... (``the Act''). See Initiation of Five-year (``Sunset'') Review, 74 FR 31412 (July 1, 2009). As a result...
On film quality in barium-air double contrast colon study
International Nuclear Information System (INIS)
Rhu, Sang Hyung; Rhee, Jae Ho; Kim, Hai Sung; Cheung, Hwan
1984-01-01
The colon double contrast study provides valuable diagnostic information by means of appropriate control of Kvp and mAa when making double contrast image by injecting air into the colon after coating the colon wall by appropriately diluted Barium solution. The following experiments were performed the results of which allowed to improve the quality of film in barium-air double contrast colon study: (1) Do the pictures have uniform density when measured with a densitometer from three measuring points established in the picture by changing Kvp and mAs depending on the thickness of the patient? (2) Is the quality of the picture improved by being compensated from the adjacent area when using a wedge filter in routine check lateral decubitus and erect view? (3) What is the optimum dilution of barium solution which gives the best result for colon wall coating? The above experiments revealed that as the patient's thickness increased, it should be considered to increase mAs as well as Kvp and a wedge filter could give diagnostically very informative pictures in routine-check lateral decubitus and erect view. And 70-80% solution of Barium-water mixture provided the best quality of double contrast image
Pressure derivatives of the second-order elastic constants of strontium, barium, and lead nitrate
International Nuclear Information System (INIS)
Bedi, S.S.; Verma, M.P.
1980-01-01
An interpretation is given of the measured results on the pressure derivatives of second-order elastic constants (SOEC) of strontium barium, and lead nitrate crystallizing in the fluorite type structure from the Lundquist potential. Potential parameters are determined from the experimental values of SOEC and the equilibrium condition
Duplicaat 24 uurs voedingen 1994 - inname aan calcium, magnesium, barium, strontium en mangaan
Loon JW van; Ooik A van; Ritsema R; LAC
1998-01-01
In 1994 zijn 123 duplicaten van 24-uurs voedingen verzameld, gevriesdroogd en nadien onderzocht. Op basis van de analyseresultaten is de dagelijkse inneming aan calcium (Ca), magnesium (Mg), barium (Ba), strontium (Sr) en mangaan (Mn) door evenzovele consumenten van deze voedingen vastgesteld.
BANDWIDTH STUDIES OF AN INJECTION-SEEDED BETA-BARIUM BORATE OPTICAL PARAMETRIC OSCILLATOR
Boonengering, J.M.; van der Veer, W.E.; Gerritsen, J.W.; Hogervorst, W.
1995-01-01
Spectral and temporal properties of a scanning injection-seeded β-barium borate optical parametric oscillator pumped by the third harmonic of a 10-Hz Nd:YAG laser have been studied. The seed source was a cw diode laser with a wavelength of 830 nm tunable over a range of 50 GHz. We measured the
A surface-chemistry study of barium ferrite nanoplates with DBSa-modified surfaces
Energy Technology Data Exchange (ETDEWEB)
Lisjak, Darja, E-mail: darja.lisjak@ijs.si [Jožef Stefan Institute, Ljubljana (Slovenia); Ovtar, Simona; Kovač, Janez [Jožef Stefan Institute, Ljubljana (Slovenia); Gregoratti, Luca; Aleman, Belen; Amati, Matteo [Elettra – Sincrotrone Trieste S.C.p.A. di interesse nazionale, Trieste (Italy); Fanetti, Mattia [University of Nova Gorica, Nova Gorica (Slovenia); Istituto Officina dei Materiali CNR, Area Science Park, Trieste (Italy); Makovec, Darko [Jožef Stefan Institute, Ljubljana (Slovenia)
2014-06-01
Barium ferrite (BaFe{sub 12}O{sub 19}) is a ferrimagnetic oxide with a high magnetocrystalline anisotropy that can be exploited in magnetically aligned ceramics or films for self-biased magnetic applications. Magnetic alignment of the films can be achieved by the directed assembly of barium ferrite nanoplates. In this investigation the nanoplates were synthesized hydrothermally and suspended in 1-butanol using dodecylbenzene sulphonic acid (DBSa) as a surfactant. They were then deposited in an electric or magnetic field on flat substrates and exhibited a significant preferential alignment in the plane of the substrate, allowing a differentiation between the analysis of their basal and side planes using scanning photoelectron microscopy with a lateral resolution down to 100 nm. The surface chemistry of the nanoplates was additionally studied with X-ray photoelectron spectroscopy and time-of-flight secondary ion mass spectrometry. For a comparison, bare barium ferrite nanoplates were also analyzed after decomposing the DBSa at 460 °C. The deviation of the surface chemistry from the stoichiometric composition was observed and the adsorption of the DBSa molecules on the nanoplates was confirmed with all three methods. Different types of bonding (physi- or chemisorption) were possible and considered with respect to the assembly of the barium ferrite nanoplates into anisotropic magnetic films.
Electromechanical Response of Polycrystalline Barium Titanate Resolved at the Grain Scale
DEFF Research Database (Denmark)
Majkut, Marta; Daniels, John E.; Wright, Jonathan P.
2017-01-01
critical for understanding bulk polycrystalline ferroic behavior. Here, three-dimensional X-ray diffraction is used to reconstruct a 3D grain map (grain orientations and neighborhoods) of a polycrystalline barium titanate sample and track the grain-scale non-180° ferroelectric domain switching strains...
A plasmonic modulator based on metal-insulator-metal waveguide with barium titanate core
DEFF Research Database (Denmark)
Babicheva, Viktoriia; Lavrinenko, Andrei
2013-01-01
We design a plasmonic modulator which can be utilized as a compact active device in photonic integrated circuits. The active material, barium titanate (BaTiO3), is sandwiched between metal plates and changes its refractive index under applied voltage. Some degree of switching of ferroelectric...
Seasonal variability in the input of lead, barium and indium to Law Dome, Antarctica
DEFF Research Database (Denmark)
Burn-Nunes...[], L.J.; Vallelonga, Paul Travis; Loss, R.D.
2011-01-01
Lead (Pb) isotopic compositions and concentrations, and barium (Ba) and indium (In) concentrations have been determined at monthly resolution in five Law Dome (coastal Eastern Antarctica) ice core sections dated from similar to 1757 AD to similar to 1898 AD. 'Natural' background Pb concentrations...
Effect of barium doping on the physical properties of zinc oxide ...
Indian Academy of Sciences (India)
2015-11-27
Home; Journals; Pramana – Journal of Physics; Volume 87; Issue 1. Effect of barium doping on the physical properties of zinc oxide ... Proceedings of the International Workshop/Conference on Computational Condensed Matter Physics and Materials Science (IWCCMP-2015). Posted on November 27, 2015. Guest Editors: ...
an oxalate-peroxide complex used in the preparation of doped barium titanate
van der Gijp, S.; Winnubst, Aloysius J.A.; Verweij, H.
1998-01-01
A method is described for the preparation of homogeneously doped barium titanate, which can be applied in non-linear dielectric elements. Ba and Ti salts are dissolved, mixed with hydrogen peroxide and added to a solution of ammonium oxalate, resulting in the formation of an insoluble peroxo-oxalate
Growth and study of barium oxalate single crystals in agar gel
Indian Academy of Sciences (India)
Unknown
tive Powder Diffraction Data Interpretation and Indexing. Program, Version 2.2) was used to calculate 'd' values. Calculated 'd' values matched with reported values. Table. 2 shows calculated unit cell parameters. Table 2. Calculated unit cell parameters. Parameters. Barium oxalate. System. Monoclinic (P) a. 8⋅2426 Å b.
International Nuclear Information System (INIS)
Shalini, M. Govindaraj; Sahoo, Subasa C.
2016-01-01
M-type barium hexaferrite (BaFe_1_2O_1_9) and cobalt doped barium hexaferrite (BaFe_1_1CoO_1_9) nanopowders were synthesized by modified sol-gel auto-combustion technique and were annealed at 900°C in air for 4 hours. The annealed powders were studied in the present work and X-ray diffraction studies showed pure phase formation after annealing. The average grain size in the nanopowder sample was decreased after doping. Magnetization value of 60 emu/g was observed at 300 K for the barium hexaferrite and was reduced to 54 emu/g after doping. The coercivity of 5586 Oe was observed at 300 K for the undoped sample and was found to be decreased in the doped sample. As the measurement temperature was decreased from 300 K to 60 K, magnetization value was increased in both the samples compared to those at 300 K. The coercivity of the undoped sample was found to decrease whereas it was increased for the doped sample at 60 K. The observed magnetic properties may be understood on the basis of modified exchange interaction and anisotropy in the doped sample compared to that of pure barium hexaferrite.
Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE
Anderson, NG; Firsching, M; de Ruiter, N; Schleich, N; Butzer, J S; Cook, N J; Grasset, R; Campbell, M; Scott, N J A; Anderson, N G
2010-01-01
Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 A mu A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct f...
Deposition barium titanate (BaTiO3) doped lanthanum with chemical solution deposition
International Nuclear Information System (INIS)
Iriani, Y.; Nurhadi, N.; Jamaludin, A.
2016-01-01
Deposition of Barium Titanate (BaTiO 3 ) thin films used Chemical Solution Deposition (CSD) method and prepared with spin coater. BaTiO 3 is doped with lanthanum, 1%, 2%, and 3%. The thermal process use annealing temperature 900°C and holding time for 3 hours. The result of characterization with x-ray diffraction (XRD) equipment show that the addition of La 3+ doped on Barium Titanate caused the change of angle diffraction.The result of refine with GSAS software shows that lanthanum have been included in the structure of BaTiO 3 . Increasing mol dopant La 3+ cause lattice parameter and crystal volume become smaller. Characterization result using Scanning Electron Microscopy (SEM) equipment show that grain size (grain size) become smaller with increasing mole dopant (x) La 3+ . The result of characterization using Sawyer Tower methods show that all the samples (Barium Titanante and Barium Titanate doped lanthanum) are ferroelectric material. Increasing of mole dopant La 3+ cause smaller coercive field and remanent polarization increases. (paper)
Moore, R.B.; Staubitz, W.W.
1984-01-01
High concentrations of dissolved barium have been found in ground water from bedrock wells on the Seneca Nation of Indians Reservation on Cattaraugus Creek in southwestern New York. Concentrations in 1982 were as high as 23.0 milligrams per liter , the highest found reported from any natural ground-water system in the world. The highest concentrations are in a bedrock aquifer and in small lenses of saturated gravel between bedrock and the overlying till. The bedrock aquifer is partly confined by silt, clay, and till. The high barium concentrations are attributed to dissolution of the mineral barite (BaSO4), which is present in the bedrock and possibly in overlying silt, clay, or till. The dissolution of barite seems to be controlled by action of sulfate-reducing bacteria, which alter the BaSO4 equilibrium by removing sulfate ions and permitting additional barite to dissolve. Ground water from the surficial, unconsolidated deposits and surface water in streams contain little or no barium. Because barium is chemically similar to calcium, it probably could be removed by cation exchange or treatments similar to those used for water softening. (USGS)
Interactions between nitrogen molecules and barium atoms on Ru (0001) surface
International Nuclear Information System (INIS)
Zhao Xinxin; Mi Yiming; Xu Hongxia; Wang Lili; Ren Li; Tao Xiangming; Tan Mingqiu
2011-01-01
We had performed first principles calculations on interactions between nitrogen molecules and barium atoms on Ru (0001) surface using density function theory methods. It was shown that effects of barium atoms weakened the bond strength of nitrogen molecules. The bond length of nitrogen molecule increases from 0.113 nm on Ru (001)-N 2 to 0.120 nm on Ru (001)-N 2 /Ba surface. While stretch vibrational frequency of nitrogen molecule decreased from 2222 cm -1 and charge transfer toward nitrogen molecule increased from 0.3 e to 1.1 e. Charge was mainly translated from 6 s orbitals of barium atoms to 4 d orbitals of substrate, which enhanced the hybridization between 4 d and 2 π orbitals and increased the dipole moment of 5 σ and d π orbitals of nitrogen molecule. The molecular dipole moment of nitrogen molecule was increased by -0.136 e Anstrom. It was suggested that barium had some characters to be an electronic promoter on the process of activating nitrogen molecules on Ru (0001) surface. (authors)
Compensation filtration for decubitus radiography during double-contrast barium enema examinations
International Nuclear Information System (INIS)
Feczko, P.J.; Haggar, A.M.; Rauch, P.L.; Halpert, R.D.; Simms, S.M.
1983-01-01
Lateral decubitus images obtained during double-contrast barium enema examinations may be difficult to interpret because of the large difference in density between the various parts of the radiographs. Several types of filters are described which can be used to rectify this problem, thus improving the quality of the decubitus radiographs and achieving a slight reduction in radiation exposure
International Nuclear Information System (INIS)
Zwart, Ingrid M. de; Griffioen, Gerrit; Shaw, M. Pertaap Chandie; Lamers, Cornelis B.H.W.; Roos, Albert de
2001-01-01
AIM: To analyse sensitivity, specificity and complication rate of endoscopy, and barium enema for the detection of colorectal neoplasia. MATERIALS AND METHODS: A MEDLINE search was performed (1980-2000) directed at the endoscopic and radiologic literature on barium enema. Articles were selected based on the type of study, availability of sensitivity and specificity values in sizeable patient groups, and reports on complications. Sixty articles were included in the analysis. RESULTS: Endoscopy proved to have superior sensitivity for polyps in patients at high-risk for colorectal neoplasia. The role of endoscopy and radiology in average-risk screening populations is not known. Sensitivity and specificity rates ranged widely, probably due to bias. For the detection of small polyps endoscopy has superior performance, whereas sensitivity is similar for endoscopy and barium enema for the detection of larger (>1 cm) polyps and tumours. Overall, endoscopy is associated with a higher complication rate. CONCLUSION: Endoscopy is the preferred detection method in high-risk patients. The role of endoscopy and radiology in a screening setting requires evaluation. This review provides the test characteristics of endoscopy and radiology which are relevant for a cost-effectiveness analysis. Double-contrast barium enema may play an important role for screening purposes, owing to its good sensitivity for detecting larger (>1 cm) polyps and its lack of major complications. Zwart, I.M. de et al. (2001)
Growth behaviour of twisted ribbons of barium carbonate/silica self-assembled ceramics
International Nuclear Information System (INIS)
Garcia-Ruiz, J.M.; Moreno, A.
1997-01-01
Twisted ribbons of self-assembled crystal aggregates of barium carbonate, in the presence of silicate ions at pH 9.5 grow at constant rate between 20 and 50 mu m/min. The morphological behaviour depends on temperature, while it was demonstrated to be independent of the viscosity of the growth environment. (Author) 7 refs
Energy Technology Data Exchange (ETDEWEB)
Eggum, R.; Kressner, U.; Haffner, J. [Buskerud Central Hospital, Drammen (Norway)
1998-05-01
Perforation of the rectum following barium enema is relatively rare, occurring in 1 of 3,000 procedures. Colorectal perforation is a serious condition and early diagnosis is of paramount importance in order to avoid any delay in treating the patient. Direct suture of the perforation, lavage, presacral drainage and stomia are the preferred methods of primary surgical treatment. 10 refs., 1 fig.
Adsorption of Pb(II) present in aqueous solution on calcium, strontium and barium hydroxy apatites
International Nuclear Information System (INIS)
Vilchis G, J.
2013-01-01
Calcium, strontium and barium hydroxy apatites were successfully synthesized by chemical precipitation method, the obtained powders were characterized by the techniques of X-ray diffraction (XRD), scanning electron microscopy (Sem), semi-quantitative elemental analysis (EDS), infrared spectroscopy (IR), and N 2 physisorption studies, complementary to these analytical techniques, was determined the surface fractal dimension (Df), and the amount of surface active sites of the materials, in order to know application as ceramic for water remediation. The ability of Pb(II) ion adsorption present in aqueous solution on the hydroxy apatites synthesized by batch type experiments was studied as a function of contact time, concentration of the adsorbate and temperature. The maximum lead adsorption efficiencies obtained were 0.31, 0.32 and 0.26 mg/g for calcium, strontium and barium hydroxy apatites respectively, achieved an equilibrium time of 20 minutes in the three solid-liquid systems studied. Experimental data were adequately adjusted at the adsorption kinetic model pseudo-second order, for the three cases. Moreover, experimental data of the strontium and calcium hydroxy apatites were adjusted to the Langmuir adsorption isotherm, indicating that the adsorption was through a monolayer, whereas barium hydroxyapatite was adjusted to the Freundlich adsorption isotherm, indicating a multilayer adsorption. The thermodynamic parameters obtained during adsorption studies as a function of temperature showed physisorption, exothermic and spontaneous processes respectively. The results showed that the calcium hydroxyapatite, strontium and barium are an alternative for the Pb(II) ion adsorption present in wastewaters. (Author)
Effect of boric acid sintering aid on densification of barium ferrite
Indian Academy of Sciences (India)
Unknown
Physical properties like density and porosity have been studied for all compositions. The phase identification and microstructural investigation on the fractured surface have been carried out to understand the effect of sintering aid on the densification characteristics. Keywords. Barium ferrite; sintering aid; densification. 1.
Inconceivable Hypokalemia: A Case Report of Acute Severe Barium Chloride Poisoning
Directory of Open Access Journals (Sweden)
Haibo Tao
2016-01-01
Full Text Available Barium is a heavy divalent alkaline earth metal that has been known as a muscle poison. Barium can cause human toxicity, which may lead to significant hypokalemia and have serious consequences. This paper reports a case of unprecedented barium intoxication in which the patient, who suffered from depression, swallowed at least 3.0 g barium chloride to commit suicide. On admission, the patient presented with nausea, vomiting, stomach burning feeling, dizziness, and weakness. Emergency biochemical testing showed that the patient was suffering from severe hypokalemia (K+ 1.7 mmol/L. His electrocardiogram (ECG prompted atrioventricular blocking, ventricular tachycardia, prolongation of PR interval, ST segment depression with U waves, and T wave inversion. Intravenous potassium supplements were given immediately to correct hypokalemia and regular monitoring of vital signs and fluid balance was arranged. After all-out rescue of our hospital personnel, the condition of the patient is currently stable and he is gradually recovering. This case exemplifies the weaknesses of the management of toxic substances and the lack of mental health education for young people. We hope to get more attention for the supervision of toxic substances and the healthy development of young people.
Integrated treatment of acid mine drainage using cryptocrystalline magnesite and barium chloride
CSIR Research Space (South Africa)
Masindi, Vhahangwele
2017-08-01
Full Text Available This study endeavours to report the efficiency of a hybrid approach in the treatment of acid mine drainage. Cryptocrystalline magnesite was used to pre-treat acid mine drainage and barium chloride was used to remove the residual sulphate through...
Performance of cement solidification with barium for high activity liquid waste including sulphate
International Nuclear Information System (INIS)
Waki, Toshikazu; Yamada, Motoyuki; Horikawa, Yoshihiko; Kaneko, Masaaki; Saso, Michitaka; Haruguchi, Yoshiko; Yamashita, Yu; Sakai, Hitoshi
2009-01-01
The target liquid waste to be solidified is generated from PWR primary loop spent resin treatment with sulphate acid, so, its main constituent is sodium sulphate and the activity of this liquid is relatively high. Waste form of this liquid waste is considered to be a candidate for the subsurface disposal. The disposed waste including sulphate is anticipated to rise a concentration of sulphate ion in the ground water around the disposal facility and it may cause degradation of materials such as cement and bentonite layer and comprise the disposal facility. There could be two approaches to avoid this problem, the strong design of the disposal facility and the minimization of sulphaste ion migration from the solidified waste. In this study, the latter approach was examined. In order to keep the low concentration of sulphate ion in the ground water, it is effective to make barium sulphate by adding barium compound into the liquid waste in solidification. However, adding equivalent amount of barium compound with sulphate ion causes difficulty of mixing, because production of barium sulphate causes high viscosity. In this study, mixing condition after and before adding cement into the liquid waste was estimated. The mixing condition was set with consideration to keep anion concentration low in the ground water and of mixing easily enough in practical operation. Long term leaching behavior of the simulated solidified waste was also analyzed by PHREEQC. And the concentration of the constitution affected to the disposal facility was estimated be low enough in the ground water. (author)
Growth and study of barium oxalate single crystals in agar gel
Indian Academy of Sciences (India)
Barium oxalate was grown in agar gel at ambient temperature. The effect of various parameters like gel concentration, gel setting time and concentration of the reactants on the growth of these crystals was studied. Prismatic platy shaped spherulites and dendrites were obtained. The grown crystals were characterized by ...
Dispersive waves induced by self-defocusing temporal solitons in a beta-barium-borate crystal
DEFF Research Database (Denmark)
Zhou, Binbin; Bache, Morten
2015-01-01
We experimentally observe dispersive waves in the anomalous dispersion regime of a beta-barium-borate (BBO) crystal, induced by a self-defocusing few-cycle temporal soliton. Together the soliton and dispersive waves form an energetic octave-spanning supercontinuum. The soliton was excited...
Proposed Oral Reference Dose (RfD) for Barium and Compounds (Final Report, 2004)
This document is the final report from the 2004 external peer review of the Proposed Oral Reference Dose (RfD) for Barium and Compounds, prepared by the U.S. Environmental Protection Agency (EPA), National Center for Environmental Assessment (NCEA), for the Integrated Risk...
Nagy, Ahmed; Steele, Catriona M.; Pelletier, Cathy A.
2014-01-01
Purpose: The authors examined the impact of barium on the perceived taste intensity of 7 different liquid tastant stimuli and the modulatory effect that these differences in perceived taste intensity have on swallowing behaviors. Method: Participants were 80 healthy women, stratified by age group (60) and genetic taste status…
González-Weller, Dailos; Rubio, Carmen; Gutiérrez, Ángel José; González, Gara Luis; Caballero Mesa, José María; Revert Gironés, Consuelo; Burgos Ojeda, Antonio; Hardisson, Arturo
2013-12-01
The aim of this study was to analyze barium, bismuth, chromium, lithium, and strontium contents in food and beverages consumed by the population of the Canary Islands (Spain) as well as determine dietary intake of these metals in the archipelago as a whole and in its individual islands. To this end, 440 samples were analyzed by ICP-OES and GFAAS. Barium concentrations ranged from 5.210 ± 2.117 mg/kg in nuts to 0.035 ± 0.043 mg/L in water. Viscera exhibited the highest levels of bismuth (38.07 ± 36.80 mg/kg). The cold meat and sausages group stood out for its high chromium concentrations (0.494 ± 0.257 mg/kg). The highest concentration of lithium and strontium came out in nuts (8.761 ± 5.368 mg/kg and 9.759 ± 5.181 mg/kg, respectively). The total intakes of barium, bismuth, chromium, lithium, and strontium were 0.685, 1.274, 0.087, 3.674, and 1.923 mg/day, respectively. Cereals turned out to contribute most to the dietary intake of barium, bismuth, chromium, and lithium in the Canary Islands, while fruit contributes most to the strontium intake. We also performed a metal intake study by age and sex of the population and compared the outcome with data from other regions, both national and international.
Diffuse X-ray scattering and far infrared absorption of barium and lead β" aluminas
DEFF Research Database (Denmark)
Hayes, W.; Kjær, Kristian; Pratt, F. L.
1985-01-01
The authors have carried out high-momentum-resolution studies in diffuse X-ray scattering of barium and lead B" aluminas in the temperature range 20-700 degrees C. They have also measured the vibrational spectra of these compounds between 2K and 300K in the energy range 10-100 cm-1. The results...
Lira, V F; Santos, G A P; Derycke, S; Larrazabal, M E L; Fonsêca-Genevois, V G; Moens, T
2011-10-01
Offshore oil and gas drilling often involves the use of fluids containing barium and traces of other heavy metals. These may affect the environment, but information on their toxicity to benthic biota remains scant. Here, we present results of a 10-day bioassay with the marine nematode Rhabditis (Pellioditis) marina at different loads of barium (0-10 ,000 ppm nominal concentrations) and cadmium (0-12 ppm) in the range of concentrations reported from drilling-impacted sediments. Barium did not affect the fitness and population development of R. (P.) marina at concentrations up to 300 ppm, but did cause a decrease in population abundance and an increase in development time from concentrations of 400-2000 ppm onwards. Increased mortality occurred at 4800 ppm Ba. For cadmium, LOEC and EC₅₀ values for total population abundance were 2.95 and 8.82 ppm, respectively. Cd concentrations as low as 2.40 to 2.68 caused a decrease in the abundance of adult nematodes, indicating that assays covering more generations would likely demonstrate yet more pronounced population-level effects. Our results indicate that oil and gas drilling activities may potentially have important implications for the meiobenthos through the toxicity of barium and associated metals like cadmium. Copyright © 2011 Elsevier Ltd. All rights reserved.
National Research Council Canada - National Science Library
Hubbard, C
1999-01-01
Ferroelectric barium strontium titanate (Ba(1-x)SrxTiO3 BSTO) films of 1-micron nominal thickness were deposited on single crystals of sapphire and electroded substrates at substrate temperatures varying from 30 deg C to 700 deg C...
Dielectric properties and vacancy-like defects in plasma-sprayed barium titanate.
Czech Academy of Sciences Publication Activity Database
Ctibor, Pavel; Čížek, J.; Sedláček, J.; Lukáč, František
2017-01-01
Roč. 100, č. 7 (2017), s. 2972-2983 ISSN 0002-7820 Institutional support: RVO:61389021 Keywords : barium titanate * plasma spraying * vacancies Subject RIV: JH - Ceramic s, Fire-Resistant Materials and Glass OBOR OECD: Ceramic s Impact factor: 2.841, year: 2016
Gastroesophageal reflux: comparison of barium studies with 24-h pH monitoring
International Nuclear Information System (INIS)
Pan, John J.; Levine, Marc S.; Redfern, Regina O.; Rubesin, Stephen E.; Laufer, Igor; Katzka, David A.
2003-01-01
Objective: To determine the correlation between massive gastroesophageal reflux (GER) on barium studies and pathologic acid reflux on 24-h pH monitoring. Methods: A search of hospital records from January 1997 to January 2001 revealed 28 patients who underwent both barium studies and 24-h pH monitoring. The radiologic reports were reviewed to determine the presence and degree of GER. Patients with reflux to or above the thoracic inlet either spontaneously or with provocative maneuvers in the recumbent position were classified as having massive reflux, whereas the remaining patients with reflux below the thoracic inlet or no reflux comprised the control group. The pH monitoring reports were also reviewed to determine if pathologic acid reflux was present in the recumbent position. The findings on these studies were then compared to determine the frequency of pathologic acid reflux in the recumbent position on pH monitoring in patients with massive reflux on barium studies compared with the control group. Results: Massive GER was observed on barium studies in 11 (39%) of the 28 patients and reflux below the thoracic inlet or no reflux in the remaining 17 patients (61%) who comprised the control group. All 11 patients (100%) with massive reflux on barium studies had pathologic acid reflux on pH monitoring in the recumbent position compared with six (35%) of 17 patients in the control group (P=0.0009). The pH in the distal esophagus on pH monitoring was less than 4.0 for 13.1% of the recumbent period for patients with massive GER on barium studies compared with 6.2% of the recumbent period for the control group (P=0.0076). Conclusion: Although 24-h pH monitoring remains the gold standard for the detection of GER, our experience suggests that patients with massive reflux on barium studies are so likely to have pathologic acid reflux in the recumbent position that these individuals can be further evaluated and treated for their gastroesophageal reflux disease (GERD
SALT reveals the barium central star of the planetary nebula Hen 2-39
Miszalski, B.; Boffin, H. M. J.; Jones, D.; Karakas, A. I.; Köppen, J.; Tyndall, A. A.; Mohamed, S. S.; Rodríguez-Gil, P.; Santander-García, M.
2013-12-01
Classical barium stars are binary systems which consist of a late-type giant enriched in carbon and slow neutron capture (s-process) elements and an evolved white dwarf (WD) that is invisible at optical wavelengths. The youngest observed barium stars are surrounded by planetary nebulae (PNe), ejected soon after the wind accretion of polluted material when the WD was in its preceding asymptotic giant branch (AGB) phase. Such systems are rare but powerful laboratories for studying AGB nucleosynthesis as we can measure the chemical abundances of both the polluted star and the nebula ejected by the polluter. Here, we present evidence for a barium star in the PN Hen 2-39 (PN G283.8-04.2) as one of only a few known systems. The polluted giant is very similar to that found in WeBo 1 (PN G135.6+01.0). It is a cool (Teff = 4250 ± 150 K) giant enhanced in carbon ([C/H] = 0.42 ± 0.02 dex) and barium ([Ba/Fe] = 1.50 ± 0.25 dex). A spectral type of C-R3 C24 nominally places Hen 2-39 amongst the peculiar early R-type carbon stars; however, the barium enhancement and likely binary status mean that it is more likely to be a barium star with similar properties, rather than a true member of this class. An AGB star model of initial mass 1.8 M⊙ and a relatively large carbon pocket size can reproduce the observed abundances well, provided mass is transferred in a highly conservative way from the AGB star to the polluted star (e.g. wind Roche lobe overflow). It also shows signs of chromospheric activity and photometric variability with a possible rotation period of ˜5.5 d likely induced by wind accretion. The nebula exhibits an apparent ring morphology in keeping with the other PNe around barium stars (WeBo 1 and A 70) and shows a high degree of ionization implying the presence of an invisible hot pre-WD companion that will require confirmation with UV observations. In contrast to A 70, the nebular chemical abundance pattern is consistent with non-Type I PNe, in keeping with the
Gastroesophageal reflux: comparison of barium studies with 24-h pH monitoring
Energy Technology Data Exchange (ETDEWEB)
Pan, John J.; Levine, Marc S. E-mail: levine@oasis.rad.upenn.edu; Redfern, Regina O.; Rubesin, Stephen E.; Laufer, Igor; Katzka, David A
2003-08-01
Objective: To determine the correlation between massive gastroesophageal reflux (GER) on barium studies and pathologic acid reflux on 24-h pH monitoring. Methods: A search of hospital records from January 1997 to January 2001 revealed 28 patients who underwent both barium studies and 24-h pH monitoring. The radiologic reports were reviewed to determine the presence and degree of GER. Patients with reflux to or above the thoracic inlet either spontaneously or with provocative maneuvers in the recumbent position were classified as having massive reflux, whereas the remaining patients with reflux below the thoracic inlet or no reflux comprised the control group. The pH monitoring reports were also reviewed to determine if pathologic acid reflux was present in the recumbent position. The findings on these studies were then compared to determine the frequency of pathologic acid reflux in the recumbent position on pH monitoring in patients with massive reflux on barium studies compared with the control group. Results: Massive GER was observed on barium studies in 11 (39%) of the 28 patients and reflux below the thoracic inlet or no reflux in the remaining 17 patients (61%) who comprised the control group. All 11 patients (100%) with massive reflux on barium studies had pathologic acid reflux on pH monitoring in the recumbent position compared with six (35%) of 17 patients in the control group (P=0.0009). The pH in the distal esophagus on pH monitoring was less than 4.0 for 13.1% of the recumbent period for patients with massive GER on barium studies compared with 6.2% of the recumbent period for the control group (P=0.0076). Conclusion: Although 24-h pH monitoring remains the gold standard for the detection of GER, our experience suggests that patients with massive reflux on barium studies are so likely to have pathologic acid reflux in the recumbent position that these individuals can be further evaluated and treated for their gastroesophageal reflux disease (GERD
Energy Technology Data Exchange (ETDEWEB)
Mitchell, J.; Farrow, R.; Hussaini, S.H.; Dalton, H.R
2001-01-01
AIM: To establish a 'one-stop' dysphagia service in which a consultation, barium swallow and endoscopy can all be performed in the same hospital visit. MATERIALS AND METHODS: In order to allow both barium swallow examination and endoscopy to be performed on the same day, a novel technique for clearing barium from the upper gastrointestinal tract was established. Following the barium swallow examination, patients were given diet cola and metoclopramide syrup. If appropriate, an upper gastrointestinal endoscopy was then performed shortly afterwards. The service was piloted for 6 months in which time 25 patients were investigated in this way. RESULTS: All patients were seen within 2 weeks of referral. The mean time between barium swallow and endoscopy was 3 h 38 min (range, 1 h 50 min to 5 h 20 min). In all 24 patients in whom an endoscopy was performed, barium had been satisfactorily cleared from the oesophagus and stomach. CONCLUSION: This technique allows both barium swallow and upper gastrointestinal endoscopy to be performed on the same day, providing a rapid, safe and accurate diagnosis with minimum patient inconvenience. Mitchell, J. (2001)
International Nuclear Information System (INIS)
Mitchell, J.; Farrow, R.; Hussaini, S.H.; Dalton, H.R.
2001-01-01
AIM: To establish a 'one-stop' dysphagia service in which a consultation, barium swallow and endoscopy can all be performed in the same hospital visit. MATERIALS AND METHODS: In order to allow both barium swallow examination and endoscopy to be performed on the same day, a novel technique for clearing barium from the upper gastrointestinal tract was established. Following the barium swallow examination, patients were given diet cola and metoclopramide syrup. If appropriate, an upper gastrointestinal endoscopy was then performed shortly afterwards. The service was piloted for 6 months in which time 25 patients were investigated in this way. RESULTS: All patients were seen within 2 weeks of referral. The mean time between barium swallow and endoscopy was 3 h 38 min (range, 1 h 50 min to 5 h 20 min). In all 24 patients in whom an endoscopy was performed, barium had been satisfactorily cleared from the oesophagus and stomach. CONCLUSION: This technique allows both barium swallow and upper gastrointestinal endoscopy to be performed on the same day, providing a rapid, safe and accurate diagnosis with minimum patient inconvenience. Mitchell, J. (2001)
Wakai, Shizuko; Tanabe, Naohito; Suzuki, Hiroshi
2005-04-01
Use of high-density barium (= or > 180 w/v%) has been widely spread in community-based mass screening for gastric cancer in Japan. However, the impact on outcomes of the screening has not been fully evaluated. Then, we investigated the advantage of high-density barium use by comparing the outcomes between a period with high-density barium and that with low-density barium (barium decreases the positive finding rate in initial mass screening x-ray examinations by 12% (odds ratio, 0.88; 95% confidence interval, 0.86 - 0.90) and increase the gastric cancer detection rate by diagnostic examination by 15% (odds ratio, 1.15; 95% confidence interval, 1.01-1.31). We conclude that introduction of high-density barium has improved the efficiency of mass screening for gastric cancer by decreasing unnecessary diagnostic examinations and reducing the total personal and public health costs. Thus, nationwide use of high-density barium is recommended for mass gastric cancer screening in Japan.
Nagata, Koichi; Singh, Anand Kumar; Sangwaiya, Minal Jagtiani; Näppi, Janne; Zalis, Michael E; Cai, Wenli; Yoshida, Hiroyuki
2009-11-01
The purpose of this evaluation was to compare the tagging quality of a barium-based regimen with that of iodine-based regimens for computed tomographic (CT) colonography. Tagging quality was assessed retrospectively in three different types of fecal-tagging CT colonographic cases: 24 barium-based cases, 22 nonionic iodine-based cases, and 24 ionic iodine-based cases. For the purpose of evaluation, the large intestine was divided into six segments, and the tagging homogeneity of a total of 420 segments (70 patients) was graded by three blinded readers from 0 (heterogeneous) to 4 (homogeneous). For barium-based cases, the average score for the three readers was 2.4, whereas it was 3.4 for nonionic iodine and 3.6 for ionic iodine. The percentages of segments that were assigned scores of 4 (excellent tagging [100%]) were 11.6%, 61.9%, and 72.9% for the barium-based, nonionic iodine-based, and ionic iodine-based regimens, respectively. The homogeneity scores of iodine-based fecal-tagging regimens were significantly higher than those of the barium-based fecal-tagging regimen (P barium-based regimen (P barium-based fecal-tagging regimen. Iodine-based fecal-tagging regimens can provide an appropriate method for use in nonlaxative or minimum-laxative CT colonography.
International Nuclear Information System (INIS)
Imashuku, Susumu; Uda, Tetsuya; Nose, Yoshitaro; Awakura, Yasuhiro
2011-01-01
Research highlights: → Very fine 15% yttrium-doped barium zirconate powder of particle size about 30 nm was obtained by synthesizing at 500 deg. C in vacuum from powder mixed by the nitrate freeze-drying method. → Large and homogeneous grains of 15% yttrium-doped barium zirconate were easily obtained using the synthesized powder. → Grain boundary resistance was not inversely proportional to the grain size as theoretically expected. → Specific grain boundary conductivity varies with samples because impurities and/or evaporation loss of barium oxide might affect the grain-boundary resistance in 15% yttrium-doped barium zirconate. - Abstract: We applied a nitrate freeze-drying method to obtain a fine synthesized powder of 15% yttrium-doped barium zirconate. Fine 15% yttrium-doped barium zirconate powder of particle size about 30 nm was obtained by synthesizing at 500 deg. C in vacuum from a powder mixed by the nitrate freeze-drying method. However, we could not obtain such fine powder by synthesizing in air. Using the powder synthesized in vacuum, large and homogeneous grains of 15% yttrium-doped barium zirconate were easily obtained after sintering. Then, the bulk and grain boundary resistance were evaluated by AC 2-terminal measurement of sample in the form of bar and pellet and DC 4-terminal measurement of bar-shape sample. The grain boundary resistance was not inversely proportional to the grain size as theoretically expected. We concluded that specific grain boundary conductivity varies with samples. Some impurities, evaporation loss of barium oxide and/or other unexpected reasons might affect the grain boundary resistance in 15% yttrium-doped barium zirconate.
Barium borate nanorod decorated reduced graphene oxide for optical power limiting applications
Muruganandi, G.; Saravanan, M.; Vinitha, G.; Jessie Raj, M. B.; Sabari Girisun, T. C.
2018-01-01
By simple hydrothermal method, nanorods of barium boate were successfully loaded on reduced graphene oxide sheets. Powder XRD confirms the incorporation of barium borate (2θ = 29°, (202)) along with the transition of graphene oxide (2θ = 12°, (001)) into reduced graphene oxide (2θ = 25°, (002)). In the FTIR spectra, presence of characteristic absorption peaks of rGO (1572 and 2928 cm-1) and barium borate (510, 760 and 856 cm-1) further evidences the formation of BBO:rGO nanocomposite. FESEM images potray the existence of graphene sheets as thin layers and growth of barium borate as nanorods on the sheets of reduced graphene oxide. Ground state absorption studies reveal the hypsochromic shift in the absorption maxima of the graphene layers due to reduction of graphene oxide and hypochromic shift in the absorbance intensity due to the inclusion of highly transparent barium bortae. The photoluminescence of BBO:rGO shows maximum emission in the UV region arising from the direct transitions involving the valence band and conduction band in the band gap region. Z-scan technique using CW diode pumped Nd:YAG laser (532 nm, 50 mW) exposes that both nanocomposite and individual counterpart possess saturable absorption and self-defocusing behavior. Third-order nonlinear optical coefficients of BBO:rGO nanocomposite is found to be higher than bare graphene oxide. In particular the nonlinear refractive index of nanocomposite is almost four times higher than GO which resulted in superior optical power limiting action. Strong nonlinear refraction (self-defocusing) and lower onset limiting thershold makes the BBO:rGO nanocomposite preferable candidate for laser safety devices.