WorldWideScience

Sample records for barium 130

  1. Barium periostitis: an intraoral complication following barium swallow.

    Science.gov (United States)

    Stanton, David C; Seeger, Douglas; Robinson, Brian T

    2007-05-01

    Barium is used with great frequency for various gastrointestinal radiographic studies. Complications arising from the use of barium are uncommon and can range from peritonitis, pneumonitis, vascular intravasation, allergic reactions, and even "barium appendicitis." We report a case of an unusual complication, periostitis, from the use of barium in a 46-year-old male.

  2. Controlling barium sulfate

    Energy Technology Data Exchange (ETDEWEB)

    Greenley, R.

    Even though for several years success has been realized in controlling barium sulfate scale deposition in relatively shallow, low pressure oil wells--by squeezing an organic phosphonate scale inhibitor into the producing zone--barium sulfate scale depositon in deep, high pressure/high temperature wells usually meant an expensive workover operation. A case history of a deep (16,000 ft) well in St. Mary Parish, Louisiana, and the scale inhibitor squeeze operation are described. Based on the successful results obtained in treating this well, a generalized treating procedure for combating downhole scale deposition in high pressure/high temperature gas wells is presented. Formation squeezing with such an inhibitor represents a significant breakthrough for the oil and gas industry.

  3. On barium oxide solubility in barium-containing chloride melts

    Energy Technology Data Exchange (ETDEWEB)

    Nikolaeva, Elena V.; Zakiryanova, Irina D.; Bovet, Andrey L.; Korzun, Iraida V. [Ural Federal Univ., Yekaterinburg (Russian Federation). Inst. of High Temperature Electrochemistry

    2016-11-01

    Oxide solubility in chloride melts depends on temperature and composition of molten solvent. The solubility of barium oxide in the solvents with barium chloride content is essentially higher than that in molten alkali chlorides. Spectral data demonstrate the existence of oxychloride ionic groupings in such melts. This work presents the results of the BaO solubility in two molten BaCl{sub 2}-NaCl systems with different barium chloride content. The received data together with earlier published results revealed the main regularities of BaO solubility in molten BaO-BaCl{sub 2}-MCl systems.

  4. MR Colonography with fecal tagging: Barium vs. barium ferumoxsil

    DEFF Research Database (Denmark)

    Achiam, M.P.; Chabanova, E.; Logager, V.B.;

    2008-01-01

    and Methods. Twenty patients referred to CC underwent dark lumen MRC prior to the colonoscopy. Two groups of patients received two different oral contrast agents (barium sulfate and barium sulfate/ferumoxsil) as a laxative-free fecal tagging prior to the MRC. After MRC, the contrast agent was rated...... qualitatively (with the standard method using contrast-to-wall ratio) and subjectively (using a visual analog scale [VAS]) by three different blinded observers. Results. Evaluated both qualitatively and subjectively, the tagging efficiency of barium sulfate/ferumoxsil was significantly better (P ... barium sulfate alone. The VAS method for evaluating the tagging efficiency of contrast agents showed a high correlation (observer 11, r = 0.91) to the standard method using contrast-to-wall ratio and also a high interclass correlation (observer 11 and III = 0.89/0.85). MRC found I of 22 (5%) polyps

  5. Doped barium titanate nanoparticles

    Indian Academy of Sciences (India)

    T K Kundu; A Jana; P Barik

    2008-06-01

    We have synthesized nickel (Ni) and iron (Fe) ion doped BaTiO3 nanoparticles through a chemical route using polyvinyl alcohol (PVA). The concentration of dopant varies from 0 to 2 mole% in the specimens. The results from X-ray diffractograms and transmission electron micrographs show that the particle diameters in the specimen lie in the range 24–40 nm. It is seen that the dielectric permittivity in doped specimens is enhanced by an order of magnitude compared to undoped barium titanate ceramics. The dielectric permittivity shows maxima at 0.3 mole% doping of Fe ion and 0.6 mole% of Ni ion. The unusual dielectric behaviour of the specimens is explained in terms of the change in crystalline structure of the specimens.

  6. Microwave-hydrothermal synthesis of barium strontium titanate nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Simoes, A.Z., E-mail: alezipo@yahoo.co [Universidade Federal de Itajuba- Unifei - Campus Itabira, Rua Sao Paulo, 377, Bairro, Amazonas, CEP 35900-37, Itabira, MG (Brazil); Universidade Estadual Paulista- Unesp - Faculdade de Engenharia de Guaratingueta, Av. Dr. Ariberto Pereira da Cunha, 333, Bairro Pedregulho, CEP 12516-410 Guaratingueta, SP (Brazil); Moura, F.; Onofre, T.B. [Universidade Federal de Itajuba- Unifei - Campus Itabira, Rua Sao Paulo, 377, Bairro, Amazonas, CEP 35900-37, Itabira, MG (Brazil); Ramirez, M.A.; Varela, J.A.; Longo, E. [Laboratorio Interdisciplinar em Ceramica (LIEC), Departamento de Fisico-Quimica, Instituto de Quimica, UNESP, CEP 14800-900, Araraquara, SP (Brazil)

    2010-10-22

    Research highlights: {yields} Barium strontium titanate nanoparticles were obtained by the Hydrothemal microwave technique (HTMW) {yields} This is a genuine technique to obtain nanoparticles at low temperature and short times {yields} Barium strontium titanate free of carbonates with tetragonal structure was grown at 130 {sup o}C. - Abstract: Hydrothermal-microwave method (HTMW) was used to synthesize crystalline barium strontium titanate (Ba{sub 0.8}Sr{sub 0.2}TiO{sub 3}) nanoparticles (BST) in the temperature range of 100-130 {sup o}C. The crystallization of BST with tetragonal structure was reached at all the synthesis temperatures along with the formation of BaCO{sub 3} as a minor impurity at lower syntheses temperatures. Typical FT-IR spectra for tetragonal (BST) nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH- groups, commonly found in materials obtained by HTMW process. FE/SEM revealed that lower syntheses temperatures led to a morphology that consisted of uniform grains while higher syntheses temperature consisted of big grains isolated and embedded in a matrix of small grains. TEM has shown BST nanoparticles with diameters between 40 and 80 nm. These results show that the HTMW synthesis route is rapid, cost effective, and could serve as an alternative to obtain BST nanoparticles.

  7. 75 FR 33824 - Barium Chloride From China

    Science.gov (United States)

    2010-06-15

    ... COMMISSION Barium Chloride From China Determination On the basis of the record\\1\\ developed in the subject... order on barium chloride from China would be likely to lead to continuation or recurrence of material... Barium Chloride from China: Investigation No. 731-TA-149 (Third Review). By order of the...

  8. 130 力学

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    04020073 130·10基础力学摩擦对机械臂运动扰动的定量分析=Quantitative analysis of disturbance of manipulator motion by friction,04020074 130·10 DC-DC开关功率变换器的非线性动力学行为研究=The Progress of Study on Nonlinear Dynamics Behavior in DC-DC Switching Power Converter,04020075 130·10安装固定气动翼板的大跨桥梁抖振分析=Coupled buffeting analysis of long span bridges with stationary aerodynamic wings……

  9. Barium aspiration and alveolarisation of barium in an infant: A case report and review of management

    Directory of Open Access Journals (Sweden)

    Alan F. Isles

    2014-05-01

    Full Text Available We describe a case of bilateral inhalation and alveolarisation of barium in an infant following a barium swallow for investigation of dusky spells associated with feeds. A bronchoscopy subsequently revealed the presence of a mid-tracheal tracheo-oesophageal cleft. We review the literature on barium aspiration, its consequences and make recommendations for management.

  10. ONE CASE REPORT OF ACUTE POISONING BY BARIUM CARBONATE

    Institute of Scientific and Technical Information of China (English)

    GE Qin-min; BIAN Fan; WANG Shu-yun; SHEN Sheng-hui

    2009-01-01

    @@ Most barium poisoning cases were caused by oral intake by mistake. Recent years, barium carbonate poisoning has been rare to be reported. Here we reported a case of acute barium carbonate toxication taken orally on purpose.

  11. Processing science of barium titanate

    Science.gov (United States)

    Aygun, Seymen Murat

    Barium titanate and barium strontium titanate thin films were deposited on base metal foils via chemical solution deposition and radio frequency magnetron sputtering. The films were processed at elevated temperatures for densification and crystallization. Two unifying research goals underpin all experiments: (1) To improve our fundamental understanding of complex oxide processing science, and (2) to translate those improvements into materials with superior structural and electrical properties. The relationships linking dielectric response, grain size, and thermal budget for sputtered barium strontium titanate were illustrated. (Ba 0.6Sr0.4)TiO3 films were sputtered on nickel foils at temperatures ranging between 100-400°C. After the top electrode deposition, the films were co-fired at 900°C for densification and crystallization. The dielectric properties were observed to improve with increasing sputter temperature reaching a permittivity of 1800, a tunability of 10:1, and a loss tangent of less than 0.015 for the sample sputtered at 400°C. The data can be understood using a brick wall model incorporating a high permittivity grain interior with low permittivity grain boundary. However, this high permittivity value was achieved at a grain size of 80 nm, which is typically associated with strong suppression of the dielectric response. These results clearly show that conventional models that parameterize permittivity with crystal diameter or film thickness alone are insufficiently sophisticated. Better models are needed that incorporate the influence of microstructure and crystal structure. This thesis next explores the ability to tune microstructure and properties of chemically solution deposited BaTiO3 thin films by modulation of heat treatment thermal profiles and firing atmosphere composition. Barium titanate films were deposited on copper foils using hybrid-chelate chemistries. An in-situ gas analysis process was developed to probe the organic removal and the

  12. 75 FR 19657 - Barium Chloride From China

    Science.gov (United States)

    2010-04-15

    ... COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Notice of... chloride from China. SUMMARY: The Commission hereby gives notice that it will proceed with a full review... revocation of the antidumping duty order on barium chloride from China would be likely to lead...

  13. Laser cooling and trapping of barium

    NARCIS (Netherlands)

    De, Subhadeep

    2008-01-01

    Laser cooling and trapping of heavy alkaline-earth element barium have been demonstrated for the first time ever. For any possible cycling transition in barium that could provide strong cooling forces, the excited state has a very large branching probability to metastable states. Additional lasers a

  14. Magneto optical trapping of Barium

    CERN Document Server

    De, S; Jungmann, K; Willmann, L

    2008-01-01

    First laser cooling and trapping of the heavy alkaline earth element barium has been achieved based on the strong 6s$^2$ $^1$S$_0$ - 6s6p $^1$P$_1$ transition for the main cooling. Due to the large branching into metastable D-states several additional laser driven transitions are required to provide a closed cooling cycle. A total efficiency of $0.4(1) \\cdot 10^{-2}$ for slowing a thermal atomic beam and capturing atoms into a magneto optical trap was obtained. Trapping lifetimes of more than 1.5 s were observed. This lifetime is shortened at high laser intensities by photo ionization losses. The developed techniques will allow to extend significantly the number of elements that can be optically cooled and trapped.

  15. Radium/Barium Waste Project

    Energy Technology Data Exchange (ETDEWEB)

    McDowell, Allen K.; Ellefson, Mark D.; McDonald, Kent M.

    2015-06-25

    The treatment, shipping, and disposal of a highly radioactive radium/barium waste stream have presented a complex set of challenges requiring several years of effort. The project illustrates the difficulty and high cost of managing even small quantities of highly radioactive Resource Conservation and Recovery Act (RCRA)-regulated waste. Pacific Northwest National Laboratory (PNNL) research activities produced a Type B quantity of radium chloride low-level mixed waste (LLMW) in a number of small vials in a facility hot cell. The resulting waste management project involved a mock-up RCRA stabilization treatment, a failed in-cell treatment, a second, alternative RCRA treatment approach, coordinated regulatory variances and authorizations, alternative transportation authorizations, additional disposal facility approvals, and a final radiological stabilization process.

  16. 75 FR 20625 - Barium Chloride From China

    Science.gov (United States)

    2010-04-20

    ... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Revised schedule for the subject review. DATES: Effective Date: April 9, 2010. FOR FURTHER INFORMATION CONTACT:...

  17. Neutral Barium Cloud Evolution at Different Altitudes

    Institute of Scientific and Technical Information of China (English)

    李磊; 徐荣栏

    2002-01-01

    Considering the joint effects of diffusion, collision, oxidation and photoionization, we study the evolution of the barium cloud at different altitudes in the space plasma active experiment. The results present the variation of the loss rate, number density distribution and brightness of the barium cloud over the range from 120 to 260km.This can be divided into oxidation, oxidation plus photoionization and photoionization regions.

  18. Small barium rail gun for plasma injection.

    Science.gov (United States)

    Kiwamoto, Y

    1980-03-01

    A small rail gun with a barium electrode can be operated at higher than one shot per second to produce more than 2x10(16) barium ions with energy 10-20 eV. The operation of the gun takes advantage of the external magnetic field for cross-field plasma injection into a trap. Up to 7 kG of the magnetic field examined, the gun performance improves with the increased magnetic field strength.

  19. RX130 Robot Calibration

    Science.gov (United States)

    Fugal, Mario

    2012-10-01

    In order to create precision magnets for an experiment at Oak Ridge National Laboratory, a new reverse engineering method has been proposed that uses the magnetic scalar potential to solve for the currents necessary to produce the desired field. To make the magnet it is proposed to use a copper coated G10 form, upon which a drill, mounted on a robotic arm, will carve wires. The accuracy required in the manufacturing of the wires exceeds nominal robot capabilities. However, due to the rigidity as well as the precision servo motor and harmonic gear drivers, there are robots capable of meeting this requirement with proper calibration. Improving the accuracy of an RX130 to be within 35 microns (the accuracy necessary of the wires) is the goal of this project. Using feedback from a displacement sensor, or camera and inverse kinematics it is possible to achieve this accuracy.

  20. Bacterial Reduction Of Barium Sulphate By Sulphate-Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Luptáková Alena

    2015-12-01

    Full Text Available Acid mine drainage (AMD is a worldwide problem leading to contamination of water sources. AMD are characterized by low pH and high content of heavy metals and sulphates. The barium salts application presents one of the methods for the sulphates removing from AMD. Barium chloride, barium hydroxide and barium sulphide are used for the sulphates precipitation in the form of barium sulphate. Because of high investment costs of barium salts, barium sulphide is recycled from barium sulphate precipitates. It can be recycled by thermic or bacterial reduction of barium sulphate. The aim of our study was to verify experimentally the possibility of the bacterial transformation of BaSO4 to BaS by sulphate-reducing bacteria. Applied BaSO4 came from experiments of sulphates removal from Smolnik AMD using BaCl2.

  1. Thermochemical hydrogen production via a cycle using barium and sulfur - Reaction between barium sulfide and water

    Science.gov (United States)

    Ota, K.; Conger, W. L.

    1977-01-01

    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653-866 C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. An expression was derived for the rate of hydrogen formation.

  2. Sulphate removal from sodium sulphate-rich brine and recovery of barium as a barium salt mixture.

    Science.gov (United States)

    Vadapalli, Viswanath R K; Zvimba, John N; Mulopo, Jean; Motaung, Solly

    2013-01-01

    Sulphate removal from sodium sulphate-rich brine using barium hydroxide and recovery of the barium salts has been investigated. The sodium sulphate-rich brine treated with different dosages of barium hydroxide to precipitate barium sulphate showed sulphate removal from 13.5 g/L to less than 400 mg/L over 60 min using a barium to sulphate molar ratio of 1.1. The thermal conversion of precipitated barium sulphate to barium sulphide achieved a conversion yield of 85% using coal as both a reducing agent and an energy source. The recovery of a pure mixture of barium salts from barium sulphide, which involved dissolution of barium sulphide and reaction with ammonium hydroxide resulted in recovery of a mixture of barium carbonate (62%) and barium hydroxide (38%), which is a critical input raw material for barium salts based acid mine drainage (AMD) desalination technologies. Under alkaline conditions of this barium salt mixture recovery process, ammonia gas is given off, while hydrogen sulfide is retained in solution as bisulfide species, and this provides basis for ammonium hydroxide separation and recovery for reuse, with hydrogen sulfide also recoverable for further industrial applications such as sulfur production by subsequent stripping.

  3. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮

    2001-01-01

    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  4. Abundance analysis of Barium stars

    Institute of Scientific and Technical Information of China (English)

    Guo-Qing Liu; Yan-Chun Liang; Li-Cai Deng

    2009-01-01

    We obtain the chemical abundances of six barium stars and two CH subgiant stars based on the high signal-to-noise ratio and high resolution Echelle spectra. The neu- tron capture process elements Y, Zr, Ba, La and Eu show obvious overabundances relative to the Sun, for example, their [Ba/Fe] values are from 0.45 to 1.27. Other elements, in- cluding Na, Mg, A1, Si, Ca, Sc, Ti, V, Cr, Mn and Ni, show comparable abundances to the Solar ones, and their [Fe/H] covers a range from -0.40 to 0.21, which means they belong to the Galactic disk. The predictions of the theoretical model of wind accretion for bi- nary systems can explain the observed abundance patterns of the neutron capture process elements in these stars, which means that their overabundant heavy-elements could be caused by accreting the ejecta of AGB stars, the progenitors of present-day white dwarf companions in binary systems.

  5. Coherent Dark Resonances in Atomic Barium

    CERN Document Server

    Dammalapati, U; Jungmann, K; Willmann, L

    2007-01-01

    The observation of dark-resonances in the two-electron atom barium and their influence on optical cooling is reported. In heavy alkali earth atoms, i.e. barium or radium, optical cooling can be achieved using n^1S_0-n^1P_1 transitions and optical repumping from the low lying n^1D_2 and n^3D_{1,2} states to which the atoms decay with a high branching ratio. The cooling and repumping transition have a common upper state. This leads to dark resonances and hence make optical cooling less inefficient. The experimental observations can be accurately modelled by the optical Bloch equations. Comparison with experimental results allows us to extract relevant parameters for effective laser cooling of barium.

  6. Improved spectrophotometric analysis of barium styphnate

    Energy Technology Data Exchange (ETDEWEB)

    Brown, N E; Blasi, J A

    1983-01-01

    A spectrophotometric procedure to determine the purity of barium styphnate monohydrate based upon the absorbance of the styphnate ion at 326 and 413.3 nm has been developed. The purity is determined by comparing the absorbance of the styphnate ion in barium styphnate and in styphnic acid. Our investigation has shown that the molar absorptivity and lambda maxima of the styphnate ion are quite pH dependent; therefore, the pH is buffered to 6.8 to 7.0 with ammonium acetate. Under these conditions the molar absorptivity is 1.6 x 10/sup 4/ L/mol-cm. Analyses following the procedure in the Navy specification WS13444A using water were found to give low molar absorptivities (1.3 x 10/sup 4/ L/mol-cm) for the styphnic acid calibration resulting in erroneous values for barium styphnate purity.

  7. Printed Barium Strontium Titanate capacitors on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Sette, Daniele [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg); Kovacova, Veronika [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Defay, Emmanuel, E-mail: emmanuel.defay@list.lu [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg)

    2015-08-31

    In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography.

  8. Electronic structure of nanograin barium titanate ceramics

    Institute of Scientific and Technical Information of China (English)

    DENG Xiangyun; WANG Xiaohui; LI Dejun; LI Longtu

    2007-01-01

    The density of states and band structure of 20 nm barium titanate(BaTiO3,BT)ceramics are investigated by first-principles calculation.The full potential linearized augmented plane wave(FLAPW)method is used and the exchange correlation effects are treated by the generalized gradient approximation(GGA).The results show that there is substantial hybridization between the Ti 3d and O 2p states in 20 nm BT ceramics and the interaction between barium and oxygen is typically ionic.

  9. Barium Ferrite Films Grown by Laser Ablation

    NARCIS (Netherlands)

    Lisfi, A.; Lodder, J.C.; Haan, de P.; Smithers, M.A.; Roesthuis, F.J.G.

    1998-01-01

    Pulsed laser ablation (PLA) has been used to grow barium ferrite films on Al2O3 single crystal substrates. When deposition occurs in an oxidising atmosphere at high temperatures, the films are single BaFe12O19 phase, very well oriented with (001) texture, and exhibit a large perpendicular magnetic a

  10. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, J.P. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Duarte, G.W. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Research Group in Technology and Information, Centro Universitário Barriga Verde (UNIBAVE), Santa Catarina, SC (Brazil); Caldart, C. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Kniess, C.T. [Post-Graduate Program in Professional Master in Management, Universidade Nove de Julho, São Paulo, SP (Brazil); Montedo, O.R.K.; Rocha, M.R. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Riella, H.G. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Fiori, M.A., E-mail: fiori@unochapeco.edu.br [Post-Graduate Program in Environmental Science, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil); Post-Graduate Program in Technology and Management of the Innovation, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil)

    2015-11-15

    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound.

  11. Chemical abundances and kinematics of barium stars

    CERN Document Server

    de Castro, D B; Roig, F; Jilinski, E; Drake, N A; Chavero, C; Silva, J V Sales

    2016-01-01

    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, $alpha$-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code {\\sc moog}. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of $alpha$-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heav...

  12. Analysis of 26 Barium Stars I. Abundances

    CERN Document Server

    Allen, D M; Allen, Dinah M.; Barbuy, Beatriz

    2006-01-01

    We present a detailed analysis of 26 barium stars, including dwarf barium stars, providing their atmospheric parameters (Teff, log g, [Fe/H], vt) and elemental abundances. We aim at deriving gravities and luminosity classes of the sample stars, in particular to confirm the existence of dwarf barium stars. Accurate abundances of chemical elements were derived. Abundance ratios between nucleosynthetic processes, by using Eu and Ba as representatives of the r- and s-processes are presented. High-resolution spectra with the FEROS spectrograph at the ESO-1.5m Telescope, and photometric data with Fotrap at the Zeiss telescope at the LNA were obtained. The atmospheric parameters were derived in an iterative way, with temperatures obtained from colour-temperature calibrations. The abundances were derived using spectrum synthesis for Li, Na, Al, alpha-, iron peak, s- and r-elements atomic lines, and C and N molecular lines. Atmospheric parameters in the range 4300 < Teff < 6500, -1.2 < [Fe/H] < 0.0 and 1.4...

  13. Lanthanide doped strontium-barium cesium halide scintillators

    Science.gov (United States)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew

    2015-06-09

    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  14. History and challenges of barium titanate: Part I

    Directory of Open Access Journals (Sweden)

    Vijatović M.M.

    2008-01-01

    Full Text Available Barium titanate is the first ferroelectric ceramics and a good candidate for a variety of applications due to its excellent dielectric, ferroelectric and piezoelectric properties. Barium titanate is a member of a large family of compounds with the general formula ABO3 called perovskites. Barium titanate can be prepared using different methods. The synthesis method depends on the desired characteristics for the end application. The used method has a significant influence on the structure and properties of barium titanate materials. In this review paper, Part I contains a study of the BaTiO3 structure and frequently used synthesis methods.

  15. Thermochemical hydrogen production via a cycle using barium and sulfur: reaction between barium sulfide and water

    Energy Technology Data Exchange (ETDEWEB)

    Ota, K.; Conger, W.L.

    1977-01-01

    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653 to 866/sup 0/C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. The rate of formation of hydrogen can be expressed as: RH2 = 1.07 x 10/sup -2/ exp (-3180/RT) (mol H/sub 2//mol BaS s). Hydrogen sulfide was produced during the initial period of reaction and the quantity of hydrogen sulfide formed during this period decreased as the temperature of reaction was increased.

  16. Barium enema findings of milk allergy in infants

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Gyoung Ju; Kim, Mi Jeong; Lee, Hee Jung [Keimyung University School of Medicine, Daegu (Korea, Republic of)

    2006-09-15

    We wanted to evaluate the barium enema findings of milk allergy in infants. Retrospective evaluation of the plain abdominal radiography and barium enema findings was performed in fifteen young infants suffering with milk allergy. The presence of gaseous distension, rectal gas, paralytic ileus and mechanical obstruction was evaluated on the plain radiography. The presence of spasm, a transitional zone, a reversed rectosigmoid index and mucosal irregularity was analyzed on the barium enema; the presence of barium retention was also evaluated on 24-hour-delayed plain radiography. Paralytic ileus was the most common finding on the plain radiography (93%). On the barium enema, continuous spasm of the colon, ranging from the rectum to the descending colon, was revealed in ten infants (67%). A transitional zone was observed in one infant and a reversed rectosigmoid index was revealed in four. Mucosal irregularity was observed in two infants. Barium retention was demonstrated in 11 of fifteen cases: throughout the entire colon (n = 3), from the rectum to the descending colon (n = 7), and up to the transverse colon (n = 1). The most common barium enema finding of milk allergy in infants was spasm of the distal colon. The other findings were a transitional zone, a reversed rectosigmoid index, mucosal irregularity and barium retention.

  17. [Silica, aluminum, iron, sulfur, and barium in a urinary calculus].

    Science.gov (United States)

    Rodríguez-Miñón Cifuentes, J L; Salvador, E; Bellanato, J; Medina, J A

    1994-05-01

    Presentation of the analytical results by Sweep Microscopy of a small papillary calculus spontaneously eliminated after a nephritic colic. The main component is monohydrate calcium oxalate. When the stone core was analyzed with EDAX, silica, aluminium, iron, sulphur and barium were detected. The origin of these elements is discussed and the presence of barium emphasized as exceptional.

  18. Scattering lengths of calcium and barium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Dammalapati, U.; Willmann, L.; Knoop, S. [Kernfysisch Versneller Instituut (KVI), University of Groningen, Zernikelaan 25, 9747 AA Groningen (Netherlands); LaserLaB Vrije Universiteit, De Boelelaan 1081, 1081 HV Amsterdam (Netherlands)

    2011-11-15

    We have calculated the s-wave scattering length of all the even isotopes of calcium (Ca) and barium (Ba) in order to investigate the prospect of Bose-Einstein condensation (BEC). For Ca we have used an accurate molecular potential based on detailed spectroscopic data. Our calculations show that Ca does not provide other isotopes alternative to the recently Bose condensed {sup 40}Ca that suffers strong losses because of a very large scattering length. For Ba we show by using a model potential that the even isotopes cover a broad range of scattering lengths, opening the possibility of BEC for at least one of the isotopes.

  19. Barium appendicitis: A single institution review in Japan

    Science.gov (United States)

    Katagiri, Hideki; Lefor, Alan Kawarai; Kubota, Tadao; Mizokami, Ken

    2016-01-01

    AIM To review clinical experience with barium appendicitis at a single institution. METHODS A retrospective review of patients admitted with a diagnosis of acute appendicitis, from January 1, 2013 to December 31, 2015 was performed. Age, gender, computed tomography (CT) scan findings if available, past history of barium studies, pathology, and the presence of perforation or the development of complications were reviewed. If the CT scan revealed high density material in the appendix, the maximum CT scan radiodensity of the material is measured in Hounsfield units (HU). Barium appendicitis is defined as: (1) patients diagnosed with acute appendicitis; (2) the patient has a history of a prior barium study; and (3) the CT scan shows high density material in the appendix. Patients who meet all three criteria are considered to have barium appendicitis. RESULTS In total, 396 patients were admitted with the diagnosis of acute appendicitis in the study period. Of these, 12 patients (3.0%) met the definition of barium appendicitis. Of these 12 patients, the median CT scan radiodensity of material in the appendix was 10000.8 HU, ranging from 3066 to 23423 HU (± 6288.2). In contrast, the median CT scan radiodensity of fecaliths in the appendix, excluding patients with barium appendicitis, was 393.1 HU, ranging from 98 to 2151 HU (± 382.0). The CT scan radiodensity of material in the appendices of patients with barium appendicitis was significantly higher than in patients with nonbarium fecaliths (P < 0.01). CONCLUSION Barium appendicitis is not rare in Japan. Measurement of the CT scan radiodensity of material in the appendix may differentiate barium appendicitis from routine appendicitis.

  20. The Novel Formation of Barium Titanate Nanodendrites

    Directory of Open Access Journals (Sweden)

    Chien-Jung Huang

    2014-01-01

    Full Text Available The barium titanate (BaTiO3 nanoparticles with novel dendrite-like structures have been successfully fabricated via a simple coprecipitation method, the so-called BaTiO3 nanodendrites (BTNDs. This method was remarkable, fast, simple, and scalable. The growth solution is prepared by barium chloride (BaCl2, titanium tetrachloride (TiCl4, and oxalic acid. The shape and size of BaTiO3 depend on the amount of added BaCl2 solvent. To investigate the influence of amount of BaCl2 on BTNDs, the amount of BaCl2 was varied in the range from 3 to 6 mL. The role of BaCl2 is found to have remarkable influence on the morphology, crystallite size, and formation of dendrite-like structures. The thickness and length of the central stem of BTND were ~300 nm and ~20 μm, respectively. The branchings were found to occur at irregular intervals along the main stem. Besides, the formation mechanism of BTND is proposed and discussed.

  1. NANOSCALE BARIUM HYDROSILICATES: CHOOSING THE SYNTHESIS TECHNOLOGY

    Directory of Open Access Journals (Sweden)

    GRISHINA Anna Nikolaevna

    2013-08-01

    Full Text Available Cement concretes are the most used materials in modern civil engineering. Due to that such materials draw great attention both in the Russian Federation and abroad. The possibility to enhance the manufacturability and operational properties of concretes results in significant reduction of overall operating costs. Many enhancement methods have been elaborated. Among them there is one based on introduction of calcium hydrosilicates into construction composition. The authors set up a hypothesis that similarity between properties and structures of different hydrosilicates (for example, alkaline earth metals and metals of the second group will provide similar increased operational characteristics. The specialists of Research and Educational Center «Nanotechnology» are developing cement composites nanomodification methods which include introduction of nanodimensional barium hydrosilicates particles. The synthesis of barium hydrosilicates particles can be done with the use of many technologies, different by energy consumption or performing complexity. Taking into account both these factors, one can assume that low-temperature sol-gel synthesis from diluted water solutions is the proper technology. The present paper shows that this assumption is correct. The selection of certain technology is made by the means of multiobjective optimization, which is in turn is performed by the means of linear scalarization. This method, while not always giving the Pareto optimal solutions, can be easily implemented. The particle size distribution is taken into consideration during selection of objectives and weights. It is shown that selected technology allows manufacturing nanoparticles with median size about 30 nm.

  2. 21 CFR 131.130 - Evaporated milk.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Evaporated milk. 131.130 Section 131.130 Food and... CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.130 Evaporated milk. (a) Description. Evaporated milk is the liquid food obtained by partial removal of water only from milk....

  3. 46 CFR 130.310 - Radar.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Radar. 130.310 Section 130.310 Shipping COAST GUARD... EQUIPMENT AND SYSTEMS Navigational Equipment § 130.310 Radar. Each vessel of 100 or more gross tons must be fitted with a general marine radar in the pilothouse....

  4. 7 CFR 65.130 - Consumer package.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Consumer package. 65.130 Section 65.130 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards..., PEANUTS, AND GINSENG General Provisions Definitions § 65.130 Consumer package. Consumer package means...

  5. 21 CFR 163.130 - Milk chocolate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk chocolate. 163.130 Section 163.130 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.130 Milk chocolate. (a) Description. (1) Milk chocolate...

  6. 21 CFR 135.130 - Mellorine.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Mellorine. 135.130 Section 135.130 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION FROZEN DESSERTS Requirements for Specific Standardized Frozen Desserts § 135.130 Mellorine....

  7. 40 CFR 130.11 - Program management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Program management. 130.11 Section 130... PLANNING AND MANAGEMENT § 130.11 Program management. (a) State agencies may apply for grants under sections 106, 205(j) and 205(g) to carry out water quality planning and management activities....

  8. 13 CFR 130.610 - General terms.

    Science.gov (United States)

    2010-01-01

    ... CFR 143 and applicable OMB Circulars. ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false General terms. 130.610 Section 130... § 130.610 General terms. Upon approval of the initial or renewal application, SBA will enter into...

  9. 22 CFR 130.7 - Supplier.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Supplier. 130.7 Section 130.7 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS POLITICAL CONTRIBUTIONS, FEES AND COMMISSIONS § 130.7 Supplier. Supplier means any person who enters into a contract with the Department of...

  10. 21 CFR 820.130 - Device packaging.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Device packaging. 820.130 Section 820.130 Food and... QUALITY SYSTEM REGULATION Labeling and Packaging Control § 820.130 Device packaging. Each manufacturer shall ensure that device packaging and shipping containers are designed and constructed to protect...

  11. 13 CFR 130.500 - Funding.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Funding. 130.500 Section 130.500 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS § 130.500 Funding. The SBA funds Cooperative Agreements through its internal Letter of Credit Replacement...

  12. 21 CFR 172.130 - Dehydroacetic acid.

    Science.gov (United States)

    2010-04-01

    ... Food Preservatives § 172.130 Dehydroacetic acid. The food additive dehydroacetic acid and/or its sodium... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Dehydroacetic acid. 172.130 Section 172.130 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD...

  13. 46 CFR 130.430 - Pilothouse control.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Pilothouse control. 130.430 Section 130.430 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS VESSEL CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Automation of Unattended Machinery Spaces § 130.430 Pilothouse control....

  14. 46 CFR 130.120 - Propulsion control.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Propulsion control. 130.120 Section 130.120 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS VESSEL CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Vessel Control § 130.120 Propulsion control. (a) Each vessel must have—...

  15. 7 CFR 58.130 - Health.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Health. 58.130 Section 58.130 Agriculture Regulations... Plants Approved for USDA Inspection and Grading Service 1 Personnel, Cleanliness and Health § 58.130 Health. No person afflicted with a communicable disease shall be permitted in any room or...

  16. 28 CFR 0.130 - General functions.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false General functions. 0.130 Section 0.130..., Tobacco, Firearms, and Explosives § 0.130 General functions. Subject to the direction of the Attorney... functions and powers of the Attorney General under the following provisions of law: (1) 18 U.S.C....

  17. 46 CFR 130.450 - Machinery alarms.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Machinery alarms. 130.450 Section 130.450 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS VESSEL CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Automation of Unattended Machinery Spaces § 130.450 Machinery alarms....

  18. C-130J Hercules Transport Aircraft (C-130J)

    Science.gov (United States)

    2015-12-01

    delivered a total of nineteen aircraft in CY 2015 to USG and FMS customers . Twenty-four USG and five FMS C-130J aircraft are estimated for delivery in...Appropriation Prior FY 2016 FY 2017 FY 2018 FY 2019 FY 2020 FY 2021 To Complete Total RDT&E 301.5 18.6 14.8 16.3 8.8 0.7 0.7 0.0 361.4 Procurement 10865.3...Prior FY 2016 FY 2017 FY 2018 FY 2019 FY 2020 FY 2021 To Complete Total Development 0 0 0 0 0 0 0 0 0 0 Production 0 137 14 3 0 0 0 0 15 169 PB

  19. Strengthening mechanism of steels treated by barium-bearing alloys

    Institute of Scientific and Technical Information of China (English)

    Zhouhua Jiang; Yang Liu

    2008-01-01

    The deoxidation, desulfurization, dephosphorization, microstructure, and mechanical properties of steels treated by barium-bearing alloys were investigated in laboratory and by industrial tests. The results show that barium takes part in the deoxidation reaction at the beginning of the experiments, generating oxide and sulfide compound inclusions, which easily float up from the molten steel, leading to the rapid reduction of total oxygen content to a very low level. The desulfurization and dephosphorization capabilities of calcium-bearing alloys increase with the addition of barium. The results of OM and SEM observations and mechanical property tests show that the structure of the steel treated by barium-bearing alloys is refined remarkably, the iamellar thickness of pearlitic structure decreases, and the pearlitic morphology shows clustering distribution. Less barium exists in steel substrate and the enrichment of barium-bearing precipitated phase mostly occurs in grain boundary and phase boundary, which can prevent the movement of grain boundary and dislocation during the heat treatment and the deformation processes. Therefore, the strength and toughness of barium-treated steels are improved by the effect of grain-boundary strengthening and nail-prick dislocation.

  20. 46 CFR 130.130 - Steering on OSVs of less than 100 gross tons.

    Science.gov (United States)

    2010-10-01

    ... must be installed in the pilothouse to indicate operation of the power units. (e) The auxiliary means... 46 Shipping 4 2010-10-01 2010-10-01 false Steering on OSVs of less than 100 gross tons. 130.130... VESSEL CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Vessel Control § 130.130 Steering on OSVs of...

  1. Barium concentration in grain of Aegilops and Triticum species

    Directory of Open Access Journals (Sweden)

    Denčić Srbislav S.

    2015-01-01

    Full Text Available The aim of this study was to evaluate the concentration of barium in grain of various Aegilops and Triticum species with different genomes. The studied species differed significantly with respect to the concentration of barium. The grain of wild diploid Aegilops speltoides, the donor of B genome, contained significantly higher Ba concentration than all other analyzed genotypes. Wild and cultivated tetraploid wheats (Triticum diciccoides, Triticum dicoccon, Triticum turgidum and Triticum durum had the lowest Ba concentration in grain. The modern cultivated hexaploid varieties presented substantial variation in grain concentration of barium. The highest Ba concentration (3.42 mg/kg occurred in Serbian winter wheat variety Panonnia.

  2. Chemical abundance analysis of 19 barium stars

    CERN Document Server

    Yang, G C; Spite, M; Chen, Y Q; Zhao, G; Zhang, B; Liu, G Q; Liu, Y J; Liu, N; Deng, L C; Spite, F; Hill, V; Zhang, C X

    2016-01-01

    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures, surface gravities, metallicity and microturbulent velocity) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their light elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn and Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-ca...

  3. Analysis of europium doped luminescent barium thioaluminate

    Institute of Scientific and Technical Information of China (English)

    张东璞; 喻志农; 薛唯; 章婷; 丁瞾; 王武育

    2010-01-01

    Europium-doped barium thioaluminate sputtering target was synthesized by powder sintering method and thin film was deposited by radio frequency(RF) sputtering.X-ray diffractometer(XRD) pattern indicated that the main compound of the target was BaAl4S7.Oxygen was the main impurity which led to the formation of BaAl2O4.It was shown that both BaAl4S7 and BaAl2S4 were contained in the as-grown thin films and a 471.7 nm emission peak in the PL spectra appeared due to a combination of BaAl4S7:Eu2+ and BaAl2S4:Eu2...

  4. Masses of Te130 and Xe130 and Double-β-Decay Q Value of Te130

    Science.gov (United States)

    Redshaw, Matthew; Mount, Brianna J.; Myers, Edmund G.; Avignone, Frank T., III

    2009-05-01

    The atomic masses of Te130 and Xe130 have been obtained by measuring cyclotron frequency ratios of pairs of triply charged ions simultaneously trapped in a Penning trap. The results, with 1 standard deviation uncertainty, are M(Te130)=129.906222744(16)u and M(Xe130)=129.903509351(15)u. From the mass difference the double-β-decay Q value of Te130 is determined to be Qββ(Te130)=2527.518(13)keV. This is a factor of 150 more precise than the result of the AME2003 [G. Audi , Nucl. Phys. A729, 337 (2003)NUPABL0375-947410.1016/j.nuclphysa.2003.11.003].

  5. Upper gastrointestinal barium evaluation of duodenal pathology: A pictorial review

    Institute of Scientific and Technical Information of China (English)

    Pankaj; Gupta; Uma; Debi; Saroj; Kant; Sinha; Kaushal; Kishor

    2014-01-01

    Like other parts of the gastrointestinal tract(GIT), duodenum is subject to a variety of lesions both congenital and acquired. However, unlike other parts of the GIT viz. esophagus, rest of the small intestine and large intestine, barium evaluation of duodenal lesions is technically more challenging and hence not frequently reported. With significant advances in computed tomography technology, a thorough evaluation including intraluminal, mural and extramural is feasible in a single non-invasive examination. Notwithstanding, barium evaluation still remains the initial and sometimes the only imaging study in several parts of the world. Hence,a thorough acquaintance with the morphology of various duodenal lesions on upper gastrointestinal barium examination is essential in guiding further evaluation. We reviewed our experience with various common and uncommon barium findings in duodenal abnormalities.

  6. A NOVEL HYDROTHERMAL SYNTHESIS METHOD FOR BARIUM FERRITE

    Institute of Scientific and Technical Information of China (English)

    Kang Li; Hongchen Gu; Qun Wei

    2004-01-01

    In the present work, fine barium ferrite powder has been synthesized through a one-step hydrothermal process in an autoclave at [OH-]/[Cl-] ratio of 2:1 in the temperature range from 180 to 260 ℃ using barium chloride (BaCl2), ferrous chloride (FeCl2) and potassium nitrate (KNO3) as the starting materials. Both particle size and saturation magnetization (Ms) increase with increasing hydrothermal reaction temperature, while the intrinsic coercivity (iHc) peaks at 685 Oe at 230 ℃. Morphology progress from the barium ferrite precursor particles to the barium hexaferrite particles has been monitored with increasing hydrothermal reaction time at 230 ℃ in the autoclave.

  7. Peritonite por bário Barium peritonitis

    Directory of Open Access Journals (Sweden)

    Gerson Alves Pereira Júnior

    1999-10-01

    Full Text Available We report a case of a 49 years-old man who underwent a barium meal examination for an epigastric pain. A perforated gastric ulcer with barium extravasation into peritoneal cavity was seen on X-rays. During an emergency laparotomy, a perforated pyloric ulcer was noted, along with barium contamination in the peritoneal cavity. The ulcer was closed with an omental patch and an extensive peritoneal lavage with saline was performed. During the postoperative period, the patient developed signs of peritonitis and underwent a new laparotomy was at the 9th day showing a subfrenic abscess with a large barium contamination. The patient presented septic shock and multiple organ failure. dying on the 21th day.

  8. Synthesis, photoluminescence and magnetic properties of barium vanadate nanoflowers

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Jing [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Chongqing University of Science and Technology, Chongqing 401331 (China); Hu, Chenguo, E-mail: hucg@cqu.edu.cn [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Xi, Yi [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Peng, Chen [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Wan, Buyong; He, Xiaoshan [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China)

    2011-06-15

    Graphical abstract: The flower-shaped barium vanadate was obtained for the first time. The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. Research highlights: {yields} In the paper, the flower-shaped barium vanadate were obtained for the first time. The CHM method used here is new and simple for preparation of barium vanadate. {yields} The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. The strong bluish-green emission was observed. {yields} The ferromagnetic behavior of the barium vanadate nanoflowers was found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g. {yields} The mechanisms of PL and magnetic property of barium vanadate nanoflowers have been discussed. -- Abstract: The flower-shaped barium vanadate has been obtained by the composite hydroxide mediated (CHM) method from V{sub 2}O{sub 5} and BaCl{sub 2} at 200 {sup o}C for 13 h. XRD and XPS spectrum of the as-synthesized sample indicate it is hexagonal Ba{sub 3}V{sub 2}O{sub 8} with small amount of Ba{sub 3}VO{sub 4.8} coexistence. Scan electron microscope and transmission electron microscope display that the flower-shaped crystals are composed of nanosheets with thickness of {approx}20 nm. The UV-visible spectrum shows that the barium vanadate sample has two optical gaps (3.85 eV and 3.12 eV). Photoluminescence spectrum of the barium vanadate flowers exhibits a visible light emission centered at 492 and 525 nm which might be attributed to VO{sub 4} tetrahedron with T{sub d} symmetry in Ba{sub 3}V{sub 2}O{sub 8}. The ferromagnetic behavior of the barium vanadate nanoflowers has been found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g, which is mainly due to the presence of a non

  9. Solar eclipse sign of intussusception on barium enema.

    Science.gov (United States)

    Raveenthiran, V

    2002-01-01

    The colographic appearance of intussusception is variously described as a claw sign, pincer defect, shouldering effect, and coiled-spring pattern. This report adds a new radiographic sign to the list. An end-on view of an intussusception on barium enema shows a ring of contrast resembling a solar eclipse. Familiarity with this bizarre appearance is desirable, lest it may be mistaken for spillage of barium due to a colonic perforation.

  10. Electrorheological behavior of rare earth-doped barium titanate suspensions

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Doping Y, La, Ce into barium titanate is found to be able to improve its electrorheological (ER) effect in DC electrical field. The yield stress of a typical doped barium titanate/silicone oil suspension is approximately 3.2 -*7〗kPa at 3.5 -*7〗kV/mm, which is 10 times larger than that of pure barium titanate/silicone oil suspensions. The ER effect increases with the decrease of ionic radius of rare earth (RE) dopant when RE concentration remains constant, and the suspensions exhibit a relatively high shear stress when Y, La, Ce mole fractions are 15%, 10%~15%, and 5%, respectively. Dielectric measurements show that the suitable doping with RE element increases dielectric loss of barium titanate and causes very marked dielectric relaxation at low frequency. By measuring X-ray diffraction patterns of doped barium titanate, it is considered that the occurrence of lattice distortion or defects may be responsible for the change of dielectric properties which results in the improvement of ER effect of barium titanate in DC electrical field.

  11. Lifetime Measurement for 6snp Rydberg States of Barium

    Institute of Scientific and Technical Information of China (English)

    SHEN Li; WANG Lei; YANG Hai-Feng; LIU Xiao-Jun; LIU Hong-Ping

    2011-01-01

    @@ We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states.This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence.The lifetimes determined with our method for barium Rydberg 6snp(n=37-59)series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J.Phys.B 14(1981)4489, 29(1996)655]on experiments.%We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states. This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence. The lifetimes determined with our method for barium Rydberg 6snp (n=37-59) series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J. Phys. B 14 (1981) 4489, 29 (1996) 655] onexperiments.

  12. 21 CFR 189.130 - Coumarin.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Coumarin. 189.130 Section 189.130 Food and Drugs... Direct Addition or Use as Human Food § 189.130 Coumarin. (a) Coumarin is the chemical 1,2-benzopyrone... synthesized. It has been used as a flavoring compound. (b) Food containing any added coumarin as such or as...

  13. 36 CFR 223.130 - Scope.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Scope. 223.130 Section 223... NATIONAL FOREST SYSTEM TIMBER Suspension and Debarment of Timber Purchasers § 223.130 Scope. (a) This... causes and procedures for debarment and suspension and for determining the scope, duration, and...

  14. 13 CFR 130.100 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Introduction. 130.100 Section 130.100 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS... the small business community by linking the resources of Federal, State and local governments with...

  15. 49 CFR 130.21 - Packaging requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Packaging requirements. 130.21 Section 130.21 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Packaging requirements. Each packaging used for the transportation of oil subject to this part must...

  16. 13 CFR 130.200 - Eligible entities.

    Science.gov (United States)

    2010-01-01

    ... or university; (3) A college or school of business, engineering, commerce or agriculture; (4) A... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Eligible entities. 130.200 Section 130.200 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS...

  17. 38 CFR 52.130 - Nursing services.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Nursing services. 52.130... FOR ADULT DAY HEALTH CARE OF VETERANS IN STATE HOMES Standards § 52.130 Nursing services. The program management must provide an organized nursing service with a sufficient number of qualified nursing...

  18. 38 CFR 51.130 - Nursing services.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Nursing services. 51.130... FOR NURSING HOME CARE OF VETERANS IN STATE HOMES Standards § 51.130 Nursing services. The facility management must provide an organized nursing service with a sufficient number of qualified nursing...

  19. High H- ionic conductivity in barium hydride

    Science.gov (United States)

    Verbraeken, Maarten C.; Cheung, Chaksum; Suard, Emmanuelle; Irvine, John T. S.

    2015-01-01

    With hydrogen being seen as a key renewable energy vector, the search for materials exhibiting fast hydrogen transport becomes ever more important. Not only do hydrogen storage materials require high mobility of hydrogen in the solid state, but the efficiency of electrochemical devices is also largely determined by fast ionic transport. Although the heavy alkaline-earth hydrides are of limited interest for their hydrogen storage potential, owing to low gravimetric densities, their ionic nature may prove useful in new electrochemical applications, especially as an ionically conducting electrolyte material. Here we show that barium hydride shows fast pure ionic transport of hydride ions (H-) in the high-temperature, high-symmetry phase. Although some conductivity studies have been reported on related materials previously, the nature of the charge carriers has not been determined. BaH2 gives rise to hydride ion conductivity of 0.2 S cm-1 at 630 °C. This is an order of magnitude larger than that of state-of-the-art proton-conducting perovskites or oxide ion conductors at this temperature. These results suggest that the alkaline-earth hydrides form an important new family of materials, with potential use in a number of applications, such as separation membranes, electrochemical reactors and so on.

  20. Thermal decomposition of barium valerate in argon

    DEFF Research Database (Denmark)

    Torres, P.; Norby, Poul; Grivel, Jean-Claude

    2015-01-01

    degrees C and evidence was found for the solidification of the melt at 380-440 degrees C, i.e. simultaneously with the onset of decomposition. Between 400 degrees C and 520 degrees C (Ba(C4H9CO2)(2) decomposes in two main steps, first into BaCO3 with release of C4H9COC4H9 (5-nonanone), whereas final......The thermal decomposition of barium valerate (Ba(C4H9CO2)(2)/Ba-pentanoate) was studied in argon by means of thermogravimetry, differential thermal analysis, IR-spectroscopy, X-ray diffraction and hot-stage optical microscopy. Melting takes place in two different steps, at 200 degrees C and 280...... conversion to BaO takes place with release of CO2. Elemental carbon that is left as a by-product is finally slowly burned by the residual oxygen present in the Ar atmosphere. (C) 2015 Elsevier B.V. All rights reserved....

  1. Chemical compositions of four barium stars

    CERN Document Server

    Liang, Y C; Chen, Y Q; Qiu, H M; Zhang, B

    2003-01-01

    Chemical compositions of four barium stars HD 26886, HD 27271, HD 50082 and HD 98839 are studied based on high resolution, high signal-to-noise Echelle spectra. Results show that all of them are disk stars. Their \\alpha and iron peak elements are similar to the solar abundances. The neutron-capture process elements are overabundant relative to the Solar. The heavy-element abundances of the strong Ba star HD 50082 are higher than those of other three mild Ba stars. Its mass is 1.32Msun (+0.28,-0.22Msun), and is consistent with the average mass of strong Ba stars (1.5Msun). For mild Ba star HD 27271 and HD 26886, the derived masses are 1.90Msun (+0.25,-0.20Msun) and 2.78Msun (+0.75,-0.78M_sun), respectively, which are consistent with the average mass of mild Ba stars. We also calculate the theoretical abundances of Ba stars by combining the AGB stars nucleosynthesis and wind accretion formation scenario of Ba binary systems. The comparisons between the observed abundance patterns of the sample stars with the th...

  2. Both barium and calcium activate neuronal potassium currents

    Energy Technology Data Exchange (ETDEWEB)

    Ribera, A.B.; Spitzer, N.C.

    1987-09-01

    Amphibian spinal neurons in culture possess both rapidly inactivating and sustained calcium-dependent potassium current components, similar to those described for other cells. Divalent cation-dependent whole-cell outward currents were isolated by subtracting the voltage-dependent potassium currents recorded from Xenopus laevis neurons in the presence of impermeant cadmium from the currents produced without cadmium but in the presence of permeant divalent cations. These concentrations of permeant ions were low enough to avoid contamination by macroscopic inward currents through calcium channels. Calcium-dependent potassium currents were reduced by 1 ..mu..M tetraethylammonium. These currents can also be activated by barium or strontium. Barium as well as calcium activated outward currents in young neurons (6-8 hr) and in relatively mature neurons (19-26 hr in vitro). However, barium influx appeared to suppress the sustained voltage-dependent potassium current in most cells. Barium also activated at least one class of potassium channels observed in excised membrane patches, whole blocking others. The blocking action may have masked and hindered detection of the stimulatory action of barium in other systems.

  3. Durability of Alite-calcium Barium Sulphoaluminate Cement

    Institute of Scientific and Technical Information of China (English)

    LU Lingchao; LU Zeye; LIU Shiquan; WANG Shoude; CHENG Xin

    2009-01-01

    The durability of the cement was mainly studied.Under 1.0 MPa of hydraulic pressure for 8 hours,water could penetrate completely through the sample made by portland cement,but could not penetrate through that by alite-barium sulphoaluminate cement.Under the condition of freezing and thawing cycle,the loss ratio of compressive strength of the cement was only about 17.3%at curing 28 d ages,but the loss of portland cement was as high as 29.5%.Alite-calcium bar-ium sulphoaluminate cement also has an excellent resistance to sulfate attack.The coefficients of resistance to sulfate attack of the cement exceeded 1.0.Meanwhile,the composition and microstructure of the hardened paste of alite-calcium barium sulphoaluminate cement were analyzed by XRD and SEM.

  4. Barium titanate thick films prepared by screen printing technique

    Directory of Open Access Journals (Sweden)

    Mirjana M. Vijatović

    2010-06-01

    Full Text Available The barium titanate (BaTiO3 thick films were prepared by screen printing technique using powders obtained by soft chemical route, modified Pechini process. Three different barium titanate powders were prepared: i pure, ii doped with lanthanum and iii doped with antimony. Pastes for screen printing were prepared using previously obtained powders. The thick films were deposited onto Al2O3 substrates and fired at 850°C together with electrode material (silver/palladium in the moving belt furnace in the air atmosphere. Measurements of thickness and roughness of barium titanate thick films were performed. The electrical properties of thick films such as dielectric constant, dielectric losses, Curie temperature, hysteresis loop were reported. The influence of different factors on electrical properties values was analyzed.

  5. Deoxidation Behavior of Alloys Bearing Barium in Molten Steel

    Institute of Scientific and Technical Information of China (English)

    LI Yang; JIANG Zhou-hua; JIANG Mao-fa; WANG Jun-wen; GU Wen-bing

    2003-01-01

    The deoxidation behaviors of alloys bearing barium in pipe steel were researched with MgO crucible under argon atmosphere in MoSi2 furnace at 1 873 K. The total oxygen contents of molten steel, the distribution, size and morphology of deoxidation products in the steel were surveyed. The metamorphic mechanism for deoxidation products of alloy bearing barium was also discussed. The results show that applying alloy bearing barium to the pipe steel, very low total oxygen contents can be obtained, and deoxidation products, which easily float up from molten steel, can be changed into globular shape and uniformly distributed in steel. The equilibrium time of total oxygen is about 25 min, and the terminal total oxygen contents range from 0.002 0 % to 0.002 2 % after treating with SiCa wire. The best deoxidizers are SiAlBaCa and SiAlBaCaSr.

  6. Barium-borate-flyash glasses: As radiation shielding materials

    Science.gov (United States)

    Singh, Sukhpal; Kumar, Ashok; Singh, Devinder; Thind, Kulwant Singh; Mudahar, Gurmel S.

    2008-01-01

    The attenuation coefficients of barium-borate-flyash glasses have been measured for γ-ray photon energies of 356, 662, 1173 and 1332 keV using narrow beam transmission geometry. The photon beam was highly collimated and overall scatter acceptance angle was less than 3°. Our results have an uncertainty of less than 3%. These coefficients were then used to obtain the values of mean free path (mfp), effective atomic number and electron density. Good agreements have been observed between experimental and theoretical values of these parameters. From the studies of the obtained results it is reported here that from the shielding point of view the barium-borate-flyash glasses are better shields to γ-radiations in comparison to the standard radiation shielding concretes and also to the ordinary barium-borate glasses.

  7. 75 FR 36629 - Barium Chloride From the People's Republic of China: Continuation of Antidumping Duty Order

    Science.gov (United States)

    2010-06-28

    ... International Trade Administration Barium Chloride From the People's Republic of China: Continuation of... China: Final Results of Expedited Third Sunset Review of Antidumping Duty Order, 74 FR 55814 (October 29... Barium Chloride From China, 75 FR 33824 (June 15, 2010), and Barium Chloride from China (Inv. No....

  8. Dicty_cDB: CHS130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS130 (Link to dictyBase) - - - Contig-U15941-1 CHS130P (Link to Original site) CHS1...30F 575 CHS130Z 798 CHS130P 1353 - - Show CHS130 Library CH (Link to library) Clone ID CHS1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHS1-B/CHS130Q.Seq.d/ Representative seq. ID CHS1...30P (Link to Original site) Representative DNA sequence >CHS130 (CHS130Q) /CSM/CH/CHS1-B/CHS1...DNA Score E Sequences producing significant alignments: (bits) Value CHS130 (CHS130Q) /CSM/CH/CHS1-B/CHS130Q

  9. 21 CFR 155.130 - Canned corn.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CANNED VEGETABLES Requirements for Specific Standardized Canned Vegetables § 155.130 Canned corn.... (v) Hydrolyzed vegetable protein. (vi) Autolyzed yeast extract. (vii) Nutritive...

  10. 42 CFR 130.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... RELIEF FUND PROGRAM General Provisions § 130.1 Purpose. This part establishes criteria and procedures for... human immunodeficiency virus (HIV) due to contaminated antihemophilic factor within a specified...

  11. 42 CFR 460.130 - General rule.

    Science.gov (United States)

    2010-10-01

    ...) Quality Assessment and Performance Improvement § 460.130 General rule. (a) A PACE organization must... organization. (c) A PACE organization must take actions that result in improvements in its performance in all types of care....

  12. Esophageal intramural pseudodiverticulosis characterized by barium esophagography: a case report

    LENUS (Irish Health Repository)

    O'Connor, Owen J

    2010-05-21

    Abstract Introduction Esophageal intramural pseudodiverticulosis is a rare condition characterized by the dilatation of the submucosal glands. Case presentation We present a case of esophageal intramural pseudodiverticulosis in a 72-year-old Caucasian man who presented with dysphagia and with a background history of alcohol abuse. An upper gastrointestinal endoscopy of our patient showed an esophageal stricture with abnormal mucosal appearances, but no malignant cells were seen at biopsy. Appearances on a barium esophagram were pathognomonic for esophageal intramural pseudodiverticulosis. Conclusion We demonstrate the enduring usefulness of barium esophagography in the characterization of abnormal mucosal appearances at endoscopy.

  13. Photoionization and Photoelectric Loading of Barium Ion Traps

    CERN Document Server

    Steele, A V; Churchill, L R; Griffin, P F

    2007-01-01

    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading technique that employs an in-expensive UV epoxy curing lamp to generate photoelectrons.

  14. MMIC Amplifiers for 90 to 130 GHz

    Science.gov (United States)

    Samoska, Lorene; Pukala, David; Peralta, Alejandro; Bryerton, Eric; Morgan, Matt; Boyd, T.; Hu, Ming; Schmitz, Adele

    2007-01-01

    This brief describes two monolithic microwave integrated-circuit (MMIC) amplifier chips optimized to function in the frequency range of 90 to 130 GHz, covering nearly all of F-band (90 - 140 GHz). These amplifiers were designed specifically for local-oscillator units in astronomical radio telescopes such as the Atacama Large Millimeter Array (ALMA). They could also be readily adapted for use in electronic test equipment, automotive radar systems, and communications systems that operate between 90 and 130 GHz.

  15. Barium Ferrite Films Grown By Pulsed Laser Ablation

    NARCIS (Netherlands)

    Lisfi, A.; Lodder, J.C.; Haan, de P.; Roesthuis, F.J.G.

    1998-01-01

    Abstract available only. It is known that barium ferrite (BaFe12019) can grow with perpendicular anisotropy on A1203 a single crystal substrate,' but also on an amorphous substrate by using a ZnO buffer.2 Because of its large magnetic anisotropy which can easily overcome the shape anisotropy of the

  16. Synthesis of Nanocrystalline Barium Ferrite in Ethanol/Water Media

    Institute of Scientific and Technical Information of China (English)

    M.Montazeri-Pour; A.Ataie

    2009-01-01

    Nanocrystalline particles of barium ferrite magnetic material have been prepared by co-precipitation route using aqueous and non-aqueous solutions of iron and barium chlorides with a Fe/Ba molar ratio of 11 and subsequent drying-annealing treatment. Water and ethanol/water mixture with volume ratio of 3:1 were used as solvents in the process. Coprecipitated powders were annealed at various temperatures for 1 h. FTIR (Fourier transform infrared spectroscopy), XRD (X-ray diffraction), DTA/TGA (differential thermal analy-sis/thermogravimetric analysis) and SEM (scanning electron microscopy) techniques were used to evaluate powder particle characteristics. DTA/TGA results confirmed by those obtained from XRD indicated that the formation of barium ferrite occurs in sample synthesized in ethanol/water solution at a relatively low temperature of 631℃. Nano-size particles of barium ferrite with mean particle size of almost 75 and 100 nm were observed in the SEM micrographs of the samples synthesized in ethanol/water solution after annealing at 700 and 800℃ for 1 h, respectively.

  17. Heavy ion recoil spectrometry of barium strontium titanate films

    Science.gov (United States)

    Stannard, W. B.; Johnston, P. N.; Walker, S. R.; Bubb, I. F.; Scott, J. F.; Cohen, D. D.; Dytlewski, N.; Martin, J. W.

    1995-05-01

    Thin films of barium strontium titanate have been analysed using heavy ion recoil spectrometry with 77 and 98 MeV 127I ions at the new heavy ion recoil facility at ANSTO, Lucas Heights. New calibration procedures have been developed for quantitative analysis. Energy spectra for each of the elements present reveal interdiffusion that was not previously known.

  18. Magnetoelastic coupling in epitaxial cobalt ferrite/barium titanate heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Gräfe, Joachim; Welke, Martin [Wilhelm-Ostwald-Institut für Physikalische und Theoretische Chemie, Universität Leipzig, Linnéstraße 2, 04103 Leipzig (Germany); Bern, Francis; Ziese, Michael [Institut für Experimentelle Physik II, Universität Leipzig, Linnéstraße 5, 04103 Leipzig (Germany); Denecke, Reinhard, E-mail: denecke@uni-leipzig.de [Wilhelm-Ostwald-Institut für Physikalische und Theoretische Chemie, Universität Leipzig, Linnéstraße 2, 04103 Leipzig (Germany)

    2013-08-15

    Ultra-thin cobalt ferrite films have been synthesised on ferroelectric barium titanate crystals. The cobalt ferrite films exhibit a magnetic response to strain induced by structural changes in the barium titanate substrate, suggesting a pathway to multiferroic coupling. These structural changes are achieved by heating through the phase transition temperatures of barium titanate. In addition the ferromagnetic signal of the substrate itself is taken into account, addressing the influence of impurities or defects in the substrate. The cobalt ferrite/barium titanate heterostructure is a suitable oxidic platform for future magnetoelectric applications with an established ferroelectric substrate and widely tuneable magnetic properties by changing the transition metal in the ferrite film. - Highlights: ► Ultra-thin CoFe{sub 2}O{sub 4} films grown on ferroelectric BaTiO{sub 3} crystals by PLD. ► Magnetic response to structural changes of BaTiO{sub 3} at transition temperatures. ► Significant magneto-elastic coupling of in-plane magnetisation in SQUID experiments. ► Clear distinction between contribution by BaTiO{sub 3} substrate and by CoFe{sub 2}O{sub 4} film.

  19. CNO and F abundances in the barium star HD 123396

    CERN Document Server

    Alves-Brito, Alan; Yong, David; Meléndez, Jorge; Vásquez, Sergio

    2011-01-01

    [Abridged] Barium stars are moderately rare chemically peculiar objects which are believed to be the result of the pollution of an otherwise normal star by material from an evolved companion on the asymptotic giant branch (AGB). We aim to derive carbon, nitrogen, oxygen, and fluorine abundances for the first time from infrared spectra of the barium red giant star HD 123396 to quantitatively test AGB nucleosynthesis models for producing barium stars via mass accretion. High-resolution and high S/N infrared spectra were obtained using the Phoenix spectrograph mounted at the Gemini South telescope. The abundances were obtained through spectrum synthesis of individual atomic and molecular lines, using the MOOG stellar line analysis program together with Kurucz's stellar atmosphere models. The analysis was classical, using 1D stellar models and spectral synthesis under the assumption of local thermodynamic equilibrium. We confirm that HD 123396 is a metal-deficient barium star ([Fe/H] = -1.05), with A(C) = 7.88, A...

  20. Excitation energies of barium oxide bands measured in flames

    NARCIS (Netherlands)

    Hurk, J. van der; Hollander, Tj.; Alkemade, C.T.J.

    1975-01-01

    Experiments are described that yield additional information about the excitation energy of visible barium oxide bands appearing in flames. Excitation energy differences are derived directly from the ratios of thermal band intensities as a function of temperature and agree with the value calculated f

  1. Flexoelectricity in barium strontium titanate thin film

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Seol Ryung; Huang, Wenbin; Yuan, Fuh-Gwo; Jiang, Xiaoning, E-mail: xjiang5@ncsu.edu [Department of Mechanical and Aerospace Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States); Shu, Longlong [Department of Mechanical and Aerospace Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States); Electronic Materials Research Laboratory, International Center for Dielectric Research, Xi' an Jiao Tong University, Xi' an, Shaanxi 710049 (China); Maria, Jon-Paul [Department of Material Science and Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States)

    2014-10-06

    Flexoelectricity, the linear coupling between the strain gradient and the induced electric polarization, has been intensively studied as an alternative to piezoelectricity. Especially, it is of interest to develop flexoelectric devices on micro/nano scales due to the inherent scaling effect of flexoelectric effect. Ba{sub 0.7}Sr{sub 0.3}TiO{sub 3} thin film with a thickness of 130 nm was fabricated on a silicon wafer using a RF magnetron sputtering process. The flexoelectric coefficients of the prepared thin films were determined experimentally. It was revealed that the thin films possessed a transverse flexoelectric coefficient of 24.5 μC/m at Curie temperature (∼28 °C) and 17.44 μC/m at 41 °C. The measured flexoelectric coefficients are comparable to that of bulk BST ceramics, which are reported to be 10–100 μC/m. This result suggests that the flexoelectric thin film structures can be effectively used for micro/nano-sensing devices.

  2. 13 CFR 130.430 - Application decisions.

    Science.gov (United States)

    2010-01-01

    ... and applicable remedies shall be specified as special terms and conditions in the Cooperative Agreement. Upon approval or conditional approval, the Grants Management specialist may issue a Cooperative... right to discontinue funding the SBDC, subject to the provisions of § 130.700....

  3. Konstantin Päts 130 / Peep Pillak

    Index Scriptorium Estoniae

    Pillak, Peep, 1957-

    2004-01-01

    23. veebruaril 2004 möödus 130 aastat EV presidendi Konstantin Pätsi sünnist. Ülevaade üritustest, mida tähtpäeva puhul korraldas Konstantin Pätsi Muuseum - 22. veebruaril peetud ajalookonverentsist, näitusest Tallinna Pedagoogikaülikooli Akadeemilises Raamatukogus ja mälestustseremooniast Tallinna Metsakalmistul

  4. 24 CFR 901.130 - Incentives.

    Science.gov (United States)

    2010-04-01

    ... HOUSING MANAGEMENT ASSESSMENT PROGRAM § 901.130 Incentives. (a) A PHA that is designated high performer or... the right decision that impacts long-term overall management or the quality of a PHA's housing stock... independent auditor (IA) audits. (2) Office of Inspector General (OIG) audits or investigations will...

  5. Design, testing, fabrication and launch support of a liquid chemical barium release payload (utilizing the liquid fluorine-barium salt/hydrazine system)

    Science.gov (United States)

    Stokes, C. S.; Smith, E. W.; Murphy, W. J.

    1972-01-01

    A payload was designed which included a cryogenic oxidizer tank, a fuel tank, and burner section. Release of 30 lb of chemicals was planned to occur in 2 seconds at the optimum oxidizer to fuel ratio. The chemicals consisted of 17 lb of liquid fluorine oxidizer and 13 lb of hydrazine-barium salt fuel mixture. The fuel mixture was 17% barium chloride, 16% barium nitrate, and 67% hydrazine, and contained 2.6 lb of available barium. Two significant problem areas were resolved during the program: explosive valve development and burner operation. The release payload was flight tested, from Wallops Island, Virginia. The release took place at an altitude of approximately 260 km. The release produced a luminous cloud which expanded very rapidly, disappearing to the human eye in about 20 seconds. Barium ion concentration slowly increased over a wide area of sky until measurements were discontinued at sunrise (about 30 minutes).

  6. Electromagnetic properties of carbon black and barium titanate composite materials

    Energy Technology Data Exchange (ETDEWEB)

    Wang Guiqin [School of Material Science and Engineering, Dalian University of Technology, Dalian 116023 (China)], E-mail: c2b2chen@163.com; Chen Xiaodong; Duan Yuping; Liu Shunhua [School of Material Science and Engineering, Dalian University of Technology, Dalian 116023 (China)

    2008-04-24

    Nanocrystalline carbon black/barium titanate compound particle (CP) was synthesized by sol-gel method. The phase structure and morphology of compound particle were investigated by X-ray diffraction (XRD), transmission electron microscope (TEM) and Raman spectrum measurements, the electroconductivity was test by trielectrode arrangement and the precursor powder was followed by differential scanning calorimetric measurements (DSC) and thermal gravimetric analysis (TGA). In addition, the complex relative permittivity and permeability of compound particle were investigated by reflection method. The compound particle/epoxide resin composite (CP/EP) with different contents of CP were measured. The results show barium titanate crystal is tetragonal phase and its grain is oval shape with 80-100 nm which was coated by carbon black film. As electromagnetic (EM) complex permittivity, permeability and reflection loss (RL) shown that the compound particle is mainly a kind of electric and dielectric lossy materials and exhibits excellent microwave absorption performance in the X- and Ku-bands.

  7. HYBRID AND CHARACTERISTIC OF POLYANILINE- BARIUM TITANATE NANOCOMPOSITE PARTICLES

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Polyaniline-barium titanate (PAn-BaTiO3) ultrafine composite particles were prepared by the oxidative polymerization of aniline with H2O2 while barium titanate nanoparticles were synthesized with a sol-gel method. The infrared spectrogram shows that the polymerization of PAn in the hybrid process of PAn-BaTiO3 is similar with the polymeric process of pure aniline, and there is interaction of PAn and BaTiO3 in the PAn-BaTiO3. SEM and TEM results show that the average diameter of the composite particles is 1.50 μm and the diameters of BaTiO3 nanoparticles are 5-15 nm in the composite particle. The electrical conductivity of the ultrafine composite particles is transformable from 100 to 10-11S/cm by equilibrium doping or dedoping method using various concentration of HCl or NaOH solutions.

  8. The crystal growth of barium flouride in aqueous solution

    Science.gov (United States)

    Barone, J. P.; Svrjcek, D.; Nancollas, G. H.

    1983-06-01

    The kinetics of growth of barium flouride seed crystals were investigated in aqueous solution at 25°C using a constant composition method, in which the supersaturation and ionic strength were maintained constant by the addition of titrants consisting of barium nitrate and potassium flouride solutions. The rates of reaction, studied over a range of supersaturation (σ ≈ 0.4 to 1.0), were interpreted in terms of crystal growth models. A spiral growth mechanism best describes the data, and scanning electron microscopy indicates a three-dimensional growth. In the presence of inorganic additives such as phosphate, however, induction periods precede a morphological two-dimensional crystallization. Coulter Counter results show little crystal agglomeration.

  9. Particularities of Radiation Defect Formation in Ceramic Barium Cerate

    Science.gov (United States)

    Khromushin, I. V.; Aksenova, T. I.; Tuseev, T.; Munasbaeva, K. K.; Ermolaev, Yu V.; Ermolaev, V. N.; Seitov, A. S.

    2015-04-01

    The effects of irradiation with electrons, ions of noble gases (Ne, Ar, Kr) and oxygen on the structure and properties of neodymium-doped barium cerate have been studied using the methods of X-ray diffraction analysis, scanning electron and atomic force microscopy, thermal desorption spectroscopy. It was shown that irradiation by low-energy ions of noble gases stimulates the blistering processes on the sample surface, while the high-energy ions contribute to formation of the structures on the irradiated surface that resemble the various stages of spherulitegrowth. The similar structures were not observed in the case of irradiation with high-energy oxygen ions. According to the data on thermal desorption of water and oxygen molecules from the irradiated barium cerate it was supposed that irradiation by the noble gas ions promotes neodymium oxidation state change. It was noticed that the electron irradiation leads to the formation of the nano-sized acicular structures on the cerate surface.

  10. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine

    Science.gov (United States)

    Graziana Genchi, Giada; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni

    2016-06-01

    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these ‘smart’ nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation.

  11. Stark spectrum of barium in highly excited Rydberg states

    Institute of Scientific and Technical Information of China (English)

    Yang Hai-Feng; Gao Wei; Cheng Hong; Liu Xiao-Jun; Liu Hong-Ping

    2013-01-01

    We present observations of Stark spectra of barium in highly excited Rydberg states in the energy region around n =35.The one-photon excitation concerns the π transition.The observed Stark spectra at electric fields ranging from 0 to 60 V·cm-1 are well explained by the diagonalization of the Hamiltonian incorporating the core effects.From the Stark maps,the anti-crossings between energy levels are identified experimentally and theoretically.The time of flight spectra at the specified Stark states are recorded,where the deceleration and acceleration of barium atoms are observed.This is very consistent with the prediction derived from the Stark maps from the point of view of energy conservation.

  12. Acute barium intoxication following ingestion of soap water solution

    Directory of Open Access Journals (Sweden)

    Nandita Joshi

    2012-01-01

    Full Text Available We present a rare case in which a young girl ingested a solution of a hair-removing soap. The ingestion resulted in profound hypokalemia and severe acidosis leading to flaccid paralysis, respiratory arrest and ventricular arrhythmias. Ultimately the patient made complete recovery. The soapwas found to contain barium sulfide. The degree of paralysis and acidosis appeared to be directly related to serum potassium levels.

  13. Complex Impedance Studies of Optically Excited Strontium Barium Niobate

    Science.gov (United States)

    2007-11-02

    has a tetragonal tungsten - bronze structure. The unit cell for this structure, illustrated below in Fig. 2.1, consists of ten oxygen octahedra joined...4 Kittel, pp. 373-374. 5 P. B. Jamieson, et al, “Ferroelectric Tungsten Bronze -Type Crystal Structures. I. Barium Strontium Niobate...Oxford, 1987). 2. C. Kittel, Introduction to Solid State Physics, (Wiley, New York, 1986). 3. P. B. Jamieson, et al, “Ferroelectric Tungsten

  14. Barium thiolates and selenolates: syntheses and structural principles.

    Science.gov (United States)

    Ruhlandt-Senge, K; Englich, U

    2000-11-17

    The synthesis and structural characterization of a family of barium thiolates and selenolates is described. The thiolates were synthesized by metallation of thiols, the selenolates by reductive insertion of the metal into the selenium-selenium bond of diorganodiselenides. Both reaction sequences were carried out by using barium metal dissolved in ammonia; this afforded barium thiolates and selenolates in good yield and purity. The structural principles displayed in the target compounds span a wide range of solid-state formulations, including monomeric and dimeric species, and separated ion triples, namely [Ba(thf)4(SMes*)2] (1; Mes* = 2,4,6-tBU3C6H2), [Ba(thf)4(SeMes*)2] (2), [Ba([18]crown-6)(hmpa)2][(SeMes*)2] (3), the dimeric [(Ba(py)3(thf)(SeTrip)2)2] (4; py = pyridine, Trip = 2,4.6-iPr3C6H2), and [Ba([18]crown-6)(SeTrip)2] (5). The full range of association modes is completed by [Ba([18]crown-6)(hmpa)SMes*][SMes*] (6) communicated earlier by this group. In the solid state, this compound displays an intermediate ion coordination mode: one anion is bound to the metal, while the second one is unassociated. Together these compounds provide structural information about all three different association modes for alkaline earth metal derivatives. This collection of structural data allows important conclusions about the influence of solvation and ligation on structural trends.

  15. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    OpenAIRE

    Mong, B.; Cook, S; Walton, T.; Chambers, C.; Craycraft, A.; Benitez-Medina, C.; Hall, K.; Fairbank Jr., W.; Albert, J. B.; Auty, D. J.; Barbeau, P. S.; Basque, V.; Beck, D.; Breidenbach, M.; Brunner, T.

    2014-01-01

    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fl...

  16. Preparation of nanosized barium zirconate powder by precipitation in aqueous solution

    OpenAIRE

    Boschini, Frédéric; Guillaume, Bernard; Rulmont, André; Cloots, Rudi

    2004-01-01

    Several ways were explored to synthesize barium zirconate by soft chemistry methods in aqueous solution. In the first method the synthesis of barium zirconate was initiated by urea decomposition, through an homogeneous precipitation of barium and zirconium salts followed by a "low temperature" thermal treatment. The kinetic of the reaction and the optimum urea/cation ratio have been determined by means of X-ray diffraction and Inductive Coupled Plasma analyses. It has been demonstrated that a...

  17. Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, Weitang; Zhang, Zhiyong; Liu, Jinbo; Li, Zhen; Song, Junmin; Wu, Changcai [Department of Colorectal Surgery, The First Affiliated Hospital and Institute of Clinical Medicine, Zhengzhou University, 450052 Zhengzhou (China); Wang, Guixian, E-mail: guixianwang@hotmail.com [Department of Colorectal Surgery, The First Affiliated Hospital and Institute of Clinical Medicine, Zhengzhou University, 450052 Zhengzhou (China)

    2012-09-15

    Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation.

  18. Sponge-associated bacteria mineralize arsenic and barium on intracellular vesicles

    Science.gov (United States)

    Keren, Ray; Mayzel, Boaz; Lavy, Adi; Polishchuk, Iryna; Levy, Davide; Fakra, Sirine C.; Pokroy, Boaz; Ilan, Micha

    2017-01-01

    Arsenic and barium are ubiquitous environmental toxins that accumulate in higher trophic-level organisms. Whereas metazoans have detoxifying organs to cope with toxic metals, sponges lack organs but harbour a symbiotic microbiome performing various functions. Here we examine the potential roles of microorganisms in arsenic and barium cycles in the sponge Theonella swinhoei, known to accumulate high levels of these metals. We show that a single sponge symbiotic bacterium, Entotheonella sp., constitutes the arsenic- and barium-accumulating entity within the host. These bacteria mineralize both arsenic and barium on intracellular vesicles. Our results indicate that Entotheonella sp. may act as a detoxifying organ for its host. PMID:28233852

  19. Effects of powdered versus liquid barium on the viscosity of fluids used in modified swallow studies

    Energy Technology Data Exchange (ETDEWEB)

    Baron, J.; Alexander, T. [Univ. of Alberta, Dept. of Radiology, Edmonton, Alberta (Canada)

    2003-06-01

    To determine if the viscosity of thickened juice mixtures used in modified barium swallow studies significantly changes with the addition of powdered barium. We also describe a test formulation created using liquid barium, which has a negligible effect on juice viscosity. The viscosities of water and standardized honey- and nectar-consistency juices mixed with different amounts of powdered barium were measured by timing the laminar flow of a given initial hydrostatic head of fluid under gravity though an orifice of fixed diameter. Standardized juices were then mixed with a liquid formulation of barium and with measured quantities of water to produce viscosities that more closely equated with those of the standardized juices. With the addition of powdered barium, viscosity increased in all fluids, most markedly with the nectar-consistency juice. Liquid barium formulations maintained the viscosities of the original thickened juices. Rendering juices radio-opaque with barium powder results in dramatic increases in the viscosity of the resulting mixture and compromises diagnostic accuracy. Liquid barium preparations have the advantage that they can be rapidly and accurately dispensed by syringe, and their use does not significantly increase the viscosity of the preparation. (author)

  20. C-130J Breathing Resistance Study

    Science.gov (United States)

    2016-05-01

    flows used in the study . The simulated workloads were: 1) 60 ALPM: Rest; 2) 90 ALPM: Light Work ; 3) 125 ALPM: Moderate Work ; and 4) 150 ALPM...AFRL-RH-WP-TR-2016-0040 C-130J BREATHING RESISTANCE STUDY George W. Miller Air Force Research Laboratory Wright-Patterson Air...ASSIGNED DISTRIBUTION STATEMENT. //signed// //signed// GEORGE W. MILLER SCOTT M. GALSTER Work Unit Manager Chief, Applied

  1. BARIUM SULPHATE ABSORPTION AND THE SERUM DIAGNOSIS OF SYPHILIS.

    Science.gov (United States)

    Noguchi, H; Bronfenbrenner, J

    1911-02-01

    The so-called syphilitic antibodies can be removed from a serum by means of absorption with barium sulphate. The removal is due either to an adsorption or a mechanical absorption. The activity of the syphilitic antibodies is thereby unimpaired. The readiness with which the absorption is accomplished with barium sulphate varies considerably with different syphilitic sera. That barium sulphate exerts the same absorbing effect upon non-syphilitic serum components is made evident by the interfering property which the latter manifest in the absorption experiment of the syphilitic antibodies. The selective removal of the serum components, other than the syphilitic antibodies, by means of barium sulphate absorption is, therefore, impossible. On the other hand, a partial removal of these components, with but little removal of the syphilitic antibodies, may be effected when the content of a given serum is poor in syphilitic antibodies and comparatively rich in the indifferent serum components. But this is impossible if the conditions are reversed. The main reasons why some negative syphilitic sera may be so modified by the barium sulphate treatment as to give positive reactions, are explained below, but these apply only to those methods in which inactivated serum is employed. The inactivation reduces the antibody content to about one-fourth to one-fifth of the original. When the serum is very rich in antibodies, this does not affect the result of the fixation test. But when the amount of the antibodies is small, the process of inactivation creates conditions quite unexpected. It may produce such a condition that a given amount of the serum contains, after inactivation, only one or two antibody units, while the other serum components remain undiminished. Here one must not lose sight of the vital fact that these apparently indifferent serum constituents are not at all indifferent in the fixation processes. They may possess affinities which are similar to those of complement

  2. 铝酸钡与氢氧化钡脱硫过程比较%Comparison of Barium Aluminate and Barium Hydroxide Desulfurization Process

    Institute of Scientific and Technical Information of China (English)

    张念炳; 黎志英; 丁彤

    2012-01-01

    The seed precipitation liquor was desulfurized with barium aluminate and barium hydroxide respectively. The desulfurization slag was characterized by XRD analysis, and the desulfurization process was compared. The results show that barium hydroxide exceeds barium aluminate with better desulfurization in terms of effect, speed and duration. In the desulfurization process with barium aluminate, 2BaO · Al2O3 · 5H2O is firstly produced in the reaction of barium aluminate with alkali, and then it reacts with sodium sulfate and sodium carbonate. To compare, Ba(OH)2 · 8H2O directly reacts with sodium sulfate and sodium carbonate in the desulfurization process with barium hydroxide. Both of desulfurization reaction processes can be described with "shrinking core model".%用铝酸钡和氢氧化钡对种分母液进行脱硫试验,对脱硫渣进行XRD分析,并比较脱硫过程.结果表明,氢氧化钡的脱硫效果更好,脱硫完成时间更短,速率更快;铝酸钡先与碱液反应生成2BaO·Al2O3·5H2O,再与硫碱和碳碱反应,而氢氧化钡直接与硫碱和碳碱反应,脱硫过程均可用未反应核模型描述.

  3. Barium isotopic composition of mainstream silicon carbides from Murchison: Constraints for s-process nucleosynthesis in asymptotic giant branch stars

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Nan; Davis, Andrew M.; Pellin, Michael J.; Dauphas, Nicolas [Department of the Geophysical Sciences, The University of Chicago, Chicago, IL 60637 (United States); Savina, Michael R. [Chicago Center for Cosmochemistry, Chicago, IL 60637 (United States); Gallino, Roberto; Bisterzo, Sara [Dipartimento di Fisica, Università di Torino, I-10125 Torino (Italy); Straniero, Oscar; Cristallo, Sergio [INAF–Osservatorio Astronomico di Collurania, via Maggini snc, I-64100 Teramo (Italy); Gyngard, Frank [Laboratory for Space Sciences, Washington University, St. Louis, MO 63130 (United States); Willingham, David G. [Materials Science Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Pignatari, Marco [Department of Physics, University of Basel, Basel CH-4056 (Switzerland); Herwig, Falk, E-mail: lnsmile@uchicago.edu [Department of Physics and Astronomy, University of Victoria, Victoria, BC V8P5C2 (Canada)

    2014-05-01

    We present barium, carbon, and silicon isotopic compositions of 38 acid-cleaned presolar SiC grains from Murchison. Comparison with previous data shows that acid washing is highly effective in removing barium contamination. Strong depletions in δ({sup 138}Ba/{sup 136}Ba) values are found, down to –400‰, which can only be modeled with a flatter {sup 13}C profile within the {sup 13}C pocket than is normally used. The dependence of δ({sup 138}Ba/{sup 136}Ba) predictions on the distribution of {sup 13}C within the pocket in asymptotic giant branch (AGB) models allows us to probe the {sup 13}C profile within the {sup 13}C pocket and the pocket mass in AGB stars. In addition, we provide constraints on the {sup 22}Ne(α, n){sup 25}Mg rate in the stellar temperature regime relevant to AGB stars, based on δ({sup 134}Ba/{sup 136}Ba) values of mainstream grains. We found two nominally mainstream grains with strongly negative δ({sup 134}Ba/{sup 136}Ba) values that cannot be explained by any of the current AGB model calculations. Instead, such negative values are consistent with the intermediate neutron capture process (i process), which is activated by the very late thermal pulse during the post-AGB phase and characterized by a neutron density much higher than the s process. These two grains may have condensed around post-AGB stars. Finally, we report abundances of two p-process isotopes, {sup 130}Ba and {sup 132}Ba, in single SiC grains. These isotopes are destroyed in the s process in AGB stars. By comparing their abundances with respect to that of {sup 135}Ba, we conclude that there is no measurable decay of {sup 135}Cs (t {sub 1/2} = 2.3 Ma) to {sup 135}Ba in individual SiC grains, indicating condensation of barium, but not cesium into SiC grains before {sup 135}Cs decayed.

  4. Barium Swallow Findings in the Evaluation of Patients with Dysphagia

    Directory of Open Access Journals (Sweden)

    Amirhosein Hashemi Attar

    2011-05-01

    Full Text Available Background/Objective: Dysphagia is a subjective"nsensation of difficulty in swallowing that has a wide"nrange of etiologies from psychosomatic disorders"nto high grade neoplasms. In this study we evaluated"nbarium swallow findings of patients with dysphagia."nPatients and Methods: We evaluated 200 patients"n(117 men, 83 women; mean age, 49.6 years with"ncomplaint of dysphagia. Fluoroscopic barium"nswallow was done for all the patients and they were"nreviewed for primary peristalsis (presence or absence,"nAbstracts"nS62 Iran J Radiol 2011, 8 (Supp.1"nAbstracts"nimpaired lower esophageal sphincter, esophageal dilatation, delayed emptying of barium, nonperistaltic contractions, stricture and filling defects. Clinical and in some cases endoscopic or manometric follow up was done for all patients."nResults: We had 134 (67% normal barium swallow"nexams with uncomplicated clinical courses. Sixty"nsix patients (33% had abnormal imaging findings"nincluding stricture in 24 patients (12%, filling defect"nin 12 patients (6% and mucosal abnormality in 14"n(7% patients (six cases of mucosal irregularity, three"ncases of mucosal ulceration and five cases of mucosal"nherniation, Bird's beak sign in three patients (1.5%,"ntertiary spasm in six patients (3% and hiatal hernia in"nseven patients (3.5%."nConclusion: In the majority of patients with dysphagia,"nbarium swallow is the only paraclinical study needed"nto plan proper treatment. If radiographic findings are"nequivocal, endoscopy or manometry may be required"nfor more certain diagnosis.

  5. New efficient catalyst for ammonia synthesis: barium-promoted cobalt on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus

    2002-01-01

    Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia......Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia...

  6. Obtaining of Nanostructured Powders of Barium and Strontium Hexaferrite by the Polymer Precursor Method

    Directory of Open Access Journals (Sweden)

    V.G. Kostishyn

    2015-12-01

    Full Text Available Studied the possibility of obtaining by precursors in the polymer nanostructured powders of barium hexaferrite BaFe12O19 and strontium hexaferrite SrFe12O19. The reagents were used as starting barium nitrate, strontium nitrate and ferric nitrate nonahydrate (III, and polyethylene glycol-400 used this technology as a polymer.

  7. Control on Crystal Forms of Ultrafine Barium Carbonate Particles and Study on its Mechanism

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Barium carbonate particles were prepared by using homogeneous precipitation method and co-precipitation method respectively. Through adding different crystalline controlling modifiers, Barium carbonate particles in five different shapes including linear, needle-like, pillarlike, sphere-like and dumbbell-like were synthesized. These particles were characterized by SEM and XRD, and their synthetic mechanism was discussed in this paper.

  8. Investigation on the effects of milling atmosphere on synthesis of barium ferrite/magnetite nanocomposite

    NARCIS (Netherlands)

    Molaei, M.J.; Ataie, A.; Raygan, S.; Picken,n S.J.

    2011-01-01

    In this research, barium ferrite /magnetite nanocomposites synthesized via a mechano-chemical route. Graphite was used in order to reduce hematite content of barium ferrite to magnetite to produce a magnetic nanocomposite. The effects of processing conditions on the powder characteristics were inves

  9. 46 CFR 130.330 - Charts and nautical publications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 130.330 Section 130... CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Navigational Equipment § 130.330 Charts and nautical... voyage, each vessel must carry adequate and up-to-date— (1) Charts of large enough scale to make...

  10. 21 CFR 176.130 - Anti-offset substances.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Anti-offset substances. 176.130 Section 176.130... for Use Only as Components of Paper and Paperboard § 176.130 Anti-offset substances. Substances named... in printing and decorating paper and paperboard used for food packaging in accordance with...

  11. 13 CFR 130.600 - Cooperative agreement. [Reserved

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Cooperative agreement. 130.600 Section 130.600 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS § 130.600 Cooperative agreement....

  12. 13 CFR 130.400 - Application procedure. [Reserved

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Application procedure. 130.400 Section 130.400 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS § 130.400 Application procedure....

  13. 7 CFR 1.130 - Meaning of words.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Meaning of words. 1.130 Section 1.130 Agriculture... Adjudicatory Proceedings Instituted by the Secretary Under Various Statutes § 1.130 Meaning of words. As used in this subpart, words in the singular form shall be deemed to import the plural, and vice versa,...

  14. 50 CFR 600.130 - Protection of confidentiality of statistics.

    Science.gov (United States)

    2010-10-01

    ... statistics. 600.130 Section 600.130 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... Fishery Management Councils § 600.130 Protection of confidentiality of statistics. Each Council must establish appropriate procedures for ensuring the confidentiality of the statistics that may be submitted...

  15. 41 CFR 105-8.130 - General prohibitions against discrimination.

    Science.gov (United States)

    2010-07-01

    ... against discrimination. 105-8.130 Section 105-8.130 Public Contracts and Property Management Federal... § 105-8.130 General prohibitions against discrimination. (a) No qualified individual with handicaps... otherwise be subjected to discrimination under any program or activity conducted by the agency. (1)...

  16. 13 CFR 107.130 - Requirement for qualified management.

    Science.gov (United States)

    2010-01-01

    ... management. 107.130 Section 107.130 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS INVESTMENT COMPANIES Qualifying for an SBIC License Organizing An Sbic § 107.130 Requirement for qualified management. When applying for a license, you must show, to the satisfaction of SBA, that...

  17. 46 CFR 130.460 - Placement of machinery alarms.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Placement of machinery alarms. 130.460 Section 130.460..., AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Automation of Unattended Machinery Spaces § 130.460 Placement of machinery alarms. (a) Visible and audible alarms must be installed at the pilothouse to...

  18. A barium-rich binary central star in Abell 70

    CERN Document Server

    Boffin, Henri M J; Frew, D J; Acker, A; Köppen, J; Moffat, A F J; Parker, Q A

    2011-01-01

    We have found the central star of Abell 70 (PN G038.1-25.4, hereafter A 70) to be a binary consisting of a G8 IV-V secondary and a hot white dwarf. The secondary shows enhanced Ba II and Sr II features, firmly classifying it as a barium star. The nebula is found to have Type-I chemical abundances with helium and nitrogen enrichment, which combined with future abundance studies of the central star, will establish A 70 as a unique laboratory for studying s-process AGB nucleosynthesis.

  19. Spectroscopic properties of trivalent praseodymium in barium yttrium fluoride

    Energy Technology Data Exchange (ETDEWEB)

    Di Bartolo, B. E-mail: dibartob@bc.edurinodiba@attbi.com; Bowlby, B.E

    2003-05-01

    We have conducted a spectroscopic investigation of Pr{sup 3+} in barium yttrium fluoride (BaY{sub 2}O{sub 8}). Two doping concentrations were used: BaY{sub 2}F{sub 8}:Pr{sup 3+} (0.3%) and BaY{sub 2}F{sub 8}:Pr{sup 3+} (1%). The measurements included absorption, luminescence under continuous and pulsed excitations, and thermal effects on some sharp lines. The experimental results were used to characterize this system.

  20. The Kerr nonlinearity of the beta-barium borate crystal

    DEFF Research Database (Denmark)

    Bache, Morten; Guo, Hairun; Zhou, Binbin;

    2013-01-01

    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond...... experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e. generate a self-defocusing Kerr-like nonlinearity. However, the material Kerr nonlinearity nI 2...

  1. Preparation of nanosized barium zirconate powder by thermal decomposition of urea in an aqueous solution containing barium and zirconium, and by calcination of the precipitate

    OpenAIRE

    Boschini, Frédéric; Robertz, B.; Rulmont, André; Cloots, Rudi

    2003-01-01

    The synthesis of barium zirconate was initiated by urea induced homogeneous precipitation followed by a "low temperature" thermal treatment. The kinetic of the reaction and the optimum urea/cation ratio have been determined by means of X-ray diffraction and Inductive Coupled Plasma analyses. It has been demonstrated that an amorphous zirconium hydrated oxide starts to precipitate followed by the precipitation of barium carbonate. A calcination at 1200 degreesC during 2 h gives rise to the for...

  2. Temperature dependence dielectric properties of modified barium titanate-PVB composites

    Science.gov (United States)

    Joshi, N. J.; Rakshit, P. B.; Grewal, G. S.; Shrinet, V.; Pratap, A.

    2013-06-01

    In this work, attempts are made to prepare ceramic polymer-composite followed by characterization of dielectric properties. The Barium Titanate ceramic powders are synthesized using the hydrothermal process. Silane treatment is carried out on Barium Titanate powder to increase its compatibility with polymer, followed with preparation of ceramic-polymer composite. Polyvinyl Butyral (PVB) is used as matrix for preparation of the composites and the concentration of Barium Titanate is increased from 60 to 90 wt%. Dielectric properties such as volume resistivity, dielectric constant, dissipation factor are evaluated. Results indicate that the dielectric constant and dissipation factor vary between 52 to 120 and 0.01 to 0.07; respectively as the relative ratio of polymer and silane modified Barium Titanate is varied. Specifically, at 90 wt% of silane modified Barium Titanate, the highest dielectric constant of 123 along with dissipation factor of 0.07 is obtained.

  3. Barium Tagging in Liquid Xenon for the nEXO Experiment

    Science.gov (United States)

    Kravitz, Scott; nEXO Collaboration

    2016-09-01

    nEXO is a next-generation experiment designed to search for neutrinoless double beta decay of xenon-136 in a liquid xenon time projection chamber. Positive observation of this decay would determine the neutrino to be a MAJORANA particle, as well as measure the absolute neutrino mass scale. In order to greatly reduce background contributions to this search, the collaboration is developing several ``barium tagging'' techniques to recover and identify the decay daughter, barium-136. Barium tagging may be available for a second phase of nEXO operation, allowing for neutrino mass sensitivity beyond the inverted mass hierarchy. Tagging methods for this phase include barium-ion capture on a probe with identification by resonance ionization laser spectroscopy. Inclusion of an argon ion gun in this system allows for improved cleaning and preparation of the barium deposition substrate, with recent results reported in this presentation.

  4. Anion and cation diffusion in barium titanate and strontium titanate; Anionen- und Kationendiffusion in Barium- und Strontiumtitanat

    Energy Technology Data Exchange (ETDEWEB)

    Kessel, Markus Franz

    2012-12-19

    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO{sub 3} single crystals has been studied by means of {sup 18}O{sub 2}/{sup 16}O{sub 2} isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial

  5. Tungsten and Barium Transport in the Internal Plasma of Hollow Cathodes

    Science.gov (United States)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.

    2008-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushedback to the emitter surface by the electric field and drag from the xenon ion flow. Thisbarium ion flux is sufficient to maintain a barium surface coverage at the downstream endgreater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length,so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollowcathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  6. Thermal expansion behaviour of barium and strontium zirconium phosphates

    Indian Academy of Sciences (India)

    P Srikari Tantri; K Geetha; A M Umarji; Sheela K Ramasesha

    2000-12-01

    Ba1.5–SrZr4P5SiO24 compounds with = 0, 0.25, 0.5, 0.75, 1.0, 1.25 and 1.5, belonging to the low thermal expansion NZP family were synthesized by the solid state reaction method. The XRD pattern could be completely indexed with respect to R$\\bar{3}$ space group indicating the ordering of vacancy at the divalent cation octahedral sites. The microstructure and bulk thermal expansion coefficient from room temperature to 800°C of the sintered samples have been studied. All the samples show very low coefficient of thermal expansion (CTE), with = 0 samples showing negative expansion. A small substitution of strontium in the pure barium compound changes the sign of CTE. Similarly, = 1.5 sample (pure strontium) shows a positive CTE and a small substitution of barium changes its sign. = 1.0 and 1.25 samples have almost constant CTE over the entire temperature range. The low thermal expansion of these samples can be attributed to the ordering of the ions in the crystal structure of these materials.

  7. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.

    2009-01-01

    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  8. Liquid-Phase Processing of Barium Titanate Thin Films

    Science.gov (United States)

    Harris, David Thomas

    Processing of thin films introduces strict limits on the thermal budget due to substrate stability and thermal expansion mismatch stresses. Barium titanate serves as a model system for the difficulty in producing high quality thin films because of sensitivity to stress, scale, and crystal quality. Thermal budget restriction leads to reduced crystal quality, density, and grain growth, depressing ferroelectric and nonlinear dielectric properties. Processing of barium titanate is typically performed at temperatures hundreds of degrees above compatibility with metalized substrates. In particular integration with silicon and other low thermal expansion substrates is desirable for reductions in costs and wider availability of technologies. In bulk metal and ceramic systems, sintering behavior has been encouraged by the addition of a liquid forming second phase, improving kinetics and promoting densification and grain growth at lower temperatures. This approach is also widespread in the multilayer ceramic capacitor industry. However only limited exploration of flux processing with refractory thin films has been performed despite offering improved dielectric properties for barium titanate films at lower temperatures. This dissertation explores physical vapor deposition of barium titanate thin films with addition of liquid forming fluxes. Flux systems studied include BaO-B2O3, Bi2O3-BaB2O 4, BaO-V2O5, CuO-BaO-B2O3, and BaO-B2O3 modified by Al, Si, V, and Li. Additions of BaO-B2O3 leads to densification and an increase in average grain size from 50 nm to over 300 nm after annealing at 900 °C. The ability to tune permittivity of the material improved from 20% to 70%. Development of high quality films enables engineering of ferroelectric phase stability using residual thermal expansion mismatch in polycrystalline films. The observed shifts to TC match thermodynamic calculations, expected strain from the thermal expansion coefficients, as well as x-ray diffract measurements

  9. 130-nm tunable grating-mirror VCSEL

    DEFF Research Database (Denmark)

    Chung, Il-Sug; Mørk, Jesper

    2014-01-01

    We have reported that a combination of the high-index-contrast grating (HCG) mirror as movable mirror and the extended cavity configuration with an antireflection layer can provide a tuning wavelength range of 100 nm for tunable VCSELs. Here, we report that using the air-coupled cavity configurat......We have reported that a combination of the high-index-contrast grating (HCG) mirror as movable mirror and the extended cavity configuration with an antireflection layer can provide a tuning wavelength range of 100 nm for tunable VCSELs. Here, we report that using the air-coupled cavity...... configuration instead of the extended cavity configuration can bring 130-nm tuning range around 1330-nm wavelength. The air-coupled cavity is known to reduce the quantum confinement factor in VCSELs, increasing threshold. In our air-coupled cavity HCG VCSEL case, the very short power penetration length...

  10. Preparation of Barium Titanate Nanopowder through Thermal Decomposition of Peroxide Precursor and Its Formation Mechanism

    Institute of Scientific and Technical Information of China (English)

    PENG, Yangxi; CHEN, Qiyuan; LIU, Shijun

    2009-01-01

    H_2TiO_3 was dissolved in the mixture of hydrogen formed peroxide and ammonia under the pH range of 8-10 with a transparent yellow solution formed. When an equivalent mole of Ba~(2+) solution was added into the yellow solution, the precipitate produced was the peroxide precursor of barium titanate. The cubic nanopowder of barium titanate was obtained when the precipitate was washed, stoved, and then calcined at 600 ℃ for 1 h. The peroxide precursor of barium titanate and barium titanate nanopowder prepared were characterized to be BaTi(H_2O_2)_2O_3 by TGA-DTA, XRD, TEM, SEM, and XREDS. The peroxide precursor of barium titanate was determined to be BaTi(H_2O_2)_2O_3. The particle size of the barium titanate nanopowder, the calcined product of BaTi(H_2O_2)_2O_3, was in the range of 20-40 nm. A formation mechanism of the barium titanate nanopowder through thermal decomposition of its peroxide precursor was proposed and then validated.

  11. Bio-based barium alginate film: Preparation, flame retardancy and thermal degradation behavior.

    Science.gov (United States)

    Liu, Yun; Zhang, Chuan-Jie; Zhao, Jin-Chao; Guo, Yi; Zhu, Ping; Wang, De-Yi

    2016-03-30

    A bio-based barium alginate film was prepared via a facile ionic exchange and casting approach. Its flammability, thermal degradation and pyrolysis behaviors, thermal degradation mechanism were studied systemically by limiting oxygen index (LOI), vertical burning (UL-94), microscale combustion calorimetry (MCC), thermogravimetric analysis (TGA) coupled with Fourier transform infrared analysis (FTIR) and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS). It showed that barium alginate film had much higher LOI value (52.0%) than that of sodium alginate film (24.5%). Moreover, barium alginate film passed the UL-94 V-0 rating, while the sodium alginate film showed no classification. Importantly, peak of heat release rate (PHRR) of barium alginate film in MCC test was much lower than that of sodium alginate film, suggested that introduction of barium ion into alginate film significantly decreased release of combustible gases. TG-FTIR and Py-GC-MS results indicated that barium alginate produced much less flammable products than that of sodium alginate in whole thermal degradation procedure. Finally, a possible degradation mechanism of barium alginate had been proposed.

  12. XB130: A novel adaptor protein in cancer signal transduction

    Science.gov (United States)

    ZHANG, RUIYAO; ZHANG, JINGYAO; WU, QIFEI; MENG, FANDI; LIU, CHANG

    2016-01-01

    Adaptor proteins are functional proteins that contain two or more protein-binding modules to link signaling proteins together, which affect cell growth and shape and have no enzymatic activity. The actin filament-associated protein (AFAP) family is an important member of the adaptor proteins, including AFAP1, AFAP1L1 and AFAP1L2/XB130. AFAP1 and AFAP1L1 share certain common characteristics and function as an actin-binding protein and a cSrc-activating protein. XB130 exhibits certain unique features in structure and function. The mRNA of XB130 is expressed in human spleen, thyroid, kidney, brain, lung, pancreas, liver, colon and stomach, and the most prominent disease associated with XB130 is cancer. XB130 has a controversial effect on cancer. Studies have shown that XB130 can promote cancer progression and downregulation of XB130-reduced growth of tumors derived from certain cell lines. A higher mRNA level of XB130 was shown to be associated with a better survival in non-small cell lung cancer. Previous studies have shown that XB130 can regulate cell growth, migration and invasion and possibly has the effect through the cAMP-cSrc-phosphoinositide 3-kinase/Akt pathway. Except for cancer, XB130 is also associated with other pathological or physiological procedures, such as airway repair and regeneration. PMID:26998266

  13. Magnetic properties of Ni substituted Y-type barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Won, Mi Hee; Kim, Chul Sung, E-mail: cskim@kookmin.ac.kr [Department of Physics, Kookmin University, Seoul 136-702 (Korea, Republic of)

    2014-05-07

    Y-type barium hexaferrite is attractive material for various applications, such as high frequency antennas and RF devices, because of its interesting magnetic properties. Especially, Ni substituted Y- type hexaferrites have higher magnetic ordering temperature than other Y-type. We have investigated macroscopic and microscopic properties of Y-type barium hexaferrite. Ba{sub 2}Co{sub 2−x}Ni{sub x}Fe{sub 12}O{sub 22} (x = 0, 0.5, 1.0, 1.5, and 2.0) samples are prepared by solid-state reaction method and studied by X-ray diffraction (XRD), vibrating sample magnetometer, and Mössbauer spectroscopy, as well as a network analyzer for high frequency characteristics. The XRD pattern is analyzed by Rietveld refinement method and confirms the hexagonal structure with R-3m. The hysteresis curve shows ferrimagnetic behavior. Saturation magnetization (M{sub s}) decreases with Ni contents. Ni{sup 2+}, which preferentially occupies the octahedral site with up-spin sub-lattice, has smaller spin value S of 1 than Co{sup 2+} having S = 3/2. The zero-field-cooled (ZFC) measurement of Ba{sub 2}Co{sub 1.5}Ni{sub 0.5}Fe{sub 12}O{sub 22} shows that Curie and spin transition temperatures are found to be 718 K and 209 K, respectively. The Curie temperature T{sub C} is increased with Ni contents, while T{sub S} is decreased with Ni. The Mössbauer spectra were measured at various temperatures and fitted by using a least-squares method with six sextet of six Lorentzian lines for Fe sites, corresponding to the 3b{sub VI}, 6c{sub IV}*, 6c{sub VI}, 18h{sub VI}, 6c{sub IV}, and 3a{sub IV} sites at below T{sub C}. From Mössbauer measurements, we confirmed the spin state of Fe ion to be Fe{sup 3+} and obtained the isomer shift (δ), magnetic hyperfine field (H{sub hf}), and the occupancy ratio of Fe ions at six sub-lattices. The complex permeability and permittivity are measured between 100 MHz and 4 GHz, suggesting that Y-type barium hexaferrite is promising for antenna

  14. Magnetic properties of Ni substituted Y-type barium ferrite

    Science.gov (United States)

    Won, Mi Hee; Kim, Chul Sung

    2014-05-01

    Y-type barium hexaferrite is attractive material for various applications, such as high frequency antennas and RF devices, because of its interesting magnetic properties. Especially, Ni substituted Y- type hexaferrites have higher magnetic ordering temperature than other Y-type. We have investigated macroscopic and microscopic properties of Y-type barium hexaferrite. Ba2Co2-xNixFe12O22 (x = 0, 0.5, 1.0, 1.5, and 2.0) samples are prepared by solid-state reaction method and studied by X-ray diffraction (XRD), vibrating sample magnetometer, and Mössbauer spectroscopy, as well as a network analyzer for high frequency characteristics. The XRD pattern is analyzed by Rietveld refinement method and confirms the hexagonal structure with R-3m. The hysteresis curve shows ferrimagnetic behavior. Saturation magnetization (Ms) decreases with Ni contents. Ni2+, which preferentially occupies the octahedral site with up-spin sub-lattice, has smaller spin value S of 1 than Co2+ having S = 3/2. The zero-field-cooled (ZFC) measurement of Ba2Co1.5Ni0.5Fe12O22 shows that Curie and spin transition temperatures are found to be 718 K and 209 K, respectively. The Curie temperature TC is increased with Ni contents, while TS is decreased with Ni. The Mössbauer spectra were measured at various temperatures and fitted by using a least-squares method with six sextet of six Lorentzian lines for Fe sites, corresponding to the 3bVI, 6cIV*, 6cVI, 18hVI, 6cIV, and 3aIV sites at below TC. From Mössbauer measurements, we confirmed the spin state of Fe ion to be Fe3+ and obtained the isomer shift (δ), magnetic hyperfine field (Hhf), and the occupancy ratio of Fe ions at six sub-lattices. The complex permeability and permittivity are measured between 100 MHz and 4 GHz, suggesting that Y-type barium hexaferrite is promising for antenna applications in UHF band.

  15. Barium ferrite nanoparticles prepared by self-propagating low-temperature combustion method and its characterization

    Indian Academy of Sciences (India)

    P M Prithviraj Swamy; S Basavaraja; Vijayanand Havanoor; N V Srinivas Rao; R Nijagunappa; A Venkataraman

    2011-12-01

    The barium ferrite particles were prepared using a self-propagating low-temperature combustion method using polyethylene glycol (PEG) as a fuel. The process was investigated with simultaneous thermogravimetric-differential thermal analysis (TG–DTA). The crystalline structure, morphology and the magnetic properties of the barium ferrite particles were studied by means of X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM) and SQUID susceptometer. The results show that the ignition temperature of PEG is lower compared with other combustion methods and gives nanocrystalline barium ferrite.

  16. Addition of methyl cellulose enema to double-contrast barium imaging of sigmoid diverticulosis

    Energy Technology Data Exchange (ETDEWEB)

    Olsson, R. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Adnerhill, I. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Bjoerkdahl, P. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Ekberg, O. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology; Fork, F.T. [Malmoe Univ. Hospital (Sweden). Dept. of Diagnostic Radiology

    1997-01-01

    Double-contrast barium enema has a reduced sensitivity in patients with severe sigmoid diverticulosis. Therefore a carboxy methyl cellulose enema was employed after the conventional double-contrast examination in 15 patients with sigmoid diverticulosis. A significant increase in lumen diameter and a superior removal of barium residue from the diverticulas facilitated the interpretation of the sigmoid loops. Conclusion: The addition of methyl cellulose enema to double-contrast barium imaging improves diagnostic imaging in diverticulosis by expanding the lumen and emptying the diverticulas. (orig.).

  17. A Comparative Study on Magnetostructural Properties of Barium Hexaferrite Powders Prepared by Polyethylene Glycol

    Directory of Open Access Journals (Sweden)

    Zehra Durmus

    2014-01-01

    Full Text Available Nanocrystalline particles of barium hexaferrite were synthesized by a sol-gel combustion route using nitrate-citrate gels prepared from metal nitrates and citric acid solutions with Fe/Ba molar ratio 12. The present paper aims to study the effect of addition of polyethylene glycol (PEG solutions with different molecular weights (MW: 400, 2000, and 10.000 g/mol on magnetostructural properties of barium hexaferrite. The formation of the barium hexaferrite was inspected using X-ray diffraction (XRD analysis, Fourier transform infrared (FT-IR analysis, thermogravimetric (TGA analysis, scanning electron microscopy (SEM analysis and vibrating sample magnetometer (VSM analysis for magnetic measurements.

  18. HC/MC-130 Recapitalization Aircraft (HC/MC-130 Recap)

    Science.gov (United States)

    2015-12-01

    device for aircrew providing a practical experience in use of checklists, palletized loading, winching exercises, loading of vehicles, loading and...Apr 2010 Airworthiness Certification Complete Jan 2012 Dec 2011 Dec 2011 Dec 2011 Initiate IOT &E Mar 2012 Mar 2012 Mar 2012 Mar 2012 Required Assets...Acronyms and Abbreviations IOT &E - Initial Operational Test and Evaluation OT&E - Operational Test and Evaluation HC/MC-130 Recap December 2015 SAR

  19. Physico-chemical study of barium (II) dipivaloylmethanate nature

    Energy Technology Data Exchange (ETDEWEB)

    Fedotova, N.E. [Rossijskaya Akademiya Nauk, Novosibirsk (Russian Federation). Inst. of Inorganic Chemistry; Igumenov, I.K. [Rossijskaya Akademiya Nauk, Novosibirsk (Russian Federation). Inst. of Inorganic Chemistry; Mamatyuk, V.I. [Rossijskaya Akademiya Nauk, Novosibirsk (Russian Federation). Inst. of Inorganic Chemistry; Sidorenko, G.V. [Rossijskaya Akademiya Nauk, Novosibirsk (Russian Federation). Inst. of Inorganic Chemistry

    1995-06-01

    A physico-chemical research of bis-(dipivaloylmethanato)barium(II) (Ba(thd){sub 2}) has been carried out from the point of its use in CVD processes as a precursor (thermal stability, immunity to external effects and etc.). The optimal conditions for synthesis, purification and storage have been found. It has been shown, that the sublimated product presents a mixture of several modifications with the main phase of a composition Ba{sub 4}(thd){sub 8}. At a lowered pressure the sublimated product is preserved without decomposition for a long time. In the air it is a monomer of a composition Ba(thd){sub 2}*2H{sub 2}O, decomposing in the course of time with forming a free ligand or a diketone (C{sub 8}H{sub 21}O{sub 2}) depending on the way of purification of the initial compound. (orig.).

  20. Synthesis and optical study of barium magnesium aluminate blue phosphors

    Science.gov (United States)

    Jeet, Suninder; Sharma, Manoj; Pandey, O. P.

    2015-05-01

    Europium doped barium magnesium aluminate (BaMgAl10O17:Eu2+) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl10O17(JCPDS 26-0163) along with an additional phase BaAl2O4(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f6 5d → 4f7 transition of Eu2+ which lies in the blue region of the visible spectrum.

  1. Synthesis and optical study of barium magnesium aluminate blue phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Jeet, Suninder, E-mail: suninder.jeet@thapar.edu; Pandey, O. P., E-mail: oppandey@thapar.edu [School of Physics and Materials Science, Thapar University, Patiala (147003), Punjab (India); Sharma, Manoj, E-mail: manojnarad@sggswu.org [Department of Nanotechnology, Sri Guru Granth Sahib World University, Fatehgarh Sahib(146406), Punjab (India)

    2015-05-15

    Europium doped barium magnesium aluminate (BaMgAl{sub 10}O{sub 17}:Eu{sup 2+}) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl{sub 10}O{sub 17}(JCPDS 26-0163) along with an additional phase BaAl{sub 2}O{sub 4}(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f{sup 6} 5d → 4f{sup 7} transition of Eu{sup 2+} which lies in the blue region of the visible spectrum.

  2. A new type of microphone using flexoelectric barium strontium titnate

    Science.gov (United States)

    Kwon, Seol ryung; Huang, Wenbin; Zhang, Shujun; Yuan, Fuh-Gwo; Jiang, Xiaoning

    2014-03-01

    A flexoelectric bridge-structured microphone using bulk barium strontium titanate (Ba0.65Sr0.35TiO3 or BST) ceramic was investigated in this study. The flexoelectric microphone was installed in an anechoic box and exposed to the sound pressure emitted from a loud speaker. Charge sensitivity of the flexoelectric microphone was measured and calibrated using a reference microphone. The 1.5 mm×768 μm×50 μm micro-machined bridge-structured flexoelectric microphone has a sensitivity of 0.92 pC/Pa, while its resonance frequency was calculated to be 98.67 kHz. The analytical and experimental results show that the flexoelectric microphone has both high sensitivity and broad bandwidth, indicating that flexoelectric microphones are potential candidates for many applications.

  3. Influence of Barium Hexaferrite on Magnetic Properties of Hydroxyapatite Ceramics.

    Science.gov (United States)

    Jarupoom, P; Jaita, P

    2015-11-01

    Hydroxyapatite (HA) powders was derived from natural bovine bone by sequence of thermal processes. The barium hexaferrite (BF) find magnetic powders were added into HA powders in ratio of 1-3 vol.%. The HA-BF ceramics were prepared by a solid state reaction method and sintered at 1250 degrees C for 2 h. Effects of BF additive on structural, physical and magnetic properties of HA ceramics were investigated. X-ray diffraction revealed that all HA-BF samples showed a main phase of high purity hydroxyapatite [Ca10(PO4)6(OH)2] with calcium and phosphate molar ratio of 1.67. The addition of BF into HA inhibited grain growth and caused an improvement of mechanical properties. The M-H hysteresis loops also showed an improvement in magnetic behavior for higher content of BF. Moreover, in vitro bioactivity test indicated that the 2-3 vol.% sample may be suitable for biological applications.

  4. Barium depletion study on impregnated cathodes and lifetime prediction

    Energy Technology Data Exchange (ETDEWEB)

    Roquais, J.M.; Poret, F.; Doze, R. le; Ricaud, J.L.; Monterrin, A.; Steinbrunn, A

    2003-06-15

    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK)

  5. Analysis of barium hydroxide and calcium hydroxide slurry carbonation reactors

    Energy Technology Data Exchange (ETDEWEB)

    Patch, K.D.; Hart, R.P.; Schumacher, W.A.

    1980-05-01

    The removal of CO/sub 2/ from air was investigated by using a continuous-agitated-slurry carbonation reactor containing either barium hydroxide (Ba(OH)/sub 2/) or calcium hydroxide (Ca(OH)/sub 2/). Such a process would be applied to scrub /sup 14/CO/sub 2/ from stack gases at nuclear-fuel reprocessing plants. Decontamination factors were characterized for reactor conditions which could alter hydrodynamic behavior. An attempt was made to characterize reactor performance with models assuming both plug flow and various degrees of backmixing in the gas phase. The Ba(OH)/sub 2/ slurry enabled increased conversion, but apparently the process was controlled under some conditions by phenomena differing from those observed for carbonation by Ca(OH)/sub 2/. Overall reaction mechanisms are postulated.

  6. A buffer gas cooled beam of barium monohydride

    Science.gov (United States)

    Iwata, Geoffrey; Tarallo, Marco; Zelevinsky, Tanya

    2016-05-01

    Significant advances in direct laser cooling of diatomic molecules have opened up a wide array of molecular species to precision studies spanning many-body physics, quantum collisions and ultracold dissociation. We present a cryogenic beam source of barium monohydride (BaH), and study laser ablation of solid precursor targets as well as helium buffer gas cooling dynamics. Additionally, we cover progress towards a molecular magneto-optical trap, with spectroscopic studies of relevant cooling transitions in the B2 Σ molecules, including resolution of hyperfine structure and precision measurements of the vibrational Frank-Condon factors. Finally, we examine the feasibility of photo dissociation of trapped BaH molecules to yield optically accessible samples of ultracold hydrogen.

  7. Infrared Spectroscopic Characterization of Calcium and Barium Hydrazone Complexes

    Directory of Open Access Journals (Sweden)

    *A. Adeniyi

    2013-06-01

    Full Text Available Hydrazones have attracted considerable interest on account of their biological activities. Introduction of calcium and barium metal ions into m- and p-nitrobenzoic hydrazones is expected to modify these biological properties for enhanced activity and versatility. The ligands were synthesized from the parent acids. The complexes have been characterized using C, H and N microanalyses and IR spectrometry. The IR spectral data of the ligands and complexes revealed bonding via the C=O and C=N groups. The suggested metal to ligand stoichiometries are: [M (m-NBHx]Cl2.yH2O, x, y = 1 and 4 for M = Ca; x, y = 2 and 3 for M = Ba respectively. [M(p-NBHx]Cl2.yH2O, x, y = 1 and 12 for M = Ca; x, y = 1 and 3 for M = Ba respectively. The structural deductions are tentative pending future X-ray structural studies.

  8. Communication: Barium ions and helium nanodroplets: solvation and desolvation.

    Science.gov (United States)

    Zhang, Xiaohang; Drabbels, Marcel

    2012-08-07

    The solvation of Ba(+) ions created by the photoionization of barium atoms located on the surface of helium nanodroplets has been investigated. The excitation spectra corresponding to the 6p (2)P(1/2) ← 6s (2)S(1/2) and 6p (2)P(3/2) ← 6s (2)S(1/2) transitions of Ba(+) are found to be identical to those recorded in bulk He II [H. J. Reyher, H. Bauer, C. Huber, R. Mayer, A. Schafer, and A. Winnacker, Phys. Lett. A 115, 238 (1986)], indicating that the ions formed at the surface of the helium droplets become fully solvated by the helium. Time-of-flight mass spectra suggest that following the excitation of the solvated Ba(+) ions, these are being ejected from the helium droplets either as bare Ba(+) ions or as small Ba(+)He(n) (n < 20) complexes.

  9. Ionoluminescence of trivalent rare-earth-doped strontium barium niobate

    Energy Technology Data Exchange (ETDEWEB)

    Calvo del Castillo, H. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain); Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Ruvalcaba, J.L. [Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Bettinelli, M.; Speghini, A. [Dipartimento Scientifico e Tecnologico, Universita di Verona and INSTM, UdR Verona, Ca Vignal, Strada Le Grazie 15, I-37134 Verona (Italy); Barboza Flores, M. [Centro de Investigacion en Fisica, Universidad de Sonora, Hermosillo, Sonora (Mexico); Calderon, T. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain)], E-mail: tomas.calderon@uam.es; Jaque, D.; Garcia Sole, J. [Departamento de Fisica de Materiales, Universidad Autonoma de Madrid, 28049 Cantoblanco, Madrid (Spain)

    2008-05-15

    Ionoluminescence spectra for different rare-earth ion (Pr{sup 3+} and Eu{sup 3+})-activated Sr{sub x}Ba{sub 1-x}Nb{sub 2}O{sub 6} strontium barium niobate crystals (x=0.33 and 0.60) have been induced with a 3 MeV proton beam for a variety of beam current intensities (45, 40 and 20 nA). The proton-beam induced luminescent spectra have shown features associated with the presence of the rare-earth ion and some spectral features mostly related to the host crystal, which appear only for high beam current intensities. We have compared the ionoluminescence results to those obtained under UV light excitation (photoluminescence technique) where a direct excitation of the band gap would occur.

  10. Structural and functional characterization of barium zirconium titanate / epoxy composites

    Directory of Open Access Journals (Sweden)

    Filiberto González Garcia

    2011-12-01

    Full Text Available The dielectric behavior of composite materials (barium zirconium titanate / epoxy system was analyzed as a function of ceramic concentration. Structure and morphologic behavior of the composites was investigated by X-ray Diffraction (XRD, Fourier transformed infrared spectroscopy (FT-IR, Raman spectroscopy, field emission scanning electron microscopy (FE-SEM and transmission electron microscopy (TEM analyses. Composites were prepared by mixing the components and pouring them into suitable moulds. It was demonstrated that the amount of inorganic phase affects the morphology of the presented composites. XRD revealed the presence of a single phase while Raman scattering confirmed structural transitions as a function of ceramic concentration. Changes in the ceramic concentration affected Raman modes and the distribution of particles along into in epoxy matrix. Dielectric permittivity and dielectric losses were influenced by filler concentration.

  11. Effect of Nb on barium titanate prepared from citrate solutions

    Directory of Open Access Journals (Sweden)

    Stojanović Biljana D.

    2002-01-01

    Full Text Available The influence of the addition of dopants on the microstructure development and electrical properties of BaTiO3 doped with 0.2, 0.4, 0.6, 0.8 mol% of Nb and 0.01 mol% of Mn based compounds was studied. Doped barium titanate was prepared using the polymeric precursor method from citrate solutions. The powders calcined at 700°C for 4 hours were analysed by infrared (IR spectroscopy to verify the presence of carbonates, and by X-ray diffraction (XRD for phase formation. The phase composition, microstructure and dielectric properties show a strong dependence on the amount of added niobium.

  12. Calcium, Strontium and Barium Homogeneous Catalysts for Fine Chemicals Synthesis.

    Science.gov (United States)

    Sarazin, Yann; Carpentier, Jean-François

    2016-12-01

    The large alkaline earths (Ae), calcium, strontium and barium, have in the past 15 years yielded a brand new generation of heteroleptic molecular catalysts for the production of fine chemicals. However, the integrity of these complexes is often plagued by ligand redistribution equilibria in solution. This personal account retraces the paths followed in our research group towards the design of stable heteroleptic alkalino-earth complexes, including the use of intramolecular noncovalent Ae···H-Si and Ae···F-C interactions. Their implementation as homogenous precatalysts for reactions such as the intramolecular and intermolecular hydroamination and hydrophosphination of activated alkenes, the hydrophosphonylation of ketones, and the dehydrogenative coupling of amines and hydrosilanes that enable the efficient and controlled formations of CP, CN, or SiN σ-bonds, is presented in a synthetic perspective that highlights their overall outstanding catalytic performance.

  13. Preparation and Characterization of Nano-particle Substituted Barium Hexaferrite

    CERN Document Server

    Atassi, Yomen; Tally, Mohammad

    2014-01-01

    High density magnetic recording requires high coercivity magnetic media and small particle size. Barium hexaferrite has been considered as a leading candidate material because of its chemical stability, fairly large crystal anisotropy and suitable magnetic characteristics. In this work, we present the preparation of the hexagonal ferrite BaFe12O19 and one of its derivative; the Zn-Sn substituted hexaferrite by the chemical co-precipitation method. The main advantage of this method on the conventional glass-ceramic one, resides in providing a small enough particle size for magnetic recording. We demonstrate using the X-ray diffraction patterns that the particle size decreases when substituting the hexaferrite by the Zn-Sn combination. This may improve the magnetic properties of the hexaferrite as a medium for HD magnetic recording

  14. Barium and carbon fluxes in the Canadian Arctic Archipelago

    Science.gov (United States)

    Thomas, Helmuth; Shadwick, Elizabeth; Dehairs, Frank; Lansard, Bruno; Mucci, Alfonso; Navez, Jacques; Gratton, Yves; Prowe, Friederike; Chierici, Melissa; Fransson, Agneta; Papakyriakou, Tim N.; Sternberg, Erika; Miller, Lisa A.; Tremblay, Jean-ÉRic; Monnin, Christophe

    2011-09-01

    The seasonal and spatial variability of dissolved Barium (Ba) in the Amundsen Gulf, southeastern Beaufort Sea, was monitored over a full year from September 2007 to September 2008. Dissolved Ba displays a nutrient-type behavior: the maximum water column concentration is located below the surface layer. The highest Ba concentrations are typically observed at river mouths, the lowest concentrations are found in water masses of Atlantic origin. Barium concentrations decrease eastward through the Canadian Arctic Archipelago. Barite (BaSO4) saturation is reached at the maximum dissolved Ba concentrations in the subsurface layer, whereas the rest of the water column is undersaturated. A three end-member mixing model comprising freshwater from sea-ice melt and rivers, as well as upper halocline water, is used to establish their relative contributions to the Ba concentrations in the upper water column of the Amundsen Gulf. Based on water column and riverine Ba contributions, we assess the depletion of dissolved Ba by formation and sinking of biologically bound Ba (bio-Ba), from which we derive an estimate of the carbon export production. In the upper 50 m of the water column of the Amundsen Gulf, riverine Ba accounts for up to 15% of the available dissolved Ba inventory, of which up to 20% is depleted by bio-Ba formation and export. Since riverine inputs and Ba export occur concurrently, the seasonal variability of dissolved Ba in the upper water column is moderate. Assuming a fixed organic carbon to bio-Ba flux ratio, carbon export out of the surface layer is estimated at 1.8 ± 0.45 mol C m-2 yr-1. Finally, we propose a climatological carbon budget for the Amundsen Gulf based on recent literature data and our findings, the latter bridging the surface and subsurface water carbon cycles.

  15. Black Hole Spin Properties of 130 AGN

    CERN Document Server

    Daly, Ruth A

    2013-01-01

    Supermassive black holes may be described by their mass and spin. When supermassive black holes are active, the activity provides a probe of the state of the black hole system. The spin of a hole can be estimated when the black hole mass and beam power of the source are known for sources with powerful outflows. Seventy-five sources for which both the black hole mass and beam power could be obtained are identified and used to obtain estimates of black hole spins. The 75 supermassive black holes studied include 52 FRII radio galaxies and 23 FRII radio loud quasars with redshifts ranging from about zero to two. The new values are combined with those obtained previously for 19 FRII radio galaxies, 7 FRII radio loud quasars, and 29 radio sources associated with CD galaxies to form samples of 71 FRII radio galaxies, 30 FRII quasars, and a total sample of 130 spin values; all of the sources are associated with massive elliptical galaxies. The new values obtained are similar to those obtained earlier at similar redsh...

  16. GP130 activation induces myeloma and collaborates with MYC

    Science.gov (United States)

    Dechow, Tobias; Steidle, Sabine; Götze, Katharina S.; Rudelius, Martina; Behnke, Kerstin; Pechloff, Konstanze; Kratzat, Susanne; Bullinger, Lars; Fend, Falko; Soberon, Valeria; Mitova, Nadya; Li, Zhoulei; Thaler, Markus; Bauer, Jan; Pietschmann, Elke; Albers, Corinna; Grundler, Rebekka; Schmidt-Supprian, Marc; Ruland, Jürgen; Peschel, Christian; Duyster, Justus; Rose-John, Stefan; Bassermann, Florian; Keller, Ulrich

    2014-01-01

    Multiple myeloma (MM) is a plasma cell neoplasm that results from clonal expansion of an Ig-secreting terminally differentiated B cell. Advanced MM is characterized by tissue damage that involves bone, kidney, and other organs and is typically associated with recurrent genetic abnormalities. IL-6 signaling via the IL-6 signal transducer GP130 has been implicated as an important driver of MM pathogenesis. Here, we demonstrated that ectopic expression of constitutively active GP130 (L-GP130) in a murine retroviral transduction-transplantation model induces rapid MM development of high penetrance. L-GP130–expressing mice recapitulated all of the characteristics of human disease, including monoclonal gammopathy, BM infiltration with lytic bone lesions, and protein deposition in the kidney. Moreover, the disease was easily transplantable and allowed different therapeutic options to be evaluated in vitro and in vivo. Using this model, we determined that GP130 signaling collaborated with MYC to induce MM and was responsible and sufficient for directing the plasma cell phenotype. Accordingly, we identified Myc aberrations in the L-GP130 MM model. Evaluation of human MM samples revealed recurrent activation of STAT3, a downstream target of GP130 signaling. Together, our results indicate that deregulated GP130 activity contributes to MM pathogenesis and that pathways downstream of GP130 activity have potential as therapeutic targets in MM. PMID:25384216

  17. Analysis list: unc-130 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available unc-130 Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/unc-13...0.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/unc-130.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/ce10/target/unc-130.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/unc-130.Larvae.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...

  18. Severe acute cholangitis after endoscopic sphincterotomy induced by barium examination: A case report

    Institute of Scientific and Technical Information of China (English)

    Zhen-Hai Zhang; Ya-Guang Wu; Cheng-Kun Qin; Zhong-Xue Su; Jian Xu; Guo-Zhe Xian; Shuo-DongWu

    2012-01-01

    Endoscopic sphincterotomy (EST) is considered as a possible etiological factor for severe cholangitis.We herein report a case of severe cholangitis after endoscopic sphincterotomy induced by barium examination.An adult male patient presented with epigastric pain was diagnosed as having choledocholithiasis by ultrasonography.EST was performed and the stone was completely cleaned.Barium examination was done 3d after EST and severe cholangitis appeared 4 h later.The patient was recovered after treated with tienam for 4 d.Barium examination may induce severe cholangitis in patients after EST,although rare,barium examination should be chosen cautiously.Cautions should be also used when EST is performed in patients younger than 50 years to avoid the damage to the sphincter of Oddi.

  19. Characterization and growth dynamics of barium titanate crystallite on nanometer scale

    Institute of Scientific and Technical Information of China (English)

    Sen Wang; Yue Zhang; Zhen Ji; Yousong Gu; Yunhua Huang; Cheng Zhou

    2005-01-01

    Barium titanate powder on nanometer scale was synthesized by means of co-precipitation. The thermal mass loss, crystal grain growth and phase transition of the barium titanate nanometer powder were investigated by TG (Thermogravimetric)-DTA (Differential scanning calorimetric) and XRD (X-ray powder diffractometer) at different heat treatment temperatures. The results show that amorphous barium titanate powder can transfer into tetragonal symmetry structure after heat treatment. When the heat treatment temperature is below 900℃, the grains grow rapidly because the activation energy at low temperature is greatly less than that at high temperature. By controlling theheat treatment temperature, the optimization of the barium titanate crystallite size and formation of tetragonal phase can be realized.

  20. Involvement of β-defensin 130 (DEFB130) in the macrophage microbicidal mechanisms for killing Plasmodium falciparum

    Science.gov (United States)

    Terkawi, Mohamad Alaa; Takano, Ryo; Furukawa, Atsushi; Murakoshi, Fumi; Kato, Kentaro

    2017-01-01

    Understanding the molecular defense mechanism of macrophages and identifying their effector molecules against malarial parasites may provide important clues for the discovery of new therapies. To analyze the immunological responses of malarial parasite-induced macrophages, we used DNA microarray technology to examine the gene profile of differentiated macrophages phagocytizing Plasmodium falciparum-parasitized erythrocytes (iRBC). The transcriptional gene profile of macrophages in response to iRBCs represented 168 down-regulated genes, which were mainly involved in the cellular immune response, and 216 upregulated genes, which were involved in cellular proteolysis, growth, and adhesion. Importantly, the specific upregulation of β-defensin 130 (DEFB130) in these macrophages suggested a possible role for DEFB130 in malarial parasite elimination. Differentiated macrophages phagocytizing iRBCs exhibited an increase in intracellular DEFB130 levels and DEFB130 appeared to accumulate at the site of iRBC engulfment. Transfection of esiRNA-mediated knockdown of DEFB130 into macrophages resulted in a remarkable reduction in their antiplasmodial activity in vitro. Furthermore, DEFB130 synthetic peptide exhibited a modest toxic effect on P. falciparum in vitro and P. yoelii in vivo, unlike scrambled DEFB130 peptide, which showed no antiplasmodial activity. Together, these results suggest that DEFB130 might be one of the macrophage effector molecules for eliminating malarial parasites. Our data broaden our knowledge of the immunological response of macrophages to iRBCs and shed light on a new target for therapeutic intervention. PMID:28181499

  1. Study on Effectiveness of Barium Enema in the Diagnosis of Hirschsprung Disease

    Directory of Open Access Journals (Sweden)

    M. Karami Chanlah

    2005-08-01

    Full Text Available Introduction & Aims: The study aims to investigate barium enema accuracy in diagnosing Hischsprung's disease (HD. Patients & Methods: This study was performed on 58 patients diagnosed with Hischsprung's disease later confirmed by pathology; the patients had undergone surgical operation in the last 3 years. The radiographs were reached from their medical records and were later assessed by a skilled pediatric radiologist. Bar-ium enema findings were also evaluated. Rectosig-moid index with the sign of transitional zone (TZ, and barium evacuation of delayed radiographs were recorded by a radiologist. Results: We measured accuracy of rectosigmoid index in these patients to be 94.8%, the sign of TZ to be 70.7%, and the barium evacuation of delayed radio-graphs to be 100% for diagnosis of HD. Fifty percent of the cases were neonates, 42% infants, and 7% more than 2 years old. Of all the patients, 76% were male and 24% were female. The most common diseases accompanying HD were cardiac abnormalities. We did not find any total aganglionosis. Conclusion & Discussion: Half of the patients were newborn infants. The fact that the ratio is more than usual shows timely diagnosis of the condition by phy-sicians of this center. Barium enema findings in new-borns of our study contradicted significantly the re-searches done in other countries. In this study, it was found that with increasing age, barium enema find-ings would be defined in such a way that in in-fantsover 2 years, it can reach a diagnosis accuracy of up to 100%. Regarding the availability of barium en-ema and its lower costs than other diagnostic meth-ods, its accuracy seems very promising. Our study emphasizes that perhaps with barium enema, we may operate these infants in one stage so that they can get rid of multiphasic operation difficulties.

  2. Study of the immunoisolating effects of barium-alginate microencapsulation on rat islets allograft survival

    Institute of Scientific and Technical Information of China (English)

    Mei Zhang; Chao Liu; Cuiping Liu; Youwen Qin; Zhaosun Zhen

    2005-01-01

    Objective: To evaluate the immunoisolating effects of barium-alginate microencapsulation on islets allograft survival. Methods: The nonmicroencapsulated and microencapsulated islets were transplanted under the kidney capsule or intraperitoneally into Wistar rat with STZ-induced diabetes. The blood glucose and insulin secretion of grafts were observed. Graft function was tested by oral rats was associated with normal glucose and insulin profiles in response to OGTT. Conclusion: Microencapsulation with barium-alginate membrane can prolong islet survival and protect islets against allorejection.

  3. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough

    Directory of Open Access Journals (Sweden)

    Carlos Shuler Nin

    2013-12-01

    Full Text Available OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons.RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6% of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6% of the patients, whereas the treatment was ineffective in 1 (8.4%. We observed no complications related to barium swallow, such as contrast aspiration.CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.

  4. Synthesis of nonstoichiometric M-type barium ferrite nanobelt by spark plasma sintering method

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wenyu; ZHANG Qingjie; TANG Xinfeng; CHENG Haibin

    2005-01-01

    This study investigated the feasibility of ultrafast crystallization of M-type barium ferrite when the coprecipitation precursors in stoichiometric proportions as BaFe12O19, Fe(OH)3 and BaCO3 nanoparticles, had been heated by spark plasma sintering (SPS) process. The results show that SPS method may realize the ultrafast crystallization of M-type barium ferrite, absolutely prevent the crystallization of intermediate phase α-Fe2O3, and significantly decrease the crystallization temperature of M-type barium ferrite. The sintered samples obtained at 800℃ by sintering the precursors for 10 minutes are a kind of multiphase ferrites composed of major phase M-type barium ferrite and trace amount of BaFe0.24Fe0.76O2.88. It is discovered that M-type barium ferrites in the holes of the sintered samples are in nanobelt microstructure about 100-300 nm in width and several micrometers in length. These M-type barium ferrite nanobelts are non-stoichiometric and may be expressed as BaFe12+Xo19+1.5x (-4.77≤x≤6.50). Their composistions suggest completely random Fe-rich or Ba-rich domains.

  5. Experimental studies on 3D printing of barium titanate ceramics for medical applications

    Directory of Open Access Journals (Sweden)

    Schult Mark

    2016-09-01

    Full Text Available The present work deals with the 3D printing of porous barium titanate ceramics. Barium titanate is a biocompatible material with piezoelectric properties. Due to insufficient flowability of the starting material for 3D printing, the barium titanate raw material has been modified in three different ways. Firstly, barium titanate powder has been calcined. Secondly, flow additives have been added to the powder. And thirdly, flow additives have been added to the calcined powder. Finally, a polymer has been added to the three materials and specimens have been printed from these three material mixtures. The 3D printed parts were then sintered at 1320°C. The sintering leads to shrinkage which differs between 29.51–71.53% for the tested material mixtures. The porosity of the parts is beneficial for cell growth which is relevant for future medical applications. The results reported in this study demonstrate the possibility to fabricate porous piezoelectric barium titanate parts with a 3D printer that can be used for medical applications. 3D printed porous barium titanate ceramics can especially be used as scaffold for bone tissue engineering, where the bone formation can be promoted by electrical stimulation.

  6. 12 CFR 204.130 - Eligibility for NOW accounts.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Eligibility for NOW accounts. 204.130 Section 204.130 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM....C. (I.R.C. 1954) section 527); and (iii) Homeowners and condominium owners associations described...

  7. 21 CFR 136.130 - Milk bread, rolls, and buns.

    Science.gov (United States)

    2010-04-01

    ..., buttermilk product, cheese whey, cheese whey product, or milk protein is used. (b) The name of the food is... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk bread, rolls, and buns. 136.130 Section 136....130 Milk bread, rolls, and buns. (a) Each of the foods milk bread, milk rolls, and milk buns...

  8. 13 CFR 130.360 - SBDC advisory boards.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false SBDC advisory boards. 130.360 Section 130.360 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT... include small business owners and other representatives from the entire Area of Service. (4) New...

  9. 13 CFR 130.800 - Oversight of the SBDC program.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Oversight of the SBDC program. 130.800 Section 130.800 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS... funds for the benefit of the small business community....

  10. 23 CFR 771.130 - Supplemental environmental impact statements.

    Science.gov (United States)

    2010-04-01

    ... relevant to environmental concerns and bearing on the proposed action or its impacts would result in... 23 Highways 1 2010-04-01 2010-04-01 false Supplemental environmental impact statements. 771.130... ENVIRONMENT ENVIRONMENTAL IMPACT AND RELATED PROCEDURES § 771.130 Supplemental environmental impact...

  11. 21 CFR 211.130 - Packaging and labeling operations.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Packaging and labeling operations. 211.130 Section... (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Packaging and Labeling Control § 211.130 Packaging and labeling operations. There shall be written procedures designed...

  12. 9 CFR 590.130 - Basis of billing plants.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Basis of billing plants. 590.130... of Service § 590.130 Basis of billing plants. Overtime and/or holiday services shall be billed to the official plant on the basis of each 15 minutes of overtime and/or holiday service performed by...

  13. 22 CFR 130.15 - Confidential business information.

    Science.gov (United States)

    2010-04-01

    ..., confidential business information means commercial or financial information which by law is entitled to... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Confidential business information. 130.15... CONTRIBUTIONS, FEES AND COMMISSIONS § 130.15 Confidential business information. (a) Any person who is...

  14. 40 CFR 130.6 - Water quality management plans.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Water quality management plans. 130.6... QUALITY PLANNING AND MANAGEMENT § 130.6 Water quality management plans. (a) Water quality management (WQM...) The functions to be exercised by the Indian Tribe pertain to the management and protection of...

  15. 40 CFR 130.4 - Water quality monitoring.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Water quality monitoring. 130.4... QUALITY PLANNING AND MANAGEMENT § 130.4 Water quality monitoring. (a) In accordance with section 106(e)(1.../quality control guidance. (b) The State's water monitoring program shall include collection and...

  16. 40 CFR 130.8 - Water quality report.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Water quality report. 130.8 Section... QUALITY PLANNING AND MANAGEMENT § 130.8 Water quality report. (a) Each State shall prepare and submit biennially to the Regional Administrator a water quality report in accordance with section 305(b) of the...

  17. 40 CFR 130.3 - Water quality standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Water quality standards. 130.3 Section... QUALITY PLANNING AND MANAGEMENT § 130.3 Water quality standards. A water quality standard (WQS) defines the water quality goals of a water body, or portion thereof, by designating the use or uses to be...

  18. 40 CFR 130.5 - Continuing planning process.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Continuing planning process. 130.5... QUALITY PLANNING AND MANAGEMENT § 130.5 Continuing planning process. (a) General. Each State shall establish and maintain a continuing planning process (CPP) as described under section 303(e)(3)(A)-(H)...

  19. 12 CFR 410.130 - General prohibitions against discrimination.

    Science.gov (United States)

    2010-01-01

    .... 410.130 Section 410.130 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED... a qualified handicapped person in the enjoyment of any right, privilege, advantage, or...

  20. 42 CFR 84.130 - Supplied-air respirators; description.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Supplied-air respirators; description. 84.130... Respirators § 84.130 Supplied-air respirators; description. Supplied-air respirators, including all completely assembled respirators designed for use as respiratory protection during entry into and escape...

  1. 49 CFR 28.130 - General prohibition against discrimination.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false General prohibition against discrimination. 28.130....130 General prohibition against discrimination. (a) No qualified individual with handicaps shall, on... subjected to discrimination under any program or activity conducted by the Department. (b)(1) The...

  2. 21 CFR 173.130 - Carbohydrase derived from Rhizopus oryzae.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Carbohydrase derived from Rhizopus oryzae. 173.130... HUMAN CONSUMPTION Enzyme Preparations and Microorganisms § 173.130 Carbohydrase derived from Rhizopus oryzae. Carbohydrase from Rhizopus oryzae may be safely used in the production of dextrose from starch...

  3. 42 CFR 494.130 - Condition: Laboratory services.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false Condition: Laboratory services. 494.130 Section 494... Patient Care § 494.130 Condition: Laboratory services. The dialysis facility must provide, or make available, laboratory services (other than tissue pathology and histocompatibility) to meet the needs of...

  4. The first barium tin(II) bromide fluoride

    Science.gov (United States)

    Dénès, Georges; Merazig, Hocine; Muntasar, Abdualhafeed; Porterfield, Robyn

    2014-04-01

    In an effort to prepare barium tin(II) bromide fluorides for the first time, possibly similar to the chloride fluorides obtained earlier in our laboratory, precipitation reactions were carried out by mixing aqueous solutions of SnF2 and of BaBr2.2H2O. In contrast with the chloride fluoride system, a single powdered phase was obtained throughout the SnF2 - BaBr2 system, with the yield being maximum at X ≈ 0.25, where X is the molar fraction of barium bromide in the reaction mixture. Phase identification with the JCPDS database failed to produce a match, confirming that a new phase had been produced. The exact chemical composition of the new compound has not been obtained yet. Based on the X value for the maximum yield, the Sn/Ba ratio is likely to be 3/1 or 2/1. The Mössbauer spectrum at ambient conditions shows that bonding to tin(II) is covalent, therefore with the tin lone pair being stereoactive. The Mössbauer parameters ( δ = 3.68 mm/s, Δ = 0.99 mm/s) are similar to those of SnBrF and of Sn2BrF5, thereby showing that tin is bonded to both fluorine and bromine. The larger isomer shift and lower quadrupole splitting than in tin(II) fluorides show that the stereoactivity of the tin lone pair is lower than in the fluorides. The Mössbauer parameters fit well the linear correlation of the quadrupole splitting versus the isomer shift" that has been shown to be present in other series of tin(II) compounds. The linear decrease on this correlation shows that the contribution of non-spherical orbitals ( p and d) to the lone pair is a much larger contributor to the quadrupole splitting than lattice distortions. The structure is likely made of Ba2+ cations and tin(II) fluoride bromide polyatomic anions, with covalent bonding withinthe anions.

  5. Enthalpy of formation of (In, Gd)-doped barium cerate

    Energy Technology Data Exchange (ETDEWEB)

    Matskevich, N.I., E-mail: nata.matskevich@yandex.ru [Nikolaev Institute of Inorganic Chemistry, Siberian Branch of the Russian Academy of Sciences, 630090 Novosibirsk (Russian Federation); Karlsruhe Institute of Technology, Institute of Solid State Physics, D-76334 Karlsruhe (Germany); Wolf, Th. [Karlsruhe Institute of Technology, Institute of Solid State Physics, D-76334 Karlsruhe (Germany); Adelmann, P.; Semerikova, A.N.; Anyfrieva, O.I. [Nikolaev Institute of Inorganic Chemistry, Siberian Branch of the Russian Academy of Sciences, 630090 Novosibirsk (Russian Federation)

    2015-09-10

    Highlights: • BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85} was prepared by solid-state reaction. • The standard formation enthalpy was determined. • The stabilization energy (Δ{sub st}H°) was calculated. • Δ{sub st}H° of BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85} is higher than BaCe{sub 0.7}Nd{sub 0.2}In{sub 0.1}O{sub 2.85} and BaCeO{sub 3}. - Abstract: Solution enthalpies of barium cerate doped by gadolinium and indium and a mixture of BaCl{sub 2} + 0.7CeCl{sub 3} + 2GdCl{sub 3} + 0.1InCl{sub 3} have been measured in 1 mol dm{sup −3} HCl with 0.1 mol dm{sup −3} KI. For the first time the standard molar formation enthalpy of BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85} has been determined by solution calorimetry as follows: Δ{sub f}H° (298.15 K) = −1615.84 ± 9.01 kJ mol{sup −1}. The stabilization energy for above-mentioned compound has been calculated as well. It has been shown that barium cerate doped gadolinium and indium has higher stabilization energy than BaCe{sub 0.7}Nd{sub 0.2}In{sub 0.1}O{sub 2.85} and BaCeO{sub 3}. The reaction enthalpy with CO{sub 2} interaction has been calculated for BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85}.

  6. Optimization of multiroute synthesis for polyaniline-barium ferrite composites

    Energy Technology Data Exchange (ETDEWEB)

    Ben Ghzaiel, Tayssir, E-mail: tayssir.ben-ghzaiel@satie.ens-cachan.fr [Université de Tunis El Manar Faculté des Sciences de Tunis, UR11ES18 Unité de Recherche de Chimie Minérale Appliquée, 2092, Tunis (Tunisia); SATIE, ENS Cachan, CNRS, Université Paris-Saclay, 61 av du Président Wilson, F-94230, Cachan (France); Dhaoui, Wadia [Université de Tunis El Manar Faculté des Sciences de Tunis, UR11ES18 Unité de Recherche de Chimie Minérale Appliquée, 2092, Tunis (Tunisia); Pasko, Alexander; Mazaleyrat, Frédéric [SATIE, ENS Cachan, CNRS, Université Paris-Saclay, 61 av du Président Wilson, F-94230, Cachan (France)

    2016-08-15

    A comparative study of physicochemical and magnetic properties of Polyaniline-BaFe{sub 12}O{sub 19} composites prepared by Solid-Based Polymerization (SBP) and by Aqueous-Based Polymerization (ABP) is carried out. The composites obtained by the latter method underwent a grinding to study the influence of shear stress. Thus, in a systematic approach, an investigation of stirring effect was done by synthesizing these composites using aqueous-based polymerization but without mechanical stirring. Different mass ratio of BaFe{sub 12}O{sub 19} was used to explore their impact on composites properties. X-ray diffraction, FTIR, SEM, TGA, conductivity and vibrating sample magnetometer measurements were performed. Structural and morphological investigations confirmed the presence of polyaniline and barium hexaferrite phase, which were in interaction in the composites regardless the polymerization route. The powder obtained by solid-based pathway revealed distinct particles with uniform distribution for various compositions (wt. %) of BaFe{sub 12}O{sub 19} in Pani, while the composites obtained by aqueous-based polymerization presented agglomerated nanostructures. Thermogravimetric analysis exhibited an improved thermal stability for Pani-BaFe{sub 12}O{sub 19} obtained by solid-based route. The electric conductivity has displayed decreasing trend of DC conductivity with the increase of BaFe{sub 12}O{sub 19} particles in the polymer matrix. Magnetic studies showed a ferromagnetic behaviour for all composites. The saturation magnetization monotonously increased with the increasing of BaFe{sub 12}O{sub 19} amount. The magnetic properties of the powders were mainly related to the hexaferrite loading which was determined using measured magnetic data. These results revealed that magnetization saturation was dependant of volume fraction of ferrite in the composites which was significantly affected by the reaction medium and mechanical stirring. The powders obtained by solid

  7. Defect Chemistry and Microstructure of Complex Perovskite Barium Zinc Niobate

    Science.gov (United States)

    Peng, Ping

    1991-02-01

    This dissertation presents a systematic study of the characterization of the phase transitions, microstructures, defects and transport properties of undoped and doped complex perovskite barium zinc niobate (BZN). Complex perovskite BZN is a paraelectric material while its parent material barium titanate is ferroelectric. With codoping of (Zn + 2Nb) into Ti site, BaTiO_3 shows three distinguished features. First, the Curie temperature is lowered; second, the three phase transitions (cubic-tetragonal-orthorhombic-rhombohedral) coalesce; and lastly, the transition becomes diffuse showing a typical 2nd order phase transition compared with 1st order in undoped BaTiO_3. Complex microchemical ordering is another characteristic of BZN. Stoichiometric BZN shows a mixture of two types of ordering schemes. 1:1, 1:2 ordered microdomains and the disordered matrix co-exist. The 1:1 type ordering involves an internal charge imbalance which inhibits the growth of 1:1 type of ordered microdomains. The 1:2 type ordering is consistent with the chemical composition of BZN. These ordering patterns can be modified by either adjustment of the Zn/Nb ratio or by doping. The defect structure of the stoichiometric BZN is closely related to that of BaTiO_3. Stoichiometric BZN is an insulator with wide band gap (~ 3.70 eV). Undoped BZN has a high oxygen vacancy concentration which comes from three possible sources, such as unavoidable acceptor impurities, due to their natural abundance, Zn/Nb ratio uncertainty due to processing limitations, and high temperature ZnO loss due to sintering process. The oxygen vacancy concentration for undoped BZN lays in the neighborhood of 1500 ppm (atm.). The compensation defects for various dopants have also been identified. Both electrons and holes conduct by a small polaron mechanism. Various thermodynamic parameters, such as enthalpies of oxidation and reduction, mass action constants for intrinsic electronic disorder, oxidation and reduction have been

  8. Mechanism of Phase Transformation and Formation of Barium Hexaferrite Doped with Rare-Earths in Sol-Gel Process

    Institute of Scientific and Technical Information of China (English)

    甘树才; 洪广言; 张军; 车平; 唐娟

    2003-01-01

    The phase-transformation in sol-gel preparation of barium hexaferrite and the formation of barium hexaferrite doped with La3+ were studied by chemical phase analysis, X-ray diffraction and infrared spectrometry analysis. The experimental results show that phase transformation reactions of FeCO3, Fe2O3 and BaFe2O4, barium hexaferrite and γ-Fe2O3 take place in the heat treatment of gel. While the doping lanthanide ion replace barium ion, an equivalent quantity of Fe3+ are reduced to Fe2+ to maintain the charge equilibrium.

  9. Dielectric and Impedance Spectroscopy of Barium Bismuth Vanadate Ferroelectrics

    Science.gov (United States)

    Sutar, B. C.; Choudhary, R. N. P.; Das, Piyush R.

    2014-07-01

    Structural, micro-structural and electrical properties of barium bismuth vanadate Ba(Bi0.5V0.5)O3 ceramics were investigated. X-ray diffraction (XRD) analysis of the prepared material confirmed the formation of the compound with monoclinic crystal system. Scanning electron microscopy (SEM) of the compound exhibits well-defined grains that are uniformly distributed throughout the surface of the sample. Dielectric properties of the compound were studied as a function of temperature at different frequencies. An observation of dielectric anomaly at 295 °C is due to ferroelectric phase transition that was later confirmed by the appearance of hysteresis loop. Detailed studies of complex impedance spectroscopy have provided a better understanding of the relaxation process and correlations between the microstructure-electrical properties of the materials. The nature of frequency dependence of ac conductivity obeys the Debye power law. The dc conductivity, calculated from the ac conductivity spectrum, shows the negative temperature coefficient of resistance behavior similar to that of a semiconductor.

  10. NLTE Strontium and Barium in metal poor red giant stars

    CERN Document Server

    Short, C I

    2006-01-01

    We present atmospheric models of red giant stars of various metallicities, including extremely metal poor (XMP, [Fe/H]<-3.5) models, with many chemical species, including, significantly, the first two ionization stages of Strontium (Sr) and Barium (Ba), treated in Non-Local Thermodynamic Equilibrium (NLTE) with various degrees of realism. We conclude that 1) for all lines that are useful Sr and Ba abundance diagnostics the magnitude and sense of the computed NLTE effect on the predicted line strength is metallicity dependent, 2) the indirect NLTE effect of overlap between Ba and Sr transitions and transitions of other species that are also treated in NLTE non-negligibly enhances NLTE abundance corrections for some lines, 3) the indirect NLTE effect of NLTE opacity of other species on the equilibrium structure of the atmospheric model is not significant, 4) the computed NLTE line strengths differ negligibly if collisional b-b and b-f rates are an order of magnitude smaller or larger than those calculated wi...

  11. On-line ultrasonic characterisation of barium doped lanthanum perovskites

    Energy Technology Data Exchange (ETDEWEB)

    Thamilmaran, P.; Arunachalam, M. [Department of Physics, Sri SRNM College, Sattur 626203, Tamil Nadu (India); Research scholars in Physics, Manonmanium Sundaranar University, Tirunelveli 627012 Tamil Nadu (India); Sankarrajan, S. [Department of Physics, Unnamalai Institute of Technology, Kovilpatti 628503, Tamil Nadu (India); Sakthipandi, K., E-mail: sakthipandi@gmail.com [Department of Physics, Sethu Institute of Technology, Kariapatti 626115, Tamil Nadu (India)

    2015-06-15

    Perovskite manganite samples La{sub 1−x}Ba{sub x}MnO{sub 3} with the composition of x=0.30, 0.33 and 0.36 were prepared by employing solid state reaction technique. The X-ray diffraction (XRD) patterns confirmed the rhombhedral structure with R3c space group of the samples. The obtained energy dispersive analysis X-rays (EDX) spectra of the samples have confirmed the elemental composition of the samples. The scanning electron microscope (SEM) images of the samples were used to find out the size of the particles. In-situ ultrasonic measurements were carried out on the samples by through transmission method. The temperature dependence of the ultrasonic parameters revealed interesting features of the samples. The observed ultrasonic velocities and attenuation both in longitudinal and shear mode are related to the paramagnetic (PM) to ferromagnetic (FM) phase transition in the prepared samples. The results confirmed that an increase in the barium content in the sample leads to an increase in the phase transition temperature T{sub C}.

  12. Barium oxide, calcium oxide, magnesia, and alkali oxide free glass

    Science.gov (United States)

    Lu, Peizhen Kathy; Mahapatra, Manoj Kumar

    2013-09-24

    A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.

  13. Review on dielectric properties of rare earth doped barium titanate

    Science.gov (United States)

    Ismail, Fatin Adila; Osman, Rozana Aina Maulat; Idris, Mohd Sobri

    2016-07-01

    Rare earth doped Barium Titanate (BaTiO3) were studied due to high permittivity, excellent electrical properties and have wide usage in various applications. This paper reviewed on the electrical properties of RE doped BaTiO3 (RE: Lanthanum (La), Erbium (Er), Samarium (Sm), Neodymium (Nd), Cerium (Ce)), processing method, phase transition occurred and solid solution range for complete study. Most of the RE doped BaTiO3 downshifted the Curie temperature (TC). Transition temperature also known as Curie temperature, TC where the ceramics had a transition from ferroelectric to a paraelectric phase. In this review, the dielectric constant of La-doped BaTiO3, Er-doped BaTiO3, Sm-doped BaTiO3, Nd-doped BaTiO3 and Ce-doped BaTiO3 had been proved to increase and the transition temperature or also known as TC also lowered down to room temperature as for all the RE doped BaTiO3 except for Er-doped BaTiO3.

  14. Growth and characterization of barium oxide nanoclusters on YSZ(111)

    Energy Technology Data Exchange (ETDEWEB)

    Nachimuthu, Ponnusamy; Kim, Yong Joo; Kuchibhatla, Satyanarayana V N T; Yu, Zhongqing; Jiang, Weilin; Engelhard, Mark H.; Shutthanandan, V.; Szanyi, Janos; Thevuthasan, Suntharampillai

    2009-08-13

    Barium oxide (BaO) was grown on YSZ(111) substrate by oxygen-plasma-assisted molecular beam epitaxy (OPA-MBE). In-situ reflection high-energy electron diffraction, ex-situ x-ray diffraction, atomic force microscopy and x-ray photoelectron spectroscopy have confirmed that the BaO grows as clusters on YSZ(111). During and following the growth under UHV conditions, BaO remains in single phase. When exposed to ambient conditions, the clusters transformed to BaCO3 and/or Ba(OH)2 H2O. However, in a few attempts of BaO growth, XRD results show a fairly single phase cubic BaO with a lattice constant of 0.5418(1) nm. XPS results show that exposing BaO clusters to ambient conditions results in the formation BaCO3 on the surface and partly Ba(OH)2 throughout in the bulk. Based on the observations, it is concluded that the BaO nanoclusters grown on YSZ(111) are highly reactive in ambient conditions. The variation in the reactivity of BaO between different attempts of the growth is attributed to the cluster size.

  15. Colonic diverticulosis: evaluation with double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja [Korea Veterans Hospital, Seoul (Korea, Republic of)

    1997-02-01

    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west.

  16. Sintering and foaming of barium silicate glass powder compacts

    Science.gov (United States)

    Mueller, Ralf; Reinsch, Stefan; Agea-Blanco, Boris

    2016-10-01

    The manufacture of sintered glasses and glass-ceramics, glass matrix composites and glass-bounded ceramics or pastes is often affected by gas bubble formation. Against this background, we studied sintering and foaming of barium silicate glass powders used as SOFC sealants using different powder milling procedures. Sintering was measured by means of heating microscopy backed up by XPD, DTA, Vacuum Hot Extraction (VHE) and optical and electron microscopy. Foaming increased significantly as milling progressed. For moderately milled glass powders, subsequent storage in air could also promote foaming. Although the powder compacts were uniaxially pressed and sintered in air, the milling atmosphere sig¬ni¬ficantly affected foaming. The strength of this effect increased in the order Ar ? N2 encapsulated CO2, even for powders milled in Ar and N2. Results of this study thus indicate that foaming is caused by carbonaceous species trapped on the glass powder surface. Foaming could be substantially reduced by milling in water and 10 wt% HCl.

  17. Abundance analysis of s-process enhanced barium stars

    CERN Document Server

    Mahanta, Upakul; Goswami, Aruna; Duorah, Kalpana

    2016-01-01

    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ~ 42000) of these objects spanning a wavelength range from 4000 to 6800 A, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature T_eff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] > 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars wit...

  18. Crystallographic properties of magnetron sputtered barium ferrite films

    Energy Technology Data Exchange (ETDEWEB)

    Capraro, S. [Laboratoire DIOM, University of Saint-Etienne, 23 rue Michelon, 42023 Saint-Etienne Cedex (France)]. E-mail: stephane.capraro@univ-st-etienne.fr; Berre, M. Le [LPM, UMR 5511, INSA Lyon, 7 av. Jean Capelle, 69621 Villeurbanne Cedex (France); Chatelon, J.P. [Laboratoire DIOM, University of Saint-Etienne, 23 rue Michelon, 42023 Saint-Etienne Cedex (France); Bayard, B. [Laboratoire DIOM, University of Saint-Etienne, 23 rue Michelon, 42023 Saint-Etienne Cedex (France); Joisten, H. [CEA-LETI, 17 rue des martyrs, 38041 Grenoble Cedex (France); Canut, C. [LPMCN, University Lyon I, 43 Bvd. du 11 novembre 1918, 69622 Villerbanne, Cedex (France); Barbier, D. [LPM, UMR 5511, INSA Lyon, 7 av. Jean Capelle, 69621 Villeurbanne Cedex (France); Rousseau, J.J. [Laboratoire DIOM, University of Saint-Etienne, 23 rue Michelon, 42023 Saint-Etienne Cedex (France)

    2004-09-15

    The development of devices combining a ferrite with a semiconductor chip is a major focus of current research. Barium hexaferrite (BaFe{sub 12}O{sub 19} or BaM) thick films are deposited here using a RF magnetron sputtering system. Films are amorphous and non magnetic after deposition. Post-deposition thermal annealing is employed to make the films crystallize. The effects of the substrate, thermal annealing process, thickness, substrate temperature on crystallographic properties and stoichiometry are studied using a X-ray diffractometry (XRD) and Rutherford back-scattering (RBS). The in-depth homogeneity of Ba, Fe and O is evaluated by secondary ion mass spectroscopy (SIMS). The study shows a good crystallization of BaM films and there is a preferential orientation among the crystallographic planes (1 0 1), (2 0 0), (2 0 3), (1 0 2), (1 1 0) and (2 0 5) when BaM films are prepared at low RF power and when the substrate is heated. For several elaboration parameters, grains size is in the range of 25 and 40 nm and BaM films are stoichiometric with regard to the target stoichiometry.

  19. Sintering and foaming of barium silicate glass powder compacts

    Directory of Open Access Journals (Sweden)

    Ralf Mueller

    2016-10-01

    Full Text Available The manufacture of sintered glasses and glass-ceramics, glass matrix composites and glass-bounded ceramics or pastes is often affected by gas bubble formation. Against this background, we studied sintering and foaming of barium silicate glass powders used as SOFC sealants using different powder milling procedures. Sintering was measured by means of heating microscopy backed up by XPD, DTA, Vacuum Hot Extraction (VHE and optical and electron microscopy. Foaming increased significantly as milling progressed. For moderately milled glass powders, subsequent storage in air could also promote foaming. Although the powder compacts were uniaxially pressed and sintered in air, the milling atmosphere sig¬ni¬ficantly affected foaming. The strength of this effect increased in the order Ar  N2 < air < CO2. Conformingly, VHE studies revealed that the pores of foamed samples predominantly encapsulated CO2, even for powders milled in Ar and N2. Results of this study thus indicate that foaming is caused by carbonaceous species trapped on the glass powder surface. Foaming could be substantially reduced by milling in water and 10 wt% HCl.

  20. Combustion synthesis, characterization and luminescence properties of barium aluminate phosphor

    Institute of Scientific and Technical Information of China (English)

    AH Wako; FB Dejene; HC Swart

    2014-01-01

    The blue-green emitting Eu2+and Nd3+ doped polycrystalline barium aluminate (BaAl2O4:Eu2+,Nd3+) phosphor, was pre-pared by a solution-combustion method at 500 ºC without a post-annealing process. The characteristic variation in the structural and luminescence properties of the as-prepared samples was evaluated with regards to a change in the Ba/Al molar ratio from 0.1:1 to 1.4:1. The morphologies and the phase structures of the products were characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS), while the optical properties were investigated using ultra-violet (UV) and photoluminescence (PL) spectroscopy, respectively. The XRD and TEM results revealed that the average crystallite size of the BaAl2O4:Eu2+,Nd3+ phosphor was about 70 nm. The broad-band UV-excited luminescence of the phosphors was observed atλmax=500 nm due to transitions from the 4f65d1 to the 4f7 configuration of the Eu2+ ion. The PL results indi-cated that the main peaks in the emission and excitation spectrum of phosphor particles slightly shifted to the short wavelength due to the changes in the crystal field due to the structure changes caused by the variation in the quantity of the Ba ions in the host lattice.

  1. Enhanced photocatalytic hydrogen generation from barium tantalate composites.

    Science.gov (United States)

    Marschall, Roland; Soldat, Julia; Busser, G Wilma; Wark, Michael

    2013-04-01

    (111)-layered Ba5Ta4O15 photocatalysts were synthesised by a solid state reaction route and a citrate synthesis route, and their structural and electronic properties were investigated. After citrate route preparation, the presence of a second phase, namely Ba3Ta5O15, was determined by X-ray powder diffraction and absorption spectroscopy. The existence of this phase had a profound effect on the photocatalytic activity of this Ba5Ta4O15/Ba3Ta5O15 composite in comparison to the pure Ba5Ta4O15 materials. The photocatalytic performance of the barium tantalates was evaluated by investigating the capability in ˙OH radical formation and hydrogen generation. Strongly increased hydrogen evolution rates for the Ba5Ta4O15/Ba3Ta5O15 composite, up to 160% higher than for the pure Ba5Ta4O15, were determined, and only very small amounts of Rh co-catalyst, deposited on the photocatalysts by stepwise reductive photo-deposition, were needed to achieve these results.

  2. Abdominal actinomycosis: barium enema and computed tomography findings.

    Science.gov (United States)

    Uchiyama, N; Ishikawa, T; Miyakawa, K; Iinuma, G; Nakajima, H; Ushio, K; Yokota, T; Akasu, T; Shimoda, T

    1997-02-01

    A case of abdominal actinomycosis is described in a woman with recurrent right lower abdominal pain and low-grade fever without history of appendectomy. Past history included the use of an intrauterine device (IUD) until 10 years before manifestation of these symptoms. We followed up the patient, via diagnostic imaging, for 7 months. On initial barium enema, a polypoid lesion was visualized at the bottom of the cecum and there was constriction of the sigmoid colon; the appendix was not seen. Seven months later, poor extension at the cecum, severe constriction in the sigmoid colon, and narrowing of the terminal ileum were also visualized. On computed tomography (CT), the lesion was initially localized only in the ileocecal region adjacent to the sigmoid colon. After 7 months, the lesion had infiltrated adjacent anatomic components and showed direct infiltration of the pelvic space. Differential diagnosis was difficult, as it was not obvious whether this was a pelvic abscess due to inflammation or appendiceal carcinoma. Laparotomy was performed. Macroscopically, the lesion was not limited to the ileocecal region, but involved the right ureter, tubes the Fallopian and ovary, bladder, psoas muscle, and abdominal wall. Pathology findings showed, chronic inflammatory tissue with evidence of actinomycosis. Although previous reports have described a lack of specific findings in this disease. When actinomycosis is suspected, CT is recommended to define its extent.

  3. Rapid and accurate determination of barium by instrumental neutron activation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Armelin, Maria Jose A.; Maihara, Vera A.; Saiki, Mitiko, E-mail: marmelin@ipen.br, E-mail: vmaihara@ipen.br, E-mail: mitiko@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Trevizam, Anderson R., E-mail: aanrt@hotmail.com [Universidade Estadual do Centro Oeste (UNICENTRO), Guarapuava, PR (Brazil)

    2013-07-01

    Barium is an alkaline earth metal naturally present in soils. When available at a high level in the soil it can cause toxicity to plants and animals. Not all the barium is readily available to living organisms. Inorganic and organic barium compounds can be presented as soluble or insoluble forms in the soil. The soluble form of BaS is extremely toxic to humans, animals and plants. Researchers have noted a decrease of K absorption in the plant when Ba concentrations are increased and a change in overall plant growth. In case of animals, Ba tends to be concentrated in the bones which may compete with calcium, although only about 2% barium ingested in dietary is absorbed by the body. Another effect is that the Ba can interfere with the availability of sulfur in the soil due to the sulphate formation of low solubility. Barium and some other elements are considered palioclimatic proxies. For some researchers, barite is perhaps the most appropriate indicator of paleoproductivity because of a high resistance to dissolution. As explained about the barium effects in various situations, it was considered important to study the more appropriated experimental conditions for determination of this element by INAA. Conditions established for this analysis were: a) Irradiation time, 15 and 40 seconds, under thermal flux neutron about 4 x 10{sup 12} n cm{sup -2} s{sup -1}, for determining barium in geological and biological matrices, respectively; b) Decay time, approximately of 4 minutes; c) Counting time of 30 minutes; d) Radionuclide measured {sup 139}Ba. The quality of Ba results was evaluated from the analysis of certified reference materials. The performance of the method was satisfactory, according to the criterion of E.ζ score. Results obtained in this study indicate INAA is a good alternative for Ba determination in geological and biological samples. (author)

  4. An 8-year review of barium studies in the diagnosis of gastroparesis

    Energy Technology Data Exchange (ETDEWEB)

    Levin, A.A. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States); Levine, M.S. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)], E-mail: marc.levine@uphs.upenn.edu; Rubesin, S.E.; Laufer, I. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)

    2008-04-15

    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings.

  5. Gastrointestinal tract labeling for MDCT of abdomen: Comparison of low density barium and low density barium in combination with water

    Energy Technology Data Exchange (ETDEWEB)

    Gulati, Kavita; Shah, Zarine K.; Sainani, Nisha; Uppot, Raul; Sahani, Dushyant V. [Massachusetts General Hospital and Harvard Medical School, Department of Abdominal Imaging and Intervention, Boston, MA (United States)

    2008-05-15

    The purpose of the study was to compare the quality of stomach and small bowel marking/labeling using 1,350 ml of low-density barium alone (Volumen) with 900 ml of low-density barium and 450 ml of water for 16-MDCT scans of the abdomen and pelvis and assess cost benefits with the two protocols. In this IRB approved study, 80 consecutive patients scheduled for routine CECT (contrast-enhanced CT) of the abdomen-pelvis were studied. Patients were randomized into two groups and were administered either 1,350 ml of VoLumen (two bottles at 20-min intervals, one half bottle at 50 min and the last half on the table) or 900 ml of Volumen (two bottles at 20-min intervals and 450 ml water on the table). Portal venous phase scanning (detector collimation = 0.625 mm, speed = 18.75 mm, thickness = 5 mm) was subsequently performed. Images were reconstructed in axial and coronal plane at the CT console. Two blinded readers used a pre-designed template to assess distension and wall characteristics of the stomach and small bowel on a 5-point scale. Median scores with the two protocols were compared using the Wilcoxon rank sum test. The stomach and small bowel labeling was rated fair to optimal in all patients and did not differ significantly in the two protocols. The mean scores for distension of the small bowel and stomach were comparable. Inter-observer agreement for bowel labeling was found to be excellent (k 0.81). With the use of coronal images there was increased reader confidence in tracing the small bowel with both protocols. Acceptance for two bottles of Volumen and water was greater among patients as compared to three bottles of VoLumen. Use of two bottles of Volumen and water combination cost less than three bottles of Volumen. Stomach and small bowel labeling with administration of 900 ml of Volumen followed by 450 ml of water is cost effective and compares well to 1,350 ml of Volumen alone. (orig.)

  6. 氯化钡除杂制取高纯氢氧化钡%Preparation of high purity barium hydroxide by impurity - removed barium chloride

    Institute of Scientific and Technical Information of China (English)

    翁贤芬; 毛逢银; 何琳; 李莉

    2009-01-01

    Removal technology of strontium and iron from crude barium chloride raw material were studied.Optimization of process conditions of strontium and iron removal were discussed.When crude barium chloride stiring and dissolving the mixture at 60 ℃ for 40 min,impurities of stromtium and calcuim can be removed and mass fraction of strontium in the obatined solid barium chloride was below 1×10-4.Then add oxydol (H2O2) at proportion of 100 g raw materials per 8 mL H2O2,and add active carbon and small quantity of sodium hydroxide.Finally,iron could be get rid of when pH was controlled below 10.Mass fraction of iron in barium hydroxide product was less than 1×10-5 when using the iron - removed barium chaloride as raw material.Therefore,purified barium chloride by this method can be used to produce purity barium hydroxide.%研究了粗氯化钡原料中锶和铁杂质的脱除工艺,探讨了脱除锶和铁的优化工艺条件.在粗氯化钡原料中加入去离子水,液固质量比为0.25: 1,在60 ℃下搅拌溶解40 min,可除去锶和钙杂质,所得氯化钡固体中锶质量分数低于1×10-4.在氯化钡溶液中加入双氧水,每100 g原料中加入双氧水8 mL,加入活性炭和少量氢氧化钠,控制pH低于10时,可除去铁杂质,用除铁后的氯化钡制取氢氧化钡,产品中铁质量分数低于1×10-5.用除杂后的氯化钡可制得高纯氢氧化钡.

  7. Is hydroxyethyl starch 130/0.4 safe?

    DEFF Research Database (Denmark)

    Haase, Nicolai; Perner, Anders

    2012-01-01

    ABSTRACT: It is heavily debated whether or not treatment with hydroxyethyl starch 130/0.4 contributes to the development of acute kidney failure in patients with severe sepsis. In the previous issue of Critical Care, Muller and colleagues report no association between initial resuscitation...... with hydroxyethyl starch 130/0.4 and renal impairment in a cohort of septic patients. Can we then consider hydroxyethyl starch 130/0.4 a safe intervention? The answer is no - observational data should be interpreted with caution and should mainly be used to identify risks, while safety must be assessed...

  8. 13 CFR 108.130 - Identified Low Income Geographic Areas.

    Science.gov (United States)

    2010-01-01

    ... VENTURE CAPITAL (âNMVCâ) PROGRAM Qualifications for the NMVC Program Organizing A Nmvc Company § 108.130... intends to make Developmental Venture Capital investments and provide Operational Assistance under...

  9. Barium Tagging in Solid Xenon for the nEXO Experiment

    Science.gov (United States)

    Chambers, Christopher; Craycraft, Adam; Walton, Timothy; Fairbank, William; nEXO Collaboration

    2016-09-01

    The proposed nEXO experiment utilizes a tonne-scale liquid xenon time projection chamber to search for neutrinoless double beta decay in xenon-136. Positive observation of this decay would determine the nature of the neutrino to be a MAJORANA particle, as well as measure the absolute neutrino mass scale. A critical concern for any rare decay search is reducing or eliminating backgrounds that cannot be distinguished from signal. A powerful background discrimination technique is positive identification of the daughter atom of the decay, in this case barium. This technique, called ``barium tagging'' may be available for a second phase of nEXO operation, allowing for neutrino mass sensitivity beyond the inverted mass hierarchy. Development is underway on a scheme to capture the barium daughter in solid xenon with a cryogenic probe and detect the barium by laser-induced fluorescence inside the solid xenon sample. This presentation reports results on imaging of single barium atoms frozen in a solid xenon matrix, as well as the progress on the freezing and removal of a solid xenon sample from liquid xenon. Graduated.

  10. Fabrication of barium/strontium carbonate coated amorphous carbon nanotubes as an improved field emitter

    Science.gov (United States)

    Maity, S.; Jha, A.; Das, N. S.; Chattopadhyay, K. K.

    2013-02-01

    Amorphous carbon nanotubes (aCNTs) were synthesized by a chemical reaction between ferrocene and ammonium chloride at a temperature ˜250 ∘C in an air furnace. As-synthesized aCNTs were coated with the barium/strontium carbonate through a simple chemical process. The coating of barium/strontium carbonate was confirmed by a high resolution transmission electron microscopy, X-ray diffraction, and Fourier transformed infrared spectroscopy. Morphology of the as-prepared samples was studied by field emission scanning electron microscopy. Thermal gravimetric analysis showed that barium/strontium carbonate coated aCNTs are more stable than the pristine aCNTs. As-prepared barium/strontium carbonate coated aCNTs showed significantly improved field emission properties with a turn-on field as low as 2.5 V/μm. The variation of field emission characteristics of the barium/strontium carbonate coated aCNTs with interelectrode distances was also studied.

  11. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    Energy Technology Data Exchange (ETDEWEB)

    Matoso, Erika, E-mail: ematoso@hotmail.com [Centro Tecnologico da Marinha em Sao Paulo (CEA/CTMS), Ipero, SP (Brazil). Centro Experimental Aramar; Cadore, Solange, E-mail: cadore@iqm.unicamp.br [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Quimica. Departamento de Quimica Analica

    2015-07-01

    Barium can be found in waters up to 1 mg L{sup -1} and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L{sup -1} and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  12. SALT reveals the barium central star of the planetary nebula Hen 2-39

    CERN Document Server

    Miszalski, B; Jones, D; Karakas, A I; Köppen, J; Tyndall, A A; Mohamed, S S; Rodríguez-Gil, P; Santander-García, M

    2013-01-01

    Classical barium stars are binary systems which consist of a late-type giant enriched in carbon and slow neutron capture (s-process) elements and an evolved white dwarf (WD) that is invisible at optical wavelengths. The youngest observed barium stars are surrounded by planetary nebulae (PNe), ejected soon after the wind accretion of polluted material when the WD was in its preceeding asymptotic giant branch (AGB) phase. Such systems are rare but powerful laboratories for studying AGB nucleosynthesis as we can measure the chemical abundances of both the polluted star and the nebula ejected by the polluter. Here we present evidence for a barium star in the PN Hen 2-39. The polluted giant is very similar to that found in WeBo 1. It is a cool (Teff=4250 +/- 150 K) giant enhanced in carbon ([C/H]=0.42 +/- 0.02 dex) and barium ([Ba/Fe]=1.50 +/- 0.25 dex). A spectral type of C-R3 C_24 nominally places Hen 2-39 amongst the peculiar early R-type carbon stars, however the barium enhancement and likely binary status mea...

  13. 9 CFR 130.10 - User fees for pet birds.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false User fees for pet birds. 130.10... AGRICULTURE USER FEES USER FEES § 130.10 User fees for pet birds. (a) User fees for pet birds of U.S. origin returning to the United States, except pet birds of U.S. origin returning from Canada, are as...

  14. Dicty_cDB: SSH130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH130 (Link to dictyBase) - G21002 DDB0190562 Contig-U05309-1...k to library) Clone ID SSH130 (Link to dictyBase) Atlas ID - NBRP ID G21002 dictyBase ID DDB0190562 Link to ...Contig Contig-U05309-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/S...NYILYPTSPPLLSECF SVSYPPPPFLNCNNNSNNSSPINSPKSFNNNNHSSNNFNITNVNNFYFNNNLNNSGSGST SSGGNSGTPPSPIQIPIICT...KKKKKINKMYQPXINNNYILYPTSPPLLSECF SVSYPPPPFLNCNNNSNNSSPINSPKSFNNNNHSSNNFNITNVNNFYFNNNLNNSGSGST SSGGNSGTPPSPIQIPIICT

  15. Deletion of Pr130 Interrupts Cardiac Development in Zebrafish

    Directory of Open Access Journals (Sweden)

    Jie Yang

    2016-11-01

    Full Text Available Protein phosphatase 2 regulatory subunit B, alpha (PPP2R3A, a regulatory subunit of protein phosphatase 2A (PP2A, is a major serine/threonine phosphatase that regulates crucial function in development and growth. Previous research has implied that PPP2R3A was involved in heart failure, and PR130, the largest transcription of PPP2R3A, functioning in the calcium release of sarcoplasmic reticulum (SR, plays an important role in the excitation-contraction (EC coupling. To obtain a better understanding of PR130 functions in myocardium and cardiac development, two pr130-deletion zebrafish lines were generated using clustered regularly interspaced short palindromic repeats (CRISPR/CRISPR-associated proteins (Cas system. Pr130-knockout zebrafish exhibited cardiac looping defects and decreased cardiac function (decreased fractional area and fractional shortening. Hematoxylin and eosin (H&E staining demonstrated reduced cardiomyocytes. Subsequent transmission electron microscopy revealed that the bright and dark bands were narrowed and blurred, the Z- and M-lines were fogged, and the gaps between longitudinal myocardial fibers were increased. Additionally, increased apoptosis was observed in cardiomyocyte in pr130-knockout zebrafish compared to wild-type (WT. Taken together, our results suggest that pr130 is required for normal myocardium formation and efficient cardiac contractile function.

  16. Deletion of Pr130 Interrupts Cardiac Development in Zebrafish

    Science.gov (United States)

    Yang, Jie; Li, Zuhua; Gan, Xuedong; Zhai, Gang; Gao, Jiajia; Xiong, Chenling; Qiu, Xueping; Wang, Xuebin; Yin, Zhan; Zheng, Fang

    2016-01-01

    Protein phosphatase 2 regulatory subunit B, alpha (PPP2R3A), a regulatory subunit of protein phosphatase 2A (PP2A), is a major serine/threonine phosphatase that regulates crucial function in development and growth. Previous research has implied that PPP2R3A was involved in heart failure, and PR130, the largest transcription of PPP2R3A, functioning in the calcium release of sarcoplasmic reticulum (SR), plays an important role in the excitation-contraction (EC) coupling. To obtain a better understanding of PR130 functions in myocardium and cardiac development, two pr130-deletion zebrafish lines were generated using clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-associated proteins (Cas) system. Pr130-knockout zebrafish exhibited cardiac looping defects and decreased cardiac function (decreased fractional area and fractional shortening). Hematoxylin and eosin (H&E) staining demonstrated reduced cardiomyocytes. Subsequent transmission electron microscopy revealed that the bright and dark bands were narrowed and blurred, the Z- and M-lines were fogged, and the gaps between longitudinal myocardial fibers were increased. Additionally, increased apoptosis was observed in cardiomyocyte in pr130-knockout zebrafish compared to wild-type (WT). Taken together, our results suggest that pr130 is required for normal myocardium formation and efficient cardiac contractile function. PMID:27845735

  17. Sputtered Modified Barium Titanate for Thin-Film Capacitor Applications

    Directory of Open Access Journals (Sweden)

    Robert Mamazza

    2012-04-01

    Full Text Available New apparatus and a new process for the sputter deposition of modified barium titanate thin-films were developed. Films were deposited at temperatures up to 900 °C from a Ba0.96Ca0.04Ti0.82Zr0.18O3 (BCZTO target directly onto Si, Ni and Pt surfaces and characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray photoelectron spectroscopy (XPS. Film texture and crystallinity were found to depend on both deposition temperature and substrate: above 600 °C, the as-deposited films consisted of well-facetted crystallites with the cubic perovskite structure. A strongly textured Pt (111 underlayer enhanced the (001 orientation of BCZTO films deposited at 900 °C, 10 mtorr pressure and 10% oxygen in argon. Similar films deposited onto a Pt (111 textured film at 700 °C and directly onto (100 Si wafers showed relatively larger (011 and diminished intensity (00ℓ diffraction peaks. Sputter ambients containing oxygen caused the Ni underlayers to oxidize even at 700 °C: Raising the process temperature produced more diffraction peaks of NiO with increased intensities. Thin-film capacitors were fabricated using ~500 nm thick BCZTO dielectrics and both Pt and Ni top and bottom electrodes. Small signal capacitance measurements were carried out to determine capacitance and parallel resistance at low frequencies and from these data, the relative permittivity (er and resistivity (r of the dielectric films were calculated; values ranged from ~50 to >2,000, and from ~104 to ~1010 Ω∙cm, respectively.

  18. Evaluation of antibacterial properties of Barium Zirconate Titanate (BZT nanoparticle

    Directory of Open Access Journals (Sweden)

    Simin Mohseni

    2014-12-01

    Full Text Available So far, the antibacterial activity of some organic and inorganic compounds has been studied. Barium zirconate titanate [Ba(Zr xTi1-xO3] (x = 0.05 nanoparticle is an example of inorganic materials. In vitro studies have provided evidence for the antibacterial activity of this nanoparticle. In the current study, the nano-powder was synthesized by sol-gel method. X-ray diffraction showed that the powder was single-phase and had a perovskite structure at the calcination temperature of 1000 ºC. Antibacterial activity of the desired nanoparticle was assessed on two gram-positive (Staphylococcus aureus PTCC1431 and Micrococcus luteus PTCC1625 and two gram-negative (Escherichia coli HP101BA 7601c and clinically isolated Klebsiella pneumoniae bacteria according to Radial Diffusion Assay (RDA. The results showed that the antibacterial activity of BZT nano-powder on both gram-positive and gram-negative bacteria was acceptable. The minimum inhibitory concentration of this nano-powder was determined. The results showed that MIC values for E. coli, K. pneumoniae, M. luteus and S. aureus were about 2.3 µg/mL, 7.3 µg/mL, 3 µg/mL and 12 µg/mL, respectively. Minimum bactericidal concentration (MBC was also evaluated and showed that the growth of E. coli, K. pneumoniae, M. luteus and S. aureus could be decreased at 2.3, 14, 3 and 18 µg/mL of BZT. Average log reduction in viable bacteria count in time-kill assay ranged between 6 Log10 cfu/mL to zero after 24 h of incubation with BZT nanoparticle.

  19. Dose optimisation of double-contrast barium enema examinations.

    Science.gov (United States)

    Berner, K; Båth, M; Jonasson, P; Cappelen-Smith, J; Fogelstam, P; Söderberg, J

    2010-01-01

    The purpose of the present work was to optimise the filtration and dose setting for double-contrast barium enema examinations using a Philips MultiDiagnost Eleva FD system. A phantom study was performed prior to a patient study. A CDRAD phantom was used in a study where copper and aluminium filtration, different detector doses and tube potentials were examined. The image quality was evaluated using the software CDRAD Analyser and the phantom dose was determined using the Monte Carlo-based software PCXMC. The original setting [100 % detector dose (660 nGy air kerma) and a total filtration of 3.5 mm Al, at 81 kVp] and two other settings identified by the phantom study (100 % detector dose and additional filtration of 1 mm Al and 0.2 mm Cu as well as 80 % detector dose and added filtration of 1 mm Al and 0.2 mm Cu) were included in the patient study. The patient study included 60 patients and up to 8 images from each patient. Six radiologists performed a visual grading characteristics study to evaluate the image quality. A four-step scale was used to judge the fulfillment of three image quality criteria. No overall statistical significant difference in image quality was found between the three settings (P > 0.05). The decrease in the effective dose for the settings in the patient study was 15 % when filtration was added and 34 % when both filtrations was added and detector dose was reduced. The study indicates that additional filtration of 1 mm Al and 0.2 mm Cu and a decrease in detector dose by 20 % from the original setting can be used in colon examinations with Philips MultiDiagnost Eleva FD to reduce the patient dose by 30 % without significantly affecting the image quality. For 20 exposures, this corresponds to a decrease in the effective dose from 1.6 to 1.1 mSv.

  20. Colonic transit time in patient with slow-transit constipation: Comparison of radiopaque markers and barium suspension method

    Energy Technology Data Exchange (ETDEWEB)

    Xu Huimin [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Department of General Surgery, Weifang People' s Hospital, ShanDong Province 261041 (China); Han Jiagang [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Na Ying [Department of Medical Imaging, Weifang People' s Hospital, ShanDong Province 261041 (China); Zhao Bo; Ma Huachong [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China); Wang Zhenjun, E-mail: wang3zj@sohu.com [Department of General Surgery, Beijing Chaoyang Hospital, Capital Medical University, No. 8 Gongtina Lu, Chaoyang District, Beijing 100020 (China)

    2011-08-15

    Background: Colonic transit study provides valuable information before surgical treatment is considered for patient with constipation. The radiopaque markers method is the most common way for evaluating colon transit time. The aim of this study is to compare the barium suspension with the radiopaque makers to assess the colonic mobility in patient with constipation. Methods: Colonic transit time was measured in 11 female patients with slow-transit constipation using both radiopaque markers and barium suspension method. In radiopaque markers method, the patient ingested 20 markers on the first day, and an abdominal radiograph was performed every 24 h until 80% markers were excreted. In barium suspension method, the patient swallowed up to 50 ml of 200% (w/v) barium meal. The abdominal radiographs were taken at the same time point as the former. Results: The total or segmental colonic transit time were obviously prolonged in all patients. Segmental transits time spent in the right colon, left colon and rectosigmoid for radiopaque markers and barium suspension method was, respectively, 30 {+-} 6 h and 34 {+-} 7 h; 38 {+-} 9 h and 32 {+-} 6 h; 40 {+-} 8 h and 38 {+-} 10 h. In the radiopaque markers method, total colonic transit time was 108 {+-} 14 h and it was 103 {+-} 13 h in the barium suspension method (P > 0.05). Conclusion: The barium suspension and radiopaque markers gave the similar results for colonic transit time. The barium suspension was a simple and cheap method for evaluating the colonic mobility.

  1. Demonstrating the potential of yttrium-doped barium zirconate electrolyte for high-performance fuel cells

    Science.gov (United States)

    Bae, Kiho; Jang, Dong Young; Choi, Hyung Jong; Kim, Donghwan; Hong, Jongsup; Kim, Byung-Kook; Lee, Jong-Ho; Son, Ji-Won; Shim, Joon Hyung

    2017-02-01

    In reducing the high operating temperatures (>=800 °C) of solid-oxide fuel cells, use of protonic ceramics as an alternative electrolyte material is attractive due to their high conductivity and low activation energy in a low-temperature regime (fuel cells. However, poor sinterability of yttrium-doped barium zirconate discourages its fabrication as a thin-film electrolyte and integration on porous anode supports, both of which are essential to achieve high performance. Here we fabricate a protonic-ceramic fuel cell using a thin-film-deposited yttrium-doped barium zirconate electrolyte with no impeding grain boundaries owing to the columnar structure tightly integrated with nanogranular cathode and nanoporous anode supports, which to the best of our knowledge exhibits a record high-power output of up to an order of magnitude higher than those of other reported barium zirconate-based fuel cells.

  2. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    CERN Document Server

    Mong, B; Walton, T; Chambers, C; Craycraft, A; Benitez-Medina, C; Hall, K; Fairbank, W; Albert, J B; Auty, D J; Barbeau, P S; Basque, V; Beck, D; Breidenbach, M; Brunner, T; Cao, G F; Cleveland, B; Coon, M; Daniels, T; Daugherty, S J; DeVoe, R; Didberidze, T; Dilling, J; Dolinski, M J; Dunford, M; Fabris, L; Farine, J; Feldmeier, W; Fierlinger, P; Fudenberg, D; Giroux, G; Gornea, R; Graham, K; Gratta, G; Heffner, M; Hughes, M; Jiang, X S; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krucken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Moore, D; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Retiere, F; Rowson, P C; Rozo, M P; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Twelker, K; Vuilleumier, J -L; Walton, J; Weber, M; Wen, L J; Wichoski, U; Yang, L; Yen, Y -R; Zhao, Y B

    2014-01-01

    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fluorescence quantum efficiency of the principal Ba emission transition are reported. Under current conditions, an image of $\\le10^4$ Ba atoms can be obtained. Prospects for imaging single Ba atoms in solid xenon are discussed.

  3. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    Energy Technology Data Exchange (ETDEWEB)

    Baştürka, Emre; Madakbaş, Seyfullah; Kahraman, Memet Vezir, E-mail: smadakbas@marmara.edu.tr [Department of Chemistry, Marmara University, Istanbul (Turkey)

    2016-03-15

    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  4. Determination of barium in bottled drinking water by graphite furnace atomic absorption spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Fagioli, F.; Locatelli, C.; Lanciotti, E.; Vallone, G.; Mazzotta, D.; Mugelli, A.

    1988-11-01

    In relation to the wide environmental spread of barium and to its cardiovascular effects, barium levels were determined by graphite furnace atomic absorption spectrometry in 60 different brands of bottled water marketed in Italy. Matrix interferences were investigated in order to evaluate the use of an analytical calibration function rather than the much more time consuming addition technique. The barium content ranged from limit of detection C/sub L/ (7.0 ..mu..g/1) up to 660 ..mu..g/1, the median value being 80 ..mu..g/l, while the recovery tests varied between 90 and 110% and the precision of the method (s/sub yx/) was 2.5%.

  5. Individual-specific transgenerational marking of fish populations based on a barium dual-isotope procedure.

    Science.gov (United States)

    Huelga-Suarez, Gonzalo; Moldovan, Mariella; Garcia-Valiente, America; Garcia-Vazquez, Eva; Alonso, J Ignacio Garcia

    2012-01-01

    The present study focuses on the development and evaluation of an individual-specific transgenerational marking procedure using two enriched barium isotopes, (135)Ba and (137)Ba, mixed at a given and selectable molar ratio. The method is based on the deconvolution of the isotope patterns found in the sample into four molar contribution factors: natural xenon (Xe nat), natural barium (Ba nat), Ba135, and Ba137. The ratio of molar contributions between Ba137 and Ba135 is constant and independent of the contribution of natural barium in the sample. This procedure was tested in brown trout ( Salmo trutta ) kept in captivity. Trout were injected with three different Ba137/Ba135 isotopic signatures ca. 7 months and 7 days before spawning to compare the efficiency of the marking procedure at long and short term, respectively. The barium isotopic profiles were measured in the offspring by means of inductively coupled plasma mass spectrometry. Each of the three different isotopic signatures was unequivocally identified in the offspring in both whole eggs and larvae. For 9 month old offspring, the characteristic barium isotope signatures could also be detected in the otoliths even in the presence of a high and variable amount of barium of natural isotope abundance. In conclusion, it can be stated that the proposed dual-isotope marking is inheritable and can be detected after both long-term and short-term marking. Furthermore, the dual-isotope marking can be made individual-specific, so that it allows identification of offspring from a single individual or a group of individuals within a given fish group.

  6. Chemical composition of nanomodified composite binder with nano- and microsized barium silicate

    Directory of Open Access Journals (Sweden)

    KOROLEV Evgenij Valerjevich

    2014-08-01

    Full Text Available There are several possibilities to improve cement-based binders. In particular, many properties of cement stone can be enhanced by means of micro- and nanoscale modification. In a number of previous works we had shown that application of barium hydrosilicates leads to such improvement. The present article is devoted to the investigation of the chemical composition of the cement stone which is modified by means of addition of barium hydrosilicates. The modification was performed on different scales: micro- and nanoscale; the results of simultaneous multi-scale modification are also presented. The examination was carried out with help of different modern research techniques – FT IR spectroscopy, differential thermal analysis and X-ray phase analysis. Identification of the new phases and comparative quantitative assessment of their content are performed. It is found that the use of nano- and micro-sized barium hydrosilicates as additives leads to reduction of portlandite by 27...28%; by means of multi-scale modification it is possible to reduce the content of portlandite much more (by 83.3%. Due to addition of nano- and micro-sized barium-based modifiers both the amount of calcium hydrosilicates in reaction products is enlarged, and structure of the mentioned hydrosilicates is changed (the formation of a fine-grained structure of hydration products takes place. Micro-sized barium hydrosilicates are chemically active additives and promote the formation of an additional quantity of calcium hydrosilicates of type CSH (I. The use of nanoscale barium hydrosilicates promotes the formation of CSH (I and CSH (II calcium hydrosilicates, and also both riversidite and xonotlite. As a result of simultaneous application of nano- and micro-sized barium hydrosilicates the content of CSH (II increases. This can be confirmed by means of differential thermal and X-ray analysis. The amount of CSH (I, riversidite and various tobermorites is also increases. It is

  7. Synthesis, characterization and thermostability of barium β-diketonate with tetraethylenepentamine ligand

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    The metal-organic chemical vapor deposition (MOCVD) technique is a promising process for high-temperature superconductor YBa2Cu3O7-δ(YBCO) preparation. In this technique, it is a challenge to obtain barium precursors with high volatility. In addition, the purity, evaporation characteristics and thermostability of adopted precursors in the whole process would decide the quality and reproducible results of YBCO film. In the present report, the barium precursor containing 2,2,6,6-tetramethylheptane-3,5-dionate...

  8. Study of the microstructural transformations of borate glass and barium metaborate crystals induced by femtosecond laser

    Institute of Scientific and Technical Information of China (English)

    Chen Bin; Yu Bing-Kun; Yan Xiao-Na; Qiu Jian-Rong; Jiang Xiong-Wei; Zhu Cong-Shan

    2004-01-01

    This paper describes the microstructural transformations of borate glass and barium metaborate crystals induced by femtosecond laser. Such structural transformations were verified by Raman spectroscopy. The borate glass is transformed into low temperature (LT) phase of barium metaborate (BaB2O4) crystals after being irradiated for 10 min by a femtosecond laser. In addition, after 20 min of irradiation, high temperature (HT) phase of BaB2O4 crystals is also produced. Further studies demonstrate that LT phase BaB2O4 crystals are formed in the HT phase BaB2O4 crystals after femtosecond laser irradiation for 10 s.

  9. Temperature-Dependent Raman Spectra and Microstructure of Barium Metaborate Crystals and Its Melts

    Institute of Scientific and Technical Information of China (English)

    尤静林; 蒋国昌; 侯怀宇; 吴永全; 陈辉; 徐匡迪

    2002-01-01

    We have measured the Raman spectra of β- and α-barium metaborate in crystal and liquid states from room temperature to 1873K, with a semiconductor laser as the laser source, coupled with a time-resolved detection system to eliminate the dense thermal emission background when temperature was considerably high.Temperature-dependent Raman spectra can clearly indicate that the phase transformation from β- to α-barium metaborate has been completed during 1273 - 1300 K. Variations of different kinds of microstructure units with temperature are identified and discussed.

  10. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate

    Indian Academy of Sciences (India)

    P Sarah; S V Suryanarayana

    2003-12-01

    Piezoelectric 3–0 composite ceramics are prepared from a mixture of barium titanate and lithium ferrite phase constituents. Dielectric properties of composites are affected by a number of parameters that include electrical properties, size, shape and amount of constituent phases. The frequency dependent measurements can provide additional insight into mechanisms controlling electrical response. Frequency dependence of dielectric constant plots of lithium ferrite/barium titanate composites will be given and the relevance of trends seen in them will be discussed. Connectivity in composites developed is studied.

  11. Physical states and properties of barium titanate films in a plane electric field

    Science.gov (United States)

    Shirokov, V. B.; Kalinchuk, V. V.; Shakhovoi, R. A.; Yuzyuk, Yu. I.

    2016-07-01

    The influence of a plane electric field on the phase states of barium titanate thin films under the conditions of forced deformation has been studied. The field dependence of a complete set of material constants has been taken in the region of the c-phase, where polarization losses are absent. The material constants are calculated using equations of the piezoelectric effect derived by linearizing the nonlinear equations of state from the phenomenological; theory for barium titanate. It has been shown that there is a critical value of the field at which the electromechanical coupling coefficient reaches a maximum.

  12. Synthesis and characterization of nickel oxide doped barium strontium titanate ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, M. [Dept. of Electrical Engineering, Bengal Institute of Technology Kolkata (India); Mukherjee, S. [Dept. of Metallurgical Engineering, Jadavpur University, Kolkata (India); Maitra, S. [Govt. College of Engg. and Ceramic Technology, Kolkata (India)

    2012-01-15

    Barium strontium titanate (BST) ceramics (Ba{sub 0.6}Sr{sub 0.4})TiO{sub 3} were synthesized by solid state sintering using barium carbonate, strontium carbonate and rutile as the precursor materials. The samples were doped with nickel oxide in different proportions. Different phases present in the sintered samples were determined from X-ray diffraction investigation and the distribution of different phases in the microstructure was assessed from scanning electron microscopy study. It was observed that the dielectric properties of BST were modified significantly with nickel oxide doping. These ceramics held promise for applications in tuned circuits. (author)

  13. CT-Guided Percutaneous Transthoracic Localization of Pulmonary Nodules Prior to Video-Assisted Thoracoscopic Surgery Using Barium Suspension

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Nyoung Keun; Park, Chang Min; Kang, Chang Hyun; Jeon, Yoon Kyung; Choo, Ji Yung; Lee, Hyun Ju; Goo, Jin Mo [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    2012-11-15

    To describe our initial experience with CT-guided percutaneous barium marking for the localization of small pulmonary nodules prior to video-assisted thoracoscopic surgery (VATS). From October 2010 to April 2011, 10 consecutive patients (4 men and 6 women; mean age, 60 years) underwent CT-guided percutaneous barium marking for the localization of 10 small pulmonary nodules (mean size, 7.6 mm; range, 3-14 mm): 6 pure ground-glass nodules, 3 part-solid nodules, and 1 solid nodule. A 140% barium sulfate suspension (mean amount, 0.2 mL; range, 0.15-0.25 mL) was injected around the nodules with a 21-gauge needle. The technical details, surgical findings and pathologic features associated with barium localizations were evaluated. All nodules were marked within 3 mm (mean distance, 1.1 mm; range, 0-3 mm) from the barium ball (mean diameter, 9.6 mm; range, 8-16 mm) formed by the injected barium suspension. Pneumothorax occurred in two cases, for which one needed aspiration. However, there were no other complications. All barium balls were palpable during VATS and visible on intraoperative fluoroscopy, and were completely resected. Both the whitish barium balls and target nodules were identifiable in the frozen specimens. Pathology revealed one invasive adenocarcinoma, five adenocarcinoma-in-situ, two atypical adenomatous hyperplasias, and two benign lesions. In all cases, there were acute inflammations around the barium balls which did not hamper the histological diagnosis of the nodules. CT-guided percutaneous barium marking can be an effective, convenient and safe pre-operative localization procedure prior to VATS, enabling accurate resection and diagnosis of small or faint pulmonary nodules.

  14. A Calorimetric Search on Double Beta Decay of 130Te

    CERN Document Server

    Arnaboldi, C; Bucci, C; Capelli, S; Cremonesi, O; Fiorini, Ettore; Giuliani, A; Nucciotti, A; Pedretti, M; Pobes, C; Pavan, M M; Pessina, G; Pirro, S; Previtali, E; Sisti, M; Vanzini, M

    2003-01-01

    We report on the final results of a series of experiments on double decay of 130Te carried out with an array of twenty cryogenic detectors. The set-up is made with crystals of TeO2 with a total mass of 6.8 kg, the largest operating one for a cryogenic experiment. Four crystals are made with isotopically enriched materials: two in 128Te and two others in 130Te. The remaining ones are made with natural tellurium, which contains 31.7 % and 33.8 % 128Te and 130Te, respectively. The array was run under a heavy shield in the Gran Sasso Underground Laboratory at a depth of about 3500 m.w.e. By recording the pulses of each detector in anticoincidence with the others a 90 % C.L. lower limit of 2.1 x 10^{23}$ years has been obtained at the 90 % C.L. on the lifetime for neutrinoless double beta decay of 130Te. In terms of effective neutrino mass this is the most restrictive limit in direct experiments, after those obtained with Ge diodes. Limits on other lepton violating decays of 130Te and to the neutrinoless double be...

  15. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage.

    Science.gov (United States)

    Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J

    2012-01-01

    Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3).

  16. CUORE-0 background analysis and evaluation of $^{130}$Te $2\

    CERN Document Server

    Chiesa, Davide

    2016-01-01

    CUORE is a bolometric experiment that will search for the Neutrinoless Double Beta decay of $^{130}$Te. CUORE-0 is a single CUORE-like tower that was run between 2013 and 2015 to test the performance of the CUORE experiment. In this proceeding we present the results of the model developed to disentangle and quantify the background sources that combine to form the CUORE-0 energy spectrum. We use detailed Geant4-based simulations and a Bayesian fitting algorithm to reconstruct the experimental data and evaluate the activities of the background sources. A direct outcome of this analysis is the measurement of the $^{130}$Te $2\

  17. A surface-chemistry study of barium ferrite nanoplates with DBSa-modified surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Lisjak, Darja, E-mail: darja.lisjak@ijs.si [Jožef Stefan Institute, Ljubljana (Slovenia); Ovtar, Simona; Kovač, Janez [Jožef Stefan Institute, Ljubljana (Slovenia); Gregoratti, Luca; Aleman, Belen; Amati, Matteo [Elettra – Sincrotrone Trieste S.C.p.A. di interesse nazionale, Trieste (Italy); Fanetti, Mattia [University of Nova Gorica, Nova Gorica (Slovenia); Istituto Officina dei Materiali CNR, Area Science Park, Trieste (Italy); Makovec, Darko [Jožef Stefan Institute, Ljubljana (Slovenia)

    2014-06-01

    Barium ferrite (BaFe{sub 12}O{sub 19}) is a ferrimagnetic oxide with a high magnetocrystalline anisotropy that can be exploited in magnetically aligned ceramics or films for self-biased magnetic applications. Magnetic alignment of the films can be achieved by the directed assembly of barium ferrite nanoplates. In this investigation the nanoplates were synthesized hydrothermally and suspended in 1-butanol using dodecylbenzene sulphonic acid (DBSa) as a surfactant. They were then deposited in an electric or magnetic field on flat substrates and exhibited a significant preferential alignment in the plane of the substrate, allowing a differentiation between the analysis of their basal and side planes using scanning photoelectron microscopy with a lateral resolution down to 100 nm. The surface chemistry of the nanoplates was additionally studied with X-ray photoelectron spectroscopy and time-of-flight secondary ion mass spectrometry. For a comparison, bare barium ferrite nanoplates were also analyzed after decomposing the DBSa at 460 °C. The deviation of the surface chemistry from the stoichiometric composition was observed and the adsorption of the DBSa molecules on the nanoplates was confirmed with all three methods. Different types of bonding (physi- or chemisorption) were possible and considered with respect to the assembly of the barium ferrite nanoplates into anisotropic magnetic films.

  18. X-Ray Fluorescence Analysis for Barium, Zinc, Calcium and Phosphorus in Oil Additives.

    Science.gov (United States)

    1983-08-01

    HOAlD-I’ 908 XRAY FLUORESCENCE ANALYSIS FOR BARIUM ZINC CALCIUM AND i/i PHOSPHORUS IN OIL HDDITIVES(U MATERIALS RESEARCH LABS ASCOT VALE (AUSTRALIA...film technique was used by McGinness, Scott and Mortensen [101 for the quantitative x-ray emission analysis of paints . The paint films, "one-half mil

  19. Inconceivable Hypokalemia: A Case Report of Acute Severe Barium Chloride Poisoning

    Directory of Open Access Journals (Sweden)

    Haibo Tao

    2016-01-01

    Full Text Available Barium is a heavy divalent alkaline earth metal that has been known as a muscle poison. Barium can cause human toxicity, which may lead to significant hypokalemia and have serious consequences. This paper reports a case of unprecedented barium intoxication in which the patient, who suffered from depression, swallowed at least 3.0 g barium chloride to commit suicide. On admission, the patient presented with nausea, vomiting, stomach burning feeling, dizziness, and weakness. Emergency biochemical testing showed that the patient was suffering from severe hypokalemia (K+ 1.7 mmol/L. His electrocardiogram (ECG prompted atrioventricular blocking, ventricular tachycardia, prolongation of PR interval, ST segment depression with U waves, and T wave inversion. Intravenous potassium supplements were given immediately to correct hypokalemia and regular monitoring of vital signs and fluid balance was arranged. After all-out rescue of our hospital personnel, the condition of the patient is currently stable and he is gradually recovering. This case exemplifies the weaknesses of the management of toxic substances and the lack of mental health education for young people. We hope to get more attention for the supervision of toxic substances and the healthy development of young people.

  20. Demonstrating the potential of yttrium-doped barium zirconate electrolyte for high-performance fuel cells.

    Science.gov (United States)

    Bae, Kiho; Jang, Dong Young; Choi, Hyung Jong; Kim, Donghwan; Hong, Jongsup; Kim, Byung-Kook; Lee, Jong-Ho; Son, Ji-Won; Shim, Joon Hyung

    2017-02-23

    In reducing the high operating temperatures (≥800 °C) of solid-oxide fuel cells, use of protonic ceramics as an alternative electrolyte material is attractive due to their high conductivity and low activation energy in a low-temperature regime (≤600 °C). Among many protonic ceramics, yttrium-doped barium zirconate has attracted attention due to its excellent chemical stability, which is the main issue in protonic-ceramic fuel cells. However, poor sinterability of yttrium-doped barium zirconate discourages its fabrication as a thin-film electrolyte and integration on porous anode supports, both of which are essential to achieve high performance. Here we fabricate a protonic-ceramic fuel cell using a thin-film-deposited yttrium-doped barium zirconate electrolyte with no impeding grain boundaries owing to the columnar structure tightly integrated with nanogranular cathode and nanoporous anode supports, which to the best of our knowledge exhibits a record high-power output of up to an order of magnitude higher than those of other reported barium zirconate-based fuel cells.

  1. Settling barium fluxes in the Arabian Sea: Critical evaluation of relationship with export production

    Digital Repository Service at National Institute of Oceanography (India)

    Nair, T.M.B.; Ittekkot, V.; Shankar, R.; Guptha, M.V.S.

    discrepancy is documented between the export flux calculated from the barium-based algorithm and from C sub(org) fluxes at different depths. However, approx. 35% increase in Ba fluxes and a concomitant increase in Ba/C sub(org) ratios are documented between...

  2. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    CERN Document Server

    Anderson, NG; Firsching, M; de Ruiter, N; Schleich, N; Butzer, J S; Cook, N J; Grasset, R; Campbell, M; Scott, N J A; Anderson, N G

    2010-01-01

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 A mu A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct f...

  3. Study of structural, ferromagnetic and ferroelectric properties of nanostructured barium doped Bismuth Ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Chaudhuri, A., E-mail: arkac123@gmail.com [Department of Applied Science, Haldia Institute of Technology, Dist.- Purba Medinipur, Haldia- 721657, West Bengal (India); Department of Condensed Matter Physics and Material Science, S.N. Bose National Center for Basic Sciences, Block JD, Salt Lake, Kolkata 700098 (India); Mandal, K. [Department of Applied Science, Haldia Institute of Technology, Dist.- Purba Medinipur, Haldia- 721657, West Bengal (India); Department of Condensed Matter Physics and Material Science, S.N. Bose National Center for Basic Sciences, Block JD, Salt Lake, Kolkata 700098 (India)

    2014-03-15

    Nanostructured multiferroic Bi{sub (1−x)}Ba{sub x}FeO{sub 3}x=0.0, 0.1, 0.2 were prepared by hydrothermal technique. All samples belonged to the rhombohedrally distorted perovskite structure. The morphology of the particles changed with the doping of barium. Effect of barium doping on the dielectric constant was studied over a wide frequency range of 1000 Hz–1 MHz. The activation energy due to relaxation and due to conduction was measured from the Cole Cole plot and the AC conductivity versus frequency plot respectively. The activation energy estimated from both the studies was close to each other. The activation energy also enhanced with the increase in the barium content. The magnetization at the highest available field (∼1.6 T) increased from 0.05 emu/g for the sample with x=0.0–12 emu/g for the sample with x=0.2. The magnetic measurements show a significant increase in magnetization around 400 °C. Remnant polarization for x=0.0 was negligible and it increased to 0.06 µC/cm{sup 2} for x=0.2. - Highlights: • Bismuth Ferrite nanostructures were synthesized by the hydrothermal technique. • Barium was doped in Bismuth site. • Morphology changed with doping. • Ferromagnetic, Ferroelectric and Dielectric properties enhanced with doping. • An unreported magnetic transition due to spin canting was observed near 550 °C.

  4. Electromechanical Response of Polycrystalline Barium Titanate Resolved at the Grain Scale

    DEFF Research Database (Denmark)

    Majkut, Marta; Daniels, John E.; Wright, Jonathan P.

    2017-01-01

    critical for understanding bulk polycrystalline ferroic behavior. Here, three-dimensional X-ray diffraction is used to reconstruct a 3D grain map (grain orientations and neighborhoods) of a polycrystalline barium titanate sample and track the grain-scale non-180° ferroelectric domain switching strains...

  5. Diffuse X-ray scattering and far infrared absorption of barium and lead β" aluminas

    DEFF Research Database (Denmark)

    Hayes, W.; Kjær, Kristian; Pratt, F. L.;

    1985-01-01

    The authors have carried out high-momentum-resolution studies in diffuse X-ray scattering of barium and lead B" aluminas in the temperature range 20-700 degrees C. They have also measured the vibrational spectra of these compounds between 2K and 300K in the energy range 10-100 cm-1. The results a...

  6. Possible discovery of the r-process characteristics in the abundances of metal-rich barium stars

    CERN Document Server

    Cui, W Y; Shi, J R; Zhao, G; Wang, W J; Niu, P

    2014-01-01

    We study the abundance distributions of a sample of metal-rich barium stars provided by Pereira et al. (2011) to investigate the s- and r-process nucleosynthesis in the metal-rich environment. We compared the theoretical results predicted by a parametric model with the observed abundances of the metal-rich barium stars. We found that six barium stars have a significant r-process characteristic, and we divided the barium stars into two groups: the r-rich barium stars ($C_r>5.0$, [La/Nd]\\,$<0$) and normal barium stars. The behavior of the r-rich barium stars seems more like that of the metal-poor r-rich and CEMP-r/s stars. We suggest that the most possible formation mechanism for these stars is the s-process pollution, although their abundance patterns can be fitted very well when the pre-enrichment hypothesis is included. The fact that we can not explain them well using the s-process nucleosynthesis alone may be due to our incomplete knowledge on the production of Nd, Eu, and other relevant elements by the ...

  7. Granulomatous colitis: findings on double contrast barium enema and follow-up studies

    Energy Technology Data Exchange (ETDEWEB)

    Song, Jong Gi; Han, Joon Koo; Kim, Seung Hoon; Choo, Sung Wook; Kim, Seung Cheol; Choi, Byung Ihn [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    1995-10-15

    To evaluate the radiologic findings of granulomatous colitis on double contrast barium enema and changes on follow-up studies. Serial double contrast barium enema of six patients with granulomatous colitis confirmed by endoscopic biopsy were reviewed. We analyzed the radiologic findings and their follow-up changes, including aphthous ulcers, lymphoid hyperplasia, deep ulcers, cobble stone appearance, geographic ulcers, asymmetric involvement of ulcers, skip lesions, sinus tract, fistula formation, pseudosacculation, focal stricture, and small bowel involvement. Pretreatment double contrast barium enema findings were aphthous ulcers in five patients, deep ulcer in six, cobble stone appearance in five, longitudinal geographic ulcers in two, fistulas in one, pseudosacculations in two, focal stricture in one, and pseudopolyps in six. Also, anal ulcers were observed in two patients, asymmetric involvement of ulcers in three, skip lesions in four, and small bowel involvement in five in five patients proved to have inactive disease after treatment, aphthous ulcers and deep ulcers disappeared. Geographic ulcers of two patients and anal ulcer of one patients decreased in size or depth. Pseudosacculation in one patient disappeared. Pseudopolyps decreased in two patients, increased in one, and decreased after increase in two. One patient whose disease remained active after treatment showed maintenance or increase of ulcers or fistula. And their pseudosacculation or focal stricture unchanged and pseudopolyps decreased. The major radiologic findings of chronic granulomatous colitis on double contrast barium enema are aphthous ulcer, deep ulcer, cobble stone appearance, discontinuity of the lesion and coexistence of ulcers and pseudopolyps. And, double contrast barium enema is good follow-up modality because its findings correlate with clinical course of the granulomatous colitis after treatment.

  8. Influence of barium substitution on bioactivity, thermal and physico-mechanical properties of bioactive glass

    Energy Technology Data Exchange (ETDEWEB)

    Arepalli, Sampath Kumar, E-mail: askumar.rs.cer11@iitbhu.ac.in; Tripathi, Himanshu; Vyas, Vikash Kumar; Jain, Shubham; Suman, Shyam Kumar; Pyare, Ram; Singh, S.P., E-mail: spsinghceram@gmail.com

    2015-04-01

    Barium with low concentration in the glasses acts as a muscle stimulant and is found in human teeth. We have made a primary study by substituting barium in the bioactive glass. The chemical composition containing (46.1 − X) SiO{sub 2−}–24.3 Na{sub 2}O–26.9 CaO–2.6 P{sub 2}O{sub 5}, where X = 0, 0.4, 0.8, 1.2 and 1.6 mol% of BaO was chosen and melted in an electric furnace at 1400 ± 5 °C. The glasses were characterized to determine their use in biomedical applications. The nucleation and crystallization regimes were determined by DTA and the controlled crystallization was carried out by suitable heat treatment. The crystalline phase formed was identified by using XRD technique. Bioactivity of these glasses was assessed by immersion in simulated body fluid (SBF) for various time periods. The formation of hydroxy carbonate apatite (HCA) layer was identified by FTIR spectrometry, scanning electron microscope (SEM) and XRD which showed the presence of HCA as the main phase in all tested bioactive glass samples. Flexural strength and densities of bioactive glasses have been measured and found to increase with increasing the barium content. The human blood compatibility of the samples was evaluated and found to be pertinent. - Highlights: • In vitro bioactivity of soda-lime–baria-phospho-silicate glass was investigated. • HCA formed on surface of glasses was confirmed by XRD, SEM and FTIR spectrometry. • Mechanical properties of glasses were found to increase with barium addition. • Hemolysis showed that 1.2 mol% BaO bioactive glass exhibited better biocompatibility. • Barium substituted bioactive glasses can be used as bone implants.

  9. Scanning electron microscopic and electrophoretic observations on barium sulphate used to absorb clotting factors.

    Science.gov (United States)

    Howell, R M; Deacon, S L

    1975-04-30

    Electron microscopy and particle electrophoresis were found to be complementary techniques with which to complete the physical data from an earlier study on barium sulphates used to absorb clotting factors from serum. The differences revealed by scanning electron microscopy (S. E. M) in the physical shape of low and high density grades of barium sulphate particles appear to be of greater significance than charge as expressed by electrophoretic mobility, in determining whether or not precursor or performed factor Xa is eluted. This conclusion was based on the finding that at pH values close to 7, where the adsorption from serum occurs, all samples with the exception of natural barytes were uncharged. However as the high-density, or soil-grade, was found by S. E. M. to consist of large solid crystals it was suggested that this shape might induce activiation of factor X as a result of partial denaturation and consequent unfolding of the adsorbed protein. In contrast, uptake of protein into the centre of the porous aggregates revealed by S. E. M. pictures of low-density or X-ray grade barium sulphate may afford protection against denaturation and exposure of the enzyme site. The porous nature of particles of low-density barium sulphate compared with the solid crystalline forms of other grades accounts not only for its lower bulk density but also for its greater surface/gram ratio which is reflected by an ability to adsorb more protein from serum. Neither technique produced evidence from any of the samples to indicate the presence of stabilising agents sometimes used to coat particles in barium meals.

  10. Phenotype abnormality: 130 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 130 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u636i decreased effic...iency during process named growth in period of F mature embryo stage ... F mature embryo stage ... decreased efficiency ... growth ...

  11. Investigation of the Fracture Behavior of Scaled HY-130 Weldments

    Science.gov (United States)

    1990-06-01

    illustrated the significant influence of the clamnping ccnditiomns and resu~ting membrane stresses or" weldmnaet fractura . STest FILY-130 WE9-3 was...UNITED KINGDOM ATTN: I. CULLIS 1 DRA FORT HALSTEAD SEVENOAKS KENT TN14 tBP ENGLAND, UNITED KINGDOM ATTN: TAF (M. BORRMANN) 1 IABG EINSTEINSTRASSE 20 D

  12. 40 CFR 180.130 - Hydrogen Cyanide; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Hydrogen Cyanide; tolerances for... § 180.130 Hydrogen Cyanide; tolerances for residues. (a) General. A tolerance for residues of the insecticide hydrogen cyanide from postharvest fumigation as a result of application of sodium cyanide...

  13. 14 CFR 21.130 - Statement of conformity.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Statement of conformity. 21.130 Section 21... conformity. Each holder or licensee of a type certificate only, for a product manufactured in the United... Administrator a statement of conformity (FAA Form 317). This statement must be signed by an authorized...

  14. Egresados 1861-1991, 130 años

    Directory of Open Access Journals (Sweden)

    Facultad de Ingeniería Universidad Nacional de Colombia

    2012-05-01

    Full Text Available En los 130 años la Facultad de Ingeniería de la Universidad Nacional, Sede Santafé de Bogotá, rinde homenaje a sus egresados y por ello desea destacarlos, en este número especial de la Revista.

  15. 40 CFR 130.0 - Program summary and purpose.

    Science.gov (United States)

    2010-07-01

    ..., interstate agencies, and areawide, local and regional planning organizations. This regulation explains the... QUALITY PLANNING AND MANAGEMENT § 130.0 Program summary and purpose. (a) This subpart establishes policies and program requirements for water quality planning, management and implementation under sections...

  16. 46 CFR 130.480 - Test procedure and operations manual.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Test procedure and operations manual. 130.480 Section....480 Test procedure and operations manual. (a) A procedure for tests to be conducted on automated... detailed operations manual that describes the operation and indicates the location of each system...

  17. 40 CFR 170.130 - Pesticide safety training for workers.

    Science.gov (United States)

    2010-07-01

    ... (iii) Have completed a pesticide safety train-the-trainer program approved by a State, Federal, or... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pesticide safety training for workers...) PESTICIDE PROGRAMS WORKER PROTECTION STANDARD Standard for Workers § 170.130 Pesticide safety training...

  18. 20 CFR 655.130 - Application filing requirements.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Application filing requirements. 655.130... Certification must be mailed, and will also post these addresses on the OFLC Internet Web site at http://www... Application for Temporary Employment Certification prior to filing. (e) Information received in the course...

  19. L130-million cut to grants hits UK physical scientists

    CERN Multimedia

    Cressey, Daniel

    2008-01-01

    "UK physicists, still reeling from massive funding cuts announced earlier this year, have learnt of worse to come. Roughly L130 million (US$260 million)is being slashed from research grants awarded by the Engineering and Physical Scienes Research Council (EPSRC), it announced on 17 March." (2 pages)

  20. 22 CFR 130.12 - Information to be furnished by vendor to applicant or supplier.

    Science.gov (United States)

    2010-04-01

    ... applicant or supplier. 130.12 Section 130.12 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN... vendor to applicant or supplier. (a) In order to determine whether it is obliged under § 130.9 to furnish the information specified in § 130.10 with respect to a sale, every applicant or supplier must...

  1. THERMAL DECOMPOSITION MECHANISM OF BARIUM BENZOATE%苯甲酸钡的热分解机理

    Institute of Scientific and Technical Information of China (English)

    张克立; 袁继兵; 袁良杰; 孙聚堂

    1999-01-01

    Barium benzoate was synthesized in semi-solid phase reaction. The complex was characterized by elemental analysis, IR, X-ray powder diffraction. It is layered structure, monoclinic system. The mechanism of thermal decomposition for barium benzoate was studied by using TG, DTA, IR and gas chromatography-mass spectrometer. The thermal decompositon of barium benzoate in nitrogen proceeded in one stage: it decomposed to form BaCO3 and organic compounds. The organic compounds obtained from decomposition reaction are mainly benzophenone, triphenylmethane and so on.

  2. Obtaining of barium sulfate from solution formed after desulfation of the active mass of scrap lead-acid batteries

    Directory of Open Access Journals (Sweden)

    O. A. Kalko

    2014-03-01

    Full Text Available Analyses of literature data about processes for solution utilization formed after desulfation of the active mass of scrap lead-acid batteries is performed. Optimal conditions for obtaining of barium sulfate sediment from ammonium sulfate solute and chemically pure Ba(OH2×8H2O и BaCl2×2H2O were found experimentally. In laboratory the commercial barium sulfate from sulfate solutions, that are waste of recycling process of battery scrap, with application of chloride and barium hydroxide was production. The possibility of using this product were discussed.

  3. Effects of barium on the nonlinear electrical characteristics and dielectric properties of SnO2-based varistors

    Institute of Scientific and Technical Information of China (English)

    Wang Chun-Ming; Wang Jin-Feng; Wang Chun-Lei; Chen Hong-Cun; Su Wen-Bin; Zang Guo-Zhong; Qi Peng; Zhao Ming-Lei; Ming Bao-Quan

    2004-01-01

    The effects of barium on electrical and dielectric properties of the SnO2·Co2Oa.Ta2O5 varistor system sintered at 1250℃ for 60min were investigated. It is found that barium significantly improves the nonlinear properties. The breakdown electrical field increases from 378.0 to 2834.5V/mm, relative dielectric constant (at 1kHz) falls from 1206 to 161 and the resistivity (at 1kHz) rises from 60.3 to 1146.5kΩ·cm with an increase of BaCO3 concentration from 0mol%to 1.00mol%. The sample with 1.00mol% barium has the best nonlinear electrical property and the highest nonlinear coefficient (α=29.2). A modified defect barrier model is introduced to illustrate the grain-boundary barrier formation of barium-doped SnO2-based varistors.

  4. Crystallographic Studies of Cephalosporin Acylase from Pseudomonas sp. Strain 130

    Institute of Scientific and Technical Information of China (English)

    DING Yi(丁怡); JIANG Weihong(姜卫红); ZHANG Shuping(张淑平); MAO Xiang(茅翔); Mark Bartlam; ZHAO Guoping(赵国平); RAO Zihe(饶子和)

    2003-01-01

    The cephalosporin acylases are a group of enzymes that hydrolyze cephalosporin C and/or glutaryl 7-aminocephalosporanic acid to produce 7-aminocephalosporanic acid.The cephalosporin acylase from Pseudomonas sp.strain 130 was crystallized in two different forms suitable for structural studies.A tetragonal crystal form diffracted to 0.24 nm belonged to the space group P41212.There was one αβ heterodimer per asymmetric unit.A second crystal form diffracted to 0.21 nm belonged to the space group P21.There was four αβ heterodimers per asymmetric unit.The tetragonal crystal structure of CA-130 was determined using the multiwavelength anomalous diffraction method and the P21 crystal structure was then determined using the molecular replacement method.

  5. Use of Different Barium Salts to Inhibit the Thaumasite Form of Sulfate Attack in Cement-based Materials

    Institute of Scientific and Technical Information of China (English)

    SU Ying; WEI Xiaochao; HUANG Jian; WANG Yingbin; HE Xingyang; WANG Xiongjue; MA Baoguo

    2016-01-01

    We investigated the effects of different barium compounds on the thaumasite form of sulphate attack (TSA) resistance of cement-based materials when they were used as admixtures in mortars. Moreover, we analyzed the inhibition mechanisms within different types of barium salts, namely BaCO3 and Ba(OH)2, on the thaumasite formation. The control cement mortar and mortars with barium salts to cement and limestone weight ratios of 0.5%, 1.0%, and 1.5% were immersed in 5% (by weight) MgSO4 solution at 5℃ to mimic TSA. Appearance, mass, and compressive strength of the mortar samples were monitored and measured to assess the general degradation extent of these samples. The products of sulphate attack were further analyzed by XRD, FTIR, and SEM, respectively. Experimental results show that different degradation extent is evident in all mortars cured in MgSO4 solution. However, barium salts can greatly inhibit such degradation. Barium in hydroxide form has better effectiveness in protection against TSA than carbonate form, which may be due to their solubility difference in alkaline cement pore solution, and the presence of these barium compounds can reduce the degree of TSA by comparison with the almost completely decomposed control samples.

  6. Scaled-energy spectroscopy of a |M|=1 Rydberg barium atom in an electric field

    Institute of Scientific and Technical Information of China (English)

    Wang Lei; Quan Wei; Shen Li; Yang Hai-Feng; Shi Ting-Yun; Liu Xiao-Jun; Liu Hong-Ping; Zhan Ming-Sheng

    2009-01-01

    We observe strong energy-dependent quantum defects in the scaled-energy Stark spectra for |M|=1 Rydberg states of barium atoms at three scaled energies: ε= -2.000, ε= -2.500 and ε=-3.000. In an attempt to explain the observations, theoretical calculations of closed orbit theory based on a model potential including core effect are performed for non-hydrogenic atoms. While such a potential has been uniformly successful for alkali atoms with a single valence electron, it fails to match experimental results for barium atoms in the 6snp Rydberg states with two valence electrons. Our study points out that this discrepancy is due to the strong perturbation from the 5d8p state, which voids the simple approximation for constant quantum defects of principle quantum number n.

  7. CORRELATED STRONTIUM AND BARIUM ISOTOPIC COMPOSITIONS OF ACID-CLEANED SINGLE MAINSTREAM SILICON CARBIDES FROM MURCHISON

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Nan; Davis, Andrew M.; Dauphas, Nicolas; Pellin, Michael J. [Department of the Geophysical Sciences, The University of Chicago, Chicago, IL, 60637 (United States); Savina, Michael R. [Chicago Center for Cosmochemistry, Chicago, IL 60637 (United States); Gallino, Roberto; Bisterzo, Sara [Dipartimento di Fisica, Università di Torino, I-10125 Torino (Italy); Gyngard, Frank [Laboratory for Space Sciences, Washington University, St. Louis, MO 63130 (United States); Käppeler, Franz [Karlsruhe Institute of Technology, Institut für Kernphysik, Karlsruhe D-76021 (Germany); Cristallo, Sergio [INAF, Osservatorio Astronomico di Collurania, I-64100 Teramo (Italy); Dillmann, Iris, E-mail: lnsmile@uchicago.edu [TRIUMF, 4004 Wesbrook Mall, Vancouver BC V6T 2A3 (Canada)

    2015-04-10

    We present strontium, barium, carbon, and silicon isotopic compositions of 61 acid-cleaned presolar SiC grains from Murchison. Comparison with previous data shows that acid washing is highly effective in removing both strontium and barium contamination. For the first time, by using correlated {sup 88}Sr/{sup 86}Sr and {sup 138}Ba/{sup 136}Ba ratios in mainstream SiC grains, we are able to resolve the effect of {sup 13}C concentration from that of {sup 13}C-pocket mass on s-process nucleosynthesis, which points toward the existence of large {sup 13}C pockets with low {sup 13}C concentrations in asymptotic giant branch stars. The presence of such large {sup 13}C pockets with a variety of relatively low {sup 13}C concentrations seems to require multiple mixing processes in parent asymptotic giant branch stars of mainstream SiC grains.

  8. Synthesis and Fluorescence of Europium-Doped Barium Fluoride Cubic Nanocolumns

    Institute of Scientific and Technical Information of China (English)

    连洪州; 刘洁; 叶泽人; 石春山

    2004-01-01

    Europium-doped barium fluoride cubic nanocolumns were synthesized from the quaternary water in oil reverse microemulsions. In this process, the aqueous cores of water/cetyl trimethyl ammonium bromide(CTAB)/n-butanol/n-octane reverse microemulsions were used as microreactors for the precipitation of europium doped barium fluoride. XRD analysis shows that under the dopant concentration of 0.06%(molar fraction), the products are single phase. The result products are cubic column-like with about 30~50 nm edge length of cross section, and about 200 nm of length obtained from the transmission electron microscopy(TEM), and atomic force microscopy(AFM). Under the 0.06%(molar fraction) of dopant concentration, the fluorescence of Eu2+ and Eu3+ under the 589 of excitation wavelength is observed.

  9. Barium phosphate conversion coating on die-cast AZ91D magnesium alloy

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Poor corrosion resistance limits the application of magnesium alloys.Conversion coating is widely used to protect magnesium alloys because of easy operation and low cost.A novel conversion coating on die.cast AZ91D magnesium alloy containing barium salts was studied.The optimum concentrations of Ba(NO3)2,Mn(NO3)2 and NH4H2PO4 are 25 g/L,15 mL/L and 20 g/L,respectively,based on orthogonal test resulm.The treating time,solution temperature and PH value are settled to be 5-30 min,50-70℃and 2.35-3.0.respectively.The corrosion resistance of barium conversion coating is better than that of manganese-based phosphate conversion coating by immersion test.The coating is composed of Ba,P, O,Mg,Zn,Mn and Al by EDX analysis.

  10. Study on the preparation and formation mechanism of barium sulphate nanoparticles modified by different organic acids

    Indian Academy of Sciences (India)

    Yuhua Shen; Chuanhao Li; Xuemei Zhu; Anjian Xie; Lingguang Qiu; Jinmiao Zhu

    2007-07-01

    This paper reports a simple method to prepare barium sulphate nanoparticles by use of tetradecanoic acid, hexadecanoic acid and stearic acid as modifier. The barium sulphate nanoparticles obtained are characterized by using Fourier transform infra-red spectroscopy (FT-IR), powder X-ray diffraction (XRD), transmission electron microscopy (TEM), dynamic laser light scatter (DLLS) and thermogravimetric analysis (TGA), respectively. The results show that the BaSO4 particles are all spherical and in the nano-scale. Our method has a better dispersion and controllable diameter dependent on the length of the chain of organic acid and the pH value of the system. A possible mechanism is also discussed.

  11. Efficient photoionization for barium ion trapping using a dipole-allowed resonant two-photon transition

    CERN Document Server

    Leschhorn, G; Schaetz, T

    2011-01-01

    Two efficient and isotope-selective resonant two-photon ionization techniques for loading barium ions into radio-frequency (RF)-traps are demonstrated. The scheme of using a strong dipole-allowed transition at \\lambda=553 nm as a first step towards ionization is compared to the established technique of using a weak intercombination line (\\lambda=413 nm). An increase of two orders of magnitude in the ionization efficiency is found favoring the transition at 553 nm. This technique can be implemented using commercial all-solid-state laser systems and is expected to be advantageous compared to other narrowband photoionization schemes of barium in cases where highest efficiency and isotope-selectivity are required.

  12. Barium hexaferrite/graphene oxide: controlled synthesis and characterization and investigation of its magnetic properties

    Science.gov (United States)

    Maddahfar, Mahnaz; Ramezani, Majid; Mostafa Hosseinpour-Mashkani, S.

    2016-08-01

    In the present study, barium hexaferrite nanocrystals (BaFe12O19) were successfully synthesized through the two-step sol-gel method in an aqueous solution in the presence of barium nitrate and iron (III) nitrate. Besides, the effect of the molar ratio of graphene oxide on the particle size and magnetic properties of final product was investigated. In this research, glucose plays a role as capping and chelating agent in the synthesis of BaFe12O19/graphene oxide. Moreover, it was found that the size, morphology, and magnetic properties of the final products could be greatly influenced by the molar ratio of graphene oxide. BaFe12O19/graphene oxide was characterized by using X-ray diffraction, scanning electron microscope, Fourier transform infrared spectroscopy, vibrating sample magnetometer, and energy-dispersive spectrometry.

  13. Correlated Strontium and Barium Isotopic Compositions of Acid-Cleaned Single Silicon Carbides from Murchison

    CERN Document Server

    Liu, Nan; Gallino, Roberto; Davis, Andrew M; Bisterzo, Sara; Gyngard, Frank; Kaeppeler, Franz; Cristallo, Sergio; Dauphas, Nicolas; Pellin, Michael J; Dillmann, Iris

    2015-01-01

    We present strontium, barium, carbon, and silicon isotopic compositions of 61 acid-cleaned presolar SiC grains from Murchison. Comparison with previous data shows that acid washing is highly effective in removing both strontium and barium contamination. For the first time, by using correlated $^{88}Sr$/$^{86}Sr$ and $^{138}Ba$/$^{136}Ba$ ratios in mainstream SiC grains, we are able to resolve the effect of $^{13}C$ concentration from that of $^{13}C$-pocket mass on s-process nucleosynthesis, which points towards the existence of large $^{13}C$-pockets with low $^{13}C$ concentration in AGB stars. The presence of such large $^{13}$R-pockets with a variety of relatively low $^{13}C$ concentrations seems to require multiple mixing processes in parent AGB stars of mainstream SiC grains.

  14. Absolute Te$_2$ reference for barium ion at $455.4~$nm

    CERN Document Server

    Dutta, T; Mukherjee, M

    2016-01-01

    Precision atomic spectroscopy is presently the work horse in quantum information technology, metrology, trace analysis and even for fundamental tests in physics. Stable lasers are inherent part of precision spectroscopy which in turn requires absolute wavelength markers suitably placed corresponding to the atomic species being probed. Here we present, new lines of tellurium (Te$_2$) which allows locking of external cavity diode laser (ECDL) for precision spectroscopy of singly charged barium ions. In addition, we have developed an ECDL with over 100 GHz mod-hop-free tuning range using commercially available diode from $\\textit{Nichia}$. These two developments allow nearly drift-free operation of a barium ion trap set-up with one single reference cell thereby reducing the complexity of the experiment.

  15. Gamma-ray shielding and structural properties of barium-bismuth-borosilicate glasses

    Science.gov (United States)

    Bootjomchai, Cherdsak; Laopaiboon, Jintana; Yenchai, Chadet; Laopaiboon, Raewat

    2012-07-01

    The attenuation coefficients of barium-bismuth-borosilicate glasses have been measured for gamma-ray photon energies of 662, 1173 and 1332 keV using a narrow beam transmission geometry. These coefficients were then used to obtain the values of mass attenuation coefficients, effective atomic number, effective electron density and mean free path. Good agreement has been observed between experimental and theoretical values of these parameters. From the obtained results it is reported here that from the barium-bismuth-borosilicate glasses are better shields to gamma-radiations in comparison to the standard radiation shielding concretes from the shielding point of view. The molar volume, FTIR and acoustic investigations have been used to study the structural properties of the prepared glass system. The obtained results reveal that the formation of non-bridging oxygens occurs at higher concentration of Bi2O3.

  16. Kinetics of barium sulphate reaction crystallization in crystallizers with internal circulation

    Directory of Open Access Journals (Sweden)

    J. Koralewska

    2008-06-01

    Full Text Available Kinetic calculation results describing the observed nucleation and growth rates of barium sulphate crystals precipitated in an integrated reaction-crystallization process in a barium sulphate-ammonium chloride-water system are presented and analyzed. The scope of experiments included two continuous model DTM-type crystallizers (Draft Tube Magma with internal circulation of the suspension forced by a liquid jet-pump device responsible for stable and intensive enough ascending/descending flow of BaSO4 crystal magma in a mixing chamber. For comparison purposes the experimental data corresponding to a continuous DT (Draft Tube crystallizer with propeller agitator are presented and discussed. The various types of laboratory crystallizers used were fed with concentrated water solution of barium chloride (of 10 or 24 mass % and - in a stoichiometric proportion - crystalline ammonium sulphate, assuming isothermal (348 K and hydrodynamic (average residence time of suspension in a crystallizer: 900 s process conditions. The observed nucleation and growth rates of barium sulphate crystals were estimated on the basis of crystal size distributions (CSDs using convenient calculation scheme derived for an MSMPR (Mixed Suspension Mixed Product Removal model approach. Considering the experimental population density distribution courses, a size-dependent growth (SDG phenomenon was taken into account in the kinetic calculations. Five SDG kinetic models recommended in the accessible literature were used for kinetic parameter values estimation. It was proved statistically, that Rojkowski’s two SDG models (hyperbolic and exponential best suit for our own experimental data description. The experimental data presented can be practically applied for improving the constructions of liquid jet-pump DTM crystallizers recommended for reaction crystallization of sparingly soluble inorganic salts (especially for high concentrations of reaction substrates in the modern

  17. Establishment of a protocol for determining gastrointestinal transit time in mice using barium and radiopaque markers

    Energy Technology Data Exchange (ETDEWEB)

    Myagmarjaibuu, Bilomaa; Moon, Myeong Ju; Heo, Suk Hee; Jeong, Seo In; Jeong, Yong Yeon; Kang, Heoung Keun [Dept. of Radiology, Chonnam National University Hwasun Hospital, Chonnam National University Medical School, Hwasun (Korea, Republic of); Park, Jong Seong [Dept. of Physiology, Chonnam National University Medical School, Gwangju (Korea, Republic of); Jun, Jae Yeoul [Dept. of Physiology, College of Medicine, Chosun University, Gwangju (Korea, Republic of)

    2013-01-15

    The purpose of this study was to establish a minimally invasive and reproducible protocol for estimating the gastrointestinal (GI) transit time in mice using barium and radiopaque markers. Twenty 5- to 6-week-old Balb/C female mice weighing 19-21 g were used. The animals were divided into three groups: two groups that received loperamide and a control group. The control group (n = 10) animals were administered physiological saline (1.5 mL/kg) orally. The loperamide group I (n = 10) and group II (n = 10) animals were administered 5 mg/kg and 10 mg/kg loperamide orally, respectively. Thirty minutes after receiving the saline or loperamide, the mice was administered 80 μL of barium solution and six iron balls (0.5 mm) via the mouth and the upper esophagus by gavage, respectively. Afterwards, the mice were continuously monitored with fluoroscopic imaging in order to evaluate the swallowing of the barium solution and markers. Serial fluoroscopic images were obtained at 5- or 10-min intervals until all markers had been excreted from the anal canal. For analysis, the GI transit times were subdivided into intestinal transit times (ITTs) and colon transit times (CTTs). The mean ITT was significantly longer in the loperamide groups than in the control group (p < 0.05). The mean ITT in loperamide group II (174.5 ± 32.3) was significantly longer than in loperamide group I (133.2 ± 24.2 minute) (p < 0.05). The mean CTT was significantly longer in loperamide group II than in the control group (p < 0.05). Also, no animal succumbed to death after the experimental procedure. The protocol for our study using radiopaque markers and barium is reproducible and minimally invasive in determining the GI transit time of the mouse model.

  18. Wideband electromagnetic wave absorber using doped barium hexaferrite in Ku-band

    Energy Technology Data Exchange (ETDEWEB)

    Tehrani, Masoud Kavosh, E-mail: m_kavosh@mut-es.ac.ir [Department of Physics, Malek-ashtar University of Technology, Shahin Shahr (Iran, Islamic Republic of); Ghasemi, Ali [Department of Material Engineering, Malek-ashtar University of Technology, Shahin Shahr (Iran, Islamic Republic of); Moradi, Mahmood; Alam, Reza Shams [Department of Physics, Shiraz University, Shiraz (Iran, Islamic Republic of)

    2011-08-18

    Highlights: > Substituted barium hexaferrite BaMg{sub 0.25}Mn{sub 0.25}Co{sub 0.5}Ti{sub 1.0}Fe{sub 10}O{sub 19} was prepared in powder configuration by solid state reaction. > The results exhibit a wideband single-layer microwave absorber with a satisfactory reflection loss throughout Ku-band. > The composite specimens for measurement of microwave absorber properties were prepared by mixing doped barium ferrite and PVC with a concentration of 70:30 by weight. > The bandwidth that can be achieved by utilization of this sample is 4.5 GHz. Minimum reflection loss of -34 dB can be obtained by sample '(e)'. - Abstract: Substituted barium hexaferrite BaMg{sub 0.25}Mn{sub 0.25}Co{sub 0.5}Ti{sub 1.0}Fe{sub 10}O{sub 19} was prepared in powder configuration by solid state reaction. The ferrite powders were mixed with polyvinylcloride (PVC) plasticizer to fabricate a microwave absorbing composite. X-ray diffraction (XRD), scanning electron microscope (SEM), vibrating sample magnetometer (VSM), and vector network analyzer were employed to characterize phase identification coupled with size and morphology of powder and microwave absorption properties of synthesized composites. It was found that the maximum reflection loss of -40 dB was appeared at frequency range of 12-18 GHz. In the present work, new cation substitutions in iron sites in the crystal lattice of barium ferrite, which can easily tune the bandwidth of the reflection loss, were used. To the best of our knowledge, this is the first study which displays the wideband absorber by employing single layer hexaferrite backed on the surface of copper.

  19. Electrical properties of thick film capacitors based on barium titanate glass formulations

    Energy Technology Data Exchange (ETDEWEB)

    Leppaevuori, S.; Uusimaeki, A.; Hannula, T.

    1981-12-18

    We carried out an investigation of the effects of the glass content of the dielectric layer of thick film capacitors with a barium titanate glass formulation on the capacitance density, loss factor and breakdown voltage of the capacitors. These effects were studied by varying the firing temperature and glass content of the dielectric paste and by using different types of electrode paste. The characteristics of a test capacitor were also measured.

  20. Effect of boric acid sintering aid on densification of barium ferrite

    Indian Academy of Sciences (India)

    S S Vidyawathi; R Amaresh; L N Satapathy

    2002-11-01

    Boric acid has been added in 0.1–0.6% range for studying the densification characteristics of solid state sintered barium hexaferrite. Sintering studies have been carried out at three different temperatures. Physical properties like density and porosity have been studied for all compositions. The phase identification and microstructural investigation on the fractured surface have been carried out to understand the effect of sintering aid on the densification characteristics.

  1. Nanoparticles for cultural heritage conservation: calcium and barium hydroxide nanoparticles for wall painting consolidation.

    Science.gov (United States)

    Giorgi, Rodorico; Ambrosi, Moira; Toccafondi, Nicola; Baglioni, Piero

    2010-08-16

    Nanotechnology provides new concepts and materials for the consolidation and protection of wall paintings. In particular, humble calcium and barium hydroxide nanoparticles offer a versatile and highly efficient tool to combat the main degradation processes altering wall paintings. Clear example of the efficacy and potentiality of nanotechnology is represented by the conservation in situ of Maya wall paintings in the archaeological area in Calakmul (Mexico).

  2. Phase conjugation, isotropic and anisotropic higher order diffraction generation, and image correlation using photorefractive barium titanate

    Science.gov (United States)

    Buranasiri, Prathan

    2005-04-01

    Using barium titanate as the photorefractive material, we demonstrate phase conjugation, beam coupling, higher diffraction order generation. At small incident angles less than 0.015 radian, both codirectional isotropic self-diffraction (CODIS) and contradirectional isotropic self-diffraction (CONDIS) are generated simultaneously. At bigger incident angles approximately more than 0.2094 radian, only codirectional anisotropic-self diffraction (CODAS) are generated. On going imaging correlation is also showing.

  3. Neutron beam test of barium fluoride crystal for dark matter direct detection

    Science.gov (United States)

    Guo, C.; Ma, X. H.; Wang, Z. M.; Bao, J.; Dai, C. J.; Guan, M. Y.; Liu, J. C.; Li, Z. H.; Ren, J.; Ruan, X. C.; Yang, C. G.; Yu, Z. Y.; Zhong, W. L.

    2016-10-01

    In order to test the capabilities of Barium Fluoride (BaF2) crystal for dark matter direct detection, nuclear recoils are studied with mono-energetic neutron beam. The energy spectra of nuclear recoils, quenching factors for elastic scattering neutrons and discrimination capability between neutron inelastic scattering events and γ events are obtained for various recoil energies of the F content in BaF2.

  4. Growth and study of barium oxalate single crystals in agar gel

    Indian Academy of Sciences (India)

    P V Dalal; K B Saraf

    2006-10-01

    Barium oxalate was grown in agar gel at ambient temperature. The effect of various parameters like gel concentration, gel setting time and concentration of the reactants on the growth of these crystals was studied. Prismatic platy shaped spherulites and dendrites were obtained. The grown crystals were characterized by X-ray powder diffractometry, infrared spectroscopy, thermogravimetric and differential thermal analysis. An attempt is made to explain the spherulitic growth mechanism.

  5. A System for Trapping Barium Ions in a Microfabricated Surface Trap

    CERN Document Server

    Graham, Richard D; Sakrejda, Tomasz; Wright, John; Zhou, Zichao; Blinov, Boris B

    2013-01-01

    We have developed a vacuum chamber and control system for rapid testing of microfabricated surface ion traps. Our system uses a modular design and is based on an in-vacuum PCB with integrated filters. We have used this system to successfully trap and cool barium ions. We have demonstrated ion 'dark' lifetimes of 31.6 s +- 3.4 s and controlled shuttling of ions using a custom 96 electrode control system with an update rate of 40 kHz.

  6. Absolute Te$_2$ reference for barium ion at $455.4~$nm

    OpenAIRE

    Dutta, T; Munshi, D; Mukherjee, M.(Variable Energy Cyclotron Centre, Kolkata, India)

    2016-01-01

    Precision atomic spectroscopy is presently the work horse in quantum information technology, metrology, trace analysis and even for fundamental tests in physics. Stable lasers are inherent part of precision spectroscopy which in turn requires absolute wavelength markers suitably placed corresponding to the atomic species being probed. Here we present, new lines of tellurium (Te$_2$) which allows locking of external cavity diode laser (ECDL) for precision spectroscopy of singly charged barium ...

  7. Modification of gray iron produced by induction melting with barium strontium

    Science.gov (United States)

    Modzelevskaya, G.; Feoktistov, A. V.; Selyanin, I. F.; Kutsenko, A. I.; Kutsenko, A. A.

    2016-09-01

    The article provides analysis of results of gray iron experimental melts in induction furnace and the following melt modification with barium-strontium carbonate (BSC-2). It is shown that modification positively affects mechanical and casting properties and as-cast iron structure. It was established that BSC-2 granulated immediately prior to use has greater impact on melt than BSC-2 of the same faction, supplied by the manufacturer.

  8. MicroRNA-130a and -130b enhance activation of hepatic stellate cells by suppressing PPARγ expression: A rat fibrosis model study

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Le; Wang, Jinlong; Lu, Hongwei [Department of General Surgery, The Second Affiliated Hospital of Xi' an Jiaotong University, No.157, West 5th Road, Xi' an, Shaanxi 710004 (China); Zhang, Guoyu [West Hospital Ward 1, Shaanxi Provincial People' s Hospital, No.256, Youyi Road(west), Xi' an, Shaanxi 710068 (China); Liu, Yang; Wang, Jiazhong; Zhang, Yafei; Shang, Hao; Ji, Hong; Chen, Xi; Duan, Yanxia [Department of General Surgery, The Second Affiliated Hospital of Xi' an Jiaotong University, No.157, West 5th Road, Xi' an, Shaanxi 710004 (China); Li, Yiming, E-mail: yiminngli@163.com [Department of General Surgery, The Second Affiliated Hospital of Xi' an Jiaotong University, No.157, West 5th Road, Xi' an, Shaanxi 710004 (China)

    2015-09-25

    Hepatic stellate cells (HSCs) are the primary sources of extracellular matrix (ECM) in normal and fibrotic liver. Peroxisome proliferator-activated receptor gamma (PPARγ) maintains HSCs in a quiescent state, and its downregulation induces HSC activation. MicroRNAs (miRNAs) can induce PPARγ mRNA degradation, but the mechanism by which miRNAs regulate PPARγ in rat HSCs is unclear. This study aimed to investigate some miRNAs which putatively bind to the 3′-untranslated region (3′-UTR) of PPARγ mRNA, and increase expression of ECM genes in rat HSCs. In carbon tetrachloride injection (CCl{sub 4}) and common bile duct ligation (CBDL) liver fibrosis models, miRNAs miR-130a, miR-130b, miR-301a, miR-27b and miR-340 levels were found to be increased and PPARγ expression decreased. Overexpression of miR-130a and miR-130b enhanced cell proliferation by involving Runx3. MiR-130a and miR-130b decreased PPARγ expression by targeting the 3′-UTR of PPARγ mRNA in rat HSC-T6 cells. Transforming growth factor-β1 (TGF-β1) may mediate miR-130a and miR-130b overexpression, PPARγ downregulation, and ECM genes overexpression in cell culture. These findings suggest that miR-130a and miR-130b are involved in downregulation of PPARγ in liver fibrosis. - Highlights: • MiR-130a and miR-130b are increased and PPARγ is decreased in liver fibrosis models. • MiR-130a and miR-130b decreased PPARγ by targeting the 3′-UTR of PPARγ mRNA. • MiR-130a and miR-130b enhanced HSC cell proliferation by involving Runx3. • TGF-β1 may mediate miR-130a and miR-130b overexpression.

  9. Luminescence of Er3+ Doped Titanium Barium Glass Microsphere under 514 nm Excitation

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The titanium barium glass microspheres doped with Er2O3 were designed and prepared. The components of the glass sample were 25TiO2-27BaCO3-8Ba(NO3)2-5ZnO2-10CaCO3-5H3BO3-10SiO2-7water glass-3Er2O3 (%, mass fraction). The emission spectra of titanium barium glass matrix and the titanium barium glass microsphere under 514 nm excitation were measured with micro-Raman spectrometer. Whispering gallery modes in the emission spectra from a 31 μm glass microsphere were observed. Many regularly spaced, sharp peaks appeared in the emission spectra of the Er2O3-doped glass microsphere. The wavelength separation between the two adjacent peaks is 1.92 nm for the 31 μm microsphere. According to the Lorenz-Mie formula, the calculated value of the wavelength separation between the two adjacent peaks is 1.95 nm. The observed resonances could be assigned by using the well-known Lorenz-Mie formula.

  10. An effective quantum defect theory for the diamagnetic spectrum of a barium Rydberg atom

    Institute of Scientific and Technical Information of China (English)

    Li Bo; Liu Hong-Ping

    2013-01-01

    A theoretical calculation is carried out to investigate the spectrum of a barium Rydberg atom in an external magnetic field.Using an effective approach incorporating quantum defect into the centrifugal term in the Hamiltonian,we reexamine the reported spectrum of the barium Rydberg atom in a magnetic field of 2.89 T [J.Phys.B 28 L537 (1995)].Our calculation employs B-spline basis expansion and complex coordinate rotation techniques.For single photon absorption from the ground 6s2 to 6snp Rydberg states,the spectrum is not influenced by quantum defects of channels ns and nd.The calculation is in agreement with the experimental observations until the energy reaches E =-60 cm-1.Beyond this energy,closer to the threshold,the calculated and experimental results do not agree with each other.Possible reasons for their discrepancies are discussed.Our study affirms an energy range where the diamagnetic spectrum of the barium atom can be explained thoroughly using a hydrogen model potential.

  11. Single molecule fluorescence imaging as a technique for barium tagging in neutrinoless double beta decay

    Science.gov (United States)

    Jones, B. J. P.; McDonald, A. D.; Nygren, D. R.

    2016-12-01

    Background rejection is key to success for future neutrinoless double beta decay experiments. To achieve sensitivity to effective Majorana lifetimes of ~ 1028 years, backgrounds must be controlled to better than 0.1 count per ton per year, beyond the reach of any present technology. In this paper we propose a new method to identify the birth of the barium daughter ion in the neutrinoless double beta decay of 136Xe. The method adapts Single Molecule Fluorescent Imaging, a technique from biochemistry research with demonstrated single ion sensitivity. We explore possible SMFI dyes suitable for the problem of barium ion detection in high pressure xenon gas, and develop a fiber-coupled sensing system with which we can detect the presence of bulk Ba++ ions remotely. We show that our sensor produces signal-to-background ratios as high as 85 in response to Ba++ ions when operated in aqueous solution. We then describe the next stage of this R&D program, which will be to demonstrate chelation and fluorescence in xenon gas. If a successful barium ion tag can be developed using SMFI adapted for high pressure xenon gas detectors, the first essentially zero background, ton-scale neutrinoless double beta decay technology could be realized.

  12. Optical planar waveguide in sodium-doped calcium barium niobate crystals by carbon ion implantation

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Jin-Hua, E-mail: zhaojinhuazjh@gmail.com [School of Science, Shandong Jianzhu University, Jinan 250101 (China); Qin, Xi-Feng; Wang, Feng-Xiang; Fu, Gang; Wang, Hui-Lin [School of Science, Shandong Jianzhu University, Jinan 250101 (China); Wang, Xue-Lin [School of Physics, Key Laboratory of Particle Physics and Particle Irradiation, Ministry of Education, and State Key Laboratory of Crystal Materials, Shandong University, Jinan 250100 (China)

    2013-07-15

    There is great interest in niobate crystals which belong to the tetragonal tungsten bronze (TTB) families owing to their intriguing properties. As one representative of such crystals, CBN (calcium barium niobate) has attracted rapidly growing attention. Because it has a higher Curie temperature than SBN (strontium barium niobate), possesses outstanding ferroelectric and it possesses optical properties. In addition, doped with sodium, CBN will show a higher Curie temperature than pure CBN. We report on the fabrication and characterization of optical planar waveguide in x-cut sodium-doped calcium barium niobate crystal by using C ion implantation. The guided-mode properties at the wavelength of 633 and 1539 nm are investigated through prism-coupling measurements, respectively. By applying direct end-face coupling arrangement, the near-field optical intensity distribution of waveguide modes is measured at 633 nm. For comparison, the modal profile of the same guided mode is also numerically calculated by the finite difference beam-propagation method via computer software BeamPROP. The transmission spectra of the waveguide before and after ion implantation treatments were investigated also. Our experiment results reveal that the waveguide could propagate light with transverse magnetic polarized direction only and it is assumed that the polarization selectivity of CBN crystal may responsible for this phenomenon.

  13. Factors influencing the detection of abnormalities in barium enemas performed by junior radiologists

    Energy Technology Data Exchange (ETDEWEB)

    Vehmas, T. [Department of Occupational Medicine, Finnish Institute of Occupational Health, Helsinki and Department of Radiology, Helsinki University Central Hospital, Helsinki (Finland)]. E-mail: tapio.vehmas@ttl.fi

    2006-03-15

    Aim: To study the effects of patient variability, technical examination and radiologist-related factors on the radiological diagnosis of barium enema studies. Materials and Methods: Twenty-one residents (12 women and nine men, age 26-39 years) performed 523 double contrast barium enemas in a university hospital. Diagnoses were classified as normal (n=203), diverticulosis (n=224), polyps (n=25), tumours (n=20) and other (n=46); five were missing diagnoses. Binary and multinomial logistic regressions were used to study the relations between the independent variables and the radiological diagnoses. Results: Patients' advanced age (p<0.001) and obesity (p=0.041) were significant positive predictors for the detection of any abnormalities, as was good or moderate study quality (p=0.023). However, patients' obesity was negatively associated with the detection of polyps (p=0.037). Pathological findings were associated with higher dose-area products (p=0.047) than normal cases. Residents' advanced age (p=0.029) and experience (a high number of previously performed barium enemas; p=0.009) were negative predictors for the detection of pathological findings. Conclusion: Patients' obesity hampers polyp detection, possibly due to decreased image quality or coexisting diverticula. The most experienced and oldest residents missed positive findings, possibly due to insufficient consultation of supervising radiologists, emphasizing the need for their optimal cooperation.

  14. A Preliminary Trial on the Use of Barium Chloride for Pregnancy Diagnosis in Sows

    Directory of Open Access Journals (Sweden)

    Ndu, A.

    2000-01-01

    Full Text Available Urine was collected twice daily (once in the morning and once in the afternoon for 5 days from 80 Yorkshire x Landrace crossbred gilts/sows made up of 40 non-pregnant and 40 pregnant pigs in an investigation to determine the possibility of using 1 % barium chloride solution for pregnancy diagnosis in pigs based on a previous report that addition of a few drops of 1 % barium chloride solution to bovine urine caused a white precipitate with non-pregnant but not with pregnant cows. The pregnant pigs were in various stages of gestation. Urine reaction to 1 % barium chloride was highly (P <0.01 dependent on the pregnancy status of the sows, the test being 100 % and 81 % effective in identifying non-pregnant and pregnant sows respectively. The sensitivity of the test in the gravid sows was significantly (P <0.05 influenced by and tended to increa-se with the stage of gestation, with 59 % of the sows in their first stage of gestation (<38 days post-coitum being correctly diagnosed as pregnant, and 95-100 % of those in their latter stages of gestation being so correctly diagnosed. Parity and time of day of performance of the test had no effect on urine reaction. It was concluded that the test was at least 95 % accurate when used as from about 39 days after breeding for pregnancy diagnosis in sows.

  15. Effects of Dysprosium Oxide Doping on Microstructure and Properties of Barium Titanate Ceramic

    Institute of Scientific and Technical Information of China (English)

    Pu Yongping; Ren Huijun; Chen Wei; Chen Shoutian

    2005-01-01

    Different amounts of dysprosium oxide were incorporated into barium titanate powders synthesized by hydrothermal method. Relations of substitution behaviors and lattice parameters with solid-solubility were studied. Furthermore, the influences of dysprosium oxide doping fraction on grain size and dielectric properties of barium titanate ceramic, including dielectric constant and breakdown electric field strength, were investigated via scanning electron microscope, X-ray diffraction and electric property tester. The results show that dysprosium oxide can restrain abnormal grain growth during sintering and that fine-grained and high density of barium titanate ceramic can result in excellent dielectric properties. As mass fraction of dysprosium oxide is 0.6%, the lattice parameters of grain increase to the maximum because of the lowest vacancy concentration. The electric property parameters are cited as following: dielectric constant (25 ℃) reaches 4100, the change in relative dielectric constant with temperature is -10% to 10% within the range of -15~100 ℃, breakdown electric field strength (alternating current) achieves 3.2 kV·mm-1, which can be used in manufacturing high voltage ceramic capacitors.

  16. Hydrothermal Synthesis and Characterization of Europium-dop ed Barium Titanate Nano crys-tallites

    Institute of Scientific and Technical Information of China (English)

    Margarita Garca-Hernandez; Genevieve Chadeyron; Damien Boyer; Antonieta Garca-Murillo; Felipe Carrillo-Romo; Rachid Mahiou

    2013-01-01

    Barium titanate nanocrystallites were synthesized by a hydrothermal technique from barium chlo-ride and tetrabutyl titanate. Single-crystalline cubic perovskite BaTiO3 consisting of spherical particles with diameters ranging from 10 to 30 nm was easily achieved by this route. In order to study the influence of the syn-thesis process on the morphology and the optical properties, barium titanate was also prepared by a solid-state reaction. In this case, only the tetragonal phase which crystallizes above 900℃ was observed. High-temperature X-ray diffraction measurements were performed to investigate the crystallization temperatures as well as the particle sizes via the Scherrer formula. The lattice vibrations were evidenced by infrared spectroscopy. Eu3+was used as a structural probe, and the luminescence properties recorded from BaTiO3:Eu3+and elaborated by a solid-state reaction and hydrothermal process were compared. The reddish emission of the europium is increased by the nanometric particles.

  17. Barium Surface Abundances of Blue Stragglers in the Open Cluster NGC 6819

    CERN Document Server

    Milliman, Katelyn E; Schuler, Simon C

    2015-01-01

    We present the barium surface abundance of 12 blue stragglers (BSs) and 18 main-sequence (MS) stars in the intermediate-age open cluster NGC 6819 (2.5 Gyr) based on spectra obtained from the Hydra Multi-object Spectrograph on the WIYN 3.5 m telescope. For the MS stars we find [Fe/H] = $+$0.05 $\\pm$ 0.04 and [Ba/Fe] = $-$0.01 $\\pm$ 0.10. The majority of the BS stars are consistent with these values. We identify five BSs with significant barium enhancement. These stars most likely formed through mass transfer from an asymptotic giant branch star that polluted the surface of the BS with the nucleosynthesis products generated during thermal pulsations. This conclusion aligns with the results from the substantial work done on the BSs in old open cluster NGC 188 that identifies mass transfer as the dominant mechanism for BS formation in that open cluster. However, four of the BSs with enhanced barium show no radial-velocity evidence for a companion. The one star that is in a binary is a double-lined system, meaning...

  18. A barium central star binary in the Type-I diamond ring planetary nebula Abell 70

    CERN Document Server

    Miszalski, B; Frew, D J; Acker, A; Köppen, J; Moffat, A F J; Parker, Q A

    2011-01-01

    Abell 70 (PN G038.1-25.4, hereafter A 70) is a planetary nebula (PN) known for its diamond ring appearance due a superposition with a background galaxy. The previously unstudied central star is found to be a binary consisting of a G8IV-V secondary at optical wavelengths and a hot white dwarf (WD) at UV wavelengths. The secondary shows Ba II and Sr II features enhanced for its spectral type that, combined with the chromospheric Halpha emission and possible 20-30 km/s radial velocity amplitude, firmly classifies the binary as a Barium star. The proposed origin of Barium stars is intimately linked to PNe whereby wind accretion pollutes the companion with dredged-up material rich in carbon and s-process elements when the primary is experiencing thermal pulses on the Asymptotic Giant Branch (AGB). A 70 provides further evidence for this scenario together with the other very few examples of Barium central stars. The nebula is found to have Type-I chemical abundances with helium and nitrogen enrichment, which when c...

  19. Er3+-substituted W-type barium ferrite: preparation and electromagnetic properties

    Institute of Scientific and Technical Information of China (English)

    HUANG

    2010-01-01

    Er3+-substituted W-type barium ferrites Ba1-xErx(Zn0.3Co0.7)2Fe16O27(x=0.00,0.05,0.10,0.15,0.20)were synthesized by polymer adsorbent combustion method.Samples were characterized by X-ray diffraction analysis(XRD),X-ray fluorescence(XRF),scanning electron microscopy(SEM)and network analyzer to investigate the relationships among Er3+concentration,crystal structure,surface mcrphology and electromagnetic properties.All the XRD patterns showed pure phase of W-type barium ferrite when x≤0.15,while the impurity phase of ErFeO3 appeared when x=0.20.The pure W-type barium ferrite showed a hexagonal flake shape.In addition,the microwave electromagnetic properties of samples were analyzed in the frequency range of 2-18 GHz.It was indicated that the electromagnetic properties were significantly improved when Er3+doping content was 0.10.The reasons were also discussed using electromagnetic theory.The optimized ferrite exhibited excellent microwave absoption performance.The maximum of reflection loss(RL)reached about-27.4 dB and RL was below-10dB at the frequency range from 8.4 GHz to 18 GHz,when the thickness was 2.6 mm.

  20. A Study on Reactive Ion Etching of Barium Strontium Titanate Films Using Mixtures of Argon (Ar), Carbon Tetrafluoride (CF4), and Sulfur Hexafluoride (SF6)

    Science.gov (United States)

    2014-07-01

    A Study on Reactive Ion Etching of Barium Strontium Titanate Films Using Mixtures of Argon (Ar), Carbon Tetrafluoride (CF4), and Sulfur...Etching of Barium Strontium Titanate Films Using Mixtures of Argon (Ar), Carbon Tetrafluoride (CF4), and Sulfur Hexafluoride (SF6) Samuel G...Study on Reactive Ion Etching of Barium Strontium Titanate Films Using Mixtures of Argon (Ar), Carbon Tetrafluoride (CF4), and Sulfur Hexafluoride

  1. Comparison of Barium and Arsenic Concentrations in Well Drinking Water and in Human Body Samples and a Novel Remediation System for These Elements in Well Drinking Water.

    Directory of Open Access Journals (Sweden)

    Masashi Kato

    Full Text Available Health risk for well drinking water is a worldwide problem. Our recent studies showed increased toxicity by exposure to barium alone (≤700 µg/L and coexposure to barium (137 µg/L and arsenic (225 µg/L. The present edition of WHO health-based guidelines for drinking water revised in 2011 has maintained the values of arsenic (10 µg/L and barium (700 µg/L, but not elements such as manganese, iron and zinc. Nevertheless, there have been very few studies on barium in drinking water and human samples. This study showed significant correlations between levels of arsenic and barium, but not its homologous elements (magnesium, calcium and strontium, in urine, toenail and hair samples obtained from residents of Jessore, Bangladesh. Significant correlation between levels of arsenic and barium in well drinking water and levels in human urine, toenail and hair samples were also observed. Based on these results, a high-performance and low-cost adsorbent composed of a hydrotalcite-like compound for barium and arsenic was developed. The adsorbent reduced levels of barium and arsenic from well water in Bangladesh and Vietnam to <7 µg/L within 1 min. Thus, we have showed levels of arsenic and barium in humans and propose a novel remediation system.

  2. [Using barium fluoride fine particles as stationary phase for TLC/FTIR analysis].

    Science.gov (United States)

    Liu, Xi; Pan, Qing-hua; Ding, Jie; Zhu, Qing; He, An-qi; Yue, Shi-juan; Li, Xiao-pei; Hu, Li-ping; Xia, Jin-ming; Liu, Cui-ge; Wei, Yong-ju; Yu, Jiang; Yang, Zhan-lan; Zhu, Xi; Xu, Yi-zhuang; Wu, Jin-guang

    2011-07-01

    In situ TLC/FTIR technique has tremendous potential in the analysis of complex mixtures. However, the progress in this technique was quite slow. The reason is that conventional stationary phase such as silica gel etc. has strong absorption in FTIR spectrum and thus brings about severe interference in the detection of samples. To solve the problem, the authors propose to use barium fluoride fine particles as stationary phase of TLC plate. The reasons are as follows: Barium fluoride wafer has been extensively used as infrared window in FTIR experiments and it has no absorbance in an IR region between 4 000 and 800 cm'. As a matter of fact, the atomic mass of barium and fluoride is quite large, thus the normal vibration of BaF2 lattice is limited in far-IR region and low frequency part of mid-IR region. Therefore, the interference caused by IR absorption of stationary phase can be resolved if BaF2 is used as stationary phase of TLC plate. Moreover, BaF2 is quite stable and insolvable in water and most organic solvents and it will not be dissolved by mobile phase or react with samples in TLC separation. Additionally, decreasing the particle size of BaF2 is very important in TLC/FTIR analysis technique. The reason is two-fold: First, decreasing the particle size of stationary phase is helpful to improving the efficiency of separation by TLC plate; second, decreasing the size of BaFz particle can improve the quality of FTIR spectra by alleviating the problem of light scattering. By optimizing the synthetic conditions, fine particles of barium fluoride were obtained. SEM results indicate that the size of the BaF2 particles is around 500 nm. FTIR spectrum of the BaF2 particles shows that no absorption of impurity was observed. Moreover, the elevation of baseline caused by light scattering is insignificant. The authors have developed a new technique named "settlement volatilization method" to prepare TLC plate without polymeric adhesive that may bring about significant

  3. A 130 GeV Gamma Ray Signal from Supersymmetry

    CERN Document Server

    Shakya, Bibhushan

    2012-01-01

    The viability of neutralino dark matter as an explanation of the 130 GeV gamma ray signal from the Galactic Center recently observed by the Fermi Large Area Telescope is examined. It is found that the signal can be compatible with a sharp feature from internal bremsstrahlung from a mostly bino dark matter particle of mass around 145 GeV, augmented by a contribution from annihilation into gamma+Z via a small wino admixture. This scenario circumvents the problematic overproduction of lower energy continuum photons that plague line interpretations of this signal. Sleptons approximately degenerate in mass with the neutralino are required to enhance the internal bremsstrahlung feature.

  4. A New Limit on the Neutrinoless DBD of 130Te

    OpenAIRE

    Arnaboldi, C.; Artusa, D. R.; Avignone III, F. T.; Balata, M.; Bandac, I.; Barucci, M; Beeman, J. W.; Brofferio, C.; Bucci, C.; Capelli, S.(INFN-Sezione di Milano Bicocca, 20126, Milano, Italy); Carbone, L.; Cebrian, S; Cremonesi, O.; Creswick, R.J.; A. de Waard

    2005-01-01

    We report the present results of CUORICINO a cryogenic experiment on neutrinoless double beta decay (DBD) of 130Te consisting of an array of 62 crystals of TeO2 with a total active mass of 40.7 kg. The array is framed inside of a dilution refrigerator, heavily shielded against environmental radioactivity and high-energy neutrons, and operated at a temperature of ~8 mK in the Gran Sasso Underground Laboratory. Temperature pulses induced by particle interacting in the crystals are recorded and ...

  5. Shell-model calculations of nuclei around mass 130

    Science.gov (United States)

    Teruya, E.; Yoshinaga, N.; Higashiyama, K.; Odahara, A.

    2015-09-01

    Shell-model calculations are performed for even-even, odd-mass, and doubly-odd nuclei of Sn, Sb, Te, I, Xe, Cs, and Ba isotopes around mass 130 using the single-particle space made up of valence nucleons occupying the 0 g7 /2 ,1 d5 /2 ,2 s1 /2 ,0 h11 /2 , and 1 d3 /2 orbitals. The calculated energies and electromagnetic transitions are compared with the experimental data. In addition, several typical isomers in this region are investigated.

  6. 40 CFR 1033.130 - Instructions for engine remanufacturing or engine installation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Instructions for engine remanufacturing or engine installation. 1033.130 Section 1033.130 Protection of Environment ENVIRONMENTAL... and Related Requirements § 1033.130 Instructions for engine remanufacturing or engine installation....

  7. 13 CFR 130.300 - Small Business Development Centers (SBDCs). [Reserved

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Small Business Development Centers (SBDCs). 130.300 Section 130.300 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS § 130.300 Small Business Development Centers (SBDCs)....

  8. 40 CFR 426.130 - Applicability; description of the hand pressed and blown glass manufacturing subcategory.

    Science.gov (United States)

    2010-07-01

    ... pressed and blown glass manufacturing subcategory. 426.130 Section 426.130 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS GLASS MANUFACTURING POINT SOURCE CATEGORY Hand Pressed and Blown Glass Manufacturing Subcategory § 426.130 Applicability; description of...

  9. 38 CFR 4.130 - Schedule of ratings-mental disorders.

    Science.gov (United States)

    2010-07-01

    ... Alzheimer's type 9326Dementia due to other neurologic or general medical conditions (endocrine disorders...-mental disorders. 4.130 Section 4.130 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS SCHEDULE FOR RATING DISABILITIES Disability Ratings Mental Disorders § 4.130 Schedule of...

  10. 40 CFR 7.130 - Actions available to EPA to obtain compliance.

    Science.gov (United States)

    2010-07-01

    ... Agency Compliance Procedures § 7.130 Actions available to EPA to obtain compliance. (a) General. If... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Actions available to EPA to obtain compliance. 7.130 Section 7.130 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  11. 33 CFR 334.130 - Atlantic Ocean off Wallops Island and Chincoteague Inlet, Va.; danger zone.

    Science.gov (United States)

    2010-07-01

    ... and Chincoteague Inlet, Va.; danger zone. 334.130 Section 334.130 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.130 Atlantic Ocean off Wallops Island and Chincoteague Inlet, Va.; danger zone. (a) The...

  12. 46 CFR 7.130 - Point Conception, CA to Point Sur, CA.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Point Conception, CA to Point Sur, CA. 7.130 Section 7.130 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Pacific Coast § 7.130 Point Conception, CA to Point Sur, CA. (a) A line drawn from...

  13. File list: Oth.ALL.05.unc-130.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.05.unc-130.AllCell ce10 TFs and others unc-130 All cell types SRX043854,SRX...043852,SRX043853,SRX043851 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.05.unc-130.AllCell.bed ...

  14. File list: Oth.ALL.50.unc-130.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.unc-130.AllCell ce10 TFs and others unc-130 All cell types SRX043851,SRX...043853,SRX043854,SRX043852 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.50.unc-130.AllCell.bed ...

  15. File list: Oth.Lar.50.unc-130.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Lar.50.unc-130.AllCell ce10 TFs and others unc-130 Larvae SRX043851,SRX043853,S...RX043854,SRX043852 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.Lar.50.unc-130.AllCell.bed ...

  16. File list: Oth.Lar.20.unc-130.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Lar.20.unc-130.AllCell ce10 TFs and others unc-130 Larvae SRX043851,SRX043853,S...RX043854,SRX043852 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.Lar.20.unc-130.AllCell.bed ...

  17. File list: Oth.ALL.20.unc-130.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.unc-130.AllCell ce10 TFs and others unc-130 All cell types SRX043851,SRX...043853,SRX043854,SRX043852 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.20.unc-130.AllCell.bed ...

  18. File list: Oth.Lar.10.unc-130.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Lar.10.unc-130.AllCell ce10 TFs and others unc-130 Larvae SRX043854,SRX043852,S...RX043853,SRX043851 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.Lar.10.unc-130.AllCell.bed ...

  19. File list: Oth.Lar.05.unc-130.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Lar.05.unc-130.AllCell ce10 TFs and others unc-130 Larvae SRX043854,SRX043852,S...RX043853,SRX043851 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.Lar.05.unc-130.AllCell.bed ...

  20. A New Limit on the Neutrinoless DBD of 130Te

    CERN Document Server

    Arnaboldi, C; Balata, M; Bandac, I; Barucci, M; Beeman, J W; Brofferio, C; Bucci, C; Capelli, S; Carbone, L; Cebrián, S; Cremonesi, O; Creswick, R J; De Waard, A; Farach, H A; Fiorini, Ettore; Frossati, G; Guardincerri, E; Giuliani, A; Gorla, P; Haller, E E; McDonald, J; Norman, E B; Nucciotti, A; Olivieri, E; Pallavicini, M; Palmieri, E; Pasca, E; Pavan, M M; Pedretti, M; Pessina, G; Pirro, S; Previtali, E; Risegari, L; Rosenfeld, C; San Giorgio, S; Sisti, M; Smith, A R; Torres, L; Ventura, G

    2005-01-01

    We report the present results of CUORICINO a cryogenic experiment on neutrinoless double beta decay (DBD) of 130Te consisting of an array of 62 crystals of TeO2 with a total active mass of 40.7 kg. The array is framed inside of a dilution refrigerator, heavily shielded against environmental radioactivity and high-energy neutrons, and operated at a temperature of ~8 mK in the Gran Sasso Underground Laboratory. Temperature pulses induced by particle interacting in the crystals are recorded and measured by means of Neutron Transmutation Doped thermistors. The gain of each bolometer is stabilized with voltage pulses developed by a high stability pulse generator across heater resistors put in thermal contact with the absorber. The calibration is performed by means of two thoriated wires routinely inserted in the set-up. No evidence for a peak indicating neutrinoless DBD of 130Te is detected and a 90% C.L. lower limit of 1.8E24 years is set for the lifetime of this process. Taking largely into account the uncertain...

  1. Small-scale fluctuations in barium drifts at high latitudes and associated Joule heating effects

    Science.gov (United States)

    Hurd, L. D.; Larsen, M. F.

    2016-01-01

    Most previous estimates of Joule heating rates, especially the contribution of small-scale structure in the high-latitude ionosphere, have been based on incoherent scatter or coherent scatter radar measurements. An alternative estimate can be found from the plasma drifts obtained from ionized barium clouds released from sounding rockets. We have used barium drift data from three experiments to estimate Joule heating rates in the high-latitude E region for different magnetic activity levels. In particular, we are interested in the contribution of small-scale plasma drift fluctuations, corresponding to equivalent electric field fluctuations, to the local Joule heating rate on scales smaller than those typically resolved by radar or other measurements. Since Joule heating is a Lagrangian quantity, the inherently Lagrangian estimates provided by the chemical tracer measurements are a full description of the effects of electric field variance and neutral winds on the heating, differing from the Eulerian estimates of the type provided by ground-based measurements. Results suggest that the small-scale contributions to the heating can be more than a factor of 2 greater than the mean field contribution regardless of geomagnetic conditions, and at times the small-scale contribution is even larger. The high-resolution barium drift measurements, moreover, show that the fine structure in the electric field can be more variable than previous studies have reported for similar conditions. The neutral winds also affect the heating, altering the height-integrated Joule heating rates by as much as 12%, for the cases studied here, and modifying the height distribution of the heating profile as well.

  2. Intermediate milling energy optimization to enhance the characteristics of barium hexaferrite magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Hodaei, A.; Ataie, A., E-mail: aataie@ut.ac.ir; Mostafavi, E.

    2015-08-15

    Highlights: • Nano-sized BaFe{sub 12}O{sub 19} was successfully synthesized via a solid-state reaction. • Intermediate milling energy was optimized to improve BaFe{sub 12}O{sub 19} properties. • Minimum total energy of 93.7 kJ/g was necessary for formation of BaFe{sub 12}O{sub 19}. • Deviation from the optimum milling energy deteriorates the magnetic properties. - Abstract: Nano-sized barium hexaferrite particles were synthesized by mechanical activation of BaCO{sub 3} and Fe{sub 2}O{sub 3} powders mixture as starting materials. The effects of mechanical milling energy on the phase composition, morphology, thermal behavior and magnetic properties of the samples were systematically investigated by employing X-ray diffractometer, field emission scanning electron microscopy, differential thermal/thermo gravimetry analysis and vibrating sample magnetometer, respectively. The milling energy was calculated at five different levels using collision model. It was found that there is an optimum milling energy value for obtaining barium hexaferrite phase. The results revealed that applying a minimum total milling energy of 93.7 kJ/g was necessary for formation of almost single barium hexaferrite at a relatively low calcination temperature of 800 °C. FESEM micrograph of the above sample exhibited nano-size particles with a mean particle size of 80 nm. Further increase in milling energy leads to dramatic decrease in phase purity as well as magnetic characteristics of the samples. By increasing the milling energy from 93.7 to 671.9 kJ/g, saturation magnetization (M{sub s}) decreased from 22.5 to 0.39 emu/g, and also coercivity (H{sub c}) decreased from 4.28 to 1.46 kOe.

  3. Microstructure and magnetic properties of Al-doped barium ferrite with sodium citrate as chelate agent

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Daming, E-mail: chendaming1986@gmail.com [State Key Laboratory of Electronic Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Liu, Yingli, E-mail: lyl@uestc.edu.cn [State Key Laboratory of Electronic Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Li, Yuanxun; Yang, Kai; Zhang, Huaiwu [State Key Laboratory of Electronic Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China)

    2013-07-15

    In this paper, M-type Al-doped barium ferrites were successfully synthesized using sodium citrate (SC) as the chelate agent by a chemical process complemented by a suitable thermal treatment of the precursor. It was found in TGA/DTA and XRD analysis that the crystallization and formation of single phase BaM had completed before 860 °C. The XRD data also confirmed Al substituting into Fe sites. Meanwhile, it can be seen from the SEM images that the particle size and morphology were not affected by Al doping. However, Al substitution played an important role on the magnetic properties. The saturation magnetization (M{sub s}) of BaAl{sub x}Fe{sub 12−x}O{sub 19} decreased from 51.43 emu/g for the sample with x=0 to 28.32 emu/g at x=1.5. The anisotropy field (H{sub a}), however, increased from 16.21 kOe to 25.01 kOe. In addition, M{sub s} increased with enhancing the ratio of SC/Ba{sup 2+}(molar ratio), reaching a maximum when SC/Ba{sup 2+} was 13. - Highlights: ► Doped barium ferrite was successfully synthesized using sodium citrate as chelate agent. ► Sodium citrate allows the mixing of metal cations in the as-synthesized barium ferrite. ► The radio of Sodium citrate/Ba{sup 2+} pay an important effect on magnetic properties.

  4. Curie temperature and magnetic properties of aluminum doped barium ferrite particles prepared by ball mill method

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Daming [Center for Magnetism and Magnetic Nanostructures, University of Colorado at Colorado Springs, 1420 Austin Bluffs Pkwy, Colorado Springs, Colorado 80918 (United States); College of Materials and Chemical Engineering, Hainan University, Haikou 570228, Hainan (China); Harward, Ian; Baptist, Joshua; Goldman, Sara; Celinski, Zbigniew [Center for Magnetism and Magnetic Nanostructures, University of Colorado at Colorado Springs, 1420 Austin Bluffs Pkwy, Colorado Springs, Colorado 80918 (United States)

    2015-12-01

    Barium ferrite has attracted considerable interest in the fields of permanent magnets and perpendicular magnetic recording due to its strong uniaxial anisotropy and high Curie temperature (T{sub c}). We prepared aluminum doped barium ferrite ceramics (BaAl{sub x}Fe{sub 12−x}O{sub 19}, 0≤x≤6) by the ball mill method. The powder was milled for 96 h, and after forming pellets, annealed for 48 h in air at 1000 °C. The X-ray diffraction (XRD) data show that there are only single hexagonal phases in the samples without any impurity phase. The crystal lattice constants, a and c, were calculated by Cohen's method. Both a and c decrease with increasing x, ranging from 0.588 nm and 2.318 nm to 0.573 nm and 2.294 nm, respectively. A Vibrating Sample Magnetometer (VSM) and Superconducting Quantum Interference Device (SQUID) were used to investigate T{sub c} and magnetic properties of BaFe{sub 12−x}Al{sub x}O{sub 19}. It is found that T{sub c} decreases with increasing x, from 425 °C to 298 °C. It is also found that the saturated magnetization (4πM{sub s}) decreases with increasing x, while the coercivity (H{sub c}) increases with the increase in x. The anisotropy field was also determined from the SQUID measurement. - Highlights: • The Curie temperature and magnetic properties of aluminum doped barium ferrite particles were studied systemically. • The relation between 4πM{sub s} and composition x at 50 K (both experimental value and theoretical calculation) was revealed. • Occupation number for spin up and spin down as a function of temperature was shown. • The relation between 4πM{sub s} and composition x from 50 K to room temperature was revealed.

  5. Barium meal follow through with pneumocolon: Screening test for chronic bowel pain

    Institute of Scientific and Technical Information of China (English)

    Sandeep Nijhawan; Saket Kumpawat; P Mallikarjun; RP Bansal; Dinesh Singla; Prachis Ashdhir; Amit Mathur; Ramesh Roop Rai

    2008-01-01

    AIM:To study the sensitivity,specificity and cost effectiveness of barium meal follow through with pneumocolon (BMFTP) used as a screening modality for patients with chronic abdominal pain of luminal origin in developing countries.METHODS:Fifty patients attending the Gastroenterology Unit,SMS Hospital,whose clinical evaluation revealed chronic abdominal pain of bowel origin were included in the study.After routine testing,BMFT,BMFTP,contrast enhanced computed tomography (CECT) of the abdomen,barium enema and colonoscopy were performed.The sensitivity,specificity and cost effectiveness of these imaging modalities in the detection of small and/or large bowel lesions were compared.RESULTS:Out of fifty patients,structural pathology was found in ten.Nine out of these ten patients had small bowel involvement while seven had colonic involvement alone or in combination with small bowel involvement.The sensitivity of BMFTP was 100% compared to 88.89% with BMFT when detecting small bowel involvement (BMFTP detected one additional patient with ileocecal involvement).The sensitivity and specificity of BMFTP for the detection of colonic pathology were 85.71% and 95.35%(41/43),respectively.Screening a patient with chronic abdominal pain (bowel origin) using a combination of BMFT and barium enema cost significantly more than BMFTP while their sensitivity was almost comparable.CONCLUSION:BMFTP should be included in the investigative workup of patients with chronic abdominal pain of luminal origin,where either multiple sites (small and large intestine) of involvement are suspected or the site is unclear on clinical grounds.BMFTP is an economical,quick and comfortable procedure which obviates the need for colonoscopy in the majority of patients.

  6. Discovery and Understanding of the Ambient-Condition Degradation of Doped Barium Cerate Proton-Conducting Perovskite Oxide in Solid Oxide Fuel Cells

    NARCIS (Netherlands)

    Yan, N.; Zeng, Y.; Shalchi, B; Wang, W.; Gao, T; Rothenberg, G.; Luo, J.L.

    2015-01-01

    Proton-conducting perovskite oxides such as doped barium cerate and barium zirconate are promising electrolytes for solid oxide fuel cells (SOFCs). Here we report that the typical high performance proton conductor, BaZr0.1Ce0.7Y0.2O3±δ (BZCY), is prone to physical, chemical and thereby electrochemic

  7. Microstructural and Electrical Characterization of Barium Strontium Titanate-Based Solid Solution Thin Films Deposited on Ceramic Substrates by Pulsed Laser Deposition

    Science.gov (United States)

    2003-04-03

    Strontium Titanate-Based Solid Solution Thin Films Deposited on Ceramic Substrates by Pulsed Laser Deposition DISTRIBUTION: Approved for public...Society H2.4 Microstructural and Electrical Characterization of Barium Strontium Titanate- based Solid Solution Thin Films Deposited on Ceramic...investigated and report the microstructural and electrical characterization of selected barium strontium titanate-based solid solution thin films

  8. Review - Fabrication of crystal-oriented barium-bismuth titanate ceramics in high magnetic field and subsequent reaction sintering

    Directory of Open Access Journals (Sweden)

    Satoshi Tanaka, Yusuke Tomita, Ryoichi Furushima, Hiroyuki Shimizu, Yutaka Doshida and Keizo Uematsu

    2009-01-01

    Full Text Available High magnetic field was applied to fabricate novel lead-free piezoelectric ceramics with a textured structure. A compact of crystallographically oriented grains was prepared by dry forming in a high magnetic field from a mixed slurry of bismuth titanate and barium titanate powders. Bismuth titanate particles with a size of about 1 μ m were used as the host material. In the forming process, the slurry was poured into a mold and set in a magnetic field of 10 T until completely dried. Bismuth titanate particles were highly oriented in the slurry under the magnetic field. The dried powder compact consisted of highly oriented bismuth titanate particles and randomly oriented barium titanate particles. Barium bismuth titanate ceramics with a- and b-axis orientations were successfully produced from the dried compact by sintering at temperatures above 1100 ° C.

  9. Synthesis and characterization of highly-ordered barium-strontium titanate nanotube arrays fabricated by sol-gel method

    Institute of Scientific and Technical Information of China (English)

    Chen Yu; Chen Wei; Guo Feng; Li Mei-Ya; Liu Wei; Zhao Xing-Zhong

    2009-01-01

    Highly uniformed barium-strontium titanate nanotube arrays were fabricated using a porous anodic aluminum oxide template from a barium-strontium titanate sol-gel solution. Electron microscope results showed that nanotubes with uniform length and diameter were obtained. The diameters and lengths of these nanotubes were dependent on the pore diameter and the thickness of the applied anodic aluminum oxide template. High resolution transmission electron microscopy and the selected-area electron diffraction pattern investigations demonstrated the perovskite structure and the polycrystaltine of the fabricated barium-strontium titanate nanotubes. The characterization of the electrical and dielectric properties had also been made. Compared to thin film material,the intrinsic leakage current density is almost the same. Besides,at 30 ℃,the dielectric constant and dielectric loss of the fabricated nanotube is 80 and 0.027 at 1 MHz respectively.

  10. Early manifestation of Yersinia colitis demonstrated by the double-contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Aspestrand, F.

    1986-11-01

    A 19-year old female with a bloody, diarrheal illness of acute onset where Crohn's disease primarly was suspected is presented. The double-contrast barium enema revealed multiple, diffusely scattered aphthous erosions of the colonic mucosa: the rectum was scarcely affected. Biopsies taken by endoscopy demonstrated nonspecific inflammatory changes of the mucous membrane. However, routinely taken stool cultures revealed an infectious colitis due to Yersinia enterocolitica. Our case demonstrates the necessity to consider Yersinia enterocolitis in the radiographic differential diagnosis when the diagnosis of Crohn's disease or ulcerative colitis seems obvious.

  11. Comparison of barium titanate thin films prepared by inkjet printing and spin coating

    Directory of Open Access Journals (Sweden)

    Jelena Vukmirović

    2015-09-01

    Full Text Available In this paper, barium titanate films were prepared by different deposition techniques (spin coating, office Epson inkjet printer and commercial Dimatix inkjet printer. As inkjet technique requires special rheological properties of inks the first part of the study deals with the preparation of inks, whereas the second part examines and compares structural characteristics of the deposited films. Inks were synthesized by sol-gel method and parameters such as viscosity, particle size and surface tension were measured. Deposited films were examined by optical and scanning electron microscopy, XRD analysis and Raman spectroscopy. The findings consider advantages and disadvantages of the particular deposition techniques.

  12. LOCULATED PYOTHORAX, PLEURAL THICKENING DUE TO ACQU IRED BOCHDALEK HERNIA AND BARIUM INGESTION- A RARE CASE

    Directory of Open Access Journals (Sweden)

    Vijayalaxmi

    2013-05-01

    Full Text Available ABSTRACT: Here, we report a fifty six year old male patient wit h intrathoracic incarceration and perforation of the stomach on the left side of t he diaphragmatic defect resulting as empyema and a late sequelae of barium induced pleural thickening where decortication was performed. It is not usual, without a history of tra uma patient developing acquired Bochdalek hernia with empyema as seen in our case. Anaesthetic management was successful in the repair of acquired Bochdalek hernia during the first surge ry and decortication of the lung during the second surgery in our patient

  13. A plasmonic modulator based on metal-insulator-metal waveguide with barium titanate core

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Lavrinenko, Andrei

    2013-01-01

    domains from the in-plane to out-of-plane orientation provides the change of the refractive index, which can be exploited for effective light modulation. By numerical analysis we prove that the π phase change can be achieved with a 12…15μm length device having propagation losses 0.05…0.2dB/μm.......We design a plasmonic modulator which can be utilized as a compact active device in photonic integrated circuits. The active material, barium titanate (BaTiO3), is sandwiched between metal plates and changes its refractive index under applied voltage. Some degree of switching of ferroelectric...

  14. Direct writing of ferroelectric domains on strontium barium niobate crystals using focused ultraviolet laser light

    Energy Technology Data Exchange (ETDEWEB)

    Boes, Andreas; Crasto, Tristan; Steigerwald, Hendrik; Mitchell, Arnan [School of Electrical and Computer Engineering and ARC Center for Ultra-High Bandwidth Devices for Optical Systems (CUDOS), RMIT University, Melbourne, Victoria 3001 (Australia); Wade, Scott [Faculty of Engineering and Industrial Sciences, Swinburne University of Technology, Hawthorn, Victoria 3122 (Australia); Frohnhaus, Jakob; Soergel, Elisabeth [Institute of Physics, University of Bonn, Wegelerstr. 8, 53115 Bonn (Germany)

    2013-09-30

    We report ferroelectric domain inversion in strontium barium niobate (SBN) single crystals by irradiating the surface locally with a strongly focused ultraviolet (UV) laser beam. The generated domains are investigated using piezoresponse force microscopy. We propose a simple model that allows predicting the domain width as a function of the irradiation intensity, which indeed applies for both SBN and LiNbO{sub 3}. Evidently, though fundamentally different, the domain structure of both SBN and LiNbO{sub 3} can be engineered through similar UV irradiation.

  15. Chondrite barium, neodymium, and samarium isotopic heterogeneity and early Earth differentiation.

    Science.gov (United States)

    Carlson, Richard W; Boyet, Maud; Horan, Mary

    2007-05-25

    Isotopic variability in barium, neodymium, and samarium in carbonaceous chondrites reflects the distinct stellar nucleosynthetic contributions to the early solar system. We used 148Nd/144Nd to correct for the observed s-process deficiency, which produced a chondrite 146Sm-142Nd isochron consistent with previous estimates of the initial solar system abundance of 146Sm and a 142Nd/144Nd at average chondrite Sm/Nd ratio that is lower than that measured in terrestrial rocks by 21 +/- 3 parts per million. This result strengthens the conclusion that the deficiency in 142Nd in chondrites relative to terrestrial rocks reflects 146Sm decayand earlyplanetary differentiation processes.

  16. Seasonal variability in the input of lead, barium and indium to Law Dome, Antarctica

    DEFF Research Database (Denmark)

    Burn-Nunes...[], L.J.; Vallelonga, Paul Travis; Loss, R.D.

    2011-01-01

    Lead (Pb) isotopic compositions and concentrations, and barium (Ba) and indium (In) concentrations have been determined at monthly resolution in five Law Dome (coastal Eastern Antarctica) ice core sections dated from similar to 1757 AD to similar to 1898 AD. 'Natural' background Pb concentrations...... more impurity laden air from the Southern Hemisphere continental regions to Eastern Antarctica and Law Dome. As this Pb is isotopically identical to that emitted from south-eastern Australia (Broken Hill, Port Pine) this implies a relatively direct air trajectory pathway from southern Australia to Law...... Dome (Eastern Antarctica). (C) 2010 Elsevier Ltd. All rights reserved...

  17. Lead-barium fluoroborate glass ceramics doped with Nd3+ or Er3+

    Science.gov (United States)

    Petrova, O. B.; Sevostjanova, T. S.; Anurova, M. O.; Khomyakov, A. V.

    2016-02-01

    Lead-barium fluoroborate glasses in the PbF2-BaF2-B2O3, PbF2-BaO-B2O3, and PbO- BaF2-B2O3 systems doped with rare-earth ions (Nd3+ or Er3+) are synthesized and studied. It is shown that, based on these glasses, it is possible to produce transparent glass ceramics with fluoride crystalline phases, including ceramics with one crystalline phase of the fluorite structure. The spectral and luminescent properties of the doped glasses, glass ceramics, and polycrystalline complex fluorides containing Pb, Ba, and rare ions are studied.

  18. Femtosecond index grating in barium flouride: efficient self-diffraction and enhancement of surface SHG

    Science.gov (United States)

    Schneider, Th; Wolfframm, D.; Mitzner, R.; Reif, J.

    2000-02-01

    A transient refractive index grating is formed in barium fluoride crystals under irradiation with femtosecond laser pulses from two non-collinear beams. At low intensities energy coupling takes place. At high intensities, a typical self-diffraction pattern is obtained with a diffraction efficiency better than 10%. Simultaneously, an enhancement of the SHG signal from the surface, as well as the generation and diffraction of the third harmonic is observable. For all effects the nonlinear Kerr-effect is responsible, with the response time being limited only by the temporal pulse shape.

  19. EDTA-type Polymer Based on Diazacrown Ether as the Solubilizer of Barium Sulfate to Water

    Institute of Scientific and Technical Information of China (English)

    Bo ZHOU; Jian Zhang LI; Chun Hong HE; Sheng Ying QIN

    2005-01-01

    The EDTA dianhydride reacted with diazacrown ethers to obtain the water-soluble EDTA-diazacrown ether polymers 1~3. The effects of crown ether ring in the polymer chains including its cavity size on the solubilization of barium sulfate to water were investigated by comparison with the crown ring-free analogue 4. The result shows that the polymer 2 is the efficient solubilizer of BaSO4 and the highest solubilization efficiency of the BaSO4 to water is up to 72.5%.

  20. Synthesis of Barium Lithium Fluoride Nanocrystals Using Reverse Micelles as Microemulsion

    Institute of Scientific and Technical Information of China (English)

    Rui Nian HUA; De Min XIE; Chun Shan SHI

    2004-01-01

    Barium lithium fluoride nanocrystals were synthesized in cetyltrimethylammonium bromide (CTAB)/ 2-octanol/ water microemulsion systems. The impurity peaks in XRD patterns were not determined. The result of SEM confirmed that the average sizes and shape of the BaLiF3 nanocrystals. The formation of BaLiF3 and particles size were strongly affected by water content. With increasing water content and reaction times, the size of the particle increases. Meanwhile, the solvent was also found to play a key role in the synthesis of the BaLiF3 nanocrystals.

  1. The ac Stark shifts of the terahertz clock transitions of barium

    Institute of Scientific and Technical Information of China (English)

    余庚华; 耿鹰鸽; 李隆; 周超; 段丞博; 柴瑞鹏; 杨永明

    2015-01-01

    Wavelength-dependent AC Stark shifts and magic wavelengths of the terahertz clock transitions between the metastable triplet states 6s5d 3D1 and 6s5d 3D2 are investigated with considering the optical lattice trapping of barium atoms with the linearly polarized laser. The trap depths and the slopes of light shift difference with distinct magic wave-lengths of the optical lattices are also discussed in detail. Several potentially suitable working points for the optical lattice trapping laser are recommended and selected from these magic wavelengths.

  2. Motional Stark Effect and Its Active Cancellation in Diamagnetic Spectrum of Barium

    Institute of Scientific and Technical Information of China (English)

    QUAN Wei; LIU Hong-Ping; SHEN Li; ZHAN Ming-Sheng

    2007-01-01

    With time-of-flight and electric field ionization detection technique, we investigate the motional Stark effect for highly excited Rydberg barium in high magnetic field and its active cancellation experimentally. In the experiment, the atom beam is aligned at a small angle of 15° with respect to the magnetic field. The motional Stark effect cancellation is demonstrated on two sets of circularly polarized spectra in static magnetic field B = 1.00000 Tesla and B = 1.70000 Tesla, respectively, although the effect is very small (~ 3.5 Vcm-1) in our apparatus configuration.

  3. Barium halide nanocrystals in fluorozirconate based glass ceramics for scintillation application

    Energy Technology Data Exchange (ETDEWEB)

    Selling, J.

    2007-07-01

    Europium (Eu)-activated barium halide nanocrystals in fluorozirconate based glass ceramics represent a promising class of Xray scintillators. The scintillation in these glass ceramics is mainly caused by the emission of divalent Eu incorporated in hexagonal BaCl{sub 2} nanocrystals which are formed in the glass matrix upon appropriate annealing. Experiments with cerium (Ce)-activated fluorozironate glass ceramics showed that Ce is an interesting alternative. In order to get a better understanding of the scintillation mechanism in Eu- or Ce-activated barium halide nanocrystals, an investigation of the processes in the corresponding bulk material is essential. The objective of this thesis is the investigation of undoped, Eu-, and Ce-doped barium halides by X-ray excited luminescence (XL), pulse height, and scintillation decay spectra. That will help to figure out which of these crystals has the most promising scintillation properties and would be the best nanoparticles for the glass ceramics. Furthermore, alternative dopants like samarium (Sm) and manganese (Mn) were also investigated. Besides the above-mentioned optical investigation electron paramagnetic resonance (EPR) and Moessbauer measurements were carried out in order to complete the picture of Eu-doped barium halides. The EPR data of Eu-doped BaI{sub 2} is anticipated to yield more information about the crystal field and crystal structure that will help to understand the charge carrier process during the scintillation process. The main focus of the Moessbauer investigations was set on the Eu-doped fluorochlorozirconate glass ceramics. The results of this investigation should help to improve the glass ceramics. The Eu{sup 2+}/Eu{sup 3+} ratio in the glass ceramics should be determined and optimize favor of the Eu{sup 2+}. We also want to distinguish between Eu{sup 2+} in the glass matrix and Eu{sup 2+} in the nanocrystals. For a better understanding of Moessbauer spectroscopy on Eu also measurements on Eu in a

  4. Investigation of thermal evolution of nanodomain structures in nonlinear barium sodium niobate crystals

    Institute of Scientific and Technical Information of China (English)

    S.V.Ivanova

    2008-01-01

    By the 90°elastic light scattering investigation and far field observation in the range of 20-800℃,the relation between behavior of light scattering anomalies and evolution of nanodomain structures in lattice of barium sodium niobate(Ba2NaNb5O15,BSN)crystal was clarified.The correlation between anomalies on the temperature curves of the elastic light scattering intensity and temperature transformations of nanodomains was studied by X-ray and electron microscope methods.Phase transition near 500℃ and movement in field of scattering light could be explained by appearance of a new incommensurate phase.

  5. Improvement of the thermal properties of a polystyrene via inclusion of barium hexaferrite particles

    Science.gov (United States)

    Hemeda, O. M.; El-Sayed, Adly H.; Tawfik, A.; Hamad, Mahmoud A.

    2016-07-01

    M-type barium hexaferrite (BaM) particles-polystyrene (PS) composite has been successfully synthesized. Fourier transform infrared spectra confirm the synthesis of the BaM-PS composite. Scanning electron microscopy shows that BaM particles are attached rather well to the PS matrix and have variable sizes and shapes. Differential and thermogravimetric analysis indicate that PS chains are well coupled within the BaM powder and the thermal stability of PS is enhanced by incorporating BaM in the PS matrix.

  6. Cascaded Brillouin lasing in monolithic barium fluoride whispering gallery mode resonators

    CERN Document Server

    Lin, Guoping; Saleh, Khaldoun; Martinenghi, Romain; Beugnot, Jean-Charles; Sylvestre, Thibaut; Chembo, Yanne K

    2015-01-01

    We report the observation of stimulated Brillouin scattering and lasing at 1550~nm in barium fluoride (BaF$_2$) crystal. Brillouin lasing was achieved with ultra-high quality ($Q$) factor monolithic whispering gallery mode (WGM) mm-size disk resonators. Overmoded resonators were specifically used to provide cavity resonances for both the pump and all Brillouin Stokes waves. Single and multiple Brillouin Stokes radiations with frequency shift ranging from $8.2$ GHz up to $49$ GHz have been generated through cascaded Brillouin lasing. BaF$_2$ resonator-based Brillouin lasing can find potential applications for high-coherence lasers and microwave photonics.

  7. Fabrication of flexible magnetic papers based on bacterial cellulose and barium hexaferrite with improved mechanical properties

    Science.gov (United States)

    Lim, Guh-Hwan; Lee, Jooyoung; Kwon, Nayoung; Bok, Shingyu; Sim, Hwansu; Moon, Kyoung-Seok; Lee, Sang-Eui; Lim, Byungkwon

    2016-09-01

    We report on a simple approach to fabricate mechanically robust magnetic cellulose papers containing M-type barium hexaferrite (BaFe12O19) nanoplates. BaFe12O19 nanoplates were synthesized by a hydrothermal method and then chemically functionalized by using a silane coupling agent. The magnetic cellulose papers prepared with the silane-treated BaFe12O19 nanoplates exhibited improved mechanical properties with tensile strength of 58.5 MPa and Young's modulus of 2.95 GPa.

  8. Low temperature preparation of nanocrystalline solid solution of strontium barium niobate by chemical process

    Indian Academy of Sciences (India)

    Asit B Panda; Amita Pathak; Panchanan Pramanik

    2002-11-01

    SrBa1–Nb2O6 (with = 0.4, 0.5 and 0.6) powders have been prepared by thermolysis of aqueous precursor solutions consisting of triethanolamine (TEA), niobium tartarate and, EDTA complexes of strontium and barium ions. Complete evaporation of the precursor solution by heating at ∼ 200°C, yields in a fluffy, mesoporous carbon rich precursor material, which on calcination at 750°C/2 h has resulted in the pure SBN powders. The crystallite and average particle sizes are found to be around 15 nm and 20 nm, respectively.

  9. Three-wave mixing mediated femtosecond pulse compression in β-barium borate.

    Science.gov (United States)

    Grün, A; Austin, Dane R; Cousin, Seth L; Biegert, J

    2015-10-15

    Nonlinear pulse compression mediated by three-wave mixing is demonstrated for ultrashort Ti:sapphire pulses in a type II phase-matched β-barium borate (BBO) crystal using noncollinear geometry. 170 μJ pulses at 800 nm with a pulse duration of 74 fs are compressed at their sum frequency to 32 fs with 55 μJ of pulse energy. Experiments and computer simulations demonstrate the potential of sum-frequency pulse compression to match the group velocities of the interacting waves to crystals that were initially not considered in the context of nonlinear pulse compression.

  10. Structural, topographical and electrical properties of cerium doped strontium barium niobate (Ce:SBN60) ceramics

    Science.gov (United States)

    Raj, S. Gokul; Mathivanan, V.; Kumar, G. Ramesh; Yathavan, S.; Mohan, R.

    2016-05-01

    Tungsten bronze type cerium doped strontium barium niobate (Ce:SBN - Sr0.6B0.4Nb2O6) ceramics were synthesized by solid state process. Cerium was used as dopant to improve its electrical properties. Influence of Ce+ ions on the photoluminescence properties was investigated in detail. The grain size topographical behavior of SBN powders and their associated abnormal grain growth (AGG) were completely analyzed through SEM studies. Finally dielectric, measurement discusses about the broad phase transition observed due to cerium dopant The results were discussed in detail.

  11. New neutron-deficient isotopes of barium and rare-earth elements

    CERN Document Server

    Bogdanov, D D; Karnaukhov, V A; Petrov, L A; Plochocki, A; Subbotin, V G; Voboril, J

    1976-01-01

    The authors present an investigation of the short-lived neutron- deficient isotopes of barium and rare-earth elements. By using the BEMS-2 isotope separator on a heavy ion beam, 19 new isotopes were produced with mass numbers ranging from 117 to 138. Five of these (/sup 117/Ba, /sup 129,131/Nd and /sup 133,135/Sm) turned out to be delayed proton emitters. The beta -decay probabilities for the new isotopes have been analyzed in terms of the beta -strength function. An analysis of the proton spectrum shape has been performed using the statistical model for delayed proton emission.

  12. Wide modulation bandwidth terahertz detection in 130 nm CMOS technology

    Science.gov (United States)

    Nahar, Shamsun; Shafee, Marwah; Blin, Stéphane; Pénarier, Annick; Nouvel, Philippe; Coquillat, Dominique; Safwa, Amr M. E.; Knap, Wojciech; Hella, Mona M.

    2016-11-01

    Design, manufacturing and measurements results for silicon plasma wave transistors based wireless communication wideband receivers operating at 300 GHz carrier frequency are presented. We show the possibility of Si-CMOS based integrated circuits, in which by: (i) specific physics based plasma wave transistor design allowing impedance matching to the antenna and the amplifier, (ii) engineering the shape of the patch antenna through a stacked resonator approach and (iii) applying bandwidth enhancement strategies to the design of integrated broadband amplifier, we achieve an integrated circuit of the 300 GHz carrier frequency receiver for wireless wideband operation up to/over 10 GHz. This is, to the best of our knowledge, the first demonstration of low cost 130 nm Si-CMOS technology, plasma wave transistors based fast/wideband integrated receiver operating at 300 GHz atmospheric window. These results pave the way towards future large scale (cost effective) silicon technology based terahertz wireless communication receivers.

  13. Acupuncture Therapy for 130 Cases of Simple Obesity

    Institute of Scientific and Technical Information of China (English)

    单琴

    2006-01-01

    One hundred and thirty cases of simple obesity were treated by acupuncture plus auricular point sticking, after a course of treatments, 49 cases got marked effect, 73 cases got effect and 8 cases got no effect, the total effective rate was 93.8%, especially the patients with severe obesity got the best effect.%130例单纯性肥胖症患者经针刺和耳穴贴压治疗,经1个疗程治疗后,显效49例,有效73例,无效8例,总有效率为93.8%.尤其以重度肥胖症的减肥效果最佳.

  14. Structure of ∼130 nuclei in La–Ce region

    Indian Academy of Sciences (India)

    Tumpa Bhattacharjee

    2010-07-01

    The variety of shapes and structures, observed in light rare earth $A ∼ 130$ nuclei, have been discussed in view of different angular momentum coupling schemes and their interplay that comes into effect at high spin. The = 79 and 80 isotopes in La–Ce region, produced via fusion evaporation reaction, have been studied using the Indian National Gamma Array (INGA) consisting of 18 clover HPGe detectors. Two nearly degenerate = 1 bands have been observed at high spin of 137Ce and a triaxial deformation of = ± 30°$ has been assigned to the bands, from the total Routhian surface (TRS) calculations. The high-spin candidates of the yrast band of 138Ce show signature splitting both in energy and (1)/(2) values. The bandcrossing due to the alignment of a pair of ℎ11/2 proton particles has been conjectured at ħ ω ∼ 0.3 MeV, from the single-particle Routhians obtained from TRS calculations. Lifetime measurements by Doppler shift attenuation method (DSAM) has been carried out and from the estimated reduced transition probability (1), the = 1 band in 138Ce has been characterized as a magnetic rotation (MR) band. The rise in the values of (1), for the higher spin candidates of the band, has been conjectured as the reopening of a different shear at the top of the Band B1. The characteristic of the MR bands in ∼ 130 region has been discussed in the light of a phenomenological calculation and compared to the MR bands in other mass regions.

  15. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO) precursor employing microwave heating technique

    Indian Academy of Sciences (India)

    Y S Malghe; A V Gurjar; S R Dharwadkar

    2004-06-01

    Cubic barium titanate (BaTiO3) powder was synthesized by heating barium titanyl oxalate hydrate, BaTiO(C2O4)$_{2}\\cdot$4H2O (BTO) precursor in microwave heating system in air at 500°C. Heating BTO in microwave above 600°C yielded tetragonal form of BaTiO3. Experiments repeated in silicon carbide furnace showed that BaTiO3 was formed only above 700°C. The product obtained was cubic.

  16. Geophysical disturbance environment during the NASA/MPE barium release at 5 earth radii on September 21, 1971.

    Science.gov (United States)

    Davis, T. N.; Stanley, G. M.; Boyd, J. S.

    1973-01-01

    The geophysical disturbance environment was quiet during the NASA/MPE barium release at 5 earth radii on September 21, 1971. At the time of the release, the magnetosphere was in the late recovery phase of a principal magnetic storm, the provisional Dst value was -13 gammas, and the local horizontal disturbance at Great Whale River was near zero. Riometer and other observations indicated low-level widespread precipitation of high-energy electrons at Great Whale River before, during, and after the release. Cloudy sky at this station prevented optical observation of aurora. No magnetic or ionospheric effects attributable to the barium release were detected at Great Whale River.

  17. XB130 expression in human osteosarcoma: a clinical and experimental study.

    Science.gov (United States)

    Wang, Xiaohui; Wang, Ruiguo; Liu, Zhaolong; Hao, Fengyun; Huang, Hai; Guo, Wenchen

    2015-01-01

    Identifying prognostic factors for osteosarcoma (OS) aids in the selection of patients who require more aggressive management. XB130 is a newly characterized adaptor protein that was reported to be a prognostic factor of certain tumor types. However, the association between XB130 expression and the prognosis of OS remains unknown. In the present study, we investigated the association between XB130 expression and clinicopathologic features and prognosis in patients suffering OS, and further investigated its potential role on OS cells in vitro and vivo. A retrospective immunohistochemical study of XB130 was performed on archival formalin-fixed paraffin-embedded specimens from 60 pairs of osteosarcoma and noncancerous bone tissues, and compared the expression of XB130 with clinicopathological parameters. We then investigate the effect of XB130 sliencing on invasion in vitro and lung metastasis in vivo of the human OS cell line. Immunohistochemical assays revealed that XB130 expression in OS tissues was significantly higher than that in corresponding noncancerous bone tissues (P=0.001). In addition, high XB130 expression more frequently occurred in OS tissues with advanced clinical stage (P=0.002) and positive distant metastasis (P=0.001). Moreover, OS patients with high XB130 expression had significantly shorter overall survival and disease-free survival (both Ptreatments. Furthermore, XB130 is the potential molecular target for OS therapy.

  18. In vitro phosphorylation and acetylation of the murine pocket protein Rb2/p130.

    Directory of Open Access Journals (Sweden)

    Muhammad Saeed

    Full Text Available The retinoblastoma protein (pRb and the related proteins Rb2/p130 and 107 represent the "pocket protein" family of cell cycle regulators. A key function of these proteins is the cell cycle dependent modulation of E2F-regulated genes. The biological activity of these proteins is controlled by acetylation and phosphorylation in a cell cycle dependent manner. In this study we attempted to investigate the interdependence of acetylation and phosphorylation of Rb2/p130 in vitro. After having identified the acetyltransferase p300 among several acetyltransferases to be associated with Rb2/p130 during S-phase in NIH3T3 cells in vivo, we used this enzyme and the CDK4 protein kinase for in vitro modification of a variety of full length Rb2/p130 and truncated versions with mutations in the acetylatable lysine residues 1079, 128 and 130. Mutation of these residues results in the complete loss of Rb2/p130 acetylation. Replacement of lysines by arginines strongly inhibits phosphorylation of Rb2/p130 by CDK4; the inhibitory effect of replacement by glutamines is less pronounced. Preacetylation of Rb2/p130 strongly enhances CDK4-catalyzed phosphorylation, whereas deacetylation completely abolishes in vitro phosphorylation. In contrast, phosphorylation completely inhibits acetylation of Rb2/p130 by p300. These results suggest a mutual interdependence of modifications in a way that acetylation primes Rb2/p130 for phosphorylation and only dephosphorylated Rb2/p130 can be subject to acetylation. Human papillomavirus 16-E7 protein, which increases acetylation of Rb2/p130 by p300 strongly reduces phosphorylation of this protein by CDK4. This suggests that the balance between phosphorylation and acetylation of Rb2/p130 is essential for its biological function in cell cycle control.

  19. Enhanced Sensitivity of Surface Plasmon Resonance Sensor Based on Bilayers of Silver-Barium Titanate

    Directory of Open Access Journals (Sweden)

    S. Fouad

    2016-12-01

    Full Text Available Surface plasmon resonance (SPR sensors have been widely adopted with various fields such as physics, chemistry, biology and biochemistry. SPR sensor has many advantages like the less number of sensing samples required, freedom of electromagnetic interference and higher sensitivity. This research investigates the phase interrogation technique of a surface plasmon resonance sensor based on silver and thin film dielectric material of Barium titanate layers. Barium titanate (BaTiO3 layer is adopted due to its excellent dielectric properties such as high dielectric constant and low dielectric loss. The numerical results demonstrate that the fusion of the proposed material BaTiO3 layer into surface plasmon resonance sensor yields a higher sensitivity of 280 degree/RIU in comparison with surface plasmon resonance sensor without BaTiO3 layer which shows only a sensitivity of 120 degree/RIU. As the thickness of this layer increases from 5 nm to 10 nm, the sensitivity is enhanced from 160 degree/RIU to 280 degree/RIU for a fixed metal layer of silver with a thickness of (70 nm.

  20. Curie temperature and magnetic properties of aluminum doped barium ferrite particles prepared by ball mill method

    Science.gov (United States)

    Chen, Daming; Harward, Ian; Baptist, Joshua; Goldman, Sara; Celinski, Zbigniew

    2015-12-01

    Barium ferrite has attracted considerable interest in the fields of permanent magnets and perpendicular magnetic recording due to its strong uniaxial anisotropy and high Curie temperature (Tc). We prepared aluminum doped barium ferrite ceramics (BaAlxFe12-xO19, 0≤x≤6) by the ball mill method. The powder was milled for 96 h, and after forming pellets, annealed for 48 h in air at 1000 °C. The X-ray diffraction (XRD) data show that there are only single hexagonal phases in the samples without any impurity phase. The crystal lattice constants, a and c, were calculated by Cohen's method. Both a and c decrease with increasing x, ranging from 0.588 nm and 2.318 nm to 0.573 nm and 2.294 nm, respectively. A Vibrating Sample Magnetometer (VSM) and Superconducting Quantum Interference Device (SQUID) were used to investigate Tc and magnetic properties of BaFe12-xAlxO19. It is found that Tc decreases with increasing x, from 425 °C to 298 °C. It is also found that the saturated magnetization (4πMs) decreases with increasing x, while the coercivity (Hc) increases with the increase in x. The anisotropy field was also determined from the SQUID measurement.

  1. Ammonia synthesis with barium-promoted iron–cobalt alloys supported on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus

    2003-01-01

    Iron–cobalt alloys supported on carbon were investigated as ammonia synthesis catalysts. Barium was found to have a promoting effect for Fe with an optimum atomic ratio Ba/Fe of 0.35. At this Ba loading, a local maximum for the NH3 synthesis activity was found at 4 wt% Co by varying the Fe/Co ratio...... it was not as effective for Fe. Power-law kinetic investigation revealed that, compared to the commercial Fe-based NH3 catalyst, the Ba–Co/C samples showed a lower inhibition by NH3 and were more active under ordinary ammonia synthesis conditions........ Samples containing only Co and no Fe, however, yielded by far the most active catalysts (7.0 μmol (NH3) g−1 s−1, 673 K, 10 bar). Barium was a very efficient promoter for Co, increasing the NH3 synthesis activity by more than two orders of magnitude compared to the unpromoted Co samples, while...

  2. Dielectric properties of barium strontium titanate / non ferroelectric oxide ceramic composites

    Energy Technology Data Exchange (ETDEWEB)

    Nenez, S. [THALES, Domaine de Corbeville, Orsay (France); Univ. de Bourgogne, Lab. de Recherche sur la Reactivite des Solides, Dijon (France); Morell, A.; Pate, M.; Ganne, J.P. [THALES, Domaine de Corbeville, Orsay (France); Maglione, M. [Inst. de Chimie de la Matiere Condensee de Bordeaux - CNRS, Pessac (France); Niepce, J.C. [Univ. de Bourgogne, Lab. de Recherche sur la Reactivite des Solides, Dijon (France)

    2002-07-01

    Barium strontium titanate ceramics present high dielectric permittivity and tunability. In order to reduce their permittivity and loss tangent while keeping tunability, various composites of barium strontium titanate oxide Ba{sub 0.6}Sr{sub 0.4}TiO{sub 3} combined with non-ferroelectric oxides such as magnesium titanate MgTiO{sub 3} or magnesia MgO were investigated. The Ba-Sr oxide powder was mixed with 20, 40 or 60 wt% of the non-ferroelectric oxide (NFO). The paper discusses the processing and the material characterisations by X-ray diffraction and SEM. A secondary phase BaMg{sub 6}Ti{sub 6}O{sub 19} was detected only in the composites synthesised with MgTiO{sub 3}. The microstructure and the dielectric characteristics are presented and discussed. A correlation between the microstructure of the composites, including secondary phase and the dielectric properties is proposed. (orig.)

  3. Calculation of exchange integrals and Curie temperature for La-substituted barium hexaferrites

    Science.gov (United States)

    Wu, Chuanjian; Yu, Zhong; Sun, Ke; Nie, Jinlan; Guo, Rongdi; Liu, Hai; Jiang, Xiaona; Lan, Zhongwen

    2016-10-01

    As the macro behavior of the strength of exchange interaction, state of the art of Curie temperature Tc, which is directly proportional to the exchange integrals, makes sense to the high-frequency and high-reliability microwave devices. Challenge remains as finding a quantitative way to reveal the relationship between the Curie temperature and the exchange integrals for doped barium hexaferrites. Here in this report, for La-substituted barium hexaferrites, the electronic structure has been determined by the density functional theory (DFT) and generalized gradient approximation (GGA). By means of the comparison between the ground and relative state, thirteen exchange integrals have been calculated as a function of the effective value Ueff. Furthermore, based on the Heisenberg model, the molecular field approximation (MFA) and random phase approximation (RPA), which provide an upper and lower bound of the Curie temperature Tc, have been adopted to deduce the Curie temperature Tc. In addition, the Curie temperature Tc derived from the MFA are coincided well with the experimental data. Finally, the strength of superexchange interaction mainly depends on 2b-4f1, 4f2-12k, 2a-4f1, and 4f1-12k interactions.

  4. Growth and characterization of solution-grown tetra glycine barium chloride (TGBC) single crystals

    Science.gov (United States)

    Senthil Pandian, M.; Ramasamy, P.

    2008-05-01

    The single crystals of tetra glycine barium chloride (TGBC), a semi-organic material, were grown by the solvent evaporation technique from an aqueous solution of glycine and barium chloride at ambient temperature. Good optical quality single crystals of size 11×13×7 mm 3 were grown in a period of 2 weeks. Powder X-ray diffraction (XRD) and Fourier transform infrared transmission (FTIR) have confirmed the formation of the new crystal. The grown crystals were characterized by single-crystal XRD analysis to study the crystal structure. The crystalline perfection was evaluated by high-resolution X-ray diffractometry (HRXRD). From this analysis we found that the quality of the crystal was quite good. The full-width at half-maximum (FWHM) of the diffraction curves is 8.5 arcsec, which is very close to that expected from the plane wave dynamical theory of XRD showing that the crystalline perfection is excellent. UV-Vis-NIR spectrum was recorded to study the optical transparency of the grown crystals. Thermal properties of the crystal have been investigated using thermo gravimetric (TG), differential thermal analysis (DTA). The mechanical strength of the crystal is estimated by Vicker's hardness test.

  5. Nanostructured Barium Titanate/Carbon Nanotubes Incorporated Polyaniline as Synergistic Electromagnetic Wave Absorbers

    Directory of Open Access Journals (Sweden)

    Lujun Yu

    2016-01-01

    Full Text Available The three-dimensional (3D conductive network structures formed by barium titanate/carbon nanotubes incorporated polyaniline were favorable for strengthening electromagnetic absorption capability. Herein, an easy and flexible method consisting of sol-gel technique, in situ polymerization, and subsequent mechanical method have been developed to prepare the barium titanate/carbon nanotubes incorporated polyaniline (CNTs/BaTiO3/PANI or CBP ternary composites. The dielectric properties and microwave absorption properties of CNTs/BaTiO3/PANI composites were investigated in the frequency range of 2–18 GHz by vector network analyzer. Interestingly, it is found that the CNTs/BaTiO3/PANI composites with 3D conductive network structures presented outstanding electromagnetic absorption properties, which may be attributed to the high impedance matching behavior and improved dielectric loss ability and novel synergistic effect. Additionally, it also can be supposed that the “geometrical effect” of composite was more beneficial to absorbing the incident electromagnetic wave. The CNTs/BaTiO3/PANI composite (the mass ratio of CNTs/BaTiO3 to PANI is 2 : 3 exhibits the best microwave absorption properties, of which the minimum reflection loss value can reach −30.9 dB at 8 GHz and the absorption bandwidth with a reflection loss blew −10 dB ranges from 7.5 to 10.2 GHz.

  6. Structural and thermal studies of modified silica-strontium-barium glass from CRT

    Science.gov (United States)

    Grelowska, I.; Kosmal, M.; Reben, M.; Pichniarczyk, P.; Sitarz, M.; Olejniczak, Z.

    2016-12-01

    Glasses were prepared by conventional melting method from 100 g batches. The influence of alumina and calcium oxide on the crystallization process of silica-strontium-barium glass from Cathode Ray Tube (CRT) were studied by means of 27Al MAS NMR and FTIR spectroscopy. This made possible to determine the influence of additives, e.g. blast furnace slag and cement dust on the structural changes of glasses (changes in the spectra shapes). The introduction of waste modifiers into the glass structure leads to the breaking of Al-O-Si and Si-O-Si bonds what causes the depolymerization of the glass network. From the FTIR spectra the narrowing of the bands at 1022 and 1027 cm-1 was observed, which may indicate on the ordering of glass network. Appearance of alumina in coordination 4 was confirmed by NMR investigations. The effects of compositional variation, thermal treatment on the nature, type and stability field of crystallizing phases and microstructure formed in CaO and/or Al2O3 silica-strontium-barium glasses were described using DTA/DSC method. Thermal characteristics of glasses like the transition temperature Tg, the temperature for the crystallization Tc, thermal stability parameter were determined. The crystalline phase was determined by the X-ray diffractometry. The microstructure of the samples was studied by SEM technique. Analysis of the local atomic interactions in the structure of glasses has been used to explain the course of the crystallization.

  7. Sulphate removal over barium-modified blast-furnace-slag geopolymer.

    Science.gov (United States)

    Runtti, Hanna; Luukkonen, Tero; Niskanen, Mikko; Tuomikoski, Sari; Kangas, Teija; Tynjälä, Pekka; Tolonen, Emma-Tuulia; Sarkkinen, Minna; Kemppainen, Kimmo; Rämö, Jaakko; Lassi, Ulla

    2016-11-05

    Blast-furnace slag and metakaolin were geopolymerised, modified with barium or treated with a combination of these methods in order to obtain an efficient SO4(2-) sorbent for mine water treatment. Of prepared materials, barium-modified blast-furnace slag geopolymer (Ba-BFS-GP) exhibited the highest SO4(2-) maximum sorption capacity (up to 119mgg(-1)) and it compared also favourably to materials reported in the literature. Therefore, Ba-BFS-GP was selected for further studies and the factors affecting to the sorption efficiency were assessed. Several isotherms were applied to describe the experimental results of Ba-BFS-GP and the Sips model showed the best fit. Kinetic studies showed that the sorption process follows the pseudo-second-order kinetics. In the dynamic removal experiments with columns, total SO4(2-) removal was observed initially when treating mine effluent. The novel modification method of geopolymer material proved to be technically suitable in achieving extremely low concentrations of SO4(2-) (<2mgL(-1)) in mine effluents.

  8. Influence of preparation route and slip casting conditions on titania and barium titanate ceramics

    Institute of Scientific and Technical Information of China (English)

    Arvind K.Nikumbh; Parag V.Adhyapak

    2012-01-01

    Titania (TiO2) and barium titanate (BaTiO3) were synthesized using three different dicarboxylates,which included oxalate,malate and tartarate.These powders were characterized by X-ray powder diffraction,scanning electron micrographs,BET specific surface area and particle size distribution.Their properties depended to a great extent on the nature of the precursor.The titania and barium titanate powders obtained from the tartarate precursor were found to be good for slip casting.Slips of these oxides with different solids contents were prepared at different pH values using both distilled water and ethanol as the dispersing agent and also with and without deflocculant.The theological behaviors of the suspensions were then determined,and the slip,green and sedimentation bulk densities were measured.The minimum viscosities were observed at pH 8.2 for the TiO2-water and pH 10.2 for the BaTiO3-water system.

  9. Dopant Behaviours of Sm2O3 on Microstructure and Properties of Barium Zirconium Titanate Ceramics

    Institute of Scientific and Technical Information of China (English)

    王永力; 李龙土; 齐建全; 桂治轮

    2001-01-01

    The effect of Sm2O3-dopant on the sintering characteristics and dielectric properties of barium zirconium titanate ceramics (BaZrxTi1-xO3) was investigated. It is shown that trace amount of Sm2O3 can greatly affect the grain growth and densification of barium zirconium titanate ceramics during sintering. At the same time, the dielectric peak at high temperature shifts to lower temperature and that at low temperature shifts to higher temperature. The two dielectric peaks overlap with each other when the Sm2O3-dopant content varies from 0.25% to 1%, and the maximum relative dielectric constant is greatly enhanced. These effects may be attributed to the substitution actions of the rare earth element in perovskite lattice. At the doping content of 0.75%, the dielectric constant maximum of 23570 can be obtained. By adopting some proper additives, an excellent Y5V dielective material is obtained, and the room temperature properties are as follows: relative dielectric constant εRT≥23,000, dielectric loss tgδ≤0.0075 and the breakdown strength under alternating field Eb≥5 kV·mm-1.

  10. Synthesis of nanosized barium titanate/epoxy resin composites and measurement of microwave absorption

    Indian Academy of Sciences (India)

    M Murugan; V K Kokate; M S Bapat; A M Sapkal

    2010-12-01

    Barium titanate/epoxy resin composites have been synthesized and tested for microwave absorption/transmission. Nanocrystalline barium titanate (BaTiO3 or BT) was synthesized by the hydrothermal method and the composites of BT/epoxy resin were fabricated as thin solid slabs of four different weight ratios. BT was obtained in the cubic phase with an average particle size of 21 nm, deduced from the X-ray diffraction data. The reflection loss (RL) and transmission loss (TL) of the composite materials were measured by the reflection/transmission method using a vector network analyser R&S: ZVA40, in the frequency range 8.0–18.5 GHz (X and Ku-bands). The RL was found to be better than −10 dB over wide frequency bands. The higher RL for lower concentration of BT could be due to increase in impedance matching effects. Low TL values indicate that the absorption by BT is quite low. This could be due to formation of BT in the cubic paraelectric phase.

  11. Electronic structure of barium strontium titanate by soft-x-ray absorption spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Uehara, Y. [Mitsubishi Electric Co., Hyogo (Japan); Underwood, J.H.; Gullikson, E.M.; Perera, R.C.C. [Ernest Orlando Lawrence Berkeley National Lab., CA (United States)

    1997-04-01

    Perovskite-type titanates, such as Strontium Titanate (STO), Barium Titanate (BTO), and Lead Titanate (PTO) have been widely studied because they show good electric and optical properties. In recent years, thin films of Barium Strontium Titanate (BST) have been paid much attention as dielectrics of dynamic random access memory (DRAM) capacitors. BST is a better insulator with a higher dielectric constant than STO and can be controlled in a paraelectric phase with an appropriate ratio of Ba/Sr composition, however, few studies have been done on the electronic structure of the material. Studies of the electronic structure of such materials can be beneficial, both for fundamental physics research and for improving technological applications. BTO is a famous ferroelectric material with a tetragonal structure, in which Ti and Ba atoms are slightly displaced from the lattice points. On the other hand, BST keeps a paraelectric phase, which means that the atoms are still at the cubic lattice points. It should be of great interest to see how this difference of the local structure around Ti atoms between BTO and BST effects the electronic structure of these two materials. In this report, the authors present the Ti L{sub 2,3} absorption spectra of STO, BTO, and BST measured with very high accuracy in energy of the absorption features.

  12. Single Molecule Fluorescence Imaging as a Technique for Barium Tagging in Neutrinoless Double Beta Decay

    CERN Document Server

    Jones, B J P; Nygren, D R

    2016-01-01

    Background rejection is key to success for future neutrinoless double beta decay experiments. To achieve sensitivity to effective Majorana lifetimes of $\\sim10^{28}$ years, backgrounds must be controlled to better than 0.1 count per ton per year, beyond the reach of any present technology. In this paper we propose a new method to identify the birth of the barium daughter ion in the neutrinoless double beta decay of $^{136}$Xe. The method adapts Single Molecule Fluorescent Imaging, a technique from biochemistry research with demonstrated single ion sensitivity. We explore possible SMFI dyes suitable for the problem of barium ion detection in high pressure xenon gas, and develop a fiber-coupled sensing system with which we can detect the presence of bulk Ba$^{++}$ ions remotely. We show that our sensor produces signal-to-background ratios as high as 85 in response to Ba$^{++}$ ions when operated in aqueous solution. We then describe the next stage of this R\\&D program, which will be to demonstrate chelation...

  13. Organometallic halide perovskite/barium di-silicide thin-film double-junction solar cells

    Science.gov (United States)

    Vismara, R.; Isabella, O.; Zeman, M.

    2016-04-01

    Barium di-silicide (BaSi2) is an abundant and inexpensive semiconductor with appealing opto-electrical properties. In this work we show that a 2-μm thick BaSi2-based thin-film solar cell can exhibit an implied photo-current density equal to 41.1 mA/cm2, which is higher than that of a state-of-the-art wafer-based c-Si hetero-junction solar cell. This performance makes BaSi2 an attractive absorber for high-performing thin-film and multi-junction solar cells. In particular, to assess the potential of barium di-silicide, we propose a thin-film double-junction solar cell based on organometallic halide perovskite (CH3NH3PbI3) as top absorber and BaSi2 as bottom absorber. The resulting modelled ultra-thin double-junction CH3NH3PbI3 / BaSi2 (< 2 μm) exhibits an implied total photo-current density equal to 38.65 mA/cm2 (19.84 mA/cm2 top cell, 18.81 mA/cm2 bottom cell) and conversion efficiencies up to 28%.

  14. Low-Temperature Synthesis and Thermodynamic and Electrical Properties of Barium Titanate Nanorods

    Directory of Open Access Journals (Sweden)

    Florentina Maxim

    2015-01-01

    Full Text Available Studies regarding the morphology dependence of the perovskite-type oxides functional materials properties are of recent interest. With this aim, nanorods (NRs and nanocubes (NCs of barium titanate (BaTiO3 have been successfully synthesized via a hydrothermal route at temperature as low as 408 K, employing barium acetate, titanium isopropoxide, and sodium hydroxide as reagents without any surfactant or template. Scanning electron microscopy (SEM, transmission electron microscopy (TEM, and X-ray powder diffraction (XRD, used for the morphology and structure analyses, showed that the NRs were formed by an oriented attachment of the NCs building-blocks with 20 nm average crystallites size. The thermodynamic properties represented by the relative partial molar free energies, enthalpies, and entropies of the oxygen dissolution in the perovskite phase, as well as the equilibrium partial pressure of oxygen, indicated that NRs powders have lower oxygen vacancies concentration than the NCs. This NRs characteristic, together with higher tetragonallity of the structure, leads to the enhancement of the dielectric properties of BaTiO3 ceramics. The results presented in this work show indubitably the importance of the nanopowders morphology on the material properties.

  15. Measurement of the line-of-sight velocity of high-altitude barium clouds A technique

    Science.gov (United States)

    Mende, S. B.; Harris, S. E.

    1982-01-01

    It is demonstrated that for maximizing the scientific output of future ionospheric and magnetospheric ion cloud release experiments a new type of instrument is required which will measure the line-of-sight velocity of the ion cloud by the Doppler technique. A simple instrument was constructed using a 5-cm diam solid Fabry-Perot etalon coupled to a low-light-level integrating TV camera. It was demonstrated that the system has both the sensitivity and spectral resolution for detection of ion clouds and measurement of their line-of-sight Doppler velocity. The tests consisted of (1) a field experiment using a rocket barium cloud release to check sensitivity, and (2) laboratory experiments to show the spectral resolving capabilities of the system. The instrument was found to be operational if the source was brighter than approximately 1 kR, and it had a wavelength resolution much better than 0.2 A, which corresponds to approximately 12 km/sec or in the case of barium ion an acceleration potential of 100 V. The instrument is rugged and, therefore, simple to use in field experiments or on flight instruments. The sensitivity limit of the instrument can be increased by increasing the size of the etalon.

  16. Role of intensive milling in the processing of barium ferrite/magnetite/iron hybrid magnetic nano-composites via partial reduction of barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Molaei, M.J., E-mail: mj.molaee@merc.ac.ir [Materials and Energy Research Center, P.O. Box: 31787-316, Karaj (Iran, Islamic Republic of); Delft Chem Tech, Faculty of Applied Sciences, Delft University of Technology, Julianalaan 136, 2628 BL Delft (Netherlands); Ataie, A.; Raygan, S. [School of Metallurgy and Materials Engineering, College of Engineering, University of Tehran, P.O. Box: 14395-553, Tehran (Iran, Islamic Republic of); Picken, S.J. [Delft Chem Tech, Faculty of Applied Sciences, Delft University of Technology, Julianalaan 136, 2628 BL Delft (Netherlands)

    2015-03-15

    In this research a mixture of barium ferrite and graphite was milled for different periods of time and then heat treated at different temperatures. The effects of milling time and heat treatment temperature on the phase composition, thermal behavior, morphology and magnetic properties of the samples have been investigated using X-ray diffraction, differential thermal analysis, high resolution transmission electron microscopy and vibrating sample magnetometer techniques, respectively. X-ray diffraction results revealed that BaFe{sub 12}O{sub 19}/Fe{sub 3}O{sub 4} nanocomposites form after a 20 h milling due to the partial reduction of BaFe{sub 12}O{sub 19}. High resolution transmission electron microscope images of a 40 h milled sample showed agglomerated structure consisting of nanoparticles with a mean particle size of 30 nm. Thermal analysis of the samples via differential thermal analysis indicated that for un-milled samples, heat treatment up to 900 °C did not result in α-Fe formation, while for a 20 h milled sample heat treatment at 700 °C resulted in reduction process progress to the formation of α-Fe. Wustite was disappeared in an X-ray diffraction pattern of a heat treated sample at 850 °C, by increasing the milling time from 20 to 40 h. By increasing the milling time, the structure of heat treated samples becomes magnetically softer due to an increase in saturation magnetization and a decrease in coercivity. Saturation magnetization and coercivity of a sample milled for 20 h and heat treated at 850 °C were 126.3 emu/g and 149.5 Oe which by increasing the milling time to 40 h, alter to 169.1 emu/g and 24.3 Oe, respectively. High coercivity values of milled and heat treated samples were attributed to the nano-scale formed iron particles. - Graphical abstract: Display Omitted - Highlights: • Barium ferrite and graphite were treated mechano-thermally. • Increasing milling time increases reduction progress after heat treatment. • Composites

  17. Pattern generation requirements for mask making beyond 130 nm

    Science.gov (United States)

    Abboud, Frank E.; Gesley, Mark A.; Maldonado, Juan R.

    1998-06-01

    It is commonly accepted in the semiconductor industry that optical lithography will be the most cost-effective solution for 150 nm and 130 nm device generations. Some selected layers at the 130 nm device generation may be produced using electron-beam direct-write or x-ray during the development phase. However, for the production phase, it is expected that 193 nm optical lithography with reticle enhancement techniques such as optical proximity correction (OPC) and phase shift masks (PSM) will be the technology of choice. What about post 193 nm. The range of solutions is more diverse and a clear winner has not yet emerged. The topic, however, is becoming more visible and has taken a prominent place in technical conferences in the past year. The five leading potential alternatives to optical lithography are proximity x-ray, e-beam projection (EBP), extended UV (EUV), ion projection lithography (IPL), and e-beam direct write. The search for the right answer will most likely continue for a few years, and possibly more than one alternative will emerge as an effective solution at and below 100 nm. All of the alternatives, with the exception of e-beam direct write, have one thing in common, the mask. Except for proximity x- ray, all solutions at present envision a 4x reduction of the mask-to-wafer image plane. Instead of chrome-coated quartz, a silicon wafer substrate is used. Aside from patterning, mask fabrication varies depending on the lithography absorbing substrate, and EUV requires a reflective multilayer stack. Most key lithography requirements needed to pattern the imaging layer are common to all of the candidates, at least for the reduction methods. For x-ray lithography, the requirements are significantly more stringent but at a smaller field. This paper will consolidate the requirements of the various types of masks from a pattern generation point of view and will focus on the pattern generation tool requirements to meet those mask requirements. In addition, it

  18. Efficacy of Barium-Based Fecal Tagging for CT Colonography: a Comparison between the Use of High and Low Density Barium Suspensions in a Korean Population - a Preliminary Study

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Min Ju; Park, Seong Ho; Lee, Seung Soo; Byeon, Jeong Sik; Kim, Jung Hoon; Kim, Yeoung Nam; Kim, Ah Young; Ha, Hyun Kwon [University of Ulsan College of Medicine, Asan Medical Center, Seoul (Korea, Republic of); Choi, Eugene K. [University of California Los Angeles, Los Angeles (United States)

    2009-02-15

    This preliminarily study was designed to determine and to compare the efficacy of two commercially available barium-based fecal tagging agents for CT colonography (CTC) (high-density [40% w/v] and low-density [4.6% w/v] barium suspensions) in a population in Korea. In a population with an identified with an average-risk for colorectal cancer, 15 adults were administered three doses of 20 ml 40% w/v barium for fecal tagging (group I) and 15 adults were administered three doses of 200 ml 4.6% w/v barium (group II) for fecal tagging. Excluding five patients in group I and one patient in group II that left the study, ten patients in group I and 14 patients in group II were finally included in the analysis. Two experienced readers evaluated the CTC images in consensus regarding the degree of tagging of stool pieces 6 mm or larger. Stool pieces were confirmed with the use of standardized CTC criteria or the absence of matched lesions as seen on colonoscopy. The rates of complete fecal tagging were analyzed on a per-lesion and a per-segment basis and were compared between the patients in the two groups. Per-lesion rates of complete fecal tagging were 52% (22 of 42; 95% CI, 37.7-66.6%) in group I and 78% (28 of 36; 95% CI, 61.7-88.5%) in group II. The difference between the two groups did not reach statistical significance (p = 0.285). The per-segment rates of complete tagging were 33% (6 of 18; 95% CI, 16.1%-56.4%) in group I and 60% (9 of 15; 95% CI, 35.7%-80.3%) in group II; again, the difference between the two groups did not reach statistical significance (p = 0.171). Barium-based fecal tagging using both the 40% w/v and the 4.6% w/v barium suspensions showed moderate tagging efficacy. The preliminary comparison did not demonstrate a statistically significant difference in the tagging efficacy between the use of the two tagging agents, despite the tendency toward better tagging with the use of the 4.6% w/v barium suspension.

  19. Determination of free barium in barium sulphate by atomic absorption spectrometry%火焰原子吸收光谱法测定硫酸钡中的游离钡

    Institute of Scientific and Technical Information of China (English)

    张博丽

    2012-01-01

    关于硫酸钡中游离钡的含量,国标中没有规定分析方法,随着硫酸钡用途的增加,游离钡的含量已成为硫酸钡产品中一个重要的杂质指标.提出了用火焰原子吸收分光光度法分析硫酸钡中的游离钡,并对溶解试样过程中酸度的控制、燃气的流量控制、助燃气的选择等影响因素进行了讨论.在波长553.6 nm、氧化亚氮作助燃气的条件下进行实验,计算得到的相对标准偏差为1.6%~3.5%,加标回收率为99.13%~ 100.07%,灵敏度为0.2,钡的检出限为0.2 mg/L,该方法具有低干扰性和高准确性的特点,测定结果令人满意,能够满足工业化生产要求.%There isn't analysis method for free barium of barium sulphate in national standards.With the increasing use of barium sulfate.free barium content has become one of the important impurity indexes of barium sulphate product.Free barium was analyzed by flame atomic absorption spectrometry (AAS).The influencing factors,such as the acidity when sample was dissolved, the gas flow, and selection of combustion-supporting gas, in experiment were discussed.The experiment was carried out under the conditions of the wavelength of 553.6 nm and with nitrous oxide as combustion-supporting gas.Through calculation relative standard deviation was at 1.6%~3.5% .standard sample recovery rates was at 99.13%~100.07% , sensitivity was 0.2,and barium detect limit was 0.2 mg/L.The deter-mination by AAS had the features of low interference and high accuracy.The experimental results were quite satisfactory and this method could meet the industrialized production requirements.

  20. 29 CFR 784.130 - “At sea.”

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false âAt sea.â 784.130 Section 784.130 Labor Regulations... First Processing, Canning, Or Packing of Marine Products Under Section 13(a)(5) § 784.130 “At sea.” The “at sea” requirement must be construed in context and in such manner as to accomplish the...

  1. Defense Acquisitions: Assessment of Institute for Defense Analyses C-130 Avionics Modernization Program Analysis

    Science.gov (United States)

    2014-05-29

    Page 1 GAO-14-547R C-130 Avionics Modernization Program 441 G St. N.W. Washington, DC 20548 May 29, 2014...Congressional Committees Defense Acquisitions: Assessment of Institute for Defense Analyses’ C-130 Avionics Modernization Program Analysis The Air...Force’s C-130 Avionics Modernization Program (AMP), which entered development in 2001, was to standardize and upgrade the cockpit and avionics for

  2. CT colonography: optimisation, diagnostic performance and patient acceptability of reduced-laxative regimens using barium-based faecal tagging

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, Stuart A. [University College Hospital, Department of Specialist Radiology, London (United Kingdom); University College Hospital, Department of Imaging, London (United Kingdom); Slater, Andrew [John Radcliffe Hospital, Oxford (United Kingdom); Burling, David N.; Tam, Emily; Gartner, Louise; Scarth, Julia; Bassett, Paul [St Mark' s Hospital, Northwick Park (United Kingdom); Greenhalgh, Rebecca; Pearce, Robert; Halligan, Steve [University College Hospital, Department of Specialist Radiology, London (United Kingdom)

    2008-01-15

    To establish the optimum barium-based reduced-laxative tagging regimen prior to CT colonography (CTC). Ninety-five subjects underwent reduced-laxative (13 g senna/18 g magnesium citrate) CTC prior to same-day colonoscopy and were randomised to one of four tagging regimens using 20 ml 40%w/v barium sulphate: regimen A: four doses, B: three doses, C: three doses plus 220 ml 2.1% barium sulphate, or D: three doses plus 15 ml diatriazoate megluamine. Patient experience was assessed immediately after CTC and 1 week later. Two radiologists graded residual stool (1: none/scattered to 4: >50% circumference) and tagging efficacy for stool (1: untagged to 5: 100% tagged) and fluid (1: untagged, 2: layered, 3: tagged), noting the HU of tagged fluid. Preparation was good (76-94% segments graded 1), although best for regimen D (P = 0.02). Across all regimens, stool tagging quality was high (mean 3.7-4.5) and not significantly different among regimens. The HU of layered tagged fluid was higher for regimens C/D than A/B (P = 0.002). Detection of cancer (n = 2), polyps {>=}6 mm (n = 21), and {<=}5 mm (n = 72) was 100, 81 and 32% respectively, with only four false positives {>=}6 mm. Reduced preparation was tolerated better than full endoscopic preparation by 61%. Reduced-laxative CTC with three doses of 20 ml 40% barium sulphate is as effective as more complex regimens, retaining adequate diagnostic accuracy. (orig.)

  3. Removal efficiency of water purifier and adsorbent for iodine, cesium, strontium, barium and zirconium in drinking water.

    Science.gov (United States)

    Sato, Itaru; Kudo, Hiroaki; Tsuda, Shuji

    2011-01-01

    The severe incident of Fukushima Daiichi Nuclear Power Station has caused radioactive contamination of environment including drinking water. Radioactive iodine, cesium, strontium, barium and zirconium are hazardous fission products because of the high yield and/or relatively long half-life. In the present study, 4 pot-type water purifiers and several adsorbents were examined for the removal effects on these elements from drinking water. Iodide, iodate, cesium and barium were removed by all water purifiers with efficiencies about 85%, 40%, 75-90% and higher than 85%, respectively. These efficiencies lasted for 200 l, which is near the recommended limits for use of filter cartridges, without decay. Strontium was removed with initial efficiencies from 70% to 100%, but the efficiencies were slightly decreased by use. Zirconium was removed by two models, but hardly removed by the other models. Synthetic zeolite A4 efficiently removed cesium, strontium and barium, but had no effect on iodine and zirconium. Natural zeolite, mordenite, removed cesium with an efficiency as high as zeolite A4, but the removal efficiencies for strontium and barium were far less than those of zeolite A4. Activated carbon had little removal effects on these elements. In case of radioactive contamination of tap water, water purifiers may be available for convenient decontamination of drinking water in the home.

  4. Introducing Barium in Transition Metal Oxide Frameworks: Impact upon Superconductivity, Magnetism, Multiferroism and Oxygen Diffusion and Storage.

    Science.gov (United States)

    Raveau, Bernard

    2016-11-25

    The role of barium in the structural chemistry of some transition metal oxides of the series "Cu, Mn, Fe,Co" is reviewed, based on its size effect and its particular chemical bonding. Its impact upon various properties, superconductivity, magnetism, multiferroism, oxygen storage is emphasized.

  5. A one-dimensional barium(II) coordination polymer with a coordinated nitro group of 2-nitrobenzoate

    Indian Academy of Sciences (India)

    Bikshandarkoil R Srinivasan; Santosh Y Shetgaonkar; Pallepogu Raghavaiah

    2008-03-01

    The aqueous reaction of barium carbonate with 2-nitrobenzoic acid (2-nbaH) results in the formation of a one-dimensional coordination polymer, catena-poly[[hexa(aqua)dibarium(II)]bis[(2-2-nitrobenzoate-O,O,O-NO2)(2-2-nitrobenzoate-O,O,O')

  6. Experimental investigation of the effect of titanium dioxide and barium titanate additives on DC transient currents in low density polyethylene

    DEFF Research Database (Denmark)

    Khalil, M.S; Henk, Peter O; Henriksen, Mogens

    1988-01-01

    The effect of titanium dioxide as a semiconductive additive and barium titanate as a highly polar additive on the DC transient currents in low-density polyethylene is investigated. Experiments were made using thick specimens under a high electric field (>25×106 V/m) and a constant temperature of 40...

  7. The effect of timing of intravenous muscle relaxant on the quality of double-contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Elson, E.M.; Campbell, D.M.; Halligan, S.; Shaikh, I.; Davitt, S.; Bartram, C.I

    2000-05-01

    AIM: To determine whether the timing of buscopan administration during double-contrast barium enema examination (DCBE) affects diagnostic quality. MATERIALS AND METHODS: In a prospective setting, 100 consecutive adult out-patients referred for DCBE received 20 mg buscopan (hyoscine-N-butylbromide) intravenously, either before infusion of barium suspension (Group A) or after barium infusion and gas insufflation (Group B). A subjective assessment of ease of contrast medium infusion was made at the time of examination and the films subsequently analysed by two radiologists unaware of the mode of relaxant administration, who noted the quality of mucosal coating and made subjective and objective measurements of segmental distension. RESULTS: There was no significant difference in screening times, infusion difficulty or colonic contrast medium coating between the two groups. Subjective assessment of distension of the caecum, ascending colon, transverse colon and rectum were not significantly different. Patients receiving intravenous relaxant after barium and gas infusion had less subjective descending (P = 0.05) and sigmoid (P = 0.04) colon distension, but there was no significant difference with respect to maximal bowel diameter in any of the segments measured. CONCLUSION: The timing of intravenous administration during DCBE is likely to have no significant effect on the diagnostic quality of the study. Elson, E.M. (2000)

  8. Monte Carlo estimation of radiation doses during paediatric barium meal and cystourethrography examinations

    Energy Technology Data Exchange (ETDEWEB)

    Dimitriadis, A; Gialousis, G; Karlatira, M; Karaiskos, P; Georgiou, E; Yakoumakis, E [Medical Physics Department, Medical School, University of Athens, 75 Mikras Asias Str., Goudi 11527, Athens (Greece); Makri, T; Papaodysseas, S, E-mail: anestisdim@yahoo.com [Radiological Imaging Department, Ag. Sofia Hospital, Lebadias and Thibon, Goudi 11527, Athens (Greece)

    2011-01-21

    Organ doses are important quantities in assessing the radiation risk. In the case of children, estimation of this risk is of particular concern due to their significant radiosensitivity and the greater health detriment. The purpose of this study is to estimate the organ doses to paediatric patients undergoing barium meal and micturating cystourethrography examinations by clinical measurements and Monte Carlo simulation. In clinical measurements, dose-area products (DAPs) were assessed during examination of 50 patients undergoing barium meal and 90 patients undergoing cystourethrography examinations, separated equally within three age categories: namely newborn, 1 year and 5 years old. Monte Carlo simulation of photon transport in male and female mathematical phantoms was applied using the MCNP5 code in order to estimate the equivalent organ doses. Regarding the micturating cystourethrography examinations, the organs receiving considerable amounts of radiation doses were the urinary bladder (1.87, 2.43 and 4.7 mSv, the first, second and third value in the parentheses corresponds to neonatal, 1 year old and 5 year old patients, respectively), the large intestines (1.54, 1.8, 3.1 mSv), the small intestines (1.34, 1.56, 2.78 mSv), the stomach (1.46, 1.02, 2.01 mSv) and the gall bladder (1.46, 1.66, 2.18 mSv), depending upon the age of the child. Organs receiving considerable amounts of radiation during barium meal examinations were the stomach (9.81, 9.92, 11.5 mSv), the gall bladder (3.05, 5.74, 7.15 mSv), the rib bones (9.82, 10.1, 11.1 mSv) and the pancreas (5.8, 5.93, 6.65 mSv), depending upon the age of the child. DAPs to organ/effective doses conversion factors were derived for each age and examination in order to be compared with other studies.

  9. Barium chloride induces redox status unbalance, upregulates cytokine genes expression and confers hepatotoxicity in rats-alleviation by pomegranate peel.

    Science.gov (United States)

    Elwej, Awatef; Grojja, Yousri; Ghorbel, Imen; Boudawara, Ons; Jarraya, Raoudha; Boudawara, Tahia; Zeghal, Najiba

    2016-04-01

    The present study was performed to establish the therapeutic efficacy of pomegranate peel against barium chloride induced liver injury. Adult rats were divided into four groups of six animals each: group I, serving as controls, received distilled water; group II received by their drinking water 67 ppm of BaCl2; group III received both 67 ppm of BaCl2 by the same way than group II and 5 % of pomegranate peel (PP) via diet; group IV received 5 % of PP. Analysis by HPLC/MS of PP showed its rich composition in flavonoids such as gallic acid, castalin, hyperin, quercitrin, syringic acid, and quercetin. The protective effects of pomegranate peel against hepatotoxicity induced by barium chloride were assessed using biochemical parameters and histological studies. Exposure of rats to barium caused oxidative stress in the liver as evidenced by an increase in malondialdehyde (MDA), lipid hydroperoxides (LOOHs), H2O2 and advanced oxidation protein product (AOPP) levels, and lactate dehydrogenase (LDH), gamma glutamyl transpeptidase (GGT), alanine aminotransferase (AST) and aspartate aminotransferase (ALT) activities, a decrease in catalase (CAT) and glutathione peroxidase (GPx) activities, glutathion (GSH), non-protein thiol (NPSH), vitamin C levels, and Mn-SOD gene expression. Liver total MT levels, MT-1, and MT-2 and pro-inflammatory cytokine genes expression like TNF-α, IL-1β and IL-6 were increased. Pomegranate peel, supplemented in the diet of barium-treated rats, showed an improvement of all the parameters indicated above.The present work provided ethnopharmacological relevance of pomegranate peel against the toxic effects of barium, suggesting its beneficial role as a potential antioxidant.

  10. Filterless pre-concentration by co-precipitation by formation of crystalline precipitate in the analysis of barium by FIA-FAES

    DEFF Research Database (Denmark)

    Plamboeck, C.; Westtoft, H.C.; Pedersen, S.A.;

    2003-01-01

    A novel method based on flow injection analysis (FIA) and flame atomic emission spectrometry (FAES) is presented. It was developed for direct determination of barium in drinking water, in natural water, in digested samples of bone and liver, in saline water and in a standard reference material...... (NIST SRM 1640). It was found that digestion of bone by an incineration procedure was required, in order to extract most of the barium. In the FIA manifold, barium was pre-concentrated by co-precipitation with lead chromate leading to a crystalline deposit that adhered well to the inner walls of a nylon...

  11. A System for Trapping Barium Ions in a Microfabricated Surface Trap

    Science.gov (United States)

    Zhou, Zichao; Wright, John; Graham, Richard; Sakrejda, Tomasz; Chen, Bing; Blinov, Boris; Musiqc Team

    2013-05-01

    We have developed a vacuum chamber and control system for rapid testing and development of microfabricated surface traps. Barium ions have been successfully cooled and trapped in this system. The dark lifetime of a single 138Ba + in this trap is up to 30s. And we can shuttle of ions at rate of 8 cm/s between different potential zones. Our system uses a modular design and is based on an in-vacuum PCB with integrated filters. Control of up to 96 DC electrodes is achieved with an update rate of 20 kHz using a custom FPGA based control system. Collection of fluorescence light over a numerical aperture of 0.28 has been achieved. This work is supported by IAPRA.

  12. Pressure effects during pulsed-laser deposition of barium titanate thin films

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalo, J.; Afonso, C.N. [Consejo Superior de Investigaciones Cientificas, Madrid (Spain). Inst. de Optica; Gomez San Roman, R.; Perez Casero, R. [Departamento de Fisica Aplicada C-XII, Universidad Autonoma de Madrid, 28049 Cantoblanco, Madrid (Spain); Perriere, J. [Groupe de Physique des Solides, Universites Paris VII et VI, URA 17 du CNRS, Tour 23, 2 Place Jussieu, 75251 Paris Cedex 05 (France)

    1998-05-01

    The composition and homogeneity of barium titanate films grown by pulsed-laser deposition at different substrate temperatures (room temperature, 700 C) and gas environments (O{sub 2},Ar) in a broad pressure range (10{sup -7}-1 mbar) are correlated to the plasma expansion dynamics. It is found that the deposited films present an excess of Ba in the intermediate pressure range (10{sup -2}

  13. Barium Strontium Titanate Thin Film Growth with rotational speed variation as a satellite temperature sensor prototype

    Science.gov (United States)

    Mulyadi; Rika, W.; Sulidah; Irzaman; Hardhienata, Hendradi

    2017-01-01

    Barium Strontium Titanate(BST) is a promising material for sensor devices such as temperature and infrared sensor. BaxSr1-xTiO3 thin films with affordable Si substrate were prepared by chemical solution deposition method and spin coating technique for 30 seconds with variation in rotation speed (3000 rpm, 5500 rpm and 8000 rpm). A high baking temperature at 8500C has been used for 15 hours during the annealing process. The thickness of BST film was calculated via gravimetric calculation. USB 2000 VIS-NIR was used to characterize the optical properties of BST thin film. The obtained reflectance curve showed that the most reflected wavelengths were in the range of 408-452 nm respectively. The result of the optical film characterization is very important for further development as a sensor in satellite technology.

  14. Multi-parameter sensing using high-k oxide of barium strontium titanate

    Energy Technology Data Exchange (ETDEWEB)

    Huck, Christina; Poghossian, Arshak; Baecker, Matthias; Schoening, Michael J. [Institute of Nano- and Biotechnologies (INB), FH Aachen, 52428, Juelich (Germany); Peter Gruenberg Institute (PGI-8), Forschungszentrum Juelich GmbH, 52525, Juelich (Germany); Reisert, Steffen; Kramer, Friederike [Institute of Nano- and Biotechnologies (INB), FH Aachen, 52428, Juelich (Germany); Begoyan, Vardges K.; Buniatyan, Vahe V. [Department of Microelectronics and Biomedical Devices, State Engineering University of Armenia, 0009, Yerevan (Armenia)

    2015-06-15

    High-k perovskite oxide of barium strontium titanate (BST) represents a very attractive multi-functional transducer material for the development of (bio-)chemical sensors. In this work, a Si-based sensor chip containing Pt interdigitated electrodes covered with a thin BST layer (485 nm) has been developed for multi-parameter chemical sensing. The chip has been applied for the contactless measurement of the electrolyte conductivity, the detection of adsorbed charged macromolecules (positively charged polyelectrolytes of polyethylenimine) and the concentration of hydrogen peroxide (H{sub 2}O{sub 2}) vapor. The experimental results of functional testing of individual sensors are presented. The mechanism of the BST sensitivity to charged polyelectrolytes and H{sub 2}O{sub 2} vapor has been proposed and discussed. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  15. Experimental investigation of barium spectra in crossed electric and magnetic fields

    Institute of Scientific and Technical Information of China (English)

    Quan Wei; Liu Hong-Ping; Shen Li; Zhan Ming-Sheng

    2007-01-01

    This paper has studied the barium spectra in external magnetic and electric fields on the recently-built system based on a super-conducting solenoid with high stability of better than 1 Gauss. Firstly, we compared the spectra in a high pure magnetic field of B = 4.00000T for different polarized laser, σ+ and σ-. We prove that after a proper shift,the σ+ and σ- spectra are completely identical. We also investigated the dependence of the spectral feature in the high magnetic field on an additionally applied crossing electric field. Along with the increase of the electric field, there is an energy shift for every spectral line. Based on a transformative Hamiltonian, we explained this energy shift well.

  16. Verification of the flexoelectricity in barium strontium titanate through d33 meter

    Directory of Open Access Journals (Sweden)

    Longlong Shu

    2016-12-01

    Full Text Available Flexoelectricity is a newly arising electromechanical property that couples strain gradient to polarization. This physical property widely exists in most of the solid dielectrics but has quite weak response that often overlooked. Recently, barium strontium titanate (BST, a well-known ferroelectrics, has been reported to be a promising flexoelectric material, and thus triggered the associated studies on flexoelectricity to a new height. However, part of the researchers argued the observed flexoelectricity in BST is either by residual piezoelectricity or centric symmetry breaking during the densification process. In this paper, we would verify the flexoelectricity in BST ceramics by many comparison experiments. Our experimental result suggested the observed polarization in BST material is likely to be induced by strain gradient through flexoelectricity.

  17. Enhanced production of barium in low-mass stars: evidence from open clusters

    CERN Document Server

    D'Orazi, Valentina; Randich, Sofia; Galli, Daniele; Busso, Maurizio; Sestito, Paola

    2009-01-01

    We report the discovery of a trend of increasing barium abundance with decreasing age for a large sample of Galactic open clusters. The observed pattern of [Ba/Fe] vs. age can be reproduced with a Galactic chemical evolution model only assuming a higher Ba yield from the $s$-process in low-mass stars than the average one suggested by parametrized models of neutron-capture nucleosynthesis. We show that this is possible in a scenario where the efficiency of the extra-mixing processes producing the neutron source $^{13}$C is anti-correlated with the initial mass, with a larger efficiency for lower masses. This is similar to the known trend of extended mixing episodes acting in H-rich layers and might suggest a common physical mechanism.

  18. Structural and magnetic properties of hexagonal barium ferrite synthesized through the sol-gel combustion route

    Science.gov (United States)

    Zahari, Muhammad Hanif bin; Guan, Beh Hoe; Chuan, Lee Kean

    2016-11-01

    Single-phased barium ferrite with the chemical formula of BaFe12O19 was synthesized through the sol-gel combustion method by using stoichiometric amounts of the precursor materials Structural characterizations were done through X-ray diffraction (XRD) analysis. The magnetic properties were determined through vibrating sample magnetometer (VSM) measurement. Pure single-phased BaFe12O19 was successfully obtained at 850°C without any accompanying secondary phases. This was reflected in the magnetic measurements where a prominent hysteresis was displayed by the synthesized powder. Values as high as 50.37 emu/g, 2984.9 G and 26.15 emu/g was observed for the magnetic saturation, coercivity and remanence respectively.

  19. Pulsed laser deposition of barium metaplumbate thin films for ferroelectric capacitors

    Science.gov (United States)

    Mardare, A. I.; Mardare, C. C.; Fernandes, J. R. A.; Vilarinho, P. M.; Joanni, E.

    2003-08-01

    Barium metaplumbate thin films were deposited in situ by pulsed laser deposition on Si/SiO2/Ti/Pt substrates with a high deposition rate. The temperatures used ranged between 400 ^circ C and 700 ^circ C. As the deposition temperature was increased, the films assumed a strong (222) preferential orientation. This orientation of the electrodes was reflected on the PZT films, having a very big influence on their ferroelectric behavior. The PZT films made over BPO deposited at high temperature presented high values of remanent polarization (43 μC/cm^2) but indications of high leakage currents could be observed in the hysteresis loops. By using BPO bottom electrodes, a 30% improvement in the fatigue behavior of PZT capacitors when compared with the normal platinum electrodes was observed.

  20. Novel Composite Materials for Chiral Separation from Cellulose and Barium Sulfate

    Directory of Open Access Journals (Sweden)

    Wei Chen

    2013-01-01

    Full Text Available Cellulose was dissolved in an aqueous solution of sodium hydroxide (NaOH and urea followed by the addition of barium sulfate (BaSO4 to yield the BaSO4/cellulose composite particles. The morphology, particle size, and BaSO4 content of the composite particles were adjusted by controlling the feed ratio of cellulose and BaSO4. The cellulose within the composite particles then reacted with 3,5-dimethylphenyl isocyanate. The resulting materials were utilized as the chiral stationary phases (CSPs whose enantioseparation capabilities were evaluated by various chiral analytes. Due to the mechanical enhancement effect of BaSO4, the composite particles could be applied to the chromatographic packing materials.

  1. Influence of fuel ratios on auto combustion synthesis of barium ferrite nano particles

    Indian Academy of Sciences (India)

    D Bahadur; S Rajakumar; Ankit Kumar

    2006-01-01

    Single-domain barium ferrite nano particles have been synthesized with narrow particle-size distribution using an auto combustion technique. In this process, citric acid was used as a fuel. Ratios of cation to fuel were maintained variously at 1 : 1, 1 : 2 and 1 : 3. The pH was 7 in all cases. Of all three cases, a cation to citric acid ratio of 1 : 2 gives better yield in the formation of crystalline and single domain particles with a narrow range of size distribution. Most particles are in the range of 80 to 100 nm. Maximum magnetization and coercivity values are also greater for 1 : 2 ratios. These values measured at room temperature are found to be 55 emu/gram and 5000 Oe respectively. XPS and ESR studies support the results.

  2. Role of barium nitrate on the sulfur fixation of calcium oxide`

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    In this paper, the effect of Ba(NO3)2 on the efficiency of sulfur fixation of calcium oxide during coal combustion was studied. The results showed that addition of barium nitrate to the CaO can enhance the sulfur removal rate of CaO significantly. The X-ray diffraction spectrum of residual ash of coal added some sulfur fixative expressed that Ba2+ can form a compound of Ba-Al-Si-O which encloses the CaSO4 to prevent it's decomposition, so Ba2+ can improve the action of sulfur fixation of CaO. The combustion character os the original coal and original coal added sulfur fixative was researched with thermal-gravity analyzer and the results expressed that adding some sulfur fixative to the coal will make the combustion character of coal change little.

  3. Structural and Mössbauer investigation on barium titanate-cobalt ferrite composites

    Science.gov (United States)

    Leonel, Liliam V.; Silva, Juliana B.; Albuquerque, Adriana S.; Ardisson, José D.; Macedo, Waldemar A. A.; Mohallem, Nelcy D. S.

    2012-11-01

    Perovskite and spinels oxides have received renewed attention due to the possibility of combining both structures in di-phase composites to obtain multifunctional materials. In this work, barium titanate (perovskite)-cobalt ferrite (spinel) composite powders with different microstructures were obtained from thermal treatment of amorphous precursors at 500-1100 °C. The precursors were prepared by combining coprecipitation and sol-gel routes. Lyophilization of ferrite prior to mixing was used as a strategy to control interphase reaction. Mössbauer spectroscopy showed that the dispersion of coprecipitated ferrite in a viscous BaTiO3 precursor gel resulted in superparamagnetic behavior and reduction of the local magnetic field of site [B].

  4. Studies on gas sensing performance of pure and modified barium strontium titanate thick film resistors

    Indian Academy of Sciences (India)

    G H Jain; L A Patil; P P Patil; U P Mulik; K R Patil

    2007-02-01

    Barium strontium titanate ((Ba0.87Sr0.13)TiO3–BST) ceramic powder was prepared by mechanochemical process. The thick films of different thicknesses of BST were prepared by screen-printing technique and gas-sensing performance of these films was tested for various gases. The films showed highest response and selectivity to ammonia gas. The effect of film thickness on gas response was also studied. As prepared BST thick films were surface modified by dipping them into an aqueous solution of titanium chloride (TiCl3) for different intervals of time. Surface modification shifted response to H2S gas suppressing the responses to ammonia and other gases. The surface modification, using dipping process, altered the adsorbate–adsorbent interactions, which gave the unusual sensitivity and selectivity effect. Sensitivity, selectivity, thermal stability, response and recovery time of the sensor were measured and presented.

  5. Therapeutic High-Density Barium Enema in a Case of Presumed Diverticular Hemorrhage

    Directory of Open Access Journals (Sweden)

    Nonthalee Pausawasdi

    2011-02-01

    Full Text Available Many patients with lower gastrointestinal bleeding do not have an identifiable source of bleeding at colonoscopy. A significant percentage of these patients will have recurrent bleeding. In many patients, the presence of multiple diverticula leads to a diagnosis of presumed diverticular bleeding. Current treatment options include therapeutic endoscopy, angiography, or surgical resection, all of which depend on the identification of the diverticular source of bleeding. This report describes a case of recurrent bleeding in an elderly patient with diverticula but no identifiable source treated successfully with barium impaction therapy. This therapeutic modality does not depend on the identification of the bleeding diverticular lesion and was well tolerated by our 86-year-old patient.

  6. Energy transfer and NIR emission in rare earth tri-doped barium lanthanum fluoro tellurite glasses

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, J. Suresh; Pavani, K.; Graca, M.P.F.; Soares, M.J. [Department of Physics and I3N, University of Aveiro (Portugal); Venkataiah, G. [Department of Physics, Sri Venkateswara University, Tirupati (India); Jayasimhadri, M. [Department of Applied Physics, Delhi Technological University, Delhi (India)

    2014-09-15

    Barium lanthanum fluoro tellurite (BLFT) glasses doped with rare earth ions (ErF{sub 3}, PrF{sub 3} and YbF{sub 3}) both singly or in combinations were prepared by melt-quench technique and analysed spectroscopically. The prepared glasses were found to be mechanically strong and transparent. Optical absorption and NIR fluorescence were measured to the highly transparent and stable glass samples. Judd-Ofelt parameters and radiative properties were estimated for the single rare earth doped BLFT glasses using the optical absorption spectra. NIR fluorescence is measured using laser excitation. From the NIR emission spectra, energy transfer among the rare earth ions is analysed in the rare earth tri-doped BLFT glasses. These rare earth tri-doped BLFT glasses are found to be highly useful for the multi- wavelength emission in the NIR region for opto-electronic applications. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Low-temperature anharmonicity of barium titanate: A path-integral molecular-dynamics study

    Science.gov (United States)

    Geneste, Grégory; Dammak, Hichem; Hayoun, Marc; Thiercelin, Mickael

    2013-01-01

    We investigate the influence of quantum effects on the dielectric and piezoelectric properties of barium titanate in its (low-temperature) rhombohedral phase, and show the strongly anharmonic character of this system even at low temperature. For this purpose, we perform path-integral molecular-dynamics simulations under fixed pressure and fixed temperature, using an efficient Langevin thermostat-barostat, and an effective Hamiltonian derived from first-principles calculations. The quantum fluctuations are shown to significantly enhance the static dielectric susceptibility (≈ by a factor of 2) and the piezoelectric constants, reflecting the strong anharmonicity of this ferroelectric system even at very low temperature. The slow temperature-evolution of the dielectric properties observed below ≈100 K is attributed (i) to zero-point energy contributions and (ii) to harmonic behavior if the quantum effects are turned off.

  8. Preparation and Characterization of M-Type Barium Ferrite Fibers via Aqueous Sol-Gel Process

    Institute of Scientific and Technical Information of China (English)

    GONG Cairong; FAN Guoliang; SONG Chonglin; L(U) Gang

    2007-01-01

    BaFe12O19 fibers was prepared via an aqueous sol-gel process using Fe(OH)( HCOO)2 synthesized in laboratory and Ba(CH3COO)2 as the original materials and citrate as the chelate. The rheological behaviour of spinnable sol was characterized on rheometer, and the development of gel fibers to barium ferrite fibers was studied by IR, TG and XRD. Morphology observation of the fibers was given on SEM, and the diameter of the obtained fibers was between 5 and 10 μm corresponding to different additives. The additives affected the surface tension of the precursor sol which had close relation to the microstructure of fibers. Sucrose and hydroxyethylic cellulose could improve the surface tension while diethanolamine and hexadecylamine reduce that of the precursor sol. And using diethanolamine or hexadecylamine as an additive, well-structured BaFe12O19 fibers could be obtained.

  9. Simulation and Scale-up of Barium Sulphate Precipitation Process Using CFD Modeling

    Institute of Scientific and Technical Information of China (English)

    龚俊波; 卫宏远; 王静康; JohnGarsideb

    2005-01-01

    Some empirical mixing models were used to describe the imperfect mixing in precipitation process.However, the models can not, in general, reflect the details of interactions between mixing and crystallization in a vessel. In this study, CFD (computational fluid dynamics) technique were developed by simulating the precipitation of barium sulphate in stirred tanks by integration of population balance equations with a CFD solver. Two typical impellers, Rushton and pitched blade turbines, were employed for agitation. The influence of feed concentration and position on crystal product properties was investigated by CFD simulation. The scale-up of these precipitators was systematically studied. Significant effect on the crystal properties was found for the scale-up under some conditions.Keywords simulation, scale up, precipitation, CFD(computational fluid dynamics)

  10. Isotope shifts of 6s5d $^3$D-states in neutral Barium

    CERN Document Server

    Dammalapati, U; Jungmann, K; Willmann, L

    2008-01-01

    Laser spectroscopy of the low lying $^1$P and $^3$D states in atomic barium has been performed. This work contributes substantially to the development of an effective laser cooling and trapping for heavy alkaline earth elements and aims in particular for a better understanding of the atomic wave function of these systems. Isotope shifts and hyperfine structures are ideal probes for the wave functions at the position of the nucleus. This is essential input for a theoretical evaluation of the sensitivity to fundamental symmetry breaking properties like permanent electric dipole moments. We report the first isotope shift measurements of the $^3$D$_{1,2}$-$^1$P$_1$ transitions. A deviation of the King plot from its expected behavior has been observed. Further we have optically resolved the hyperfine structure of the $^3$D$_{1,2}$ states.

  11. Properties of composition sinter prepared from fibrous barium titanate and nanometer zirconia

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Fibrous Batium Titanate particles,30-50 μm long,prepared by a hydrothermal reaction,and the monoclinic phase and nanometer Zirconia,11.6 nm long were prepared by citric acid reaction respectively.Then,the two were composite sintered to produce a new functional material by making full use of crystal-axis orientation of fibers and the activity of nanometer powder.The analydid of composition and microstructure of the new material in terms of XRD and SEM.shows that the solid solution was formed between fibers and nanometer powder,and the distance between lattice(d value)of Barium Titanate changed.But the crystal-axis orientations of fibers remain unchanged.

  12. Dielectric property of polyimide/barium titanate composites and its influence factors (Ⅱ)

    Institute of Scientific and Technical Information of China (English)

    Weidong LIU; Baoku ZHU; Shuhui XIE; Zhikang XU

    2008-01-01

    Using poly(amic acid) (PAA) as a precursor followed by thermal imidization, the polyimide/barium titanate composite films were successfully prepared by a direct mixing method and in situ process. The influence of processing factors, such as particle size, distribution mode and polymerization method on dielectric prop-erties was studied. Results revealed that the dielectric constant (ε) of the composite film increased by using bigger fillers or employing in situ polymerization and bimodal distribution. When the composite film contain-ing 50 Vol-% of BaTiO3 with size in 100 nm was pre-pared via in situ process, its dielectric constant reached 45 at 10 kHz.

  13. Crystalline Structure, Defect Chemistry and Room Temperature Colossal Permittivity of Nd-doped Barium Titanate.

    Science.gov (United States)

    Sun, Qiaomei; Gu, Qilin; Zhu, Kongjun; Jin, Rongying; Liu, Jinsong; Wang, Jing; Qiu, Jinhao

    2017-02-13

    Dielectric materials with high permittivity are strongly demanded for various technological applications. While polarization inherently exists in ferroelectric barium titanate (BaTiO3), its high permittivity can only be achieved by chemical and/or structural modification. Here, we report the room-temperature colossal permittivity (~760,000) obtained in xNd: BaTiO3 (x = 0.5 mol%) ceramics derived from the counterpart nanoparticles followed by conventional pressureless sintering process. Through the systematic analysis of chemical composition, crystalline structure and defect chemistry, the substitution mechanism involving the occupation of Nd(3+) in Ba(2+) -site associated with the generation of Ba vacancies and oxygen vacancies for charge compensation has been firstly demonstrated. The present study serves as a precedent and fundamental step toward further improvement of the permittivity of BaTiO3-based ceramics.

  14. Dispersive waves induced by self-defocusing temporal solitons in a beta-barium-borate crystal

    DEFF Research Database (Denmark)

    Zhou, Binbin; Bache, Morten

    2015-01-01

    We experimentally observe dispersive waves in the anomalous dispersion regime of a beta-barium-borate (BBO) crystal, induced by a self-defocusing few-cycle temporal soliton. Together the soliton and dispersive waves form an energetic octave-spanning supercontinuum. The soliton was excited...... in the normal dispersion regime of BBO through a negative cascaded quadratic nonlinearity. Using pump wavelengths from 1.24 to 1.4 μm, dispersive waves are found from 1.9 to 2.2 μm, agreeing well with calculated resonant phasematching wavelengths due to degenerate four-wave mixing to the soliton. We also...... observe resonant radiation from nondegenerate four-wave mixing between the soliton and a probe wave, which was formed by leaking part of the pump spectrum into the anomalous dispersion regime. We confirm the experimental results through simulations....

  15. Barium fluoride whispering-gallery-mode disk-resonator with one billion quality-factor

    CERN Document Server

    Lin, Guoping; Henriet, Rémi; Jacquot, Maxime; Chembo, Yanne K

    2015-01-01

    We demonstrate a monolithic optical whispering gallery mode resonator fabricated with barium fluoride (BaF$_2$) with an ultra-high quality ($Q$) factor above $10^9$ at $1550$ nm, and measured with both the linewidth and cavity-ring-down methods. Vertical scanning optical profilometry shows that the root mean square surface roughness of $2$ nm is achieved for our mm-size disk. To the best of our knowledge, we show for the first time that one billion $Q$-factor is achievable by precision polishing in relatively soft crystals with mohs hardness of ~$3$. We show that complex thermo-optical dynamics can take place in these resonators. Beside usual applications in nonlinear optics and microwave photonics, high energy particle scintillation detection utilizing monolithic BaF$_2$ resonators potentially becomes feasible.

  16. Growth, characterization and dielectric property studies of gel grown barium succinate single crystals

    Indian Academy of Sciences (India)

    M P Binitha; P P Pradyumnan

    2014-05-01

    Single crystals of barium succinate (BaC4H4O4) were grown in silica gel medium using controlled chemical reaction method. Plate-like single crystals of size up to 3 × 2 × 0.2 mm3 was obtained. Single crystal X-ray diffraction (XRD) studies confirmed that structure of the title compound is tetragonal. Powder X-ray diffraction (PXRD) pattern of the grown crystal and the Fourier transform infrared (FT–IR) spectrum in the range 400–4000 cm-1 are recorded. The vibrational bands corresponding to different functional groups are assigned. Thermal stability of the grown crystals is confirmed by differential scanning calorimetry (DSC). Dielectric constant and dielectric loss have been calculated and discussed as a function of frequency at different temperatures.

  17. Optimized growth and dielectric properties of barium titanate thin films on polycrystalline Ni foils

    Institute of Scientific and Technical Information of China (English)

    Liang Wei-Zheng; Ji Yan-Da; Nan Tian-Xiang; Huang Jiang; Zeng Hui-Zhong; Du Hui; Chen Chong-Lin; Lin Yuan

    2012-01-01

    Barium titanate (BTO) thin films were deposited on polycrystalline Ni foils by using the polymer assisted deposition (PAD) technique.The growth conditions including ambient and annealing temperatures were carefully optimized based on thermal dynamic analysis to control the oxidation processing and interdiffusion.Crystal structures,surface morphologies,and dielectric performance were examined and compared for BTO thin films annealed under different temperatures.Correlations between the fabrication conditions,microstructures,and dielectric properties were discussed.BTO thin films fabricated under the optimized conditions show good crystalline structure and promising dielectric properties with εr ~ 400 and tanδ < 0.025 at 100 kHz.The data demonstrate that BTO films grown on polycrystalline Ni substrates by PAD are promising in device applications.

  18. Decrease in the rate of thermal decomposition of lead and barium styphnates in a radiation field

    Energy Technology Data Exchange (ETDEWEB)

    Ryabykh, S.M.; Kholodkovskaya, N.V.; Zhulanova, V.P. [Kemerovo State Univ. (Russian Federation)

    1995-09-01

    The effect of radiation on the thermolysis of lead and barium styphnates C{sub 6}H(NO{sub 2}){sub 3}O{sub 2}Pb{center_dot}H{sub 2}O and C{sub 6}H(NO{sub 2}){sub 3}O{sub 2}Ba{center_dot}H{sub 2}O, which are priming explosives, was studied. Decomposition of the substances was evaluated by measuring a decrease in the concentration of styphnate ions, as determined by chemical analysis. Irradiation was carried out on an RkhM-{gamma}-20 {sup 60}Co {gamma}-radiation source at a dose rate of D {approx} 10 kGy/h. Thermostating was performed in the temperature range 120-190{degrees}C to within {plus_minus}0.5{degrees}/C.

  19. Room temperature optical and dielectric properties of Ca and Ni doped barium ferrite

    Science.gov (United States)

    Agrawal, Shraddha; Parveen, Azra; Azam, Ameer

    2016-05-01

    The citrate sol gel combustion method has been used to synthesize (Ba0.9Ca0.1) (Fe0.8 Ni0.2)12O19 hexaferrites. Microstructural analyses were carried out by XRD and FTIR. Optical properties were studied by UV-visible technique in the range of 300-800 nm. The energy band gap was calculated with the help of Tauc relationship shows increases in band gap. Ca and Ni doped barium ferrite annealed at 850°C exhibit significant dispersion in complex permeability. The dispersion in complex dielectric constant can be explained on the basis of Koop's theory based on Maxwell-Wagner two layer models in studied nanoparticles.

  20. Measurements of the time constant for steady ionization in shaped-charge barium releases

    Science.gov (United States)

    Hoch, Edward L.; Hallinan, Thomas J.

    1993-01-01

    Quantitative measurements of three solar illuminated shaped-charge barium releases injected at small angles to the magnetic field were made using a calibrated color television camera. Two of the releases were from 1989. The third release, a reanalysis of an event included in Hallinan's 1988 study of three 1986 releases, was included to provide continuity between the two studies. Time constants for ionization, measured during the first 25 s of each release, were found to vary considerably. The two 1989 time constants differed substantially, and both were significantly less than any of the 1986 time constants. On the basis of this variability, we conclude that the two 1989 releases showed evidence of continuous nonsolar ionization. One release showed nonsolar ionization which could not he attributed to Alfven's critical ionization velocity process, which requires a component of velocity perpendicular to the magnetic field providing a perpendicular energy greater than the ionization potential.

  1. Simultaneous videoradiography and solid state intraluminal pharyngeal manometry during barium swallow; videomanometry

    Energy Technology Data Exchange (ETDEWEB)

    Olsson, Rolf

    1995-08-01

    The technique was used in nondysphagic volunteers and in dysphagic patients. Our normal values in nondysphagic volunteers are in accordance with normal values in the literature. Regarding catheter movement we found the a previously not described sensor movement where the sensor in the upper esophageal sphincter followed the laryngeal elevation with no response to soft palate elevation. We found a longitudinal asymmetry in the pharynx with higher contraction pressures at lower levels. In the experimental model we found that intrabolus pressure was dependent on bolus volume, lumen narrowing, sensor position, flow rate, and bolus viscosity. In patients with a cricopharyngeal indentation we found weak pharyngeal constrictors with outpouching of the lumen above and below. Finally, in dysphagic patients with a normal radiologic investigation, videomanometry displayed abnormalities in 74% of the patients. We conclude that barium swallow and manometry are complementary and we suggest the addition of pharyngeal solid state manometry, preferably with simultaneous videoradiography, in dysphagic patients. 128 refs, 4 figs.

  2. Dispersive waves induced by self-defocusing temporal solitons in a beta-barium-borate crystal.

    Science.gov (United States)

    Zhou, Binbin; Bache, Morten

    2015-09-15

    We experimentally observe dispersive waves in the anomalous dispersion regime of a beta-barium-borate (BBO) crystal, induced by a self-defocusing few-cycle temporal soliton. Together the soliton and dispersive waves form an energetic octave-spanning supercontinuum. The soliton was excited in the normal dispersion regime of BBO through a negative cascaded quadratic nonlinearity. Using pump wavelengths from 1.24 to 1.4 μm, dispersive waves are found from 1.9 to 2.2 μm, agreeing well with calculated resonant phase-matching wavelengths due to degenerate four-wave mixing to the soliton. We also observe resonant radiation from nondegenerate four-wave mixing between the soliton and a probe wave, which was formed by leaking part of the pump spectrum into the anomalous dispersion regime. We confirm the experimental results through simulations.

  3. Study of a Flexible Low Profile Tunable Dipole Antenna Using Barium Strontium Titanate Varactors

    Science.gov (United States)

    Cure, David; Weller, Thomas; Miranda, Felix A.

    2014-01-01

    In this paper a flexible low profile dipole antenna using a frequency selective surface (FSS) with interdigital barium strontium titanate (BST) varactor-tuned unit cells is presented. The varactor chips were placed only along one dimension of the FSS to avoid the use of vias and simplify the DC bias network. The antenna uses overlapping metallic plates that resemble fish scales as a ground plane to improve the flexibility of the multi-material stack structure. The measured data of the antenna demonstrate tunability from 2.42 GHz to 2.66 GHz and 1.3 dB gain drop when using overlapping metallic plates instead of continuous ground plane. The total antenna thickness is approximately lambda/24.

  4. Barium Titanate Nanoparticles: Highly Cytocompatible Dispersions in Glycol-chitosan and Doxorubicin Complexes for Cancer Therapy

    Science.gov (United States)

    Ciofani, Gianni; Danti, Serena; D'Alessandro, Delfo; Moscato, Stefania; Petrini, Mario; Menciassi, Arianna

    2010-07-01

    In the latest years, innovative nanomaterials have attracted a dramatic and exponentially increasing interest, in particular for their potential applications in the biomedical field. In this paper, we reported our findings on the cytocompatibility of barium titanate nanoparticles (BTNPs), an extremely interesting ceramic material. A rational and systematic study of BTNP cytocompatibility was performed, using a dispersion method based on a non-covalent binding to glycol-chitosan, which demonstrated the optimal cytocompatibility of this nanomaterial even at high concentration (100 μg/ml). Moreover, we showed that the efficiency of doxorubicin, a widely used chemotherapy drug, is highly enhanced following the complexation with BTNPs. Our results suggest that innovative ceramic nanomaterials such as BTNPs can be realistically exploited as alternative cellular nanovectors.

  5. Chemical bonding and charge density distribution analysis of undoped and lanthanum doped barium titanate ceramics

    Indian Academy of Sciences (India)

    J MANGAIYARKKARASI; R SARAVANAN; MUKHLIS M ISMAIL

    2016-12-01

    A-site deficient, Lanthanum substituted Ba1−xLa2x/3TiO3 (x=0.000, 0.005, 0.015, 0.020 and 0.025) ceramics have been synthesized by chemical route. The effects of lanthanum dopant on the BaTiO3 lattice and the electron density distributions in the unit cell of the samples were investigated. Structural studies suggested the reduction in cell parameters and shrinkage in cell volume with the increase in lanthanum content. Chemical bonding and electron density distributions were examined through high resolution maximum entropy method (MEM). The mid bond electron density values revealed the enhancement of covalent nature between titanium and oxygen ions and predominant ionic nature between barium and oxygen ions. Average grain sizes were estimated for the undoped and doped samples. SEM investigations showed the existence of smaller grains with large voids in between them.

  6. Characterizations of strontium(II) and barium(II) adsorption from aqueous solutions using dolomite powder.

    Science.gov (United States)

    Ghaemi, Ahad; Torab-Mostaedi, Meisam; Ghannadi-Maragheh, Mohammad

    2011-06-15

    In this research, adsorption technique was applied for strontium and barium removal from aqueous solution using dolomite powder. The process has been investigated as a function of pH, contact time, temperature and adsorbate concentration. The experimental data was analyzed using equilibrium isotherm, kinetic and thermodynamic models. The isotherm data was well described by Langmuir isotherm model. The maximum adsorption capacity was found to be 1.172 and 3.958 mg/g for Sr(II) and Ba(II) from the Langmuir isotherm model at 293 K, respectively. The kinetic data was tested using first and pseudo-second order models. The results indicated that adsorption fitted well with the pseudo-second order kinetic model. The thermodynamic parameters (ΔG°, ΔH°, and ΔS°) were also determined using the equilibrium constant value obtained at different temperatures. The results showed that the adsorption for both ions was feasible and exothermic.

  7. Effective removal of methyl blue by fine-structured strontium and barium phosphate nanorods

    Science.gov (United States)

    Zhang, Fan; Song, Weijie; Lan, Jing

    2015-01-01

    In this work, the composite of strontium phosphate and barium phosphate (called SBP) nanorods have been synthesized, characterized and studied for removal of methyl blue (MB). The effects of pH, temperature, contact time, initial dye concentration on removal of MB were studied in detail. Results suggest that pH and temperature were not critical limiting factors for the removal of MB. Reaching equilibrium was very rapid (within 10 min) and the high adsorption capacity of MB by SBP nanorods was 1691.8 mg/g at initial dye concentration of 2000 mg/L. The adsorption process obeyed the pseudo-second-order kinetics model and Langmuir isotherm model. Importantly, the mechanism contributed to the MB removal was proposed to be the ionic interaction and hydrogen bonds for low dye concentration, chemical precipitation for high dye concentration. It is predicted that the SBP nanorods being an effective adsorbent for elimination of MB from colored aqueous solutions.

  8. Remarkable magnetic enhancement of type-M hexaferrite of barium in polystyrene polymer

    Directory of Open Access Journals (Sweden)

    Adly H. El-Sayed

    2015-10-01

    Full Text Available We demonstrate that the promising effect of inclusion of single magnetic-domain type-M hexaferrite of barium (BaM particles in polystyrene (PS polymer (BaM/PS weight ratio = 2/1. The results show that the coercivity of BaM particles remarkably increases from 714 to 3772 Oe and remanence increases from 2.07 to 5.41 emu.g−1 when they embedded into PS. Moreover, magnetic coercivity and squareness of the BaM-PS are significantly larger, and is comparable with corresponding values of other BaM-polymer composites. Therefore, BaM-PS composite enforce itself as the modern potential materials with tendency of replacing existing composite materials in several applications.

  9. Investigation of thickness effects on the dielectric constant barium strontium titanate thin films

    CERN Document Server

    Grattan, L J

    2002-01-01

    The collapse in dielectric constant at small thickness commonly observed in ferroelectric thin films was measured and investigated in barium strontium titanate (Ba sub 0 sub . sub 5 Sr sub 0 sub . sub 5 TiO sub 3). The possible mechanisms responsible for this effect are reviewed. Functional measurements were performed on BST thin films, of 7.5 to 950 nm, by incorporating them into capacitor structures with bottom electrodes of strontium ruthenate (SRO) and thermally- evaporated Au top electrodes. A discussion on thin film growth considerations, optimal PLD conditions and the measurement techniques employed in the project is presented. The experimentally determined dielectric constant - thickness profile was fitted using the series capacitor model assuming low dielectric constant interfacial layers in series with the bulk. Consideration of the case where the combined 'dead layer' thickness was close to the total BST thickness revealed that, for this system, the total 'dead layer' thickness had to be less than ...

  10. Barium ferrite/epoxy resin nanocomposite system: Fabrication, dielectric, magnetic and hydration studies

    Directory of Open Access Journals (Sweden)

    A. Kanapitsas

    2016-03-01

    Full Text Available Composite systems of epoxy resin and barium ferrite nanoparticles have been prepared, and studied varying the content of the inclusions. Morphology of prepared samples has been examined via scanning electron microscopy and X-ray diffraction spectra, while electrical and magnetic properties were investigated by means of broadband dielectric spectroscopy, and magnetization tests respectively. Finally, water vapor sorption measurements were conducted in order to study the water sorption dynamics of the system. Electron microscopy images revealed the successful fabrication of nanocomposites. Dielectric permittivity increases with filler content, while three relaxation processes were detected in the relative spectra. These processes are attributed to interfacial polarization, glass to rubber transition of the matrix, and re-orientation of polar side groups of the polymer’s chain. Magnetization and magnetic saturation increase with magnetic nano-powder content. Nanocomposites absorb a small amount of water, not exceeding 1.7 wt%, regardless filler content, indicating their hydrophobic character.

  11. Techniques for the measurements of the line of sight velocity of high altitude Barium clouds

    Science.gov (United States)

    Mende, S. B.

    1981-01-01

    It is demonstrated that for maximizing the scientific output of future ion cloud release experiments a new type of instrument is required which will measure the line of sight velocity of the ion cloud by the Doppler Technique. A simple instrument was constructed using a 5 cm diameter solid Fabry-Perot etalon coupled to a low light level integrating television camera. It was demonstrated that the system has both the sensitivity and spectral resolution for the detection of ion clouds and the measurement of their line of sight Doppler velocity. The tests consisted of (1) a field experiment using a rocket barium cloud release to check the sensitivity, (2) laboratory experiments to show the spectral resolving capabilities of the system. The instrument was found to be operational if the source was brighter than about 1 kilorayleigh and it had a wavelength resolution much better than .2A which corresponds to about 12 km/sec or an acceleration potential of 100 volts.

  12. The origin of barium in the Cambrian–Vendian aquifer system, North Estonia

    Directory of Open Access Journals (Sweden)

    Mokrik, Robert

    2009-09-01

    Full Text Available Identification of the barium occurrence and its origin is made on the basis of the groundwater chemistry study. High Ba content has been detected in the Cambrian–Vendian aquifer system in the coastal vicinity of the Gulf of Finland in Estonia and St Petersburg. The dissolution of Ba from witherite as the primary source was derived from the analysis of the aqueous solution equilibrium with Ba-related minerals. It is reflected in the chemical composition of groundwater and influenced by the galenite–calcite–fluorite polymetallic mineralization in Vendian sandstones. The dissolution and re-deposition of carbonates and baryte are confirmed by mineral saturation states for an aqueous solution and distribution of other species in the groundwater of the Cambrian–Vendian aquifer system in North Estonia.

  13. Poly (vinylidene fluoride-trifluoroethylene/barium titanate nanocomposite for ferroelectric nonvolatile memory devices

    Directory of Open Access Journals (Sweden)

    Uvais Valiyaneerilakkal

    2013-04-01

    Full Text Available The effect of barium titanate (BaTiO3 nanoparticles (particle size <100nm on the ferroelectric properties of poly (vinylidenefluoride-trifluoroethylene P(VDF-TrFE copolymer has been studied. Different concentrations of nanoparticles were added to P(VDF-TrFE using probe sonication, and uniform thin films were made. Polarisation - Electric field (P-E hysteresis analysis shows an increase in remnant polarization (Pr and decrease in coercive voltage (Vc. Piezo-response force microscopy analysis shows the switching capability of the polymer composite. The topography and surface roughness was studied using atomic force microscopy. It has been observed that this nanocomposite can be used for the fabrication of non-volatile ferroelectric memory devices.

  14. 42 CFR Appendix A to Part 130 - Definition of HIV Infection or HIV

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Definition of HIV Infection or HIV A Appendix A to... PAYMENTS RICKY RAY HEMOPHILIA RELIEF FUND PROGRAM Pt. 130, App. A Appendix A to Part 130—Definition of HIV Infection or HIV ER31MY00.000 ER31MY00.001...

  15. 21 CFR 130.8 - Conformity to definitions and standards of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Conformity to definitions and standards of identity. 130.8 Section 130.8 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... Conformity to definitions and standards of identity. In the following conditions, among others, a food...

  16. 42 CFR 413.130 - Introduction to capital-related costs.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Introduction to capital-related costs. 413.130 Section 413.130 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... depreciable assets under § 413.134(f). (2) Taxes on land or depreciable assets used for patient care....

  17. Biosynthesis of 130-kilodalton mosquito larvicide in the cyanobacterium Agmenellum quadruplicatum PR-6.

    OpenAIRE

    Angsuthanasombat, C; Panyim, S

    1989-01-01

    The 130-kilodalton mosquito larvicidal gene, cloned from Bacillus thuringiensis var. israelensis, was introduced into the cyanobacterium Agmenellum quadruplicatum PR-6 by plasmid transformation. Transformed cells synthesized 130-kilodalton delta-endotoxin protein and showed mosquito larvicidal activity. Results demonstrate a potential use of a cyanobacterium for biological control of mosquitoes.

  18. Biosynthesis of 130-kilodalton mosquito larvicide in the cyanobacterium Agmenellum quadruplicatum PR-6.

    Science.gov (United States)

    Angsuthanasombat, C; Panyim, S

    1989-09-01

    The 130-kilodalton mosquito larvicidal gene, cloned from Bacillus thuringiensis var. israelensis, was introduced into the cyanobacterium Agmenellum quadruplicatum PR-6 by plasmid transformation. Transformed cells synthesized 130-kilodalton delta-endotoxin protein and showed mosquito larvicidal activity. Results demonstrate a potential use of a cyanobacterium for biological control of mosquitoes.

  19. 21 CFR 573.130 - Aminoglycoside 3′-phospho- transferase II.

    Science.gov (United States)

    2010-04-01

    ... genetically modified cotton, oilseed rape, and tomatoes in accordance with the following prescribed conditions... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aminoglycoside 3â²-phospho- transferase II. 573.130 Section 573.130 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...

  20. 21 CFR 130.6 - Review of Codex Alimentarius food standards.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Review of Codex Alimentarius food standards. 130.6... (CONTINUED) FOOD FOR HUMAN CONSUMPTION FOOD STANDARDS: GENERAL General Provisions § 130.6 Review of Codex Alimentarius food standards. (a) All food standards adopted by the Codex Alimentarius Commission will...

  1. 31 CFR 1.30 - Application to system of records maintained by Government contractors.

    Science.gov (United States)

    2010-07-01

    ... by Government contractors. When a component contracts for the operation of a system of records, to... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Application to system of records maintained by Government contractors. 1.30 Section 1.30 Money and Finance: Treasury Office of the...

  2. 40 CFR 436.130 - Applicability; description of the borax subcategory.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Applicability; description of the borax subcategory. 436.130 Section 436.130 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY...

  3. 46 CFR 130.220 - Design of equipment for cooking and heating.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Design of equipment for cooking and heating. 130.220 Section 130.220 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS... Design of equipment for cooking and heating. (a) Doors on each cooking appliance must be provided...

  4. 20 CFR 404.130 - How we determine disability insured status.

    Science.gov (United States)

    2010-04-01

    .... 404.130 Section 404.130 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS... quarters of coverage (QCs) you need to be fully insured). (b) Rule I—You must meet the 20/40 requirement... may be paid or increased under Rule III before May 1983. (e) Rule IV—You are statutorily blind....

  5. 46 CFR 130.140 - Steering on OSVs of 100 or more gross tons.

    Science.gov (United States)

    2010-10-01

    ... hydraulic-helm steering-system in paragraph (b) of this section. (b) Each hydraulic-helm steering-system... the vessel at every service speed without being damaged at maximum astern speed. (2) A hydraulic... stops. (6) Either— (i) Two steering pumps in accordance with § 130.130(c)(3) of this part; or (ii)...

  6. 49 CFR 393.130 - What are the rules for securing heavy vehicles, equipment and machinery?

    Science.gov (United States)

    2010-10-01

    ..., equipment and machinery? 393.130 Section 393.130 Transportation Other Regulations Relating to Transportation... heavy vehicles, equipment and machinery? (a) Applicability. The rules in this section apply to the transportation of heavy vehicles, equipment and machinery which operate on wheels or tracks, such as front...

  7. Catalytic activity of Mn-substituted barium hexaaluminates for methane combustion

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The catalysts of hexaaluminate (BaMnxAl12-xO19-δ , x = 1.0, 2.0, 3.0, 4.0) to be used in methane combustion have been successfully synthesized by co-precipitation method and supercritical drying. The crystalline structure and surface area of catalyst were characterized by X-ray diffraction (XRD) and nitrogen adsorption analysis of BET method. BET analysis revealed that the preparing and drying method proposed here provides stable materials with higher surface area of 51.4 m2/g in comparison to materials prepared using conventional ambient drying method for BaMnxAl12?xO19-δ calcined at 1200℃ under oxygen. XRD analysis indicated that formation of a pure single phase BaMnxAl12-xO19-δ occurred up to x = 3 in the case of Mn-substituted barium hexaaluminates. Incorporation of Mn in excess leads to BaAl2O4 phase formation. As far as the valence state of Manganese ions was concerned, the introduced Mn ions were either divalent or trivalent. The first Mn ions were introduced in the matrix essentially as Mn2+ and only for BaMn3Al9O19-δ does manganese exist exclusively as Mn3+; the higher the Mn concen- tration, the higher the proportion of Mn3+. Catalytic activity for methane combustion has been measured for Mn-substituted barium hexaaluminates, light-off temperature was observed in the 512-624℃ range. The highest activity was obtained for catalysts containing 3 Mn ions per unit cell, which reveals that the BaMnxAl12-xO19-δ catalyst was a promising methane combustion catalyst with high activity and good thermal stability. Temperature programmed reduction (TPR) under hydrogen has been used to correlate the catalytic activity with the amount of easily reducible species.

  8. Boar sperm changes after sorting and encapsulation in barium alginate membranes.

    Science.gov (United States)

    Spinaci, M; Bucci, D; Chlapanidas, T; Vallorani, C; Perteghella, S; Communod, R; Vigo, D; Tamanini, C; Galeati, G; Faustini, M; Torre, M L

    2013-09-15

    A routine use of boar-sexed semen is limited by the long sorting time necessary to obtain an adequate number of sexed spermatozoa for artificial insemination and by the high susceptibility of spermatozoa of this species to damages induced by sorting procedure and subsequent cryopreservation. The aim of this work was to study the impact of encapsulation in barium alginate membrane on sorted boar spermatozoa by evaluating membrane integrity, chlortetracycline staining patterns, protein tyrosine phosphorylation, and Hsp70 immunolocalization during storage over 72 hours in liquid or encapsulated form. The encapsulation procedure significantly (P < 0.05) decreased the overall membrane integrity of control unsorted semen (81.8 vs. 57.4, CTR vs. CPS), but did not negatively affect the overall viability and the chlortetracycline staining patterns of sorted encapsulated cells. Moreover, encapsulation significantly decreased (P < 0.05) the overall phosphotyrosin A pattern cell percentage in unsorted (98.4 vs. 92.6, CTR vs. CPS) but not in sorted semen (64.0 vs. 74.2; SORT CTR vs. SORT CPS). As for Hsp70, the overall percentage of cells displaying the different patterns was significantly influenced (P < 0.05) by treatment but not by storage time. The sorting procedure seems to induce the major changes, whereas encapsulation tends to exert a protective effect on sorted semen by increasing the percentage of spermatozoa displaying the T pattern (2.8 vs. 24.3; SORT CTR vs. SORT CPS). In conclusion, our data confirm that the damaging impact of the encapsulation in barium alginate capsules seems to be limited when compared with that of the sorting procedure and, moreover, the association of the two procedures does not result in an algebraic sum of the negative effects. These results suggest the possibility of a future utilization of the encapsulation technology in order to store sorted spermatozoa and permit their controlled release in the female genital tract.

  9. Kinetic and structural analyses for the formation of anatase nanocrystals in barium titanoborate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Jong Youn; Sung, Yun-Mo, E-mail: ymsung@korea.ac.kr

    2015-10-25

    Transparent barium titanoborate glass-ceramics bearing TiO{sub 2} (anantase) nanocrystals were prepared by the conventional melt-quenching and subsequent heat treatment of 35BaO–xTiO{sub 2}–110B{sub 2}O{sub 3} (in mol) (x = 20, 25, and 30) glasses. X-ray diffraction (XRD) and high-resolution transmission electron microscopy (HRTEM) results clearly reveal the formation of highly-crystalline anatase nanocrystals in glass matrices. The average crystal size ranges from ∼10 to 20 nm according to TiO{sub 2} contents. Non-isothermal kinetic analyses were performed to understand the crystallization behavior of each glass using differential scanning calorimetry (DSC) scan curves. With the increase of TiO{sub 2} contents in the glass, the crystallization peak temperature of TiO{sub 2} decreases, while the activation energy for crystallization increases. We propose a possible mechanism for the formation of TiO{sub 2} nanocrystals based upon kinetic analysis results and structural changes in barium titanoborate glass matrices according to TiO{sub 2} contents. The nanocrystalline glass-ceramics show ∼60–75% visible light transmittance and sharp UV-light absorption edges at ∼387 nm, corresponding to the energy band gap of anatase (3.2 eV). They show apparent photocatalytic properties and ∼70% of methylene blue solution was decomposed within 180 min. - Highlights: • The first report on the TiO{sub 2} nanocrystal formation mechanism in borate glasses. • TiO{sub 2} seems not to be involved in the borate glass network forming. • Crystallization temperature increases and activation E decreases with TiO{sub 2} content. • Increasing number of non-bridging oxygens affect the crystallization kinetics. • UV-light blocking and photocatalytic properties were identified for glass-ceramics.

  10. Preparation of meta-stable phases of barium titanate by Sol-hydrothermal method

    Directory of Open Access Journals (Sweden)

    Mahalakshmi Selvaraj

    2015-11-01

    Full Text Available Two low-cost chemical methods of sol–gel and the hydrothermal process have been strategically combined to fabricate barium titanate (BaTiO3 nanopowders. This method was tested for various synthesis temperatures (100 °C to 250 °C employing barium dichloride (BaCl2 and titanium tetrachloride (TiCl4 as precursors and sodium hydroxide (NaOH as mineralizer for synthesis of BaTiO3 nanopowders. The as-prepared BaTiO3 powders were investigated for structural characteristics using x-ray diffraction (XRD, scanning electron microscopy (SEM and transmission electron microscopy (TEM. The overall analysis indicates that the hydrothermal conditions create a gentle environment to promote the formation of crystalline phase directly from amorphous phase at the very low processing temperatures investigated. XRD analysis showed phase transitions from cubic - tetragonal - orthorhombic - rhombohedral with increasing synthesis temperature and calculated grain sizes were 34 – 38 nm (using the Scherrer formula. SEM and TEM analysis verified that the BaTiO3 nanopowders synthesized by this method were spherical in shape and about 114 - 170 nm in size. The particle distribution in both SEM and TEM shows that as the reaction temperature increases from 100 °C to 250 °C, the particles agglomerate. Selective area electron diffraction (SAED shows that the particles are crystalline in nature. The study shows that choosing suitable precursor and optimizing pressure and temperature; different meta-stable (ferroelectric phases of undoped BaTiO3 nanopowders can be stabilized by the sol-hydrothermal method.

  11. The mass-ratio and eccentricity distributions of barium and S stars, and red giants in open clusters

    Science.gov (United States)

    Van der Swaelmen, M.; Boffin, H. M. J.; Jorissen, A.; Van Eck, S.

    2017-01-01

    Context. A complete set of orbital parameters for barium stars, including the longest orbits, has recently been obtained thanks to a radial-velocity monitoring with the HERMES spectrograph installed on the Flemish Mercator telescope. Barium stars are supposed to belong to post-mass-transfer systems. Aims: In order to identify diagnostics distinguishing between pre- and post-mass-transfer systems, the properties of barium stars (more precisely their mass-function distribution and their period-eccentricity (P-e) diagram) are compared to those of binary red giants in open clusters. As a side product, we aim to identify possible post-mass-transfer systems among the cluster giants from the presence of s-process overabundances. We investigate the relation between the s-process enrichment, the location in the (P-e) diagram, and the cluster metallicity and turn-off mass. Methods: To invert the mass-function distribution and derive the mass-ratio distribution, we used the method pioneered by Boffin et al. (1992) that relies on a Richardson-Lucy deconvolution algorithm. The derivation of s-process abundances in the open-cluster giants was performed through spectral synthesis with MARCS model atmospheres. Results: A fraction of 22% of post-mass-transfer systems is found among the cluster binary giants (with companion masses between 0.58 and 0.87 M⊙, typical for white dwarfs), and these systems occupy a wider area than barium stars in the (P-e) diagram. Barium stars have on average lower eccentricities at a given orbital period. When the sample of binary giant stars in clusters is restricted to the subsample of systems occupying the same locus as the barium stars in the (P-e) diagram, and with a mass function compatible with a WD companion, 33% (=4/12) show a chemical signature of mass transfer in the form of s-process overabundances (from rather moderate - about 0.3 dex - to more extreme - about 1 dex). The only strong barium star in our sample is found in the cluster with

  12. 130 años, Presencia de la Academia.

    Directory of Open Access Journals (Sweden)

    Efraím Otero Ruiz

    2003-09-01

    Full Text Available

    El mes de agosto conmemora la Academia Nacional de Medicina, en ceremonia especial, sus 130 años de fundada. Efectivamente, el 3 de enero de 1873 se reunieron en Bogotá, en casa del Dr. Abraham Aparicio los fundadores, doctores Manuel Plata Azuero, Nicolás Osorio, Liborio Zerda, Leoncio Barreto, Evaristo García y el dueño de casa para crear una sociedad “para el estudio y adelanto de las ciencias médicas y naturales”, teniendo como objetivo adicional “el de solidarizar al cuerpo médico y darle unidad al ejercicio profesional, en Bogotá y después en el resto del país”.

    Como Presidente y Secretario se eligieron al Dr. Plata Azuero y al Dr. Aparicio, encargando al Dr. Zerda la elaboración del proyecto de reglamento. En la segunda reunión, que declaró formalmente establecida la Sociedad de Medicina y Ciencias Naturales, concurrieron además los doctores Julio A. Corredor, Samuel Fajardo, Proto Gómez, Andrés María Pardo, Bernardino Medina, Policarpo Pizarro, Pío Rengifo, Rafael Rocha Castilla, Federico Rivas, Joaquín Sarmiento y Antonio Ospina como médicos, asistiendo como naturalista el Sr. Francisco Montoya.

    Adoptaron el reglamento elaborado por el Dr. Zerda y continuaron reuniéndose mensualmente; en julio 2 de 1873 apareció el primer número de la Revista Médica (hoy “Medicina” que, con algunas interrupciones, continuaría publicándose hasta nuestros días.

    Diecisiete años después, en noviembre de 1890, el presidente Carlos Holguín sancionó la Ley 71 de 1890 en que se creaba, con base en la antigua Sociedad, la Academia Nacional de Medicina, cuyo primer Presidente fue el Dr. José María Buendía.

    La Academia fue formalmente instalada por el Presidente Holguín en Abril de 1891 y desde entonces ha venido sesionando en forma ininterrumpida por más de un siglo, cumpliendo la función asesora en materias de salud que le fuera otorgada desde su creación y le fuera ratificada por la

  13. Investigation of the lasing characteristics of a barium vapor laser with pulse repetition frequencies up to 320 kHz for navigation

    Science.gov (United States)

    Soldatov, A. N.; Polunin, Yu. P.

    2015-11-01

    Results of experimental investigations into the characteristics of a laser on self-terminating transitions of the barium atom with λ = 1499 nm are presented for high pulse repetition frequencies (PRF). The frequency-energy characteristics are investigated in the self-heating mode of laser operation. Record values of PRF for the barium vapor laser, equal to ~320 kHz, have been attained.

  14. Host protein Snapin interacts with human cytomegalovirus pUL130 and affects viral DNA replication

    Indian Academy of Sciences (India)

    Guili Wang; Gaowei Ren; Xin Cui; Yanpin Ma; Ying Qi; Yujing Huang; Zhongyang Liu; Zhengrong Sun; Qiang Ruan

    2016-06-01

    The interplay between the host and Human cytomegalovirus (HCMV) plays a pivotal role in the outcome of an infection. HCMV growth in endothelial and epithelial cells requires expression of viral proteins UL128, UL130, and UL131 proteins (UL128-131), of which UL130 is the largest gene and the only one that is not interrupted by introns. Mutation of the C terminus of the UL130 protein causes reduced tropism of endothelial cells (EC). However, very few host factors have been identified that interact with the UL130 protein. In this study, HCMV UL130 protein was shown to directly interact with the human protein Snapin in human embryonic kidney HEK293 cells by Yeast two-hybrid screening, in vitro glutathione S-transferase (GST) pull-down, and co-immunoprecipitation. Additionally, heterologous expression of protein UL130 revealed co-localization with Snapin in the cell membrane and cytoplasm of HEK293 cells using fluorescence confocal microscopy. Furthermore, decreasing the level of Snapin via specific small interfering RNAs decreased the number of viral DNA copies and titer in HCMV-infected U373-S cells. Taken together, these results suggest that Snapin, the pUL130 interacting protein, has a role in modulating HCMV DNA synthesis.

  15. XB130 translocation to microfilamentous structures mediates NNK-induced migration of human bronchial epithelial cells.

    Science.gov (United States)

    Wu, Qifei; Nadesalingam, Jeya; Moodley, Serisha; Bai, Xiaohui; Liu, Mingyao

    2015-07-20

    Cigarette smoking contributes to the pathogenesis of chronic obstructive pulmonary disease and lung cancer. Nicotine-derived nitrosamine ketone (NNK) is the most potent carcinogen among cigarette smoking components, and is known to enhance migration of cancer cells. However, the effect of NNK on normal human bronchial epithelial cells is not well studied. XB130 is a member of actin filament associated protein family and is involved in cell morphology changes, cytoskeletal rearrangement and outgrowth formation, as well as cell migration. We hypothesized that XB130 mediates NNK-induced migration of normal human bronchial epithelial cells. Our results showed that, after NNK stimulation, XB130 was translocated to the cell periphery and enriched in cell motility-associated structures, such as lamellipodia, in normal human bronchial epithelial BEAS2B cells. Moreover, overexpression of XB130 significantly enhanced NNK-induced migration, which requires both the N- and C-termini of XB130. Overexpression of XB130 enhanced NNK-induced protein tyrosine phosphorylation and promoted matrix metalloproteinase-14 translocation to cell motility-associated cellular structures after NNK stimulation. XB130-mediated NNK-induced cell migration may contribute to airway epithelial repair; however, it may also be involved in cigarette smoking-related chronic obstructive pulmonary disease and lung cancer.

  16. Host protein Snapin interacts with human cytomegalovirus pUL130 and affects viral DNA replication.

    Science.gov (United States)

    Wang, Guili; Ren, Gaowei; Cui, Xin; Lu, Zhitao; Ma, Yanpin; Qi, Ying; Huang, Yujing; Liu, Zhongyang; Sun, Zhengrong; Ruan, Qiang

    2016-06-01

    The interplay between the host and Human cytomegalovirus (HCMV) plays a pivotal role in the outcome of an infection. HCMV growth in endothelial and epithelial cells requires expression of viral proteins UL128, UL130, and UL131 proteins (UL128-131), of which UL130 is the largest gene and the only one that is not interrupted by introns.Mutation of the C terminus of the UL130 protein causes reduced tropism of endothelial cells (EC). However, very few host factors have been identified that interact with the UL130 protein. In this study, HCMV UL130 protein was shown to directly interact with the human protein Snapin in human embryonic kidney HEK293 cells by Yeast two-hybrid screening, in vitro glutathione S-transferase (GST) pull-down, and co-immunoprecipitation. Additionally, heterologous expression of protein UL130 revealed co-localization with Snapin in the cell membrane and cytoplasm of HEK293 cells using fluorescence confocal microscopy. Furthermore, decreasing the level of Snapin via specific small interfering RNAs decreased the number of viral DNA copies and titer inHCMV-infected U373-S cells. Taken together, these results suggest that Snapin, the pUL130 interacting protein, has a role in modulating HCMV DNA synthesis.

  17. The MicroRNA-130/301 Family Controls Vasoconstriction in Pulmonary Hypertension*

    Science.gov (United States)

    Bertero, Thomas; Cottrill, Katherine; Krauszman, Adrienn; Lu, Yu; Annis, Sofia; Hale, Andrew; Bhat, Balkrishen; Waxman, Aaron B.; Chau, B. Nelson; Kuebler, Wolfgang M.; Chan, Stephen Y.

    2015-01-01

    Pulmonary hypertension (PH) is a complex disorder, spanning several known vascular cell types. Recently, we identified the microRNA-130/301 (miR-130/301) family as a regulator of multiple pro-proliferative pathways in PH, but the true breadth of influence of the miR-130/301 family across cell types in PH may be even more extensive. Here, we employed targeted network theory to identify additional pathogenic pathways regulated by miR-130/301, including those involving vasomotor tone. Guided by these predictions, we demonstrated, via gain- and loss-of-function experimentation in vitro and in vivo, that miR-130/301-specific control of the peroxisome proliferator-activated receptor γ regulates a panel of vasoactive factors communicating between diseased pulmonary vascular endothelial and smooth muscle cells. Of these, the vasoconstrictive factor endothelin-1 serves as an integral point of communication between the miR-130/301-peroxisome proliferator-activated receptor γ axis in endothelial cells and contractile function in smooth muscle cells. Thus, resulting from an in silico analysis of the architecture of the PH disease gene network coupled with molecular experimentation in vivo, these findings clarify the expanded role of the miR-130/301 family in the global regulation of PH. They further emphasize the importance of molecular cross-talk among the diverse cellular populations involved in PH. PMID:25505270

  18. catena-Poly[[(pentaaqua)(4-nitrobenzoato-O,O')barium(II)] (-4-nitrobenzoato-O,O')]: A barium(II) coordination polymer showing O-H$\\cdots$O and C-H$\\cdots$O interactions

    Indian Academy of Sciences (India)

    Bikshandarkoil R Srinivasan; Jyoti V Sawant; Sarvesh C Sawant; Pallepogu Raghavaiah

    2007-11-01

    The reaction of barium carbonate with 4-nitrobenzoic acid (4-nbaH) results in the formation of a Ba(II) coordination polymer, catena-poly[[(pentaaqua)(4-nitrobenzoato-O,O')barium(II)](-4-nitrobenzoato-O,O')] 1. The polymeric compound [[Ba(H2O)5(4-nba-O,O')](-4-nba-O,O')] 1 was characterized by elemental analysis, IR and UV-Vis spectra, weight loss studies, X-ray powder diffraction and its structure determined. In 1 five water molecules are coordinated to the central metal and one of the 4-nba ligands is bonded to Ba(II) in a bidentate manner (4-nba-O,O') through the carboxylate O atoms. The [(pentaaqua)(4-nitrobenzoato-O,O')barium(II)] units are linked into an infinite one-dimensional chain along -axis with the aid of the second 4-nba anion, which functions as a bridging bidentate (-4-nba-O,O') ligand. This results in nine coordination around each Ba(II) ion in the coordination polymer. A long Ba$\\cdots$Ba distance of 6.750(1) Å is observed between adjacent Ba(II) ions in the chain and the oxygen atoms of the carboxylate group and the nitro functionalities of the 4-nba ligand are involved in several O-H$\\cdots$O and C-H$\\cdots$O interactions.

  19. 130 LPW 1000 Lm Warm White LED for Illumination

    Energy Technology Data Exchange (ETDEWEB)

    Soer, Wouter [Philips Lumileds Lighting Company LLC, San Jose, CA (United States)

    2012-12-21

    An illumination-grade warm-white LED, having correlated color temperature (CCT) between 2700 and 3500 K and capable of producing 1000 lm output at over 130 lm/W at room temperature, has been developed in this program. The high-power warm-white LED is an ideal source for use in indoor and outdoor lighting applications. Over the two year period, we have made the following accomplishments: • Developed a low-cost high-power white LED package and commercialized a series of products with CCT ranging from 2700 to 5700 K under the product name LUXEON M; • Demonstrated a record efficacy of 124.8 lm/W at a flux of 1023 lm, CCT of 3435 K and color rendering index (CRI) over 80 at room temperature in the productized package; • Demonstrated a record efficacy of 133.1 lm/W at a flux of 1015 lm, CCT of 3475 K and CRI over 80 at room temperature in an R&D package. The new high-power LED package is a die-on-ceramic surface mountable LED package. It has four 2 mm2 InGaN pump dice, flip-chip attached to a ceramic submount in a 2x2 array configuration. The submount design utilizes a design approach that combines a high-thermal- conductivity ceramic core for die attach and a low-cost and low-thermal-conductivity ceramic frame for mechanical support and as optical lens carrier. The LED package has a thermal resistance of less than 1.25 K/W. The white LED fabrication also adopts a new batch level (instead of die-by-die) phosphor deposition process with precision layer thickness and composition control, which provides not only tight color control, but also low cost. The efficacy performance goal was achieved through the progress in following key areas: (1) high-efficiency royal blue pump LED development through active region design and epitaxial growth quality improvement (funded by internal programs); (2) improvement in extraction efficiency from the LED package through improvement of InGaN-die-level and package-level optical extraction efficiency; and (3) improvement in phosphor

  20. Sol-gel synthesis of macroporous barium zirconate monoliths from ionic precursors via a phase separation route

    Science.gov (United States)

    Guo, Xingzhong; Wang, Zichen; Song, Jie; Yang, Hui

    2017-03-01

    Monolithic macroporous barium zirconate derived from ionic precursors has been successfully prepared via a phase separation route in the presence of poly(ethylene oxide) (PEO) and propyleneoxide (PO). Poly(ethylene oxide) (PEO) acts as a phase separation inducer, while propyleneoxide (PO) acts as a gelation accelerant in the sol-gel process. Appropriate choice of poly(ethylene oxide) (PEO) and propyleneoxide (PO) allows the production of continuous macroporous monolithic gel with a porosity of ca. 63% and a macropore size of 1.8 μm. Some BaCl2 recrystallizes in the dried gel, and subsequently tetragonal ZrO2 phase precipitates after heat-treated at 800 °C. The crystalline phase barium zirconate forms after heat treatment at 1100 °C in air, while the macroporous structure is preserved with a slight increase of porosity and a decrease of macropore size.

  1. Solid state (47,49)Ti, (87)Sr and (137)Ba NMR characterisation of mixed barium/strontium titanate perovskites.

    Science.gov (United States)

    Gervais, Christel; Veautier, Delphine; Smith, Mark E; Babonneau, Florence; Belleville, Philippe; Sanchez, Clément

    2004-01-01

    Solid state (47,49)Ti, (137)Ba, (87)Sr NMR spectra have been recorded on BaxSrl-xTiO3 (0 strontium) in the coordination second sphere of the probed titanium site: substitution of strontium by barium induces the broadening of the peaks, due to quadrupolar effects, while the isotropic chemical shift increases. (137)Ba NMR spectra exhibit a distribution of the quadrupolar interaction, that could be tentatively quantified, CQ increasing with the amount of strontium. Preliminary results were also obtained on (87)Sr NMR showing behaviour comparable to (137)Ba NMR, i.e. a broadening of the peaks due to an increasing quadrupolar interaction with the amount of barium distorting the environment of the strontium sites.

  2. Enhanced reflection loss and permittivity of self assembled Mg-Co-Zr substituted barium ferrite dot array on carbon nanotube

    Energy Technology Data Exchange (ETDEWEB)

    Ghasemi, Ali, E-mail: ali13912001@yahoo.com [Materials Engineering Department, Malek Ashtar University of Technology, Shahin Shahr (Iran, Islamic Republic of)

    2012-03-15

    In this research work, magnetic multi-walled carbon nanotube (MWCNTs) nanocomposites have been created by the assembly of Mg-Co-Zr substituted barium ferrite film onto the surface of MWCNTs. Microwave absorption of the MWCNTs/doped barium ferrite nanocomposites is evidently enhanced compared to that of pure MWCNTs and substituted ferrites. The maximum reflection loss increased significantly with an increase in volume percentage of MWCNTs. Reflection loss evaluations indicated that nanocomposites display a great potential application as thinner and lighter wide-band electromagnetic wave absorbers. - Highlights: Black-Right-Pointing-Pointer Ferrite dot array was formed on carbon nanotube by sol-gel method. Black-Right-Pointing-Pointer It was found that the volume percentage of carbon nanotube has remarkable influence on reflection loss characteristics. Black-Right-Pointing-Pointer Microwave measurements indicate that the synthesized nanocomposites could be employed as wide-band electromagnetic wave absorbers.

  3. Size effects of 109° domain walls in rhombohedral barium titanate single crystals—A molecular statics analysis

    Energy Technology Data Exchange (ETDEWEB)

    Endres, Florian, E-mail: florian.endres@ltm.uni-erlangen.de; Steinmann, Paul, E-mail: paul.steinmann@ltm.uni-erlangen.de [Department of Mechanical Engineering, University of Erlangen - Nuremberg, Paul-Gordan Str. 3, 91052 Erlangen (Germany)

    2016-01-14

    Ferroelectric functional materials are of great interest in science and technology due to their electromechanically coupled material properties. Therefore, ferroelectrics, such as barium titanate, are modeled and simulated at the continuum scale as well as at the atomistic scale. Due to recent advancements in related manufacturing technologies the modeling and simulation of smart materials at the nanometer length scale is getting more important not only to predict but also fundamentally understand the complex material behavior of such materials. In this study, we analyze the size effects of 109° nanodomain walls in ferroelectric barium titanate single crystals in the rhombohedral phase using a recently proposed extended molecular statics algorithm. We study the impact of domain thicknesses on the spontaneous polarization, the coercive field, and the lattice constants. Moreover, we discuss how the electromechanical coupling of an applied electric field and the introduced strain in the converse piezoelectric effect is affected by the thickness of nanodomains.

  4. Influnce of Stoichiometry and Molar Ratio of Barium Ferrite Thin Film Synthesized by Sol-gel on Alumina Substrate

    Institute of Scientific and Technical Information of China (English)

    AliGhasemi; M.R.Shams; A.Saatchi; M.Salehi; A.Hosseinpour

    2004-01-01

    Amorphous gels were processed with a varying Fe/Ba ratio of 11/5, 28/2, 10.5/1 in water and Solvent. Iron and barium nitrites with specific molar ratio was soloed in water and slovent at 60℃ for 3 hours untill a dark brown solution was prepared. The sols were introduced to substrate dropwise and spinning with 2000 rpm in 3 min was applied ; the work was repeated for 10 times and the samples were dried and sintered. The TGA analysis was used to identify the heating rate of the samples; at temperature of 1150℃ for one hour the final phase was attained, the thickness, uniformity, morphology and the composition were examined by SEM and XRD. The study shows that the fabrication barium ferrite film of the molar ratio of Fe/Ba=10.5/1 is much more suitable than other ratios.

  5. Influnce of Stoichiometry and Molar Ratio of Barium Ferrite Thin Film Synthesized by Sol-gel on Alumina Substrate

    Institute of Scientific and Technical Information of China (English)

    Ali Ghasemi; M.R. Shams; A.Saatchi; M.Salehi; A.Hosseinpour

    2004-01-01

    Amorphous gels were processed with a varying Fe/Ba ratio of 11/5, 28/2, 10.5/1 in water and Solvent. Iron and barium nitrites with specific molar ratio was solved in water and slovent at 60℃ for 3 hours untill a dark brown solution was prepared. The sols were introduced to substrate dropwise and spinning with 2000 rpm in 3 min was applied; the work was repeated for 10 times and the samples were dried and sintered. The TGA analysis was used to identify the heating rate of the samples; at temperature of 1150℃ for one hour the final phase was attained. the thickness, uniformity, morphology and the composition were examined by SEM and XRD. The study shows that the fabrication barium ferrite film of the molar ratio of Fe/Ba = 10.5/1 is much more suitable than other ratios.

  6. Change of nuclear configurations in the neutrinoless double-$\\beta$ decay of $^{130}$Te $\\rightarrow$ $^{130}$Xe and $^{136}$Xe $\\rightarrow$ $^{136}$Ba

    CERN Document Server

    Entwisle, J P; Tamii, A; Adachi, S; Aoi, N; Clark, J A; Freeman, S J; Fujita, H; Fujita, Y; Furuno, T; Hashimoto, T; Hoffman, C R; Ideguchi, E; Ito, T; Iwamoto, C; Kawabata, T; Liu, B; Miura, M; Ong, H J; Schiffer, J P; Sharp, D K; Süsoy, G; Suzuki, T; Szwec, S V; Takaki, M; Tsumura, M; Yamamoto, T

    2016-01-01

    The change in the configuration of valence protons between the initial and final states in the neutrinoless double-$\\beta$ decay of $^{130}$Te $\\rightarrow$ $^{130}$Xe and of $^{136}$Xe $\\rightarrow$ $^{136}$Ba has been determined by measuring the cross sections of the ($d$,$^3$He) reaction with 101-MeV deuterons. Together with our recent determination of the relevant neutron configurations involved in the process, a quantitative comparison with the latest shell-model and interacting-boson-model calculations reveals significant discrepancies. These are the same calculations used to determine the nuclear matrix elements governing the rate of neutrinoless double-$\\beta$ decay in these systems.

  7. Corrosion-Fatigue Cracking in HY-80 and HY-130 Steels

    Science.gov (United States)

    2015-01-22

    on HY80 steel and HY-130 steel are shown in Fig. A-13 through A-16 for various specimens tested at different load ratios and environments. Because...Naval Research Laboratory Washington, DC 20375-5320 NRL/MR/6355--15-9584 Corrosion-Fatigue Cracking in HY-80 and HY-130 Steels January 22, 2015 P.S...Cracking in HY-80 and HY-130 Steels P.S. Pao and R.L. Holtz Naval Research Laboratory 4555 Overlook Avenue, SW Washington, DC 20375-5328 Office of Naval

  8. Imaging, photophysical properties and DFT calculations of manganese blue (barium manganate(VI) sulphate)--a modern pigment.

    Science.gov (United States)

    Accorsi, Gianluca; Verri, Giovanni; Acocella, Angela; Zerbetto, Francesco; Lerario, Giovanni; Gigli, Giuseppe; Saunders, David; Billinge, Rachel

    2014-12-18

    Manganese blue is a synthetic barium manganate(VI) sulphate compound that was produced from 1935 to the 1990s and was used both as a blue pigment in works of art and by conservators in the restoration of paintings. The photophysical properties of the compound are described as well as the setup needed to record the spatial distribution of the pigment in works of art.

  9. Flow injection spectrophotometry coupled with a crushed barium sulfate reactor column for the determination of sulfate ion in water samples

    OpenAIRE

    Burakham,Rodjana; Higuchi, Keiro; Oshima, Mitsuko; Grudpan, Kate; Motomizu, Shoji

    2004-01-01

    A new type of a reactor column, a crushed BaSO4 reactor column used for the flow injection spectrophotometric determination of sulfate ion using the exchange reaction of sulfate ion and barium-dimethylsulfonazo III is proposed. The column is very simple and economical. It can be continuously used for 8 h before washing with water for repeated usage of at least 1 month. The procedure is sensitive. Application to various water samples was demonstrated.

  10. Preparation and Sintering Effect in Quartz-Barium Titanate Porous Ceramics and Permeability Modulation Using an Implanted Electrode

    Directory of Open Access Journals (Sweden)

    Ernesto Suaste Gómez

    2014-01-01

    Full Text Available Barium titanate and quartz mixed in different proportions were used to create porous piezoelectric ceramics. Three different sintering temperatures were used for the ceramics preparation; a nichrome wire was used as internal electrode in porous ceramics. Characteristics as porous area, porosity, and its relationship with quartz percentage and sintering temperatures were studied. Porous ceramics with an implanted electrode were created, by applying an alternating voltage in the internal electrode that controlled the liquid permeability coefficient, calculated by the Darcy Law.

  11. Preparation and studies of Co(II) and Co(III)-substituted barium ferrite prepared by sol-gel method

    Energy Technology Data Exchange (ETDEWEB)

    Teh, Geok Bee [Department of Bioscience and Chemistry, Faculty of Engineering and Science, Universiti Tunku Abdul Rahman, 53300 Kuala Lumpur (Malaysia)]. E-mail: tehgb@mail.utar.edu.my; Nagalingam, Saravanan [Department of Bioscience and Chemistry, Faculty of Engineering and Science, Universiti Tunku Abdul Rahman, 53300 Kuala Lumpur (Malaysia); Jefferson, David A. [Department of Chemistry, University of Cambridge, Lensfield Road, Cambridge CB2 1EW (United Kingdom)

    2007-01-15

    The sol-gel preparative method was employed to synthesise Co(II) and Co(III)-substituted barium ferrite. This method was attempted to achieve higher homogeneity of the final product. Samples of substituted ferrites were characterised by various experimental techniques including high resolution transmission electron microscopy, X-ray diffraction analysis, magnetometry and thermal gravimetric analysis. The microstructural changes induced by such substitution are also discussed.

  12. Role of the double-contrast barium enema in rectal stenosis due to suppositories containing paracetamol and acetylsalicylic acid

    Energy Technology Data Exchange (ETDEWEB)

    Tannouri, F.; Lalmand, B.; Zalcman, M.; Gansbeke, D. van; Gevenois, P.A.; Struyven, J. [Department of Radiology, Hopital Erasme, University of Brussels (Belgium); Peny, M.O. [Department of Pathology, University of Brussels (Belgium); Gossum, A. van [Department of Gastroenterology, University of Brussels (Belgium)

    1998-09-01

    Self-treatment of chronic headache with suppositories containing paracetamol and acetylsalaicylic acid may lead to serious complications. We report the radiological features of five cases of rectal stenosis following the use of such suppositories. The role of the double-contrast barium enema in suggesting the diagnosis of this complication of a chronic and often unrecognized self-treatment is emphasized. (orig.) With 6 figs., 20 refs.

  13. Obesidad, inflamación e insulino-resistencia: papel de los ligandos del receptor gp 130 Obesity, inflammation and insulin resistance: role of gp 130 receptor ligands

    Directory of Open Access Journals (Sweden)

    B. Marcos-Gómez

    2008-08-01

    Full Text Available La obesidad puede ser considerada como una patología inflamatoria crónica de bajo grado, caracterizada por una elevación de los niveles plasmáticos de citoquinas proinflamatorias como el factor de necrosis tumoral alfa (TNF-alfa, y proteínas reactantes de fase aguda como la proteína C reactiva. En este contexto, algunas de las citoquinas de la familia de interleuquina (IL-6 han sido también implicadas en el proceso inflamatorio asociado a obesidad y enfermedades relacionadas. Además de IL-6, pertenecen a esta familia citoquinas como IL-11, ciliary neurotrophic factor (CNTF, cardiotrophin-1 (CT-1, cardiotrophin- like cytokine (CLC, leukemia inhibitory factor (LIF y oncostatin M (OsM. Todas ellas ejercen sus acciones biológicas mediante la interacción con un complejo receptor del que forma parte una molécula glicoproteica transductora de la señal denominada glicoproteína 130 (gp130, por lo que también se denominan citoquinas gp130. Sin embargo, su papel en obesidad y sus complicaciones es controvertido; así, mientras que algunas han sido implicadas en el desarrollo de obesidad y enfermedades relacionadas como enfermedad hepática, insulino-resistencia y patología cardiovascular, otros estudios han llevado a proponer a los ligandos del receptor gp130 como potenciales agentes terapéuticos para el tratamiento de la obesidad y sus patologías asociadas. De hecho, el tratamiento con CNTF ha demostrado ser efectivo en la reducción del peso corporal, promoviendo la inhibición de la ingesta, la activación del gasto energético y la sensibilidad a la insulina. En esta revisión se analiza el potencial terapéutico de algunas de las citoquinas ligando del receptor gp130 en procesos de obesidad y enfermedades relacionadas.Obesity can be considered as a low grade inflammatory disease, characterized by increased plasma levels of proinflammatory cytokines such as tumoral necrosis factor-alpha (TNF-alpha, and acute phase reactant proteins

  14. Factors of Impacting the Coprecipitation Process for Synthesizing CoTi-substitued Barium M-type Ferrite Ultrafine Powder

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wen-yu; ZHANG Qing-jie ZHANG Qing-jie; GUAN Jian-guo

    2004-01-01

    The effect of pH values on synthesizing single-phase CoTi-substituted barium M-type ferrite ultrafine powders,and BaCoTiFe10O19, was investigated employing corrosion versus pH plot (E-pH plot) for metal element, thermodynamic calculation, and co-dump coprecipitation. The pH values of complete coprecipitation of all Fe3+, Ti4+, Co2+ and Ba2+ cations are 9-12 and higher than 7.9 on the basis of E-pH plot analysis and thermodynamic calculation, respectively. The minimum pH value necessary to the formation of single-phase BaCoTiFe10O19 is 8.5 in the light of the co-dump coprecipitation.These results indicate that the coprecipitation process for synthesizing CoTi-substituted barium M-type ferrite ultrafine powders is simultaneously influenced by synergetic coprecipation effect of cations and coordination effect of Cl anions. The test time of the minimum pH value corresponding to forming a series of single-phase CoTi-substituted barium M-type ferrite ultrafine powders,and BaCoxTixFe12-2xO19, may be significantly reduced by using the effects of two new factors on the coprecipitation process.

  15. Improvement of Mechanical, Thermal and Optical Properties of Barium Mixed Cobalt Tartrate Hydrate Crystals Grown by Gel Method

    Directory of Open Access Journals (Sweden)

    S. Vanaja

    2015-10-01

    Full Text Available In this present work, CTH and BCTH crystals have been prepared by gel technique by using single diffusion method at room temperature. The as grown crystals were characterized by using XRD, FT-IR, UV, TG / DTA and Micro hardness studies. X-ray powder diffraction results analyzed by using suitable software suggest that a CTH and BCTH crystals belong to cubic crystal system. The unit cell volume is observed to increase with increase in the concentration of barium in cobalt tartrate due to the lattice distortion. The band gap and optical properties have analyzed by UV-Visible spectrum. The functional groups and compound formation of the crystals have been studied by FT-IR spectrum. The mechanical properties of the grown crystals were tested by using Vicker’s microhardness studies. The work hardening coefficient (n was determined to be 3.7 for CTH, 5.3 for BCTH (1 : 1 and 6.4 for BCTH (2 : 1 and the stiffness constants for different loads were calculated and reported. Thermal analysis suggests that pure cobalt tartrate starts decomposing at 73.2 °C whereas the barium mixed cobalt tartrate brings about better thermal stability which increases with an increase in barium concentration.

  16. Simultaneous Elimination of Soot and NOX through Silver-Barium Based Catalytic Materials

    Directory of Open Access Journals (Sweden)

    Ganesh Chandra Dhal

    2017-04-01

    Full Text Available In this research paper, the nanometric size effect, the effects of the intrinsic factors including structure, and the redox properties of three systems of nanometric of silver-based catalysts were summarized. In this work, these catalysts were investigated for the simultaneous removal of particulate matter (diesel soot, and NOX was compared with that of a model of Pt-Ba/Al2O3 catalyst. The Silver-Barium based catalytic materials of Ag (5 wt%-Ba(10 wt%/MO (MO=Al2O3, CeO2, ZrO2, and Ag (5 wt%-Sr (10 wt%/CeO2 catalysts have been prepared by wetness impregnation method and characterized by BET, XRD, HRTEM, XPS and TPR (temperature-programmed reduction experiments. The behavior of the catalyst in the soot combustion (under tight conditions and NOX elimination has been separately analyzed by means of temperature programmed oxidation and isothermal concentration step change experiments, respectively. The results showed that all the catalysts were active in soot combustion with an indicative decrease of oxidation onset temperature compared to uncatalyzed soot oxidation. The removal of NOX in the presence and in the absence of soot was investigated under cycling conditions, i.e. alternating lean-rich phases according to the LNT approach. It has been found that the Ag-based samples were able to simultaneously remove soot and NOX. In particular, studying the behavior of the prepared catalysts, the Ba-containing systems exhibited higher NOX storage capacity than Sr-catalyst; also, the nitrogen selectivity increased even if resulted lower than the traditional LNT Pt-based catalyst. An adverse effect of soot on the NOX storage activity has been also observed. Copyright © 2017 BCREC GROUP. All rights reserved Received: 18th August 2016; Revised: 19th October 2016; Accepted: 19th October 2016 How to Cite: Dhal, G.C., Dey, S., Prasad, R., Mohan, D. (2017. Simultaneous Elimination of Soot and NOX through Silver-Barium Based Catalytic Materials. Bulletin of

  17. Combustion Synthesis of Yttrium BARIUM(2) COPPER(3) OXYGEN(6+X) Superconductor.

    Science.gov (United States)

    Lin, Sy-Chyi

    YBa_2Cu_3 O_{rm 6 + x} was produced from copper, barium peroxide, and yttrium oxide by Self-propagating High-temperature Synthesis (SHS) and thermal explosion methods. The SHS process was conducted in two modes: a horizontal combustion and a vertical combustion. The influence of copper particle size on the stability of the reaction front was studied. In contrast to previous studies, a stable reaction front could be maintained even when relatively large copper particles (smaller than 325 mesh) were used. In the horizontal SHS process, large diameter pellets (larger than 22 mm in diameter) enabled stable combustion at room temperature. Elevated ambient temperatures (400 {~} 500^circ C) were needed to stabilize the combustion front movement in small diameter pellets. The product had an average concentration of 84 wt% YBa_2Cu _3O_{rm 6 + x}. In the vertical SHS process, with the aid of a booster, the combustion front moved more rapidly and smoothly than that in the horizontal SHS process and gave a product concentration of about 90 wt% YBa _2Cu_3O_ {rm 6 + x}. High quality product (above 95 wt% YBa_2Cu_3 O_{rm 6 + x}) may be obtained by sintering/calcining the SHS product in an oxygen atmosphere. Three different sintering/calcining processes were studied and the required temperature and the time for each process were determined. The temperature at the center of the pellet in a vertical SHS was measured by thermocouples. The pellet temperature rise is a two step process. The first temperature rise is caused by the oxidation of the copper and the second is caused by the reaction between yttrium oxide and barium cuprate. A reaction mechanism is proposed to explain this behavior. A thermal explosion process was conducted in a continuous rotary kiln. In this mode a pellet was introduced suddenly into a heated rotary kiln causing it to be combusted. After the combustion, the pellet was sintered at 900 to 980 ^circC and a product containing about 95 wt% YBa_2Cu_3 O_{rm 6 + x

  18. 33 CFR 169.130 - When are ships required to make reports?

    Science.gov (United States)

    2010-07-01

    ... Reporting Systems for the Protection of Northern Right Whales § 169.130 When are ships required to make reports? Participating ships must report to the shore-based authority upon entering the area covered by...

  19. 40 CFR 1027.130 - How do I make a fee payment?

    Science.gov (United States)

    2010-07-01

    ... CONTROLS FEES FOR ENGINE, VEHICLE, AND EQUIPMENT COMPLIANCE PROGRAMS § 1027.130 How do I make a fee payment... following methods: money order, bank draft, certified check, corporate check, electronic funds transfer,...

  20. Role of the intracellular receptor domain of gp130 (exon 17) in human inflammatory bowel disease

    Institute of Scientific and Technical Information of China (English)

    Christoph J. Auernhammer; Thomas Ochsenkühn; Kathrin Zitzmann; Fabian Schnitzler; Julia Seiderer; Peter Lohse; George Vlotides; Dieter Engelhardt; Michael Sackmann; Burkhard G(o)ke

    2005-01-01

    AIM: To study the role of the intracellular receptor domain of gp130 in human inflammatory bowel disease (IBD).METHODS: We amplified and sequenced the complete exon 17 of the human gp130 gene in 146 patients with IBD. According to clinical and histopathological signs,the 146 patients with IBD were classified as having Crohn's disease (n = 73) or ulcerative colitis (n = 63),or as indeterminate status (n = 10).RESULTS: No mutations in exon 17 of the gp130 gene could be detected in any of the 146 patients with IBD examined.CONCLUSION: There is no evidence that mutations in exon 17 of the gp130 gene are involved in the pathogenesis of human IBD.