WorldWideScience

Sample records for barium 130 target

  1. Barium

    International Nuclear Information System (INIS)

    Present article is devoted to barium content in fluoride. In order to obtain the comprehensive view on barium distribution in fluorite 303 mono mineral fractions of various geologic deposits and ores of Kazakhstan, Uzbekistan, Tajikistan and some geologic deposits of Russia were analyzed. The barium content in fluorite of geologic deposits of various mineralogical and genetic type was defined. The basic statistical estimation of barium distribution in fluorite were evaluated.

  2. production of carrier -free 131 cesium from neutron irradiated barium targets

    International Nuclear Information System (INIS)

    this work describes the production of carrier-free radioactive 131 Cs from bulk amounts of Ba CO3 (1g each) as target material irradiated at ETRR-1, ETRR-2 and IRI research reactors. Cesium-131 was prepared according to the thermal neutron reaction 130Ba (n,γ ) 131 Ba (β- decay)131 Cs. Carrier-free 131Cs is separated from the irradiated barium target, by precipitation of Ba2+ cations with addition of SO42- anions in excess and filtration of the formed precipitate . quality control investigations including radionuclidic, radiochemical and chemical purity of 131 Cs product has proved its suitability for nuclear medicine use

  3. MicroRNA-130b targets Fmr1 and regulates embryonic neural progenitor cell proliferation and differentiation

    International Nuclear Information System (INIS)

    Highlights: •We found that the 3′ UTR of the Fmr1 mRNA is a target of miR-130b. •MiR-130b suppresses the expression of Fmr1 in mouse embryonic stem cell. •MiR-130b alters the proliferation of mouse embryonic stem cell. •MiR-130b alters fate specification of mouse embryonic stem cell. -- Abstract: Fragile X syndrome, one of the most common forms of inherited mental retardation, is caused by expansion of the CGG repeat in the 5′-untranslated region of the X-linked Fmr1 gene, which results in transcriptional silencing and loss of expression of its encoded protein FMRP. The loss of FMRP increases proliferation and alters fate specification in adult neural progenitor cells (aNPCs). However, little is known about Fmr1 mRNA regulation at the transcriptional and post-transcriptional levels. In the present study, we report that miR-130b regulated Fmr1 expression by directly targeting its 3′-untranslated region (3′ UTR). Up-regulation of miR-130b in mouse embryonic neural progenitor cells (eNPCs) decreased Fmr1 expression, markedly increased eNPC proliferation and altered the differentiation tendency of eNPCs, suggesting that antagonizing miR-130b may be a new therapeutic entry point for treating Fragile X syndrome

  4. MicroRNA-130b targets Fmr1 and regulates embryonic neural progenitor cell proliferation and differentiation

    Energy Technology Data Exchange (ETDEWEB)

    Gong, Xi [State Key Laboratory of Food Science and Technology, College of Life Sciences and Food Engineering, Nanchang University, Nanchang 330047 (China); Zhang, Kunshan [Department of Regenerative Medicine, Stem Cell Center, Tongji University School of Medicine, Shanghai 200092 (China); Wang, Yanlu; Wang, Junbang; Cui, Yaru [State Key Laboratory of Food Science and Technology, College of Life Sciences and Food Engineering, Nanchang University, Nanchang 330047 (China); Li, Siguang, E-mail: siguangli@163.com [Department of Regenerative Medicine, Stem Cell Center, Tongji University School of Medicine, Shanghai 200092 (China); Luo, Yuping, E-mail: luoyuping@163.com [State Key Laboratory of Food Science and Technology, College of Life Sciences and Food Engineering, Nanchang University, Nanchang 330047 (China)

    2013-10-04

    Highlights: •We found that the 3′ UTR of the Fmr1 mRNA is a target of miR-130b. •MiR-130b suppresses the expression of Fmr1 in mouse embryonic stem cell. •MiR-130b alters the proliferation of mouse embryonic stem cell. •MiR-130b alters fate specification of mouse embryonic stem cell. -- Abstract: Fragile X syndrome, one of the most common forms of inherited mental retardation, is caused by expansion of the CGG repeat in the 5′-untranslated region of the X-linked Fmr1 gene, which results in transcriptional silencing and loss of expression of its encoded protein FMRP. The loss of FMRP increases proliferation and alters fate specification in adult neural progenitor cells (aNPCs). However, little is known about Fmr1 mRNA regulation at the transcriptional and post-transcriptional levels. In the present study, we report that miR-130b regulated Fmr1 expression by directly targeting its 3′-untranslated region (3′ UTR). Up-regulation of miR-130b in mouse embryonic neural progenitor cells (eNPCs) decreased Fmr1 expression, markedly increased eNPC proliferation and altered the differentiation tendency of eNPCs, suggesting that antagonizing miR-130b may be a new therapeutic entry point for treating Fragile X syndrome.

  5. Barium enema

    Science.gov (United States)

    Barium enema is a special x-ray of the large intestine, which includes the colon and rectum. ... to a bag that holds a liquid containing barium sulfate. This is a contrast material that highlights ...

  6. Barium Sulfate

    Science.gov (United States)

    Barium sulfate is used to help doctors examine the esophagus (tube that connects the mouth and stomach), ... dimensional pictures of the inside of the body). Barium sulfate is in a class of medications called ...

  7. MiR-130a regulates neurite outgrowth and dendritic spine density by targeting MeCP2.

    Science.gov (United States)

    Zhang, Yunjia; Chen, Mengmeng; Qiu, Zilong; Hu, Keping; McGee, Warren; Chen, Xiaoping; Liu, Jianghong; Zhu, Li; Wu, Jane Y

    2016-07-01

    MicroRNAs (miRNAs) are critical for both development and function of the central nervous system. Significant evidence suggests that abnormal expression of miRNAs is associated with neurodevelopmental disorders. MeCP2 protein is an epigenetic regulator repressing or activating gene transcription by binding to methylated DNA. Both loss-of-function and gain-of-function mutations in the MECP2 gene lead to neurodevelopmental disorders such as Rett syndrome, autism and MECP2 duplication syndrome. In this study, we demonstrate that miR-130a inhibits neurite outgrowth and reduces dendritic spine density as well as dendritic complexity. Bioinformatics analyses, cell cultures and biochemical experiments indicate that miR-130a targets MECP2 and down-regulates MeCP2 protein expression. Furthermore, expression of the wild-type MeCP2, but not a loss-of-function mutant, rescues the miR-130a-induced phenotype. Our study uncovers the MECP2 gene as a previous unknown target for miR-130a, supporting that miR-130a may play a role in neurodevelopment by regulating MeCP2. Together with data from other groups, our work suggests that a feedback regulatory mechanism involving both miR-130a and MeCP2 may serve to ensure their appropriate expression and function in neural development. PMID:27245166

  8. miR-130b-3p Upregulation Contributes to the Development of Thyroid Adenomas Targeting CCDC6 Gene

    Science.gov (United States)

    Leone, Vincenza; Langella, Concetta; Esposito, Francesco; De Martino, Marco; Decaussin-Petrucci, Myriam; Chiappetta, Gennaro; Bianco, Antonio; Fusco, Alfredo

    2015-01-01

    We have previously studied the function of microRNAs (miRNAs) in thyroid cells using the differentiated rat thyroid PC Cl 3 cells that need thyrotropin (TSH) for their growth. The miRNA expression profile examination allowed the detection of a set of miRNAs downregulated and upregulated by TSH. Here, we first demonstrated that upregulation of miR-130b-3p occurs through a protein kinase A-cAMP-responsive element binding protein (CREB)-dependent mechanism. Then, we analyzed its expression in human thyroid follicular adenomas, where a constitutive CREB activation is frequently present. miR-130b-3p results in upregulation with a high fold-change in most thyroid follicular adenomas. Then, we identified CCDC6, coding for a protein that interacts with CREB1 leading to the transcriptional repression of CREB1 target genes, as a target of this miRNA. The targeting of CCDC6 by miR-130b-3p likely accounts for the mechanism by which its upregulation contributes to the development of thyroid adenomas increasing CREB1 activity. PMID:26835423

  9. An experimental study on barium peritonitis in rats

    International Nuclear Information System (INIS)

    Barium sulfate is universally used contrast media in gastrointestinal roentgenology, and spillage of barium into peritoneal cavity can occur. The references on effect of barium sulfate in the peritoneal cavity have been scattered and the results are varied. In 80 rats, body weight of 130 gm to 150 gm, sterile pure barium, sterile commercial barium, intestinal content, and mixed pure barium and intestinal content were experimentally injected into the peritoneal cavity. Consecutive weekly laparotomy and microscopic examination were done for 4 weeks. The results are as followings: 1. Mind inflammatory reaction and mild adhesion after sterile pure barium injection. 2. Mild inflammatory reaction and moderate adhesion after sterile commercial barium injection. 3. Acute peritonitis and abscess formation after intestinal content injection. 4. High mortality due to severe acute peritonitis, and severe adhesion in survivors after injection of both pure barium and intestinal content.

  10. Barium Sulfate

    Science.gov (United States)

    ... using x-rays or computed tomography (CAT scan, CT scan; a type of body scan that uses ... be clearly seen by x-ray examination or CT scan. ... more times before an x-ray examination or CT scan.If you are using a barium sulfate ...

  11. Thick-target yields of iodine isotopes from proton interactions in Te, and the double-β decays of 128,130Te

    International Nuclear Information System (INIS)

    We measured thick-target yields of 126,128,130I from bombardments of natural Te targets with 15-, 30-, 45-, and 50-MeV protons, together with iodine production cross sections for 1.85- and 5.0-GeV protons. Using these data, we have estimated the relative cosmic-ray induced production of 126Xe, 128Xe, and 130Xe in Te ores. These quantities are significantly different from those used previously in a determination of the ratio of the double-β decay half-lives of 130Te and 128Te, and as a result the cosmic-ray correction is smaller than previously assumed. A revised correction of cosmic-ray produced xenon can change the half-life ratio by about 6%. This quantity is of importance because it can be used to set a limit on the 0-ν double-β decay mode

  12. Nuclear factor-κB-dependent microRNA-130a upregulation promotes cervical cancer cell growth by targeting phosphatase and tensin homolog.

    Science.gov (United States)

    Feng, Yeqian; Zhou, Shenghua; Li, Guiyuan; Hu, Chunhong; Zou, Wen; Zhang, Haixia; Sun, Lili

    2016-05-15

    Nuclear factor-κB (NF-κB) may activate a series of gene transcription control cellular signaling pathways whose products are components in a wide range of biological processes. MicroRNAs, a group of non-coding endogenous ones, may regulate gene expression and plays specific roles in tumorigenesis. Using human cervical cancer cell lines, we explored whether NF-κB regulates the expression of microRNA-130a (miR-130a) through binding elements in the miR-130a promoter region. We found that miR-130a accelerates cervical cancer cell proliferation by targeting the phosphatase and tensin homolog on chromosome 10 (PTEN). Further, NF-κB activates both HeLa and CaSki cell growth by upregulating miR-130a. In addition, by targeting PTEN 3' untranslated region, miR-130a might increase cell growth and initiate protein kinase B (AKT) pathway activation. Lastly, PTEN protein was upregulated in response to NF-κB overexpression and downregulated in response to NF-κB inhibition. Compared to total AKT protein level, p-AKT was downregulated by NF-κB overexpression while upregulated by NF-κB inhibition, indicating PTEN pathway activated and affected by NF-κB. Taken together, our findings shed new light on the NF-κB/miR-130a/PTEN pathway in cervical cancer and add new insight regarding the carcinogenesis of cervical cancer. PMID:27040383

  13. BARIUM RECOVERY PROCESS

    Science.gov (United States)

    Blanco, R.E.

    1959-07-21

    A method of separating barium from nuclear fission products is described. In accordance with the invention, barium may be recovered from an acidic solution of neutron-irradiated fissionable material by carrying ihe barium cut of solution as a sulfate with lead as a carrier and then dissolving the barium-containing precipitate in an aqueous solution of an aliphatic diamine chelating reagent. The barium values together with certain other metallic values present in the diamine solution are then absorbed onto a cation exchange resin and the barium is selectively eluted from the resin bed with concentrated nitric acid.

  14. Potential therapeutic implications of IL-6/IL-6R/gp130-targeting agents in breast cancer

    Science.gov (United States)

    Heo, Tae-Hwe; Wahler, Joseph; Suh, Nanjoo

    2016-01-01

    Interleukin-6 (IL-6) is a pleiotropic cytokine with known multiple functions in immune regulation, inflammation, and oncogenesis. Binding of IL-6 to the IL-6 receptor (IL-6R) induces homodimerization and recruitment of glycoprotein 130 (gp130), which leads to activation of downstream signaling. Emerging evidence suggests that high levels of IL-6 are correlated with poor prognosis in breast cancer patients. IL-6 appears to play a critical role in the growth and metastasis of breast cancer cells, renewal of breast cancer stem cells (BCSCs), and drug resistance of BCSCs, making anti–IL-6/IL-6R/gp130 therapies promising options for the treatment and prevention of breast cancers. However, preclinical and clinical studies of the applications of anti–IL-6/IL-6R/gp130 therapy in breast cancers are limited. In this review, we summarize the structures, preclinical and clinical studies, mechanisms of action of chemical and biological blockers that directly bind to IL-6, IL-6R, or gp130, and the potential clinical applications of these pharmacological agents as breast cancer therapies. PMID:26840088

  15. Barium enema (image)

    Science.gov (United States)

    A barium enema is performed to examine the walls of the colon. During the procedure, a well lubricated enema tube is inserted gently into the rectum. The barium, a radiopaque (shows up on X-ray) contrast ...

  16. Radioisotope analyzer of barium

    International Nuclear Information System (INIS)

    Principle of operation and construction of radioisotope barium sulphate analyzer type MZB-2 for fast determination of barium sulphate content in barite ores and enrichment products are described. The gauge equipped with Am-241 and a scintillation detector enables measurement of barium sulphate content in prepared samples of barite ores in the range 60% - 100% with the accuracy of 1%. The gauge is used in laboratories of barite mine and ore processing plant. 2 refs., 2 figs., 1 tab. (author)

  17. Dynamical simulation of tritium depth profile due to 130 keV D+ ion bombardment on a TiT target

    International Nuclear Information System (INIS)

    The depth profiles of tritium atoms in a TiT target at liquid nitrogen temperature induced by 130 keV deuterium ion bombardment have been studied, using the hybrid Monte Carlo simulation code ACAT-DIFFUSE. The present ACAT-DIFFUSE code can estimate the slowing down process of incident ions and the thermal process of moderated atoms. It is found that the experimental depth profile is explained by the Doyle's local mixing model and the target expansion brought out by the accumulated deuterium atoms or recoil tritium atoms which cannot enter the interstitial sites. Another interesting feature is that the range of the implanted deuterium ion becomes shorter as the ion fluence increases. (author)

  18. Thick-target yields of iodine isotopes from proton interactions in Te, and the double-β decay of 128,130Te

    International Nuclear Information System (INIS)

    We report thick-target yields of 126,128,130I from the bombardment of natural Te targets with 15-, 30-, 45- and 50-MeV protons, together with the iodine production cross sections for 1.85- and 5.0-GeV protons. With these data, we have estimated the relative cosmic-ray induced production of 126Xe, 128Xe and 13OXe in Te ores. These quantities affect the ratio of double-β decay half-lives of 13OTe and 128Te. A revised correction of cosmic-ray induced xenon can change the half-life ratio by as much as 10%, from (3.52±0.11) x 10-4 to (3.88±0.14) x 10-4

  19. Investigation of the Deuteron Breakup on Proton Target in the Forward Angular Region at 130 MeV

    International Nuclear Information System (INIS)

    A set of differential cross-section data of the 1H(d, pp)n breakup reaction at 130 MeV deuteron beam energy has been measured in the domain of very forward polar angles with the use of the Germanium Wall detector at the Forschungszentrum Jülich. The data obtained for over 1000 kinematical points (112 geometries) are compared with the theoretical predictions based on various models of the three-nucleon (3N) dynamics. They comprise: the realistic nucleon-nucleon potentials alone or combined with the three-nucleon force (3NF), the coupled-channel calculations with the explicit treatment of the Δ-isobar excitation and finally, the potentials derived from chiral perturbation theory. In the part of the phase space studied, the Coulomb interaction between protons has a strong impact on the differential cross section of the breakup reaction. The strongest Coulomb effects are found in regions where the relative energy of the two protons is the smallest. In these regions the data are well reproduced exclusively by calculations which include the electromagnetic repulsion between protons. In spite of the dominance of the Coulomb force in the phase space studied, the contribution of 3NF effects is also observed. (author)

  20. Tailored Barium Swallow Study

    Science.gov (United States)

    ... View Denver Pollen Count You are here: Programs & Services > Tests We Offer > Imaging Tests Tailored Barium Swallow Study The TBS is a special study that is completed in radiology. The test evaluates the mouth and the throat ...

  1. Lower GI Series (Barium Enema)

    Science.gov (United States)

    ... barium into a bedpan or nearby toilet. A health care professional may give you an enema to flush out the rest of the barium. An x-ray technician and a radiologist perform a lower gastrointestinal (GI) series at a ...

  2. Observed Barium Emission Rates

    Science.gov (United States)

    Stenbaek-Nielsen, H. C.; Wescott, E. M.; Hallinan, T. J.

    1993-01-01

    The barium releases from the CRRES satellite have provided an opportunity for verifying theoretically calculated barium ion and neutral emission rates. Spectra of the five Caribbean releases in the summer of 1991 were taken with a spectrograph on board a U.S. Air Force jet aircraft. Because the line of sight release densities are not known, only relative rates could be obtained. The observed relative rates agree well with the theoretically calculated rates and, together with other observations, confirm the earlier detailed theoretical emission rates. The calculated emission rates can thus with good accuracy be used with photometric observations. It has been postulated that charge exchange between neutral barium and oxygen ions represents a significant source for ionization. If so. it should be associated with emissions at 4957.15 A and 5013.00 A, but these emissions were not detected.

  3. Barium isotopes in Allende meteorite - Evidence against an extinct superheavy element

    Science.gov (United States)

    Lewis, R. S.; Anders, E.; Shimamura, T.; Lugmair, G. W.

    1983-01-01

    Carbon and chromite fractions from the Allende meteorite that contain isotopically anomalous xenon-131 to xenon-136 (carbonaceous chondrite fission or CCF xenon) at up to 5 x 10 to the 11th atoms per gram show no detectable isotopic anomalies in barium-130 to barium-138. This rules out the possibility that the CCF xenon was formed by in situ fission of an extinct superheavy element. Apparently the CCF xenon and its carbonaceous carrier are relics from stellar nucleosynthesis.

  4. New barium tantalum sulphides

    International Nuclear Information System (INIS)

    The authors discuss a new barium tantalum sulphide, Ba3Ta2S8, prepared by sulphurization of a mixture of BaCO3 and Ta2O5. The electron and powder X-ray diffraction patterns of the compound are indexed on the basis of a monoclinic cell with lattice constants. A structure model is proposed. The refinement based on the powder X-ray diffraction intensities is performed

  5. Barium calcium hydroxyapatite solid solutions

    International Nuclear Information System (INIS)

    The replacement of calcium by barium in the hydroxyapatite structure by solid-state reaction at different temperatures and by precipitation from an aqueous system has been investigated by X-ray diffraction and i.r. absorption analyses. The products obtained by solid-state reaction at 1200 deg C are solid solutions over the range of barium concentration 60 to 100 atom %. The lattice dimensions and the i.r. frequencies of the solid solutions vary linearly with the atom % of barium. Only small amounts of barium can be incorporated in hydroxyapatite by precipitation from the aqueous system. (author)

  6. Barium zirconate base ceramics

    International Nuclear Information System (INIS)

    The chemical corrosion at high temperatures is a serious problem in the refractory materials field, leading to degradation and bath contamination by elements of the refractory. The main objective of this work was to search for ceramics that could present higher resistance to chemical attack by aggressive molten oxides. The general behaviour of a ceramic material based on barium zirconate (Ba Zr O3) with the addition of different amounts of liquid phase former was investigated. The densification behaviour occurred during different heat treatments, as well as the microstructure development, as a function of the additives and their reactions with the main phase, were observed and are discussed. (author)

  7. Lifetime Measurements in Chiral Nucleus 130Cs

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>The high spin states of the 130Cs were populated by the reaction 124Sn(11B, 5n)130Cs at a beam energy of 65 MeV. The 11B beam was provided by the HI-13 tandem accelerator in the China Institute of Atomic Energy. The target

  8. Microwave-hydrothermal synthesis of barium strontium titanate nanoparticles

    International Nuclear Information System (INIS)

    Research highlights: → Barium strontium titanate nanoparticles were obtained by the Hydrothemal microwave technique (HTMW) → This is a genuine technique to obtain nanoparticles at low temperature and short times → Barium strontium titanate free of carbonates with tetragonal structure was grown at 130 oC. - Abstract: Hydrothermal-microwave method (HTMW) was used to synthesize crystalline barium strontium titanate (Ba0.8Sr0.2TiO3) nanoparticles (BST) in the temperature range of 100-130 oC. The crystallization of BST with tetragonal structure was reached at all the synthesis temperatures along with the formation of BaCO3 as a minor impurity at lower syntheses temperatures. Typical FT-IR spectra for tetragonal (BST) nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH- groups, commonly found in materials obtained by HTMW process. FE/SEM revealed that lower syntheses temperatures led to a morphology that consisted of uniform grains while higher syntheses temperature consisted of big grains isolated and embedded in a matrix of small grains. TEM has shown BST nanoparticles with diameters between 40 and 80 nm. These results show that the HTMW synthesis route is rapid, cost effective, and could serve as an alternative to obtain BST nanoparticles.

  9. MR Colonography with fecal tagging: Barium vs. barium ferumoxsil

    DEFF Research Database (Denmark)

    Achiam, M.P.; Chabanova, E.; Logager, V.B.; Thomsen, H.S.; Rosenberg, J.

    2008-01-01

    . Materials and Methods. Twenty patients referred to CC underwent dark lumen MRC prior to the colonoscopy. Two groups of patients received two different oral contrast agents (barium sulfate and barium sulfate/ferumoxsil) as a laxative-free fecal tagging prior to the MRC. After MRC, the contrast agent was...... rated qualitatively (with the standard method using contrast-to-wall ratio) and subjectively (using a visual analog scale [VAS]) by three different blinded observers. Results. Evaluated both qualitatively and subjectively, the tagging efficiency of barium sulfate/ferumoxsil was significantly better (P...... <.05) than barium sulfate alone. The VAS method for evaluating the tagging efficiency of contrast agents showed a high correlation (observer 11, r = 0.91) to the standard method using contrast-to-wall ratio and also a high interclass correlation (observer 11 and III = 0.89/0.85). MRC found I of 22 (5...

  10. Doped barium titanate nanoparticles

    Indian Academy of Sciences (India)

    T K Kundu; A Jana; P Barik

    2008-06-01

    We have synthesized nickel (Ni) and iron (Fe) ion doped BaTiO3 nanoparticles through a chemical route using polyvinyl alcohol (PVA). The concentration of dopant varies from 0 to 2 mole% in the specimens. The results from X-ray diffractograms and transmission electron micrographs show that the particle diameters in the specimen lie in the range 24–40 nm. It is seen that the dielectric permittivity in doped specimens is enhanced by an order of magnitude compared to undoped barium titanate ceramics. The dielectric permittivity shows maxima at 0.3 mole% doping of Fe ion and 0.6 mole% of Ni ion. The unusual dielectric behaviour of the specimens is explained in terms of the change in crystalline structure of the specimens.

  11. New barium tantalum sulphides

    International Nuclear Information System (INIS)

    A new barium tantalum sulphide has been synthesized by the reaction of CS2 with a mixture of BaCO3 and Ta2O5. The chemical analysis of the compound was performed for 3 components (Ba, Ta and S), and the chemical composition was found to be BaTa2S5. The powder X-ray diffraction peaks were indexable on the basis of a hexagonal cell with lattices constants of a=3.32A, c=25.13A. However, the electron diffraction measurements show that the structure is more complex than that observed by powder X-ray diffraction. The compound indicates metallic behavior and Pauli paramagnetism

  12. Abundance analysis of barium and mild barium stars

    CERN Document Server

    Smiljanic, R; Silva, L

    2007-01-01

    High signal to noise, high resolution spectra were obtained for a sample of normal, mild barium, and barium giants. Atmospheric parameters were determined from the FeI and FeII lines. Abundances for Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Sr, Y, Zr, Ba, La, Ce, Nd, Sm, Eu, and Gd, were determined from equivalent widths and model atmospheres in a differential analysis, with the red giant Eps Vir as the standard star. The different levels of s-process overabundances of barium and mild barium stars were earlier suggested to be related to the stellar metallicity. Contrary to this suggestion, we found in this work no evidence for barium and mild barium to have a different range in metallicity. However, comparing the ratio of abundances of heavy to light s-process elements, we found some evidence that they do not share the same neutron exposure parameter. The exact mechanism controlling this difference is still not clear. As a by-product of this analysis we identify two normal red giants misclass...

  13. Barium aluminate cement: its application

    International Nuclear Information System (INIS)

    The technology of manufacturing barium aluminate cement from barium sulfate and alumina, using a rotary kiln for firing the clinker is described. The method of granulation of the homogenized charge was used. Conditions of using the ''to mud'' method in industry were indicated. The physical and chemical properties of barium aluminate cement are determined and the quality of several batches of cement prepared on a semi-industrial scale and their suitability for making highly refractory concretes are tested. The optimal composition of the concretes is determined as a function of the mixing water and barium aluminate cement contents. Several experimental batches of concretes were used in the linings of furnaces in the steel industry. The suitability of these cements for use in fields other than steelmaking is examined. It is established that calcium aluminate cement has certain limited applications

  14. Discovery of the Barium Isotopes

    OpenAIRE

    SHORE, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; Schuh, A.; Thoennessen, M

    2009-01-01

    Thirty-eight barium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  15. Barium light source method and apparatus

    Science.gov (United States)

    Curry, John J. (Inventor); MacDonagh-Dumler, Jeffrey (Inventor); Anderson, Heidi M. (Inventor); Lawler, James E. (Inventor)

    2002-01-01

    Visible light emission is obtained from a plasma containing elemental barium including neutral barium atoms and barium ion species. Neutral barium provides a strong green light emission in the center of the visible spectrum with a highly efficient conversion of electrical energy into visible light. By the selective excitation of barium ionic species, emission of visible light at longer and shorter wavelengths can be obtained simultaneously with the green emission from neutral barium, effectively providing light that is visually perceived as white. A discharge vessel contains the elemental barium and a buffer gas fill therein, and a discharge inducer is utilized to induce a desired discharge temperature and barium vapor pressure therein to produce from the barium vapor a visible light emission. The discharge can be induced utilizing a glow discharge between electrodes in the discharge vessel as well as by inductively or capacitively coupling RF energy into the plasma within the discharge vessel.

  16. Features of Raman amplification in KGW and barium nitrate crystals at excitation by femtosecond pulses

    International Nuclear Information System (INIS)

    Measurements of Raman amplification in KGd(WO4)2 (KGW) and barium nitrate crystals at femtosecond excitation demonstrate spectral transformation of amplification band with change of pump parameters. The half-height amplification bandwidth of up to 45 nm (650 cm-1) what is 5 times larger than the pumping pulse spectral band 8.5 nm (130 cm-1) was observed for KGW crystal. Implementation of impulsive excitation for the low-frequency vibrations allows estimations of the dephasing times and linewidths for the 87 and 83 cm-1 Raman lines in KGW and barium nitrate

  17. Analysis of europium doped luminescent barium thioaluminate

    Institute of Scientific and Technical Information of China (English)

    张东璞; 喻志农; 薛唯; 章婷; 丁瞾; 王武育

    2010-01-01

    Europium-doped barium thioaluminate sputtering target was synthesized by powder sintering method and thin film was deposited by radio frequency(RF) sputtering.X-ray diffractometer(XRD) pattern indicated that the main compound of the target was BaAl4S7.Oxygen was the main impurity which led to the formation of BaAl2O4.It was shown that both BaAl4S7 and BaAl2S4 were contained in the as-grown thin films and a 471.7 nm emission peak in the PL spectra appeared due to a combination of BaAl4S7:Eu2+ and BaAl2S4:Eu2...

  18. The problem of the barium stars

    Science.gov (United States)

    Bohm-Vitense, E.; Nemec, J.; Proffitt, C.

    1984-01-01

    Ultraviolet observations of barium stars and other cool stars with peculiar element abundances are reported. Those observations attempted to find hot white dwarf companions. Among six real barium stars studied, only Zeta Cap was found to have a white dwarf companion. Among seven mild, or marginal, barium stars studied, at least three were found to have hot subluminous companions. It is likely that all of them have white dwarf companions.

  19. Radioisotope barium sulphate gauge MZB-2

    International Nuclear Information System (INIS)

    A method and the gauge for measuring content of barium sulphate are described. The gauge is intended for fast determination of barium sulphate in barite ore and in output products of the enrichment process. The measuring range 60-100% of BaSO4, accuracy ±1% and measuring time 60 s were reached. The barium sulphate gauge is used in barite mine ''Boguszow'' in Poland. (author)

  20. ONE CASE REPORT OF ACUTE POISONING BY BARIUM CARBONATE

    Institute of Scientific and Technical Information of China (English)

    GE Qin-min; BIAN Fan; WANG Shu-yun; SHEN Sheng-hui

    2009-01-01

    @@ Most barium poisoning cases were caused by oral intake by mistake. Recent years, barium carbonate poisoning has been rare to be reported. Here we reported a case of acute barium carbonate toxication taken orally on purpose.

  1. Barium Depletion in Hollow Cathode Emitters

    Science.gov (United States)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira

    2009-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the ow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  2. Processing science of barium titanate

    Science.gov (United States)

    Aygun, Seymen Murat

    Barium titanate and barium strontium titanate thin films were deposited on base metal foils via chemical solution deposition and radio frequency magnetron sputtering. The films were processed at elevated temperatures for densification and crystallization. Two unifying research goals underpin all experiments: (1) To improve our fundamental understanding of complex oxide processing science, and (2) to translate those improvements into materials with superior structural and electrical properties. The relationships linking dielectric response, grain size, and thermal budget for sputtered barium strontium titanate were illustrated. (Ba 0.6Sr0.4)TiO3 films were sputtered on nickel foils at temperatures ranging between 100-400°C. After the top electrode deposition, the films were co-fired at 900°C for densification and crystallization. The dielectric properties were observed to improve with increasing sputter temperature reaching a permittivity of 1800, a tunability of 10:1, and a loss tangent of less than 0.015 for the sample sputtered at 400°C. The data can be understood using a brick wall model incorporating a high permittivity grain interior with low permittivity grain boundary. However, this high permittivity value was achieved at a grain size of 80 nm, which is typically associated with strong suppression of the dielectric response. These results clearly show that conventional models that parameterize permittivity with crystal diameter or film thickness alone are insufficiently sophisticated. Better models are needed that incorporate the influence of microstructure and crystal structure. This thesis next explores the ability to tune microstructure and properties of chemically solution deposited BaTiO3 thin films by modulation of heat treatment thermal profiles and firing atmosphere composition. Barium titanate films were deposited on copper foils using hybrid-chelate chemistries. An in-situ gas analysis process was developed to probe the organic removal and the

  3. Barium methylphosphonates: synthesis, characterization and mutual interconversions

    Czech Academy of Sciences Publication Activity Database

    Beneš, L.; Melánová, Klára; Svoboda, Jan; Zima, Vítězslav

    Strasbourg: University of Strasbourg, Francie, 2015. P64. [ISIC18 International Symposium on Intercalation Compounds. 31.05.2015-04.06.2015, Strasbourg] R&D Projects: GA ČR(CZ) GA14-13368S Institutional support: RVO:61389013 Keywords : hydrates of barium methylphosphonate * barium hydrogen methylphosphonate * powder X-ray diffraction Subject RIV: CA - Inorganic Chemistry

  4. CT-Guided Percutaneous Transthoracic Localization of Pulmonary Nodules Prior to Video-Assisted Thoracoscopic Surgery Using Barium Suspension

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Nyoung Keun; Park, Chang Min; Kang, Chang Hyun; Jeon, Yoon Kyung; Choo, Ji Yung; Lee, Hyun Ju; Goo, Jin Mo [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    2012-11-15

    To describe our initial experience with CT-guided percutaneous barium marking for the localization of small pulmonary nodules prior to video-assisted thoracoscopic surgery (VATS). From October 2010 to April 2011, 10 consecutive patients (4 men and 6 women; mean age, 60 years) underwent CT-guided percutaneous barium marking for the localization of 10 small pulmonary nodules (mean size, 7.6 mm; range, 3-14 mm): 6 pure ground-glass nodules, 3 part-solid nodules, and 1 solid nodule. A 140% barium sulfate suspension (mean amount, 0.2 mL; range, 0.15-0.25 mL) was injected around the nodules with a 21-gauge needle. The technical details, surgical findings and pathologic features associated with barium localizations were evaluated. All nodules were marked within 3 mm (mean distance, 1.1 mm; range, 0-3 mm) from the barium ball (mean diameter, 9.6 mm; range, 8-16 mm) formed by the injected barium suspension. Pneumothorax occurred in two cases, for which one needed aspiration. However, there were no other complications. All barium balls were palpable during VATS and visible on intraoperative fluoroscopy, and were completely resected. Both the whitish barium balls and target nodules were identifiable in the frozen specimens. Pathology revealed one invasive adenocarcinoma, five adenocarcinoma-in-situ, two atypical adenomatous hyperplasias, and two benign lesions. In all cases, there were acute inflammations around the barium balls which did not hamper the histological diagnosis of the nodules. CT-guided percutaneous barium marking can be an effective, convenient and safe pre-operative localization procedure prior to VATS, enabling accurate resection and diagnosis of small or faint pulmonary nodules.

  5. A new double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jun Sang; Cho, Won Sik; Lee, Sung Woo; Lee, Mun Gyu; Jeon, Jeong Dong; Jaun, Woo Ki; Han, Chung Yul [Inje College Paik Hospital, Pusan (Korea, Republic of)

    1987-12-15

    A new technic of the barium enema was proposed for the better colonic double contrast study with the average 204ml of 50w/v% barium, applied to 109 serial patients. The barium was introduced to sigmoid colon, and then pushed to a mid transverse colon by the air insufflation through an enema syringe, a new device. An advance to cecum is accomplished by the air insufflation and/or the position change of the patient. The barium transfer method was developed for the best spot film exposure, through colon, by the position change of the patient, the tilting of the x-ray table and the air insufflation with the enema syringe. The mean angle of the x-ray table tilted was -10 .deg. at the beginning the barium enema till the barium sent past the splenic flexure, -15 . deg. for the best lateral view of rectum and -18 .deg. for the bet prone PA view of rectosigmoid colon. This was a simple, better and economic double contrast barium enema for the cooperative patients.

  6. Synthesis of barium titanium oxide from barium sulphate and anatase. Study of equimolar mixtures under different atmospheres

    International Nuclear Information System (INIS)

    To enable the ceramization of a barium sulphate-rich radioactive waste the synthesis of barium titanium oxide is studied by using anatase and barium sulphate. As a function of the calcination atmosphere, helium (or air) and Ar/H2, two reactions are studied. A mechanism of barium titanium oxide synthesis in helium (or in air) is proposed

  7. Double contrast barium meal and acetylcysteine

    International Nuclear Information System (INIS)

    In a prospective double blind study, acetylcysteine, a local and systemic respiratory tract mucolytic agent, or a placebo, were given to 100 patients prior to a double contrast barium meal to decrease the gastric mucus viscosity and to make the mucus layer thinner, in order to permit barium to outline the furrows surrounding the areae gastricae instead of the overlying thick mucus. However, acetylcysteine failed to improve either visualization of the areae gastricae or the general quality of the double contrast barium meal. (orig.)

  8. Barium adsorption on the (110) and (111) molybdenum faces

    Energy Technology Data Exchange (ETDEWEB)

    Azizov, U.V.; Sabirov, S.T.; Dzhalilov, S.T. (Tashkentskij Gosudarstvennyj Univ. (USSR))

    1982-07-01

    Barium adsorption on Mo faces (110) and (111) was investigated by thermoemission and Cs surface ionization methods to obtain a more broad representation of barium adsorption at higher temperatures of cathode. Experiments show that the substrate temperature increase at a constant barium concentration results in the formation of small barium islands. At that, barium is under similar energy conditions in the small islands formed on the face (110) independent of relative areas of the islands.

  9. Fabrication of thin target of 138Ba by vacuum evaporation

    International Nuclear Information System (INIS)

    Target fabrication is a highly sophisticated and crucial step in nuclear physics experiments. The success of any nuclear experiment is primarily determined by the quality and quantity of the target. 138Ba target is prepared for the evaporation residue cross section measurement of 188Pt populated through the reaction with 50Ti ion beam. Barium is a highly reactive metal and upon exposure to air at room temperature it will readily react with oxygen. Presently no information is available in the literature for the thin barium target fabrication through vacuum evaporation method. The two previous attempts available in literature were in sputtering method using barium nitrate or barium carbonate

  10. Barium Isotopes in Single Presolar Grains

    Science.gov (United States)

    Pellin, M. J.; Davis, A. M.; Savina, M. R.; Kashiv, Y.; Clayton, R. N.; Lewis, R. S.; Amari, S.

    2001-01-01

    Barium isotopic compositions of single presolar grains were measured by laser ablation laser resonant ionization mass spectrometry and the implications of the data for stellar processes are discussed. Additional information is contained in the original extended abstract.

  11. HUM 130 UOP Coureses/UOP Help

    OpenAIRE

    royal8

    2015-01-01

    HUM-130-Entire-Coures For more course tutorials visit www.uophelp.com HUM 130 Week 1 Assignment Vocabulary Quiz HUM 130 Week 1 CheckPoint Effects Of Religion HUM 130 Week 2 Exercise Indigenous Culture Web Site Reviews HUM 130 Week 2 DQ 1 and DQ 2 HUM 130 Week 3 CheckPoint Hindu Terms Map HUM 130 Week 3 Assignment Hinduism Paper HUM 130 Week 4 CheckPoint Final Project Preparation HUM 130 Week 4 DQ 1 and DQ 2 HUM 130 Week 5 CheckPoint Eastern Religion...

  12. Bacterial Reduction Of Barium Sulphate By Sulphate-Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Luptáková Alena

    2015-12-01

    Full Text Available Acid mine drainage (AMD is a worldwide problem leading to contamination of water sources. AMD are characterized by low pH and high content of heavy metals and sulphates. The barium salts application presents one of the methods for the sulphates removing from AMD. Barium chloride, barium hydroxide and barium sulphide are used for the sulphates precipitation in the form of barium sulphate. Because of high investment costs of barium salts, barium sulphide is recycled from barium sulphate precipitates. It can be recycled by thermic or bacterial reduction of barium sulphate. The aim of our study was to verify experimentally the possibility of the bacterial transformation of BaSO4 to BaS by sulphate-reducing bacteria. Applied BaSO4 came from experiments of sulphates removal from Smolnik AMD using BaCl2.

  13. Venous barium embolization, a rare, potentially fatal complication of barium enema: 2 case reports

    International Nuclear Information System (INIS)

    Venous embolization of barium has been recognized for 4 decades as one of the most dreaded complications of barium enema. Fortunately, the condition is extremely rare. In this report, the radiographic findings in 2 cases of venous embolization (one involving the portal vein and one systematic) are described, and ways to decrease the risk of this complication are discussed. (author)

  14. Thermochemical hydrogen production via a cycle using barium and sulfur - Reaction between barium sulfide and water

    Science.gov (United States)

    Ota, K.; Conger, W. L.

    1977-01-01

    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653-866 C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. An expression was derived for the rate of hydrogen formation.

  15. Characteristics of FEU-130 photomultiplier

    International Nuclear Information System (INIS)

    This paper presents measurements of single-electron spectra for various potential distributions and positions of the light spot on the photocathode. It is shown that, for the FEU-130, the amplitude distribution of single-electron pulses differs greatly from a Poisson distribution. Data on the short-term instability of the FEU-130 are given. Recommendations on divider selection are made. The duration of the FEU-130 single-electron pulse at the base is ca 6 nsec, which can be important for operation in the photon-counting mode

  16. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    International Nuclear Information System (INIS)

    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  17. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    Energy Technology Data Exchange (ETDEWEB)

    Baştürka, Emre; Madakbaş, Seyfullah; Kahraman, Memet Vezir, E-mail: smadakbas@marmara.edu.tr [Department of Chemistry, Marmara University, Istanbul (Turkey)

    2016-03-15

    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  18. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮

    2001-01-01

    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  19. Chemical abundances and kinematics of barium stars

    Science.gov (United States)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Silva, J. V. Sales

    2016-04-01

    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, alpha-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of alpha-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anti-correlated with the metallicity. Our kinematical analysis showed that 90% of the barium stars belong to the thin disk population. Based on their luminosities, none of the barium stars are luminous enough to be an AGB star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  20. Chemical abundances and kinematics of barium stars

    Science.gov (United States)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Sales Silva, J. V.

    2016-07-01

    In this paper, we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scaleheight, radial velocities, abundances of the Na, Al, α-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars cannot be represented by a single Gaussian distribution. The abundances of α-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anticorrelated with the metallicity. Our kinematical analysis showed that 90 per cent of the barium stars belong to the thin disc population. Based on their luminosities, none of the barium stars are luminous enough to be an asymptotic giant branch star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  1. ENG 130 UOP COURSE Tutorial/UOPHELP

    OpenAIRE

    fdgvhbnm

    2015-01-01

    For more course tutorials visit www.uophelp.com   ENG 130 Week 1 Individual Assignment Writing Process Essay   ENG 130 Week 1 DQ   ENG 130 Week 2 Individual Assignment Comparison and Contrast OR Classification Essay: Prewriting EXERCISES   ENG 130 Week 2 DQ   ENG 130 Week 3 Individual Assignment Comparison and Contrast OR Classification Essay   ENG 130 Week 3 Individual Assignment Cause and Effect OR Process Ana...

  2. HUM 130 UOP Course Tutorial / Tutorialoutlet

    OpenAIRE

    lippi

    2015-01-01

    For more course tutorials visit   www.tutorialoutlet.com     HUM 130 Week 1 Assignment Vocabulary Quiz (Uop) HUM 130 Week 1 CheckPoint Effects of Religion (Uop) HUM 130 Week 2 Exercise Indigenous Culture Web Site Reviews (Uop) HUM 130 Week 2 DQ 1 and DQ 2 (Uop) HUM 130 Week 3 CheckPoint Hindu Terms Map (Uop) HUM 130 Week 3 Assignment Hinduism Paper (Uop) HUM 130 Week 4 CheckPoint Final Project Preparation (Uop) HUM 130 Week 4 DQ 1...

  3. Adoption of the EU's target of 130 g CO{sub 2}/km: estimate of contributions 2012-2020 - Final report; Uebernahme des EU-Ziels 130 g CO{sub 2}/km: Abschaetzung Abgabenverlaeufe 2012-2020 - Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Haan, P. de

    2009-12-15

    This final report for the Swiss Federal Office of Energy (SFOE) presents a review of the steps to be taken in order to meet prescriptions on the average emissions of carbon dioxide by motor vehicles for new matriculations in 2015 as prescribed by the European Union. Dues to be paid by vehicle importers who do not attain the 130 g/km limit are discussed. Three steps to be taken are discussed: Simulated basis data for 2008, adaptation of the Swiss reference reduction path and the calculation of the dues to be paid by importers of vehicles are looked at. Various factors used in the calculations are examined. Results are listed and discussed and further research areas are proposed. The results are presented in tabular form in a comprehensive appendix.

  4. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium...

  5. Coprecipitation of iron and silver with barium fluoride

    International Nuclear Information System (INIS)

    Distribution of trace contaminants of iron and silver at coprecipitation of barium fluoride is studied in present work. It is defined that iron almost completely coprecipitated with barium fluoride in wide range of ph 5.5-12. Silver coprecipitated with barium fluoride in ph range 4-7. The value of coprecipitation varies from 94% to 100%.

  6. Recrystallization of 223Ra with barium sulfate

    International Nuclear Information System (INIS)

    In this work, the kinetics of barium sulfate recrystallization has been studied in acidic 0.01 mol dm-3 sodium sulfate solution using 223Ra and 133Ba tracers at very low total radium concentration, i.e. less than 10-13 mol dm-3. It was found that the system follows the homogeneous recrystallization model and that recrystallization rates, inferred by the decrease of 223Ra and 133Ba in the aqueous solution, are fast. Therefore, even at very low concentrations, below the solubility limit, radium will be retained by barium sulfate-a mineral present in the deep underground repository. (author)

  7. Printed Barium Strontium Titanate capacitors on silicon

    International Nuclear Information System (INIS)

    In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography

  8. Printed Barium Strontium Titanate capacitors on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Sette, Daniele [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg); Kovacova, Veronika [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Defay, Emmanuel, E-mail: emmanuel.defay@list.lu [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg)

    2015-08-31

    In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography.

  9. Enterogastroesophageal reflux during barium enema: Report of a case

    International Nuclear Information System (INIS)

    Enterogastric reflux during barium enema examination has been ascribed to various causes including incompetence of the ilepcecal valve, shunt, fistula, excessive barium etc. Recently we have encountered a case of complete enterogastroesphageal regurgitation during barium enema examination performed for the reduction of the ileocolic intuosusception in 6 months old baby. The regurgitation occurred only in the first of two barium enema examinations conducted at one month interval for recurring intussusception. The barium-saline solution used in the present study was not more than 350 ml in quantity. No organic or physical causes of such a complete regurgitation could be determined

  10. 75 FR 19657 - Barium Chloride From China

    Science.gov (United States)

    2010-04-15

    ... Commission found that the domestic interested party group response to its notice of institution (74 FR 31757... COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Notice of Commission determination to conduct a full five-year review concerning the antidumping duty order on...

  11. Impurities in barium titanate posistor ceramics

    Czech Academy of Sciences Publication Activity Database

    Korniyenko, S. M.; Bykov, I. P.; Glinchuk, M. J.; Laguta, V. V.; Belous, A. G.; Jastrabík, Lubomír

    2000-01-01

    Roč. 239, - (2000), s. 1209-1218. ISSN 0015-0193 Institutional research plan: CEZ:AV0Z1010914 Keywords : barium titanate phase transition * ESR * positive temperature coefficient of resistivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.547, year: 2000

  12. 75 FR 20625 - Barium Chloride From China

    Science.gov (United States)

    2010-04-20

    ... established a schedule for the conduct of this review (74 FR 62587, November 30, 2010). Subsequently, counsel... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION:...

  13. Thermal decomposition of barium valerate in argon

    DEFF Research Database (Denmark)

    Torres, P.; Norby, Poul; Grivel, Jean-Claude

    2015-01-01

    The thermal decomposition of barium valerate (Ba(C4H9CO2)(2)/Ba-pentanoate) was studied in argon by means of thermogravimetry, differential thermal analysis, IR-spectroscopy, X-ray diffraction and hot-stage optical microscopy. Melting takes place in two different steps, at 200 degrees C and 280...

  14. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    International Nuclear Information System (INIS)

    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound

  15. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, J.P. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Duarte, G.W. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Research Group in Technology and Information, Centro Universitário Barriga Verde (UNIBAVE), Santa Catarina, SC (Brazil); Caldart, C. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Kniess, C.T. [Post-Graduate Program in Professional Master in Management, Universidade Nove de Julho, São Paulo, SP (Brazil); Montedo, O.R.K.; Rocha, M.R. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Riella, H.G. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Fiori, M.A., E-mail: fiori@unochapeco.edu.br [Post-Graduate Program in Environmental Science, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil); Post-Graduate Program in Technology and Management of the Innovation, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil)

    2015-11-15

    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound.

  16. MicroRNA-130a and -130b enhance activation of hepatic stellate cells by suppressing PPARγ expression: A rat fibrosis model study

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Le; Wang, Jinlong; Lu, Hongwei [Department of General Surgery, The Second Affiliated Hospital of Xi' an Jiaotong University, No.157, West 5th Road, Xi' an, Shaanxi 710004 (China); Zhang, Guoyu [West Hospital Ward 1, Shaanxi Provincial People' s Hospital, No.256, Youyi Road(west), Xi' an, Shaanxi 710068 (China); Liu, Yang; Wang, Jiazhong; Zhang, Yafei; Shang, Hao; Ji, Hong; Chen, Xi; Duan, Yanxia [Department of General Surgery, The Second Affiliated Hospital of Xi' an Jiaotong University, No.157, West 5th Road, Xi' an, Shaanxi 710004 (China); Li, Yiming, E-mail: yiminngli@163.com [Department of General Surgery, The Second Affiliated Hospital of Xi' an Jiaotong University, No.157, West 5th Road, Xi' an, Shaanxi 710004 (China)

    2015-09-25

    Hepatic stellate cells (HSCs) are the primary sources of extracellular matrix (ECM) in normal and fibrotic liver. Peroxisome proliferator-activated receptor gamma (PPARγ) maintains HSCs in a quiescent state, and its downregulation induces HSC activation. MicroRNAs (miRNAs) can induce PPARγ mRNA degradation, but the mechanism by which miRNAs regulate PPARγ in rat HSCs is unclear. This study aimed to investigate some miRNAs which putatively bind to the 3′-untranslated region (3′-UTR) of PPARγ mRNA, and increase expression of ECM genes in rat HSCs. In carbon tetrachloride injection (CCl{sub 4}) and common bile duct ligation (CBDL) liver fibrosis models, miRNAs miR-130a, miR-130b, miR-301a, miR-27b and miR-340 levels were found to be increased and PPARγ expression decreased. Overexpression of miR-130a and miR-130b enhanced cell proliferation by involving Runx3. MiR-130a and miR-130b decreased PPARγ expression by targeting the 3′-UTR of PPARγ mRNA in rat HSC-T6 cells. Transforming growth factor-β1 (TGF-β1) may mediate miR-130a and miR-130b overexpression, PPARγ downregulation, and ECM genes overexpression in cell culture. These findings suggest that miR-130a and miR-130b are involved in downregulation of PPARγ in liver fibrosis. - Highlights: • MiR-130a and miR-130b are increased and PPARγ is decreased in liver fibrosis models. • MiR-130a and miR-130b decreased PPARγ by targeting the 3′-UTR of PPARγ mRNA. • MiR-130a and miR-130b enhanced HSC cell proliferation by involving Runx3. • TGF-β1 may mediate miR-130a and miR-130b overexpression.

  17. MicroRNA-130a and -130b enhance activation of hepatic stellate cells by suppressing PPARγ expression: A rat fibrosis model study

    International Nuclear Information System (INIS)

    Hepatic stellate cells (HSCs) are the primary sources of extracellular matrix (ECM) in normal and fibrotic liver. Peroxisome proliferator-activated receptor gamma (PPARγ) maintains HSCs in a quiescent state, and its downregulation induces HSC activation. MicroRNAs (miRNAs) can induce PPARγ mRNA degradation, but the mechanism by which miRNAs regulate PPARγ in rat HSCs is unclear. This study aimed to investigate some miRNAs which putatively bind to the 3′-untranslated region (3′-UTR) of PPARγ mRNA, and increase expression of ECM genes in rat HSCs. In carbon tetrachloride injection (CCl4) and common bile duct ligation (CBDL) liver fibrosis models, miRNAs miR-130a, miR-130b, miR-301a, miR-27b and miR-340 levels were found to be increased and PPARγ expression decreased. Overexpression of miR-130a and miR-130b enhanced cell proliferation by involving Runx3. MiR-130a and miR-130b decreased PPARγ expression by targeting the 3′-UTR of PPARγ mRNA in rat HSC-T6 cells. Transforming growth factor-β1 (TGF-β1) may mediate miR-130a and miR-130b overexpression, PPARγ downregulation, and ECM genes overexpression in cell culture. These findings suggest that miR-130a and miR-130b are involved in downregulation of PPARγ in liver fibrosis. - Highlights: • MiR-130a and miR-130b are increased and PPARγ is decreased in liver fibrosis models. • MiR-130a and miR-130b decreased PPARγ by targeting the 3′-UTR of PPARγ mRNA. • MiR-130a and miR-130b enhanced HSC cell proliferation by involving Runx3. • TGF-β1 may mediate miR-130a and miR-130b overexpression

  18. Performance of cement solidification with barium for high activity liquid waste including sulphate

    International Nuclear Information System (INIS)

    The target liquid waste to be solidified is generated from PWR primary loop spent resin treatment with sulphate acid, so, its main constituent is sodium sulphate and the activity of this liquid is relatively high. Waste form of this liquid waste is considered to be a candidate for the subsurface disposal. The disposed waste including sulphate is anticipated to rise a concentration of sulphate ion in the ground water around the disposal facility and it may cause degradation of materials such as cement and bentonite layer and comprise the disposal facility. There could be two approaches to avoid this problem, the strong design of the disposal facility and the minimization of sulphaste ion migration from the solidified waste. In this study, the latter approach was examined. In order to keep the low concentration of sulphate ion in the ground water, it is effective to make barium sulphate by adding barium compound into the liquid waste in solidification. However, adding equivalent amount of barium compound with sulphate ion causes difficulty of mixing, because production of barium sulphate causes high viscosity. In this study, mixing condition after and before adding cement into the liquid waste was estimated. The mixing condition was set with consideration to keep anion concentration low in the ground water and of mixing easily enough in practical operation. Long term leaching behavior of the simulated solidified waste was also analyzed by PHREEQC. And the concentration of the constitution affected to the disposal facility was estimated be low enough in the ground water. (author)

  19. Liquid-Phase Processing of Barium Titanate Thin Films

    Science.gov (United States)

    Harris, David Thomas

    . Our system exhibits flux-film-substrate interactions that can lead to dramatic changes to the microstructure. This effect is especially pronounced onc -sapphire, with Al diffusion from the substrate leading to formation of an epitaxial BaAl2O4 second phase at the substrate-film interface. The formation of this second phase in the presence of a liquid phase seeds {111} twins that drive abnormal grain growth. The orientation of the sapphire substrate determines the BaAl2O 4 morphology, enabling control the abnormal grain growth behavior. CuO additions leads to significant grain growth at 900 °C, with average grain size approaching 500 nm. The orthorhombic-tetragonal phase transition is clearly observable in temperature dependent measurements and both linear and nonlinear dielectric properties are improved. All films containing CuO are susceptible to aging. A number of other systems were investigated for efficacy at temperatures below 900 °C. Pulsed laser deposition was used to study flux + BaTiO 3 targets, layered flux films, and in situ liquids. RF-magnetron sputtering using a dual-gun approach was used to explore integration on flexible foils with Ba1-xSrxTiO3. Many of these systems were based on the BaO-B2O3 system, which has proven effective in thin films, multilayer ceramic capacitors, and bulk ceramics. Modifiers allow tailoring of the microstructure at 900 °C, however no compositions were found, and no reports exist in the open literature, that provide significant grain growth or densification below 900 °C. Liquid phase fluxes offer a promising path forward for low temperature processing of barium titanate, with the ultimate goal of integration with metalized silicon substrates. This work demonstrates significant improvements to dielectric properties and the necessity of understanding interactions in the film-flux-substrate system.

  20. Radioactive Barium Ion Trap Based on Metal-Organic Framework for Efficient and Irreversible Removal of Barium from Nuclear Wastewater.

    Science.gov (United States)

    Peng, Yaguang; Huang, Hongliang; Liu, Dahuan; Zhong, Chongli

    2016-04-01

    Highly efficient and irreversible capture of radioactive barium from aqueous media remains a serious task for nuclear waste disposal and environmental protection. To address this task, here we propose a concept of barium ion trap based on metal-organic framework (MOF) with a strong barium-chelating group (sulfate and sulfonic acid group) in the pore structures of MOFs. The functionalized MOF-based ion traps can remove >90% of the barium within the first 5 min, and the removal efficiency reaches 99% after equilibrium. Remarkably, the sulfate-group-functionalized ion trap demonstrates a high barium uptake capacity of 131.1 mg g(-1), which surpasses most of the reported sorbents and can selectively capture barium from nuclear wastewater, whereas the sulfonic-acid-group-functionalized ion trap exhibits ultrafast kinetics with a kinetic rate constant k2 of 27.77 g mg(-1) min(-1), which is 1-3 orders of magnitude higher than existing sorbents. Both of the two MOF-based ion traps can capture barium irreversibly. Our work proposes a new strategy to design barium adsorbent materials and provides a new perspective for removing radioactive barium and other radionuclides from nuclear wastewater for environment remediation. Besides, the concrete mechanisms of barium-sorbent interactions are also demonstrated in this contribution. PMID:26999358

  1. Prospects for Barium Tagging in Gaseous Xenon

    International Nuclear Information System (INIS)

    Tagging events with the coincident detection of a barium ion would greatly reduce the background for a neutrino-less double beta decay search in xenon. This paper describes progress towards realizing this goal. It outlines a source that can produce large quantities of Ba++ in gas, shows that this can be extracted to vacuum, and demonstrates a mechanism by which the Ba++ can be efficiently converted to Ba+ as required for laser identification.

  2. Production of translationally cold barium monohalide ions

    OpenAIRE

    DePalatis, M. V.; Chapman, M.S.

    2013-01-01

    We have produced sympathetically cooled barium monohalide ions BaX$^+$ (X = F, Cl, Br) by reacting trapped, laser cooled Ba$^+$ ions with room temperature gas phase neutral halogen-containing molecules. Reaction rates for two of these (SF$_6$ and CH$_3$Cl) have been measured and are in agreement with classical models. BaX$^+$ ions are promising candidates for cooling to the rovibrational ground state, and our method presents a straightforward way to produce these polar molecular ions.

  3. Chemical abundances and kinematics of barium stars

    CERN Document Server

    de Castro, D B; Roig, F; Jilinski, E; Drake, N A; Chavero, C; Silva, J V Sales

    2016-01-01

    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, $alpha$-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code {\\sc moog}. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of $alpha$-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heav...

  4. Barium hexaferrite nanoparticles: Synthesis and magnetic properties

    Energy Technology Data Exchange (ETDEWEB)

    Martirosyan, K.S., E-mail: karen.martirosyan@utb.edu [Department of Chemical and Biomolecular Engineering, University of Houston, Houston, TX 77204 (United States); Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Department of Electrical and Computer Engineering, University of Houston, Houston, TX 77204 (United States); Galstyan, E. [Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Hossain, S.M.; Wang Yiju [Department of Electrical and Computer Engineering, University of Houston, Houston, TX 77204 (United States); Litvinov, D. [Department of Chemical and Biomolecular Engineering, University of Houston, Houston, TX 77204 (United States); Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Department of Electrical and Computer Engineering, University of Houston, Houston, TX 77204 (United States)

    2011-01-15

    Carbon combustion synthesis is applied to rapid and energy efficient fabrication of crystalline barium hexaferrite nanoparticles with the average particle size of 50-100 nm. In this method, the exothermic oxidation of carbon nanoparticles with an average size of 5 nm with a surface area of 80 m{sup 2}/g generates a self-propagating thermal wave with maximum temperatures of up to 1000 deg. C. The thermal front rapidly propagates through the mixture of solid reactants converting it to the hexagonal barium ferrite. Carbon is not incorporated in the product and is emitted from the reaction zone as a gaseous CO{sub 2}. The activation energy for carbon combustion synthesis of BaFe{sub 12}O{sub 19} was estimated to be 98 kJ/mol. A complete conversion to hexagonal barium ferrite is obtained for carbon concentration exceeding 11 wt.%. The magnetic properties H{sub c}{approx}3000 Oe and M{sub s}{approx}50.3 emu/g of the compact sintered ferrites compare well with those produced by other synthesis methods.

  5. Barium hexaferrite nanoparticles: Synthesis and magnetic properties

    International Nuclear Information System (INIS)

    Carbon combustion synthesis is applied to rapid and energy efficient fabrication of crystalline barium hexaferrite nanoparticles with the average particle size of 50-100 nm. In this method, the exothermic oxidation of carbon nanoparticles with an average size of 5 nm with a surface area of 80 m2/g generates a self-propagating thermal wave with maximum temperatures of up to 1000 deg. C. The thermal front rapidly propagates through the mixture of solid reactants converting it to the hexagonal barium ferrite. Carbon is not incorporated in the product and is emitted from the reaction zone as a gaseous CO2. The activation energy for carbon combustion synthesis of BaFe12O19 was estimated to be 98 kJ/mol. A complete conversion to hexagonal barium ferrite is obtained for carbon concentration exceeding 11 wt.%. The magnetic properties Hc∼3000 Oe and Ms∼50.3 emu/g of the compact sintered ferrites compare well with those produced by other synthesis methods.

  6. Lifetime measurements in chiral nucleus 130Cs

    Institute of Scientific and Technical Information of China (English)

    WANG Lie-Lin; WU Xiao-Guang; ZHU Li-Hua; LI Guang-Sheng; HAO Xin; ZHENG Yun; HE Chuang-Ye; WANG Lei; LI Xue-Qin; LIU Ying; PAN Bo; LI Zhong-Yu; DING Huai-Bo

    2009-01-01

    The level lifetimes in partner bands of 130Cs have been measured using the Doppler Shift Attenuation method. The high-spin states of 130Cs were populated via fusion evaporation reaction 124Sn(11B,5n)130Cs at a beam energy of 65 MeV. The absolute M1 and E2 transition probabilities have been deduced. The results indicate that the partner bands of 130Cs manifest the chiral properties.

  7. Test of Chirality in Nucleus 130Cs

    Institute of Scientific and Technical Information of China (English)

    吴晓光; 王烈林; 竺礼华; 李广生; 郝昕; 郑云; 贺创业; 李雪琴; 潘波; 刘颖; 汪雷; 赵延新; 李忠宇; 丁怀博

    2012-01-01

    The level lifetimes in partner bands of 130Cs have been measured using the Doppler Shift Attenuation method (DSAM). The high-spin states of 130Cs were populated via fusion evap- oration reaction 124Sn(11B; 5n)130Cs at a beam energy of 65 MeV. The absolute M1 and E2 transition probabilities have been deduced. The results indicate that the partner bands of 130Cs indeed manifest chiral properties.

  8. Lanthanide doped strontium-barium cesium halide scintillators

    Science.gov (United States)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew

    2015-06-09

    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  9. 21 CFR 131.130 - Evaporated milk.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Evaporated milk. 131.130 Section 131.130 Food and... CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.130 Evaporated milk. (a) Description. Evaporated milk is the liquid food obtained by partial removal of water only from milk....

  10. 21 CFR 163.130 - Milk chocolate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk chocolate. 163.130 Section 163.130 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.130 Milk chocolate. (a) Description. (1) Milk chocolate is the solid or semiplastic food prepared by intimately mixing and...

  11. 46 CFR 130.450 - Machinery alarms.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Machinery alarms. 130.450 Section 130.450 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS VESSEL CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Automation of Unattended Machinery Spaces § 130.450 Machinery alarms....

  12. 5 CFR 185.130 - Motions.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Motions. 185.130 Section 185.130 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.130 Motions. (a) Any application to the ALJ for an order or ruling shall be by motion....

  13. 46 CFR 126.130 - Cranes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes. 126.130 Section 126.130 Shipping COAST GUARD... § 126.130 Cranes. (a) Except as provided by paragraph (b) of this section, cranes, if installed, must... chapter. (b) The manufacturer of a crane may have tests and inspections conducted in compliance with §...

  14. 21 CFR 135.130 - Mellorine.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Mellorine. 135.130 Section 135.130 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION FROZEN DESSERTS Requirements for Specific Standardized Frozen Desserts § 135.130 Mellorine....

  15. 46 CFR 130.120 - Propulsion control.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Propulsion control. 130.120 Section 130.120 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS VESSEL CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Vessel Control § 130.120 Propulsion control. (a) Each vessel must have—...

  16. 46 CFR 130.430 - Pilothouse control.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Pilothouse control. 130.430 Section 130.430 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS VESSEL CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Automation of Unattended Machinery Spaces § 130.430 Pilothouse control....

  17. 46 CFR 130.310 - Radar.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Radar. 130.310 Section 130.310 Shipping COAST GUARD... EQUIPMENT AND SYSTEMS Navigational Equipment § 130.310 Radar. Each vessel of 100 or more gross tons must be fitted with a general marine radar in the pilothouse....

  18. 21 CFR 225.130 - Equipment.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Equipment. 225.130 Section 225.130 Food and Drugs... CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Facilities and Equipment § 225.130 Equipment. Equipment shall be capable of producing a medicated feed of intended potency and purity, and shall...

  19. 13 CFR 130.440 - Maximum grant.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Maximum grant. 130.440 Section 130.440 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS § 130.440 Maximum grant. No recipient shall receive an SBDC grant exceeding the greater of the minimum statutory amount, or its pro rata share of...

  20. 13 CFR 130.430 - Application decisions.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Application decisions. 130.430 Section 130.430 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS § 130.430 Application decisions. (a) The AA/SBDCs may approve, conditionally approve, or...

  1. 7 CFR 58.130 - Health.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Health. 58.130 Section 58.130 Agriculture Regulations... Plants Approved for USDA Inspection and Grading Service 1 Personnel, Cleanliness and Health § 58.130 Health. No person afflicted with a communicable disease shall be permitted in any room or...

  2. 21 CFR 820.130 - Device packaging.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Device packaging. 820.130 Section 820.130 Food and... QUALITY SYSTEM REGULATION Labeling and Packaging Control § 820.130 Device packaging. Each manufacturer shall ensure that device packaging and shipping containers are designed and constructed to protect...

  3. Spasmolytic effect of peppermint oil in barium during double-contrast barium enema compared with Buscopan

    Energy Technology Data Exchange (ETDEWEB)

    Asao, T.; Kuwano, H.; Ide, M.; Hirayama, I.; Nakamura, J.-I.; Fujita, K.-I.; Horiuti, R

    2003-04-01

    AIM: To evaluate the efficacy of peppermint oil in barium as a spasmolytic agent during a double-contrast barium enema (DCBE). MATERIALS AND METHODS: A total of 383 DCBEs with positive results from occult blood tests were assessed. Patients were assigned to one of four groups: peppermint in barium (n=91), peppermint in tube (n=90), Buscopan (n=105), or no treatment (n=97). After a screening sigmoidoscopy, the DCBEs were performed using air as a distending gas. In the Buscopan group, the DCBE was performed with an intramuscular injection of 20 mg Buscopan at the start of the examination. Patients in the no-treatment group underwent DCBE without any spasmolytic agent. A peppermint oil preparation (30 ml) was mixed in the barium solution for patients in the peppermint-in-barium group, and the same dose of peppermint oil was included in the enema tube in the peppermint-in-tube group. The presence of spasm on a series of spot films was evaluated without information about the type of spasmolytic agent used. RESULTS: The percentage of patients in the four groups (no treatment, Buscopan, peppermint in tube, and peppermint in barium) with absence of spasm in the entire colon on the series of spot films was 13.4, 38.1, 41.8, and 37.8%, respectively. In the group using peppermint oil or Buscopan, the rate of patients with non-spasm examination was higher than that in no-treatment group (p<0.0005). Peppermint oil had the same spasmolytic effect as the systemic administration of Buscopan in the transverse and descending colon. Peppermint oil had a stronger effect in the caecum and the ascending colon than a Buscopan injection (p<0.005). There was no advantage to placing peppermint oil in the enema tube over mixing it in the barium solution. A total of 157 polyps were found during the DCBE procedures, and no differences were observed in the number of lesions among the four groups. Peppermint oil did not impair image quality. CONCLUSION: Barium solution mixed with peppermint oil

  4. Barium enema findings of milk allergy in infants

    International Nuclear Information System (INIS)

    We wanted to evaluate the barium enema findings of milk allergy in infants. Retrospective evaluation of the plain abdominal radiography and barium enema findings was performed in fifteen young infants suffering with milk allergy. The presence of gaseous distension, rectal gas, paralytic ileus and mechanical obstruction was evaluated on the plain radiography. The presence of spasm, a transitional zone, a reversed rectosigmoid index and mucosal irregularity was analyzed on the barium enema; the presence of barium retention was also evaluated on 24-hour-delayed plain radiography. Paralytic ileus was the most common finding on the plain radiography (93%). On the barium enema, continuous spasm of the colon, ranging from the rectum to the descending colon, was revealed in ten infants (67%). A transitional zone was observed in one infant and a reversed rectosigmoid index was revealed in four. Mucosal irregularity was observed in two infants. Barium retention was demonstrated in 11 of fifteen cases: throughout the entire colon (n = 3), from the rectum to the descending colon (n = 7), and up to the transverse colon (n = 1). The most common barium enema finding of milk allergy in infants was spasm of the distal colon. The other findings were a transitional zone, a reversed rectosigmoid index, mucosal irregularity and barium retention

  5. Synthesis of double perxenate of lanthanum and barium

    International Nuclear Information System (INIS)

    Synthesis of double perxenate of lanthanum and barium on the basis of sodium perxenate and lanthanum and barium acetates, is described. The obtained compound is characterized by means of element analysis, x-ray-electron-, IR- and RS-spectroscopy. Its thermal stability and water solubility are determined

  6. BARIUM IN TEETH AS INDICATOR OF BODY BURDEN

    Science.gov (United States)

    A study was conducted to determine the biological availability of naturally occurring barium in a municipal drinking water by the analysis of barium in deciduous teeth of children. The grade school children of two Illinois towns were chosen for the study. The towns were chosen ba...

  7. Colour centres in barium hexaaluminate (phase I)

    International Nuclear Information System (INIS)

    Colour centres produced by X-ray irradiation of barium hexaaluminate (phase I) with β-alumina structure are studied by electron paramagnetic resonance, optical absorption, and thermally stimulated luminescence. It is shown that in addition to the F+ centres characteristic of β-alumina phases, this compound presents other colour centres such as F, O-, and possibly V-type centres. The stability of these defects is investigated by means of thermal bleaching experiments and thermally stimulated luminescence. An alternative model to the generally accepted one is proposed, for the F+ centres, together with a mechanism of defect formation. (author)

  8. Short-cavity squeezing in barium

    Science.gov (United States)

    Hope, D. M.; Bachor, H-A.; Manson, P. J.; Mcclelland, D. E.

    1992-01-01

    Broadband phase sensitive noise and squeezing were experimentally observed in a system of barium atoms interacting with a single mode of a short optical cavity. Squeezing of 13 +/- 3 percent was observed. A maximum possible squeezing of 45 +/- 8 percent could be inferred for out experimental conditions, after correction for measured loss factors. Noise reductions below the quantum limit were found over a range of detection frequencies 60-170 MHz and were best for high cavity transmission and large optical depths. The amount of squeezing observed is consistent with theoretical predictions from a full quantum statistical model of the system.

  9. Duodenal diverticula demonstrated by barium examination

    Energy Technology Data Exchange (ETDEWEB)

    Christiansen, T.; Thommesen, P.

    An investigation for biliary tract calculi and food-stimulated gastro-oesophageal reflux was carried out in 37 patients with duodenal diverticula demonstrated by barium examination. Sixty per cent of the diverticula were located in the descending part of the duodenum. Biliary tract calculi were demonstrated in 38 per cent and food-stimulated gastro-oesophageal reflux in 81 per cent of the patients. The detection of a duodenal diverticulum should result in a supplementary investigation for gallstones and gastrooesophageal reflux and its sequelae.

  10. Barium dithionate as an EPR dosemeter.

    Science.gov (United States)

    Baran, M P; Bugay, O A; Kolesnik, S P; Maksimenko, V M; Teslenko, V V; Petrenko, T L; Desrosiers, M F

    2006-01-01

    Electron paramagnetic resonance (EPR) dosimetry is growing in popularity and this success has encouraged the search for other dosimetric materials. Previous studies of gamma-irradiated barium dithionate (BaS(2)O(6) x 2H(2)O) have shown promise for its use as a radiation dosemeter. This work studies in greater detail several essential attributes of the system. Special attention has been directed to the study of EPR response dependences on microwave power, irradiation temperature, minimum detectable dose and post-irradiation stability. PMID:16565205

  11. Scattering lengths of calcium and barium isotopes

    OpenAIRE

    Dammalapati, U.; Willmann, L.; Knoop, S.

    2011-01-01

    We have calculated the s-wave scattering length of all the even isotopes of calcium (Ca) and barium (Ba), in order to investigate the prospect of Bose-Einstein condensation (BEC). For Ca we have used an accurate molecular potential based on detailed spectroscopic data. Our calculations show that Ca does not provide other isotopes alternative to the recently Bose condensed 40Ca that suffers strong losses because of a very large scattering length. For Ba we show by using a model potential that ...

  12. Barium cardiotoxicity: Relationship between ultrastructural damage and mechanical effects.

    Science.gov (United States)

    Delfino, G; Amerini, S; Mugelli, A

    1988-01-01

    The ultrastructural damage in guinea-pig ventricular strips caused by barium was analysed. At a concentration of 1 mmol/litre, barium chloride caused a dramatic increase in the developed tension associated with the onset of automaticity. The ultrastructural analysis demonstrated that barium caused notable and consistent alterations which affected most myocyte components. Various degenerative aspects were observed in mitochondria and in the contractile apparatus. Glycogen deposits were completely depleted. Preparations driven at 4 Hz (i.e. the rate of spontaneous firing of barium-treated preparations) showed moderate ultrastructural alterations, thus demonstrating that the increase in the rate of beating is not the only determinant of the observed damage. These results suggest that the myocardial toxicity of barium is due not only to the well-known modifications in membrane permeability, but possibly also to alterations in cell function. PMID:20702358

  13. Barium and radium migration in unconsolidated Canadian geological materials

    International Nuclear Information System (INIS)

    This report describes the results of laboratory studies on the distribution coefficients of radium and barium in samples of unconsolidated geologic materials. Graphs of Ksub(d) versus solution concentration for the respective elements showed constant Ksub(d) values in the low concentration range suggesting that, at low concentrations, a distribution coefficient is a valid means of representing the geochemical reactions of both barium and radium. The Ksub(d) values for barium range between 60 and 3500 ml/g. The values appear to be influenced by the amount of barium occurring naturally in the soil materials and thus there is little possiblility of using barium as an analog of radium in laboratory experiments. The Ksub(d) values of radium vary from 50 to 1000 ml/g indicating that a wide range of geological materials have a substantial capacity to retard the migration of radium

  14. The Novel Formation of Barium Titanate Nanodendrites

    Directory of Open Access Journals (Sweden)

    Chien-Jung Huang

    2014-01-01

    Full Text Available The barium titanate (BaTiO3 nanoparticles with novel dendrite-like structures have been successfully fabricated via a simple coprecipitation method, the so-called BaTiO3 nanodendrites (BTNDs. This method was remarkable, fast, simple, and scalable. The growth solution is prepared by barium chloride (BaCl2, titanium tetrachloride (TiCl4, and oxalic acid. The shape and size of BaTiO3 depend on the amount of added BaCl2 solvent. To investigate the influence of amount of BaCl2 on BTNDs, the amount of BaCl2 was varied in the range from 3 to 6 mL. The role of BaCl2 is found to have remarkable influence on the morphology, crystallite size, and formation of dendrite-like structures. The thickness and length of the central stem of BTND were ~300 nm and ~20 μm, respectively. The branchings were found to occur at irregular intervals along the main stem. Besides, the formation mechanism of BTND is proposed and discussed.

  15. High resolution studies of barium Rydberg states

    International Nuclear Information System (INIS)

    The subtle structure of Rydberg states of barium with orbital angular momentum 0, 1, 2 and 3 is investigated. Some aspects of atomic theory for a configuration with two valence electrons are reviewed. The Multi Channel Quantum Defect Theory (MQDT) is concisely introduced as a convenient way to describe interactions between Rydberg series. Three high-resolution UV studies are presented. The first two, presenting results on a transition in indium and europium serve as an illustration of the frequency doubling technique. The third study is of hyperfine structure and isotope shifts in low-lying p states in Sr and Ba. An extensive study of the 6snp and 6snf Rydberg states of barium is presented with particular emphasis on the 6snf states. It is shown that the level structure cannot be fully explained with the model introduced earlier. Rather an effective two-body spin-orbit interaction has to be introduced to account for the observed splittings, illustrating that high resolution studies on Rydberg states offer an unique opportunity to determine the importance of such effects. Finally, the 6sns and 6snd series are considered. The hyperfine induced isotope shift in the simple excitation spectra to 6sns 1S0 is discussed and attention is paid to series perturbers. It is shown that level mixing parameters can easily be extracted from the experimental data. (Auth.)

  16. NANOSCALE BARIUM HYDROSILICATES: CHOOSING THE SYNTHESIS TECHNOLOGY

    Directory of Open Access Journals (Sweden)

    GRISHINA Anna Nikolaevna

    2013-08-01

    Full Text Available Cement concretes are the most used materials in modern civil engineering. Due to that such materials draw great attention both in the Russian Federation and abroad. The possibility to enhance the manufacturability and operational properties of concretes results in significant reduction of overall operating costs. Many enhancement methods have been elaborated. Among them there is one based on introduction of calcium hydrosilicates into construction composition. The authors set up a hypothesis that similarity between properties and structures of different hydrosilicates (for example, alkaline earth metals and metals of the second group will provide similar increased operational characteristics. The specialists of Research and Educational Center «Nanotechnology» are developing cement composites nanomodification methods which include introduction of nanodimensional barium hydrosilicates particles. The synthesis of barium hydrosilicates particles can be done with the use of many technologies, different by energy consumption or performing complexity. Taking into account both these factors, one can assume that low-temperature sol-gel synthesis from diluted water solutions is the proper technology. The present paper shows that this assumption is correct. The selection of certain technology is made by the means of multiobjective optimization, which is in turn is performed by the means of linear scalarization. This method, while not always giving the Pareto optimal solutions, can be easily implemented. The particle size distribution is taken into consideration during selection of objectives and weights. It is shown that selected technology allows manufacturing nanoparticles with median size about 30 nm.

  17. Coprecipitation of europium with barium sulphate

    International Nuclear Information System (INIS)

    The distribution behaviour of the trivalent europium ion at a micro-component scale, between barium sulphate and aqueous solution, was studied at ambient temperature. Experiments were carried out using radioactive tracers. Results indicate an enrichment of the micro component in the solid phase relative to the solution. The effects of the concentrations of the micro and macro-elements on the coprecipitation have been examined. Europium distribution coefficient DEu increases from 1.1 ± 0.2 to 3.2 ± 0.4 when initial europium concentration decreases from more than 17 x 10-5 to 1.4 x 10-5 M, in sulphuric media with SO42- in excess or CBa2+/CSO42- Eu. The coprecipitation of europium with barium sulphate as a heterovalent solid-solution is described by heterogeneous model obeying the Doerner and Hoskins logarithmic partition law. The weaker partition coefficients lower than unity (λ = 0.25 when CEu(III) ∼ 1.4 x 10-5 M and λ = 0.13 when CBa2+/CSO42- -5 ≤ CEu(III) = 153.5 x 10-5 M) lead to crystals increasingly enriched in the trace element. (orig.)

  18. Photon attenuation characteristics of barium enriched cement

    International Nuclear Information System (INIS)

    Nuclear radiations are widely used in several applications of nuclear sciences, medicine and industry. In the design and construction of installations housing high intensity radioactive sources and other radiation generating equipment, a variety of shielding materials are used to minimise the exposure to the individuals. Among the materials used, lead is best known for radiation shielding due to its high density and atomic number. However, in construction of radiation facilities, lead in the form of bricks or slabs cannot be substituted for cement as building material. As an alternative, barium enriched cement, which apart from better compressive strength, smoother surface finish and high abrasive resistance, offers adequate shielding to gamma radiations. In the present work, attenuation properties of commercial as well as barium enriched cements have been studied and compared with that of lead for photons of 662 and 1250 keV emitted from 137Cs and 60Co, respectively. Although photon attenuation data can be obtained by mixture rule theoretically, it is necessary to determine this data experimentally before use

  19. Impact of microRNA-130a on the neutrophil proteome

    DEFF Research Database (Denmark)

    Pedersen, Corinna Cavan; Refsgaard, Jan Christian; Østergaard, Ole;

    2015-01-01

    by in silico prediction algorithms one at a time. However, one miRNA can have many different targets, which may vary depending on the context. Here, we investigated the effect of miR-130a on the proteome of a murine and a human myeloid cell line. RESULTS: Using pulsed stable isotope labelling of amino acids...... with the impact on protein levels. We used RAIN, a novel database for miRNA-protein and protein-protein interactions, to identify putative miR-130a targets. In the 32Dcl3 clone, putative targets were more up-regulated than the remaining quantified proteins following miR-130a inhibition, and three significantly...... derepressed proteins (NFYC, ISOC1, and CAT) are putative miR-130a targets with good RAIN scores. We also created a network including inferred, putative neutrophil miR-130a targets and identified the transcription factors Myb and CBF-β as putative miR-130a targets, which may regulate the primary granule...

  20. 21 CFR 168.130 - Cane sirup.

    Science.gov (United States)

    2010-04-01

    ... sirup” or “Sugar cane sirup”. Alternatively, the word “sirup” may be spelled “syrup”. (d) Label... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cane sirup. 168.130 Section 168.130 Food and Drugs... § 168.130 Cane sirup. (a) Cane sirup is the liquid food derived by concentration and heat treatment...

  1. C-130 Automated Digital Data System (CADDS)

    Science.gov (United States)

    Scofield, C. P.; Nguyen, Chien

    1991-01-01

    Real time airborne data acquisition, archiving and distribution on the NASA/Ames Research Center (ARC) C-130 has been improved over the past three years due to the implementation of the C-130 Automated Digital Data System (CADDS). CADDS is a real time, multitasking, multiprocessing ROM-based system. CADDS acquires data from both avionics and environmental sensors inflight for all C-130 data lines. The system also displays the data on video monitors throughout the aircraft.

  2. Do all barium stars have a white dwarf companion?

    Science.gov (United States)

    Dominy, J. F.; Lambert, D. L.

    1983-01-01

    International Ultraviolet Explorer short-wavelength, low-dispersion spectra were analyzed for four barium, two mild barium, and one R-type carbon star in order to test the hypothesis that the barium and related giants are produced by mass transfer from a companion now present as a white dwarf. An earlier tentative identification of a white dwarf companion to the mild barium star Zeta Cyg is confirmed. For the other stars, no ultraviolet excess attributable to a white dwarf is seen. Limits are set on the bolometric magnitude and age of a possible white dwarf companion. Since the barium stars do not have obvious progenitors among main-sequence and subgiant stars, mass transfer must be presumed to occur when the mass-gaining star is already on the giant branch. This restriction, and the white dwarf's minimum age, which is greater than 8 x 10 to the 8th yr, determined for several stars, effectively eliminates the hypothesis that mass transfer from an asymptotic giant branch star creates a barium star. Speculations are presented on alternative methods of producing a barium star in a binary system.

  3. Designed microstructures in textured barium hexaferrite

    Science.gov (United States)

    Hovis, David Brian

    It is a fundamental principle of materials science that the microstructure of a material defines its properties and ultimately its performance for a given application. A prime example of this can be found in the large conch shell Strombus gigas, which has an intricate microstructure extending across five distinct length scales. This microstructure gives extraordinary damage tolerance to the shell. The structure of Strombus gigas cannot be replicated in a modern engineering ceramic with any existing processing technique, so new processing techniques must be developed to apply this structure to a model material. Barium hexaferrite was chosen as a model material to create microstructures reminiscent of Strombus gigas and evaluate its structure-property relations. This work describes novel processing methods to produce textured barium hexaferrite with no coupling between the sample geometry and the texture direction. This technique, combining magnetic field-assisted gelcasting with templated grain growth, also allows multilayer samples to be fabricated with different texture directions in adjacent layers. The effects of adding either B2O3 or excess BaCO 3 on the densification and grain growth of barium hexaferrite was studied. The texture produced using this technique was assessed using orientation imaging microscopy (OIM) at Oak Ridge National Laboratory. These measurements showed peak textures as high as 60 MRD and sharp interfaces between layers cast with different texture directions. The effect of oxygen on the quality of gelcasting is also discussed, and it is shown that with proper mold design, it is possible to gelcast multiple layers with differing texture directions without delamination. Monolithic and multilayer samples were produced and tested in four point bending to measure the strength and work of fracture. Modulus measurements, made with the ultrasonic pulse-echo technique, show clear signs of microcracking in both the isotropic and textured samples

  4. Chemical composition of Eu2+ luminescence in the barium hexaaluminates

    International Nuclear Information System (INIS)

    This paper consists of two parts. In the first part the chemical composition of two kinds of barium hexaaluminate (one poor and one rich in barium) is explained using the local electroneutrality concept. In the second part a reinvestigation of the Eu2+ luminescence in these compounds is reported. The emission spectrum of each of the two compounds shows a blue and a green emission bank. The blue emission bank is ascribed to Eu2+ ions at barium sites, whereas the green emission band is identified with Eu2+ ions incorporated at aluminum sites within spinel blocks of the structure

  5. Magic Wavelength of an Optical Clock Transition of Barium

    International Nuclear Information System (INIS)

    Similar to most of the other alkaline earth elements, barium atoms can be candidates for optical clocks, thus the magic wavelength for an optical lattice is important for the clock transition. We calculate the magic wavelength of a possible clock transition between 6s21S0 and 6s5d3 D2 states of barium atoms. Our theoretical result shows that there are three magic wavelengths 615.9nm, 641.2nm and 678.8nm for a linearly polarized optical lattice laser for barium. (atomic and molecular physics)

  6. 33 CFR 156.130 - Connection.

    Science.gov (United States)

    2010-07-01

    ... operations unless it is: (1) A bolted or full threaded connection; or (2) A quick-connect coupling acceptable... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connection. 156.130 Section 156....130 Connection. (a) Each person who makes a connection for transfer operations shall: (1) Use...

  7. 13 CFR 130.460 - Budget justification.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Budget justification. 130.460... CENTERS § 130.460 Budget justification. The SBDC Director, as a part of the renewal application, or the... submit to the SBA Project Officer the budget justification for the upcoming budget period. The...

  8. 13 CFR 130.610 - General terms.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false General terms. 130.610 Section 130.610 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS... CFR 143 and applicable OMB Circulars....

  9. 13 CFR 130.110 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 130.110 Section 130.110 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS... awards Federal funds and recipient organizations provide services to the small business...

  10. 13 CFR 130.100 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Introduction. 130.100 Section 130.100 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS... the small business community by linking the resources of Federal, State and local governments with...

  11. 13 CFR 130.200 - Eligible entities.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Eligible entities. 130.200 Section 130.200 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT... or university; (3) A college or school of business, engineering, commerce or agriculture; (4)...

  12. 13 CFR 130.420 - Renewal applications.

    Science.gov (United States)

    2010-01-01

    ... Program Manager and Grants Management Specialist shall review the renewal application for conformity with... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Renewal applications. 130.420 Section 130.420 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS...

  13. 9 CFR 130.49 - Exemptions.

    Science.gov (United States)

    2010-01-01

    ... States for testing for foreign animal diseases. (b) ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions. 130.49 Section 130.49 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  14. 24 CFR 574.130 - Formula allocations.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Formula allocations. 574.130... URBAN DEVELOPMENT COMMUNITY FACILITIES HOUSING OPPORTUNITIES FOR PERSONS WITH AIDS Formula Entitlements § 574.130 Formula allocations. (a) Data sources. HUD will allocate funds based on the number of cases...

  15. 49 CFR 130.21 - Packaging requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Packaging requirements. 130.21 Section 130.21 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Packaging requirements. Each packaging used for the transportation of oil subject to this part must...

  16. Dicty_cDB: SSA130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA130 (Link to dictyBase) - - - Contig-U14356-1 SSA130P (Link to Original site) SSA...130F 308 SSA130Z 423 SSA130P 731 - - Show SSA130 Library SS (Link to library) Clone ID SSA... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA130Q.Seq.d/ Representative seq. ID SSA...130P (Link to Original site) Representative DNA sequence >SSA130 (SSA130Q) /CSM/SS/SSA1-B/SSA1...qxkxqlxhxp--- ---*hdasgltkanppliknfskspfs*li*itpglssailgtwflatpkiplapgsvtn caflsl*mvwcgdnnekvnkslvadasvaknll

  17. A novel barium polymeric membrane sensor for selective determination of barium and sulphate ions based on the complex ion associate barium(II)-Rose Bengal as neutral ionophore

    Energy Technology Data Exchange (ETDEWEB)

    Othman, A.M. [Genetic Engineering and Biotechnology Research Institute (GEBRI), Minufiya University, Sadat City (Egypt); El-Shahawi, M.S. [Chemistry Department, Faculty of Science at Damiatta, Mansoura University, Damiatta, Dumyat 34517 (Egypt)]. E-mail: mohammad_el_shahawi@yahoo.co.uk; Abdel-Azeem, M. [Chemistry Department, Faculty of Science at Damiatta, Mansoura University, Damiatta, Dumyat 34517 (Egypt)

    2006-01-12

    A simple, long life, rapid response and sensitive barium(II)-PVC membrane sensor that typically follows Nernstian behavior has been developed for the assay of barium(II) ions. The developed sensor has been made by incorporating the complex ion associate of barium(II)-Rose Bengal (Ba-RB) as an ionophore into a plasticized PVC matrix. The sensor is stable and exhibited fast potential response of 20 s and gave a good linear response with a Nernstian slope of 28.5 {+-} 0.4 mV/decade of activity within the concentration range 5 x 10{sup -5} to 10{sup -1} M over a wide range of pH 4.5-10.0 for barium(II) ions. The developed sensor showed comparatively good selectivity for barium(II) ions with respect to other alkali, alkaline earth, transition and heavy metal ions. The plasticizer o-nitrophenyloctyl ether controlled significantly the calibration slope and the lifetime of the fabricated sensor. The proposed sensor was used successfully for the analysis of barium(II) ions in wastewater samples and in lithophone pigment with excellent recovery percentages in the range 98.9-99.8 {+-} 1.6%. The determination of sulphate in fresh and potable water samples with the developed sensor has been also achieved successfully. The described sensor provides a reliable means with good correlation with the data obtained by atomic absorption spectrometry (AAS) and other spectrophotometric methods for the analysis of trace amounts of barium(II) and/or sulphate ions in different matrices.

  18. A novel barium polymeric membrane sensor for selective determination of barium and sulphate ions based on the complex ion associate barium(II)-Rose Bengal as neutral ionophore

    International Nuclear Information System (INIS)

    A simple, long life, rapid response and sensitive barium(II)-PVC membrane sensor that typically follows Nernstian behavior has been developed for the assay of barium(II) ions. The developed sensor has been made by incorporating the complex ion associate of barium(II)-Rose Bengal (Ba-RB) as an ionophore into a plasticized PVC matrix. The sensor is stable and exhibited fast potential response of 20 s and gave a good linear response with a Nernstian slope of 28.5 ± 0.4 mV/decade of activity within the concentration range 5 x 10-5 to 10-1 M over a wide range of pH 4.5-10.0 for barium(II) ions. The developed sensor showed comparatively good selectivity for barium(II) ions with respect to other alkali, alkaline earth, transition and heavy metal ions. The plasticizer o-nitrophenyloctyl ether controlled significantly the calibration slope and the lifetime of the fabricated sensor. The proposed sensor was used successfully for the analysis of barium(II) ions in wastewater samples and in lithophone pigment with excellent recovery percentages in the range 98.9-99.8 ± 1.6%. The determination of sulphate in fresh and potable water samples with the developed sensor has been also achieved successfully. The described sensor provides a reliable means with good correlation with the data obtained by atomic absorption spectrometry (AAS) and other spectrophotometric methods for the analysis of trace amounts of barium(II) and/or sulphate ions in different matrices

  19. Theoretical isotope shifts in neutral barium

    CERN Document Server

    Nazé, Cédric; Godefroid, Michel

    2015-01-01

    The present work deals with a set of problems in isotope shifts of neutral barium spectral lines. Some well known transitions ($6s^2~^1S_0-6s6p~^{1,3}P^o_1$ and $6s^2~^1S_0-6p^2~^3P_0$) are first investigated. Values of the changes in the nuclear mean-square charge radius are deduced from the available experimental isotope shifts using our ab initio electronic factors. The three sets $\\{ \\delta\\langle r^2\\rangle^{A,A'}\\} $ obtained from these lines are consistent with each other. The combination of the available nuclear mean-square radii with our electronic factors for the $6s5d~^3D_{1,2} -6s6p~^{1}P^o_1$ transitions produces isotope shift values in conflict with the laser spectroscopy measurements of Dammalapati et al. (Eur. Phys. J. D 53, 1 (2009)).

  20. Chemical abundance analysis of 19 barium stars

    CERN Document Server

    Yang, G C; Spite, M; Chen, Y Q; Zhao, G; Zhang, B; Liu, G Q; Liu, Y J; Liu, N; Deng, L C; Spite, F; Hill, V; Zhang, C X

    2016-01-01

    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures, surface gravities, metallicity and microturbulent velocity) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their light elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn and Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-ca...

  1. Barium hexaferrite ferrofluids - preparation and physical properties

    Science.gov (United States)

    Müller, R.; Hiergeist, R.; Steinmetz, H.; Ayoub, N.; Fujisaki, M.; Schüppel, W.

    1999-07-01

    Barium hexaferrite BaFe 12-2 xTi xCo xO 19 ferrofluids have been prepared for the first time using oleic acid as surfactant and Isopar M ® as carrier liquid. The initial susceptibility versus temperature for zero-field cooling of the ferrofluid was obtained by a vibrating sample magnetometer. TEM pictures of the fluid show isolated particles and only small agglomerates and a mean particle diameter of approx. 8 nm. Numerical calculations of the magneto-viscous effect, based on the local-equilibrium magnetic state model, clearly show the benefit for Ba-ferrite ferrofluids resulting from the high uniaxial anisotropy compared to magnetite ferrofluids. Rheological measurements were performed with a rotational-type viscometer with magnetic field perpendicular to the hydrodynamic vortex axis.

  2. Radar absorption properties of doped barium hexaferrite

    International Nuclear Information System (INIS)

    Full text: Since the 1950s, it has been known that barium hexaferrite exhibits a ferrimagnetic resonance at about 48 GHz. Early research was directed at finding dopants that would increase this frequency to enable the preparation of lossless waveguide components. However, more recent efforts have explored the potential of doped barium hexaferrite as a radar absorbing material in the low GHz frequency range. In particular, Nedkov et al demonstrated that partial substitution of the iron with cobalt-titanium, to give Ba(Co0.5Ti0.5)xFe11.9-xMn0.1O19 with x = 1.6, could reduce the ferrimagnetic resonance frequency to 15 GHz. The small amount of manganese was included 'to improve the dielectric properties' of the material. In this work we increased the doping to x = 2.2 to arrive at a resonance frequency of just 1.35 GHz, which lies within the operational frequency range of typical airborne early warning and control (AEWAC) radar systems. An increase in the resonance signal at this concentration is believed to be associated with the onset of a switch from axial to planar magnetocrystalline anisotropy, as reported by Kreisel et al . It is uncertain why our resonance frequency for x = 2.2 is significantly lower than the value of 2.56 GHz reported elsewhere for a Mn-free specimen with x = 2.6. Chromium was also tested as a new dopant material but proved unsuccessful in reducing the resonant frequency below 40 GHz, the upper limit of the microwave network analyser that was employed. All specimens were prepared using solid state reaction of stoichiometric amounts of oxides and carbonates, and characterised using x-ray powder diffraction and 57Fe Moessbauer spectroscopy

  3. The Karlsruhe 4π barium fluoride detector

    International Nuclear Information System (INIS)

    A new experimental approach has been implemented for accurate measurements of neutron capture cross sections in the energy range from 5 to 200 keV. The Karlsruhe 4π Barium Fluoride Detector consists of 42 crystals shaped as hexagonal and pentagonal truncated pyramids forming a spherical shell with 10 cm inner radius and 15 cm thickness. All crystals are supplied with reflector and photomultiplier, thus representing independent gamma-ray detectors. Each detector module covers the same solid angle with respect to a gamma-ray source located in the centre. The energy resolution of the 4π detector is 14% at 662 keV and 7% at 2.5 MeV gamma-ray energy, the overall time reslution is 500 ps and the peak efficiency 90% at 1 MeV. The detector allows to register capture cascades with 95% probability above a threshold energy of 2.5 MeV in the sum energy spectrum. Neutrons are produced via the 7Li(p,n)7Be reaction using the pulsed proton beam of a Van de Graaff accelerator. The neutron spectrum can be taylored according to the experimental requirements in an energy range from 5 to 200 keV by choosing appropriate proton energies. A collimated neutron beam is passing through the detector and hits the sample in the centre. The energy of captured neutrons is determined via time of flight, the primary flight path being 77 cm. The combination of short primary flight path, a 10 cm inner radius of the spherical BaF2 shell, and the low capture cross section of barium allows to discriminate background due to capture of sample scattered neutrons in the scintillator by time of flight, leaving part of the neutron energy range completely undisturbed. (orig./HSI)

  4. Upper gastrointestinal barium evaluation of duodenal pathology: A pictorial review

    Institute of Scientific and Technical Information of China (English)

    Pankaj; Gupta; Uma; Debi; Saroj; Kant; Sinha; Kaushal; Kishor

    2014-01-01

    Like other parts of the gastrointestinal tract(GIT), duodenum is subject to a variety of lesions both congenital and acquired. However, unlike other parts of the GIT viz. esophagus, rest of the small intestine and large intestine, barium evaluation of duodenal lesions is technically more challenging and hence not frequently reported. With significant advances in computed tomography technology, a thorough evaluation including intraluminal, mural and extramural is feasible in a single non-invasive examination. Notwithstanding, barium evaluation still remains the initial and sometimes the only imaging study in several parts of the world. Hence,a thorough acquaintance with the morphology of various duodenal lesions on upper gastrointestinal barium examination is essential in guiding further evaluation. We reviewed our experience with various common and uncommon barium findings in duodenal abnormalities.

  5. Liquid-phase-deposited barium titanate thin films on silicon

    International Nuclear Information System (INIS)

    Using a mixture of hexafluorotitanic acid, barium nitrate and boric acid, high refractive index (1.54) barium titanate films can be deposited on silicon substrates. The deposited barium titanate films have featureless surfaces. The deposition temperature is near room temperature (800C). However, there are many fluorine and silicon incorporations in the films. The refractive index of the as-deposited film is 1.54. By current-voltage measurement, the leakage current of the as-deposited film with a thickness of 1000 A is about 9.48x10-7 A cm-2 at the electrical field intensity of 0.3 MV cm-1. By capacitance-voltage measurement, the effective oxide charge of the liquid-phase-deposited barium titanate film is 3.06x1011 cm-2 and the static dielectric constant is about 22. (author)

  6. Synthesis, photoluminescence and magnetic properties of barium vanadate nanoflowers

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Jing [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Chongqing University of Science and Technology, Chongqing 401331 (China); Hu, Chenguo, E-mail: hucg@cqu.edu.cn [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Xi, Yi [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Peng, Chen [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Wan, Buyong; He, Xiaoshan [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China)

    2011-06-15

    Graphical abstract: The flower-shaped barium vanadate was obtained for the first time. The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. Research highlights: {yields} In the paper, the flower-shaped barium vanadate were obtained for the first time. The CHM method used here is new and simple for preparation of barium vanadate. {yields} The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. The strong bluish-green emission was observed. {yields} The ferromagnetic behavior of the barium vanadate nanoflowers was found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g. {yields} The mechanisms of PL and magnetic property of barium vanadate nanoflowers have been discussed. -- Abstract: The flower-shaped barium vanadate has been obtained by the composite hydroxide mediated (CHM) method from V{sub 2}O{sub 5} and BaCl{sub 2} at 200 {sup o}C for 13 h. XRD and XPS spectrum of the as-synthesized sample indicate it is hexagonal Ba{sub 3}V{sub 2}O{sub 8} with small amount of Ba{sub 3}VO{sub 4.8} coexistence. Scan electron microscope and transmission electron microscope display that the flower-shaped crystals are composed of nanosheets with thickness of {approx}20 nm. The UV-visible spectrum shows that the barium vanadate sample has two optical gaps (3.85 eV and 3.12 eV). Photoluminescence spectrum of the barium vanadate flowers exhibits a visible light emission centered at 492 and 525 nm which might be attributed to VO{sub 4} tetrahedron with T{sub d} symmetry in Ba{sub 3}V{sub 2}O{sub 8}. The ferromagnetic behavior of the barium vanadate nanoflowers has been found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g, which is mainly due to the presence of a non

  7. Investigation of neutron-deficient isotopes in the barium-region

    International Nuclear Information System (INIS)

    Bombarding targets of 106Cd, 108Cd and 110Cd with 16O ions of 52.5-66.0 MeV neutron deficient barium, cesium and xenon isotopes were produced and have been studied using excitation functions and neutron-gamma, proton-gamma, alpha-gamma and gamma-gamma coincidence measurements. Partial level schemes for 123Ba and 121Ba were proposed. A number of gamma transitions was assigned to the different product nuclei. The measured particle emission probabilities from the compound nuclei are compared with different evaporation models. The models mostly underestimate neutron emission and often overestimate the emission of alpha particles. (orig.)

  8. Capacitively coupled electrolyte-conductivity sensor based on high-k material of barium strontium titanate

    OpenAIRE

    Huck, C.; Poghossian, A; Baecker, M; Chaudhuri, S.; Zander, W; Schubert, J.; Begoyan, V. K.; Buniatyan, V. V.; Wagner, Patrick Hermann; Schoening, M. J

    2014-01-01

    A miniaturized capacitively coupled contactless conductivity detection (C4D) sensor based on high-kperovskite oxide of barium strontium titanate (BST) has been implemented for the first time. The BST films(∼120 nm thick) of Ba0.25Sr0.75TiO3composition were prepared on a p-Si-SiO2-Pt structure by pulsed laserdeposition technique using BST targets fabricated by the self-propagating high-temperature synthesismethod. The Pt electrodes were buried into the SiO2layer to obtain a planar structure. F...

  9. Lifetime Measurement for 6snp Rydberg States of Barium

    Institute of Scientific and Technical Information of China (English)

    SHEN Li; WANG Lei; YANG Hai-Feng; LIU Xiao-Jun; LIU Hong-Ping

    2011-01-01

    @@ We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states.This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence.The lifetimes determined with our method for barium Rydberg 6snp(n=37-59)series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J.Phys.B 14(1981)4489, 29(1996)655]on experiments.%We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states. This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence. The lifetimes determined with our method for barium Rydberg 6snp (n=37-59) series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J. Phys. B 14 (1981) 4489, 29 (1996) 655] onexperiments.

  10. HUM 130 uop course tutorial/uop helP

    OpenAIRE

    roken

    2015-01-01

    For more course tutorials visit www.uophelp.com HUM 130 Week 1 Assignment Vocabulary Quiz HUM 130 Week 1 CheckPoint Effects Of Religion HUM 130 Week 2 Exercise Indigenous Culture Web Site Reviews HUM 130 Week 2 DQ 1 and DQ 2 HUM 130 Week 3 CheckPoint Hindu Terms Map HUM 130 Week 3 Assignment Hinduism Paper HUM 130 Week 4 CheckPoint Final Project Preparation HUM 130 Week 4 DQ 1 and DQ 2 HUM 130 Week 5 CheckPoint Eastern Religion Elements Matrix HUM 1...

  11. Electrooptic and piezoelectric measurements in photorefractive barium titanate and strontium barium niobate

    International Nuclear Information System (INIS)

    The authors measured the low-frequency (''unclamped'') electrooptic and piezoelectric coefficients in undoped BaTiO/sub 3/ and Sr/sub x/Ba/sub 1-x/Nb/sub 2/O/sub 6/ (chi - 0.61) crystals using interferometric techniques. The contribution of the piezoelectric effect to the Pockels measurement is discussed. For an applied ac electric field in the range 0.1-200 V/cm, the electrooptic and piezoelectric effects are linear in the magnitude of of the applied field and independent of its frequency in the range of 10 Hz-100 kHz. The unclamped electrooptic coefficients of poled BaTiO/sub 3/ single crystals are r/sub 13/ = 19.5 +- 1 pm/V and r/sub 33/ = 97 +- 7 pm/V, and for strontium barium niobate are r/sub 13/ = 47 +- 5 pm/V and r/sub 33/ = 235 +- 21 pm/V, all measured at a wavelength of 514.5 nm and at T = 230C. For the barium titanate samples the measured Pockels coefficient r/sub c/ identical to r/sub 33/ - (n/sub 1//n/sub 3/)/sup 3/r/sub 13/ = 79 +- 6 pm/V in good agreement with the value r/sub c/ = 76 +- 7 pm/V computed from the above values of r/sub 13/ and r/sub 33/, where n/sub 1/ and n/sub 3/ are the ordinary and extraordinary indexes of refraction, respectively. The measured piezoelectric coefficient is d/sub 23/ = +28.7 +- 2 pm/V for barium titanate, and is d/sub 23/ = +24.6 +- 2 pm/V for strontium barium niobate. They also measured the photoreflective coupling of two optical beams in the crystals, and they show that the dependence of the coupling strength on beam polarization is in fair agreement with the measured values of the Pockels coefficients

  12. Magnetoresistance studies on barium doped nanocrystalline manganite

    International Nuclear Information System (INIS)

    An energetically attractive, simple, fast and a novel low temperature (300 deg. C) solution combustion route for the synthesis of crystalline and homogeneous nanoparticles of lanthanum barium manganese oxide La0.9Ba0.1MnO3+δ (LBMO) is reported. Formation and homogeneity of the solid solutions have been confirmed by powder X-ray diffraction (PXRD) and energy dispersive X-ray analysis (EDS) respectively. The Rietveld analysis shows both as-formed as well as calcined samples are in cubic phase with space group pm3m. The microstructure and agglomerated particle size of the compounds are examined by scanning electron microscope. Infrared spectroscopy revealed that both Mn-O-Mn bending mode and Mn-O stretching mode are influenced by calcination temperature. The magnetoresistance measurement on sintered LBMO pellet exhibits a broad metal-insulator transition (TM-I) at around 228 K. At 1 T applied magnetic field, LBMO shows magnetoresistance (MR) of 10%, whereas for 4 and 7 T, the negative magnetoresistance values are in the range 51 and 59% respectively at TM-I. The experimental resistivity data of the present investigation are fitted to a simple empirical equation in order to understand conduction mechanism in this compound

  13. Optical properties of calcium barium niobate

    International Nuclear Information System (INIS)

    We report on optical measurements on the novel tungsten bronze type calcium barium niobate. [001]-oriented transparent and colorless single crystals were grown by the Czochralski method with dimensions of 12 mm in diameter and about 80 mm in length. With its relatively high Curie temperature of about 538 K for the congruently melting composition of 28.1 mole% calcium and its high nonlinear coefficients, CBN is a promising material for future applications. Recent experiments revealed, that the application of an external electric field of several kV/cm to CBN at room temperature leads to an increasing opacity of the sample. This might be a drawback considering the future usability of CBN in optical systems. We present investigations on the transmittance behaviour of CBN under external electric fields, demonstrating the erasement of the clouding without affecting the polarization. Experiments have been performed at temperatures ranging from room temperature to approximately 480 K. When heating up the sample, its colorless appearance changes to a light yellow, which can be attributed to a shift of the band edge to longer wavelengths with increasing temperature. To further investigate the transmittance properties of CBN, measurements of the band edge under various temperatures up to the ferroelectric phase transition have been performed.

  14. Leachability of barium-radium sulphate sludges

    International Nuclear Information System (INIS)

    This paper presents results from the first phase of a research program designed to examine the leachability of radium-226 from barium-radium sulphate sludges. Batch leaching tests were performed. Results showed that liquid:solid contact time was relatively unimportant; radium in the sludge was stable in the presence of deionized water with a slight increase in the amount leached per gram of sludge occurring at higher liquid:solid ratios. Not unexpectedly, low and high values of leachant pH increased radium leaching. Both monovalent and divalent salt solutions also increased leaching; however, dissolved radium-226 activity levels in the leachate decreased as leachant molarity increased. For divalent salts this can be explained by the common ion effect; for monovalent salts it is opposite to results expected from solubility considerations. The interpretation of all results is complicated by the fact that in most tests, the amount of radium-226 present in the leachate was lower than the calculated contribution from the mother liquour present with the sludge. This apparent ability of the sludge to absorb radium from solution may be related to dissolution and reprecipitation of the sludge during the leaching tests

  15. Chemical compositions of four barium stars

    CERN Document Server

    Liang, Y C; Chen, Y Q; Qiu, H M; Zhang, B

    2003-01-01

    Chemical compositions of four barium stars HD 26886, HD 27271, HD 50082 and HD 98839 are studied based on high resolution, high signal-to-noise Echelle spectra. Results show that all of them are disk stars. Their \\alpha and iron peak elements are similar to the solar abundances. The neutron-capture process elements are overabundant relative to the Solar. The heavy-element abundances of the strong Ba star HD 50082 are higher than those of other three mild Ba stars. Its mass is 1.32Msun (+0.28,-0.22Msun), and is consistent with the average mass of strong Ba stars (1.5Msun). For mild Ba star HD 27271 and HD 26886, the derived masses are 1.90Msun (+0.25,-0.20Msun) and 2.78Msun (+0.75,-0.78M_sun), respectively, which are consistent with the average mass of mild Ba stars. We also calculate the theoretical abundances of Ba stars by combining the AGB stars nucleosynthesis and wind accretion formation scenario of Ba binary systems. The comparisons between the observed abundance patterns of the sample stars with the th...

  16. The diagnostic value of barium enema in acute appendicitis

    International Nuclear Information System (INIS)

    Acute appendicitis is the most common acute surgical condition of the abdomen. When the clinical presentation is atypical, barium enema has proven to be safe and useful in confirming the diagnosis and reducing the negative surgical exploration. However, the performance of barium enema in acute appendicitis has known contraindication primarily because of fear of leakage by perforation of the inflamed appendix. This study using barium enema as a diagnostic aid in acute appendicitis with atypical clinical presentation was performed to further support the previously noted efficacy and safety of this procedure. The results were as followings: 1. In case of acute appendicitis with atypical clinical presentation, the use of barium enema as a diagnostic aid increased the accuracy of diagnosis and decreased the negative surgical exploration. In women between 11 to 50 years old age, especially, it played important role differentiating appendicitis from nonsurgical acute abdomen. 2. The results of the study were 92.31% in sensitivity, 7.69% in false positive, 6.9% in false negative, and 10.26% in negative appendectomy. 3. None of case of leakage of barium by perforation of the inflamed appendix was noted, therefore, barium enema was thought to be safe as a diagnostic aid in acute appendicitis. 4. A simple partial or non filling of appendix without other associated positive finding could not exclude appendicitis, therefore, close clinical observation was necessary. 5. The positive findings of barium enema and their sensitivity were as followings: 1. Non filling of appendix: 90% 2. Partial filling of appendix: 91.7% 3. Displacement or a local impression on terminal ileum: 100%

  17. Elastic scattering cross sections of metastable barium on helium and argon

    International Nuclear Information System (INIS)

    Barium atoms in the 1D2, 3D2 and 3D3 metastable excited states have been observed by their low field Zeeman resonances using an Atomic Beam Magnetic Resonance Spectrometer. The 1S0 ground state is also observed. The scattering of Ba atoms in each of these states by helium or argon atoms (in their ground states) was performed by allowing a secondary beam to intersect the Ba beam at 900 (crossed beam geometry). The ratio of the cross sections for scattering from different excited Ba states and the same target atom was measured to a precision of 1 to 2 percent. By a combination of further experiment and calculation the absolute cross sections were also measured. It is argued that the elastic scattering dominates so that the measured cross section is sigma/sub elastic/. Comparison of the scattering of Ba(1S0) and Ba(1,3D2,3) for either target gas shows that the ground state cross section is larger by a factor of 1.8 than for the excited states. This somewhat surprising result is in accord with naive pictures of the ''size'' of the 5d 6s electronic configuration of the excited barium compared with the ground state configuration, 6s2

  18. High spin spectroscopy in 130,131Ba

    International Nuclear Information System (INIS)

    The high spin states in 130,131Ba has been populated in the fusion evaporation reaction 122Sn(13C,4n)130,131Ba at Ebeam = 65 MeV. The experiment was carried out at the 14-UD pelletron accelerator at IUAC, New Delhi, India, which delivered 13C beam on a ∼ 1.0 mg/cm2 thick 122Sn target with Au (6.7 mg/cm2) backing. The γ decay following the reaction was studied using an array consisting of fifteen Compton suppressed clover detectors of INGA (Indian National Gamma Array) placed at angle of 32°(3-covers), 57°(2-clovers), 90°(4-clovers), 123°(2-clovers), 148°(4-clovers) with respect to the beam direction. The data were collected when two or more clover fired. Data have been analyzed using software CANDLE, INGASORT and RADWARE. Symmetric and Asymmetric matrices have been constructed using 2-fold as well as 3-fold data. Cube has also been made for 3-fold data. The γ transitions belonging to various band structure were detected using an array of fifteen Clover Germanium detector. In extension to earlier work done by R. Ma et al to study 131 Ba and D. Bazzacco et al. to study 130 Ba some of new transitions has been placed in high spin states. A few transitions connecting two negative parity bands in 130Ba has been established. Spin and parity for a band has been calculated for first time in 131Ba. The said band is interpreted in term of multi-quasiparticle configuration, based on Total Routhian Surface (TRS) calculation (author)

  19. Preparation of barium hexaferrite powders using oxidized steel scales waste

    Science.gov (United States)

    Septiani, Ardita; Idayanti, Novrita; Kristiantoro, Tony

    2016-02-01

    Research on preparation of barium hexaferrite powders has been done using Hot Strip Mill scales as raw materials. Hot Strip Mill scales are oxidized steel scales waste from steel industrial process. The method used for preparing the barium hexaferrite powders was solid state reaction method. Oxidized steel scales were milled using ball mill for 10 hours, then screened through a 250 mesh sieve to obtain powders with maximum size of 63 µm. Powders were roasted at 600°C temperature for 4 hours to obtain hematite (Fe2O3) phase. Roasted powders were then mixed with barium carbonate, and were subsequently milled for 16 hours. After mixing, powders were calcined with an increasing rate of 10°C/min and maintained at 1100°C for 3 hours. Calcination process was performed to acquire barium hexaferrite phase. X-ray Diffraction (XRD) characterization in conjunction with RIR analysis showed that 85 wt. % of barium hexaferrite is formed. The magnetic properties of powders were characterized using Permagraph. It is found the value of remanent induction is 1.09 kG, coercivity of 2.043 kOe, and the maximum energy product of 0.25 MGOe.

  20. Barium Depletion in the NSTAR Discharge Cathode After 30,000 Hours of Operation

    Science.gov (United States)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira

    2010-01-01

    Dispenser hollow cathodes rely on a consumable supply of barium released by impregnant materials in the pores of a tungsten matrix to maintain a low work function surface. Examinations of cathode inserts from long duration ion engine tests show deposits of tungsten at the downstream end that appear to block the flow of barium from the interior. In addition, a numerical model of barium transport in the insert plasma indicates that the barium partial pressure in the insert may exceed the equilibrium vapor pressure of the dominant barium-producing reaction, and it was postulated previously that this would suppress barium loss in the upstream part of the insert. New measurements of the depth of barium depletion from a cathode insert operated for 30,352 hours reveal that barium loss is confined to a narrow region near the downstream end, confirming this hypothesis.

  1. Sputtered Modified Barium Titanate for Thin-Film Capacitor Applications

    Directory of Open Access Journals (Sweden)

    Robert Mamazza

    2012-04-01

    Full Text Available New apparatus and a new process for the sputter deposition of modified barium titanate thin-films were developed. Films were deposited at temperatures up to 900 °C from a Ba0.96Ca0.04Ti0.82Zr0.18O3 (BCZTO target directly onto Si, Ni and Pt surfaces and characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray photoelectron spectroscopy (XPS. Film texture and crystallinity were found to depend on both deposition temperature and substrate: above 600 °C, the as-deposited films consisted of well-facetted crystallites with the cubic perovskite structure. A strongly textured Pt (111 underlayer enhanced the (001 orientation of BCZTO films deposited at 900 °C, 10 mtorr pressure and 10% oxygen in argon. Similar films deposited onto a Pt (111 textured film at 700 °C and directly onto (100 Si wafers showed relatively larger (011 and diminished intensity (00ℓ diffraction peaks. Sputter ambients containing oxygen caused the Ni underlayers to oxidize even at 700 °C: Raising the process temperature produced more diffraction peaks of NiO with increased intensities. Thin-film capacitors were fabricated using ~500 nm thick BCZTO dielectrics and both Pt and Ni top and bottom electrodes. Small signal capacitance measurements were carried out to determine capacitance and parallel resistance at low frequencies and from these data, the relative permittivity (er and resistivity (r of the dielectric films were calculated; values ranged from ~50 to >2,000, and from ~104 to ~1010 Ω∙cm, respectively.

  2. Studies of hexacelsian and celsian barium aluminosilicates

    Science.gov (United States)

    Lee, Kuo-Tong

    1998-09-01

    The first part of this work (chapter 3) describes the reaction paths leading to the formation of BaAlsb2Sisb2Osb8 (BAS) from a mixture of gamma-BaCOsb3,\\ alpha-Alsb2Osb3, and amorphous SiOsb2 powders. Heat treatments conducted from 600 to 1200sp°C in air were used to transform the powder mixtures into hexacelsian BAS. The phase evolution to BAS was examined by x-ray diffraction. Several experiments were designed to microscopically reproduce the solid-solid interfaces expected during the synthesis of BAS and enabled the author to describe the different stages of the reaction. There exist two reaction paths in formation of BAS in this study: (1) formation of a series of barium silicates leading to BaO*2SiOsb2 (BSsb2) which then reacts with Alsb2Osb3 to form BAS and (2) formation of BaO*Alsb2Osb3 (BA) which then reacts with SiOsb2 to form BAS. The kinetics of the latter is slower than that of the former because the reaction between BaO*Alsb2Osb3 and SiOsb2 to form BAS includes a bond breaking process. The second part (chapter 4) of this research was undertaken to study the role of additives on the kinetics of the transformation of hexacelsian to celsian. Pre-synthesized hexacelsian powders doped with various additives were heated at temperatures ranging from 850 to 1400sp°C for 4 hrs. Semi-quantitative analysis of XRD was used to determine the extent of the hexacelsian-to-celsian transformation. This work was extended further to investigate the mechanisms involved in the transformation. Defect structures developed in the additive-containing celsian provide insights about the sites occupied by the cations added. Experimental results indicate that the doping of ˜0.99A cations in promoting the conversion of hexacelsian to celsian is by forming an interstitial solid solution in hexacelsian and ˜0.66A cations form a substitutional solid solution. In a kinetic study on the CaO- or MgO-enhanced transformation, values of rate constant, k, and Avlami constant, n, at

  3. Occupational doses in pediatric barium meal procedures

    International Nuclear Information System (INIS)

    Ionizing radiation has become an indispensable tool when it comes to diagnosis and therapy. However, its use should happen in a rational manner, taking into account the risks to which the staff is being exposed. Barium meal (BM), or upper gastrointestinal (GI) studies, using fluoroscopy, are widely used for gastroesophageal reflux disease diagnostic in children and professionals are required to stay inside the examination room to position and immobilize pediatric patients during the procedure. Therefore, it is very important that proffessionals strictly follow the technical standards of radiation protection. According to the ICRP and the NCRP recommendations, the annual limit equivalent doses for eyes, thyroid and hands are, espectively, 20 mSv, 150 mSv and 500 mSv. Based on those data, the aim of the current study is to estimate the annual equivalent dose for eyes, thyroid and hands of professionals who perform BM procedures in children. This was done using properly package LiF:Mg,Cu,P thermoluminescent dosimeters in 37 procedures; 2 pairs were positioned near each staff´s eye, 2 pairs on each professional´s neck (on and under the lead protector) and 2 pairs on both staff´s hands. The range of the estimative annual equivalent doses, for eyes, thyroid and hands, are, respectively: 14 – 36 mSv, 7 – 22 mSv and 14 – 58 mSv. Only the closest staff to the patient exceeded the annual equivalent doses in the eyes (around 80% higher than the limit set by ICRP). However, the results from this study, for hands and thyroid, compared to similar studies, show higher values. Therefore, the optimization implementation is necessary, so that the radiation levels can be reduced. (authors)

  4. Method for the extraction chromatographic separation of barium from other elements with dibenzo-18-crown-6

    International Nuclear Information System (INIS)

    A method has been developed for the extraction chromatographic separation of barium from 0.01 M picric acid solution with dibenzo-18-crown-6 coated on hydrophobic silica gel as the stationary phase. Various mineral acids can be used as stripping agents. Barium was separated from other elements by selective extraction and the separation of barium from alkali and alkaline earth metals, uranium, thorium and lead was achieved. The method was applied to the determination of barium in real samples. (author)

  5. High spin structure in 130Ba

    International Nuclear Information System (INIS)

    Nuclei with mass A ∼130 has been of great interest to experimental studies on high spin states. This is particularly so for the nuclei in the A∼130 region which exhibit a softness to γ. Evidence for characteristics such as shape coexistence and γ-softness has been gathered during the last two decades for many nuclei from Xe to Nd. Another interesting feature of this mass region is the existence of a regular M1 band which has been considered to be a promising candidate for magnetic rotation. In several nuclei of the A ∼130 mass region M1 bands like those observed in the A < 200 mass region are known. One signature of magnetic rotation is the decrease of the B (M1) values with increasing spin. The aim of the work is to study the high spin states and lifetime measurements using the DSAM technique

  6. Electron microscopy of barium bismuth titanate multilayer ceramics

    International Nuclear Information System (INIS)

    For a number of years bismuth containing compounds have been used with pre-calcined barium titanate to reduce the sintering temperature of the capacitor formulations. As reported earlier the backscattered electron (BSE) SEM micrographs of the bismuth containing barium titanate ceramic reveal that the grains having an average size of 1.2μm consist of a two phase structure consisting of relatively pure barium titanate grain cores surrounded by bismuth rich grain shells. The TEM and STEM studies along with the EDS analyses show that the bismuth concentration increases sharply as one steps towards the grain boundary with a maximum bismuth content at the grain boundary. It is the purpose of this work to investigate the distribution of bismuth in these formulations including the bismuth content, if any, at the ceramic metal interface as affected by the sintering temperature. The subsequent effect on the electrical resistivity of these ceramics in the multilayer configuration is reported

  7. Economically dissolving barium sulfate scale with a chelating agent

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, E.A.; Scheuerman, R.E.

    1977-06-21

    A composition is described for dissolving a barium sulfate scale from a subterranean or other relatively remote location into which fluid can be flowed. Fluid is flow-flowed into the remote location so that a stream of fluid contacts and flows along the surface of the scale. The composition and flow rate of the fluid are adjusted so that (1) the scale is contacted by a stream of aqueous solution in which each portion contains enough dissolved aminopolyacetic acid salt chelating agent to dissolve barium sulfate, and (2) substantially all upstream portions of the scale are contacted by a succession of portions of the aqueous liquid which are substantially unsaturated with respect to dissolved barium-chelant complex. (5 claims)

  8. Barium titanate thick films prepared by screen printing technique

    Directory of Open Access Journals (Sweden)

    Mirjana M. Vijatović

    2010-06-01

    Full Text Available The barium titanate (BaTiO3 thick films were prepared by screen printing technique using powders obtained by soft chemical route, modified Pechini process. Three different barium titanate powders were prepared: i pure, ii doped with lanthanum and iii doped with antimony. Pastes for screen printing were prepared using previously obtained powders. The thick films were deposited onto Al2O3 substrates and fired at 850°C together with electrode material (silver/palladium in the moving belt furnace in the air atmosphere. Measurements of thickness and roughness of barium titanate thick films were performed. The electrical properties of thick films such as dielectric constant, dielectric losses, Curie temperature, hysteresis loop were reported. The influence of different factors on electrical properties values was analyzed.

  9. Radiation dose in mass screening for gastric cancer with high-concentration barium sulphate compared with moderate-concentration barium sulphate

    International Nuclear Information System (INIS)

    Full text: Recently, high-concentration barium sulfate has been developed and is used in many medical facilities. This study compared radiation dose using high-concentration and moderate-concentration barium sulfate. The dose was evaluated with an experimental method using a gastric phantom and with a clinical examination. In the former, the dose and X-ray tube load were measured on the phantom with two concentrations of barium sulfate. In the latter, the fluoroscopic dose-area product (DAP), the radiographic DAP and their sum, the total DAP, were investigated in 150 subjects (112 males, 38 females) treated with both concentrations of barium sulfate. The effective dose was calculated by the software of PCXMC in every case. The results of the experimental evaluation indicated that the effective dose and X-ray tube load were greater with high-concentration barium sulfate than with moderate-concentration barium sulfate (p < 0.05). The results of the clinical evaluation indicated that the fluoroscopic DAP was greater with moderate-concentration barium sulfate than with high-concentration barium sulfate (p < 0.05), but the radiographic DAP was quite the reverse, so the total DAP and effective dose were almost same with both concentrations of barium sulfate. We conclude that high-concentration barium sulfate does not increase radiation dose in mass screening for gastric cancer.

  10. Reaction sintering of a zirconia-containing barium feldspar ceramic

    International Nuclear Information System (INIS)

    Zircon (ZrSiO4) is a natural mineral resource known to react with certain oxides to produce a dispersion of zirconia particles within ceramic or glass-ceramic matrices. Barium aluminosilicates, particularly the celsian polymorphs of BaO- Al2O3 2SiO2 display oxidation resistance and refractory characteristics commensurate with the properties required of high temperature materials. Such properties, coupled with the high melting point of ZrO2 (2680 deg C), suggest that barium aluminosilicates and zirconia are an ideal combination from which to fabricate high temperature materials. A recent study has indicated that a barium aluminosilicate containing up to 40mol% ZrO2 can be prepared via a sol-gel process. However, the desire to utilise a natural resource in the form of zircon in the present work has led to the choice of reaction sintering as an alternative processing route. The current work was undertaken to investigate the possibility of forming a zirconia-containing barium feldspar composite material using the reaction sintering of zircon and assuming the following stoichiometric reaction: 2ZrSiO4 + BaCO3 + Al2O3 → 2ZrO2 + BaO-Al2O3-2SiO2 + CO2 ↑. The reaction sintering of zircon with alumina and barium carbonate produces a composite material comprising distributed ZrO2 in a continous barium feldspar matrix. Yttria added during processing allows a significant fraction of the ZrO2 to be retained as tetragonal phase to room temperature and thus the potential for a measure of transformation toughening

  11. Reaction sintering of a zirconia-containing barium feldspar ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Nordmann, A.; Cheng, Y-B.; Muddle, B. C. [Monash Univ., Clayton, VIC (Australia). Dept. of Materials Engineering

    1996-12-31

    Zircon (ZrSiO{sub 4}) is a natural mineral resource known to react with certain oxides to produce a dispersion of zirconia particles within ceramic or glass-ceramic matrices. Barium aluminosilicates, particularly the celsian polymorphs of BaO- Al{sub 2}O{sub 3} 2SiO{sub 2} display oxidation resistance and refractory characteristics commensurate with the properties required of high temperature materials. Such properties, coupled with the high melting point of ZrO{sub 2} (2680 deg C), suggest that barium aluminosilicates and zirconia are an ideal combination from which to fabricate high temperature materials. A recent study has indicated that a barium aluminosilicate containing up to 40mol% ZrO{sub 2} can be prepared via a sol-gel process. However, the desire to utilise a natural resource in the form of zircon in the present work has led to the choice of reaction sintering as an alternative processing route. The current work was undertaken to investigate the possibility of forming a zirconia-containing barium feldspar composite material using the reaction sintering of zircon and assuming the following stoichiometric reaction: 2ZrSiO{sub 4} + BaCO{sub 3} + Al{sub 2}O{sub 3} {yields} 2ZrO{sub 2} + BaO-Al{sub 2}O{sub 3}-2SiO{sub 2} + CO{sub 2} {up_arrow}. The reaction sintering of zircon with alumina and barium carbonate produces a composite material comprising distributed ZrO{sub 2} in a continous barium feldspar matrix. Yttria added during processing allows a significant fraction of the ZrO{sub 2} to be retained as tetragonal phase to room temperature and thus the potential for a measure of transformation toughening. 14 refs., 2 tabs., 6 figs.

  12. Compact pulse forming line using barium titanate ceramic material

    Science.gov (United States)

    Kumar Sharma, Surender; Deb, P.; Shukla, R.; Prabaharan, T.; Shyam, A.

    2011-11-01

    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO3) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber.

  13. Compact pulse forming line using barium titanate ceramic material.

    Science.gov (United States)

    Kumar Sharma, Surender; Deb, P; Shukla, R; Prabaharan, T; Shyam, A

    2011-11-01

    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO(3)) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber. PMID:22129008

  14. 49 CFR 173.182 - Barium azide-50 percent or more water wet.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or...

  15. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished...

  16. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  17. The adhesiometer: a simple device to measure adherence of barium sulfate to intestinal mucosa.

    Science.gov (United States)

    Salomonowitz, E; Frick, M P; Cragg, A H; Lund, G

    1984-04-01

    A simple, inexpensive device assessing barium sulfate adherence to alimentary tract mucosa was tested in an animal study using pigs and dogs. Interaction of gastric, intestinal, and colonic mucosal lining with three different barium preparations was studied. In both pigs and dogs, barium adherence to gastric mucosa was significantly stronger when compared with colonic mucosa. PMID:6608230

  18. Esophageal intramural pseudodiverticulosis characterized by barium esophagography: a case report

    LENUS (Irish Health Repository)

    O'Connor, Owen J

    2010-05-21

    Abstract Introduction Esophageal intramural pseudodiverticulosis is a rare condition characterized by the dilatation of the submucosal glands. Case presentation We present a case of esophageal intramural pseudodiverticulosis in a 72-year-old Caucasian man who presented with dysphagia and with a background history of alcohol abuse. An upper gastrointestinal endoscopy of our patient showed an esophageal stricture with abnormal mucosal appearances, but no malignant cells were seen at biopsy. Appearances on a barium esophagram were pathognomonic for esophageal intramural pseudodiverticulosis. Conclusion We demonstrate the enduring usefulness of barium esophagography in the characterization of abnormal mucosal appearances at endoscopy.

  19. Kinetics of thermal decomposition of barium zirconyl oxalate

    International Nuclear Information System (INIS)

    Kinetics of the thermal decomposition of anhydrous barium zirconyl oxalate and a carbonate intermediate have been studied. Decomposition of the anhydrous oxalate, though it could be explained based on a contracting-cube model, is quite complex. Kinetics of decomposition of the intermediate carbonate Ba2Zr2O5CO3 is greatly influenced by thermal effects during its formation. (α-t) curves are sigmoidal and obey a power law equation followed by first order decay. Presence of carbon in the vacuum-prepared carbonate has a strong deactivating effect. Decomposition of the carbonate is accompanied by growth in particle size of the product barium zirconate. (Author)

  20. Photoionization and Photoelectric Loading of Barium Ion Traps

    CERN Document Server

    Steele, A V; Churchill, L R; Griffin, P F

    2007-01-01

    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading technique that employs an in-expensive UV epoxy curing lamp to generate photoelectrons.

  1. Photoionization and Photoelectric Loading of Barium Ion Traps

    OpenAIRE

    Steele, A. V.; Churchill, L. R.; Griffin, P. F.; Chapman, M. S.

    2007-01-01

    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading t...

  2. Equations of state for barium in high-pressure phases

    International Nuclear Information System (INIS)

    The universal equation of state with an arbitrary reference point presented by the author (Fang Zheng-Hua 1998 Phys. Rev. B 50 16 238) is applied successfully to the analysis of the experimental compression data of barium in different structural phases (I, II, and V). The comparison given in this paper shows that this equation suits for the isothermal compression behaviour of barium in the high-pressure phases (II and V) better than the Birch-Murnaghan equation. The applicability of equations of state for solids in high-pressure phases is also discussed. (author)

  3. Dicty_cDB: SSI130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI130 (Link to dictyBase) - - - Contig-U01598-1 SSI130Z (Link... to Original site) - - SSI130Z 458 - - - - Show SSI130 Library SS (Link to library) Clone ID SSI130 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI1-B/SSI130Q.Seq.d/ Representative seq. ID SSI13...0Z (Link to Original site) Representative DNA sequence >SSI130 (SSI130Q) /CSM/SS/SSI1-B/SSI130Q.Seq.d/ XXXXX...lkmflmv i*kvksiykmkkk*ilikiikmviiiiiiiikkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSI

  4. Chemical abundance analysis of 19 barium stars

    Science.gov (United States)

    Yang, Guo-Chao; Liang, Yan-Chun; Spite, Monique; Chen, Yu-Qin; Zhao, Gang; Zhang, Bo; Liu, Guo-Qing; Liu, Yu-Juan; Liu, Nian; Deng, Li-Cai; Spite, Francois; Hill, Vanessa; Zhang, Cai-Xia

    2016-01-01

    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures Teff, surface gravities log g, metallicity [Fe/H] and microturbulence velocity ξt) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants as indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their Na, Al, α- and iron-peak elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-capture) process elements relative to the Sun. Their median abundances of [Ba/Fe], [La/Fe] and [Eu/Fe] are 0.54, 0.65 and 0.40, respectively. The Y I and Zr I abundances are lower than Ba, La and Eu, but higher than the α- and iron-peak elements for the strong Ba stars and similar to the iron-peak elements for the mild stars. There exists a positive correlation between Ba intensity and [Ba/Fe]. For the n-capture elements (Y, Zr, Ba, La), there is an anti-correlation between their [X/Fe] and [Fe/H]. We identify nine of our sample stars as strong Ba stars with [Ba/Fe] >0.6 where seven of them have Ba intensity Ba=2-5, one has Ba=1.5 and another one has Ba=1.0. The remaining ten stars are classified as mild Ba stars with 0.17<[Ba/Fe] <0.54.

  5. 38 CFR 52.130 - Nursing services.

    Science.gov (United States)

    2010-07-01

    ... FOR ADULT DAY HEALTH CARE OF VETERANS IN STATE HOMES Standards § 52.130 Nursing services. The program... to meet the total nursing care needs, as determined by participant assessment and individualized... level of nursing staff is determined by the authorized capacity of participants and the nursing...

  6. 38 CFR 51.130 - Nursing services.

    Science.gov (United States)

    2010-07-01

    ... FOR NURSING HOME CARE OF VETERANS IN STATE HOMES Standards § 51.130 Nursing services. The facility... to meet the total nursing care needs, as determined by resident assessment and individualized comprehensive plans of care, of all patients within the facility 24 hours a day, 7 days a week. (a) The...

  7. 40 CFR 130.11 - Program management.

    Science.gov (United States)

    2010-07-01

    ... planning and management activities. Grant administrative requirements for these funds appear in 40 CFR... 40 CFR part 35, subpart J. A State may also use part of the 205(g) funds to administer approved... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Program management. 130.11 Section...

  8. Organic matter on asteroid 130 Elektra

    Science.gov (United States)

    Cruikshank, D. P.; Brown, R. H.

    1987-01-01

    Infrared absorption spectra of a low-albedo water-rich asteroid appear to show a weak 3.4-micrometer carbon-hydrogen stretching mode band, which suggests the presence of hydrocarbons on asteroid 130 Elektra. The organic extract from the primitive carbonaceous chondritic Murchison meteorite shows similar spectral bands.

  9. Evidence of asymmetric top in 130Ba

    International Nuclear Information System (INIS)

    Introduced is a new relation connecting moment of inertia, Lipas parameter and asymmetric rotor model energies and put forward much closer trend in odd even staggering of quasi γ-band. A different view point regarding generation of quasi γ-band in 130Ba have been presented

  10. Konstantin Päts 130 / Peep Pillak

    Index Scriptorium Estoniae

    Pillak, Peep, 1957-

    2004-01-01

    23. veebruaril 2004 möödus 130 aastat EV presidendi Konstantin Pätsi sünnist. Ülevaade üritustest, mida tähtpäeva puhul korraldas Konstantin Pätsi Muuseum - 22. veebruaril peetud ajalookonverentsist, näitusest Tallinna Pedagoogikaülikooli Akadeemilises Raamatukogus ja mälestustseremooniast Tallinna Metsakalmistul

  11. BARIUM AND RADIUM REMOVAL FROM GROUNDWATER BY ION EXCHANGE

    Science.gov (United States)

    The primary objective of this study was to determine the applicability of weak acid exchange resin in the hydrogen form for removal of hardness, barium and radium from groundwater. Weak acid resin in the hydrogen form eliminates the addition of sodium to drinking water. The capac...

  12. PROPOSED ORAL REFERENCE DOSE (RFD) FOR BARIUM AND COMPOUNDS

    Science.gov (United States)

    The Integrated Risk Information System (IRIS) is a database of EPA's consensus opinion of the human health effects that may result from exposure to various substances found in the environment. A Toxicological Review and IRIS Summary were prepared for barium and compounds in 1998 ...

  13. Barium titanate inverted opals-synthesis, characterization, and optical properties

    Energy Technology Data Exchange (ETDEWEB)

    Soten, I.; Miguez, H.; Yang, S.M.; Petrov, S.; Coombs, N.; Tetreault, N.; Ozin, G.A. [Toronto Univ., ON (Canada). Dept. of Chemistry; Matsuura, N.; Ruda, H.E. [Toronto Univ., ON (Canada). Dept. of Metallurgy and Materials Science

    2002-01-01

    The engineering of cubic or tetragonal polymorphs of nanocrystalline barium titanate inverted opals has been achieved by thermally induced transformations. Optical characterization demonstrated photonic crystal behavior of the opals. The tuning of the ferroelectric-paraelectric transition around the Curie temperature is shown in this paper. (orig.)

  14. Nanocrystals formation on Ho3+ doped strontium barium niobate glass

    International Nuclear Information System (INIS)

    The study of two different methods to obtain strontium barium niobate nanocrystals immersed in a glass matrix has been carried out. Ho2O3-doped SrO-BaO-Nb2O5-B2O3 glasses were fabricated using the melt quenching method. Glass ceramic samples were obtained from the precursor glass by thermal treatment in a furnace and by laser irradiation. These glass ceramic samples are formed by a glassy phase and a crystalline phase of strontium barium niobate nanocrystals. This structure was confirmed by X-ray diffraction and Atomic Force Microscope images. The incorporation of Ho3+ ions in the strontium barium niobate nanocrystals were corroborated by optical measurements, which produced an increment in the luminescence intensity compared to the precursor glass. - Research Highlights: →Ho doped strontium barium niobate nanocrystals have been obtained. →XRD, AFM and optical measurements corroborate the formation of SBN. →A laser irradiation technique has been carried out successfully.

  15. Removal of barium and radium from groundwater. Environmental research brief

    International Nuclear Information System (INIS)

    A research project was undertaken to investigate processes for removing barium and radium from drinking water. Special emphasis was placed on ion exchange processes that can be used without adding large concentrations of sodium to the water. The wastes from radium and barium removal processes were also characterized, and processes suitable for treatment of ion-exchange brines were evaluated. The report discusses two ion-exchange processes that can be used for barium and radium removal accompanied by either partial or no hardness removal. The calcium-form, strong-acid ion-exchange resin can be used for barium and radium removal without significant change in hardness or the concentration of other salts. This resin can be regenerated with CaC12 brine. The radium-selective complexer (RSC) will remove radium without altering hardness or other salt concentration. The capacity of this resin for waters with low total dissolved solids (TDS) (<1000 to 2000 mg/L TDS) is in excess of 30,000 pCi/dry g; however, if the TDS is increased to about 40,000 mg/L, the capacity drops to 200 to 300 pCi/dry g. Thus using this resin to remove radium from spent brine does not appear feasible

  16. CNO and F abundances in the barium star HD 123396

    CERN Document Server

    Alves-Brito, Alan; Yong, David; Meléndez, Jorge; Vásquez, Sergio

    2011-01-01

    [Abridged] Barium stars are moderately rare chemically peculiar objects which are believed to be the result of the pollution of an otherwise normal star by material from an evolved companion on the asymptotic giant branch (AGB). We aim to derive carbon, nitrogen, oxygen, and fluorine abundances for the first time from infrared spectra of the barium red giant star HD 123396 to quantitatively test AGB nucleosynthesis models for producing barium stars via mass accretion. High-resolution and high S/N infrared spectra were obtained using the Phoenix spectrograph mounted at the Gemini South telescope. The abundances were obtained through spectrum synthesis of individual atomic and molecular lines, using the MOOG stellar line analysis program together with Kurucz's stellar atmosphere models. The analysis was classical, using 1D stellar models and spectral synthesis under the assumption of local thermodynamic equilibrium. We confirm that HD 123396 is a metal-deficient barium star ([Fe/H] = -1.05), with A(C) = 7.88, A...

  17. Ultra-low temperature processing of barium tellurate dielectrics

    Science.gov (United States)

    Kwon, Do-Kyun

    Ceramics, metals and polymers have unique electrical properties that are combined for electronic devices and systems. It necessitates lower processing temperatures for ceramics to be compatible with metal and polymer systems. In this thesis, the synthesis, crystal structure, and dielectric properties of barium tellurate are studied for temperatures between 500 and 900°C. Barium tellurate dielectric ceramics (BaTe4O9, BaTe 2O5, BaTe2O6, BaTeO3, BaTeO 4, and Ba2TeO5) are extensively investigated as new LTCC (Low-Temperature Cofired Ceramics) dielectric systems integrated with low resistivity metal electrodes such as silver and aluminum for microwave application. Studies on the phase formation and crystal structure through thermal analyses (Differential Scanning Calorimetry and Thermogravimetric Analysis, DSC-TGA) and X-ray diffraction phase analysis attest that barium tellurates are formed in the temperature range of 500 ˜ 900°C, through the sequential phase formations from Te-rich to Ba-rich phases. The oxygen coordination of the tellurium ion progresses from TeO4 to TeO6 via TeO 3+1 and TeO3 with increasing barium content as confirmed by structural analysis using infrared spectroscopy. High density barium tellurate ceramics are achieved at temperatures as low as 550°C, which provides the potential to be co-fired with low-melting aluminum metal electrodes in LTCC processing. Dielectric permittivity, loss, and temperature stability of barium tellurate dielectric ceramics were measured from 100 Hz to 13 GHz. Barium tellurate ceramics exhibit excellent microwave dielectric properties with intermediate dielectric permittivities and high quality factors (Q). The dielectric properties at microwave frequencies are epsilonr = 17.5, Qxf = 54700 GHz, TCf = -90 ppm/°C for BaTe4O9, epsilonr = 21, Qxf = 50300 GHz, TCf = -51 ppm/°C for BaTe2O6, epsilonr = 10, Qxf = 34000 GHz, TCf = -54 ppm/°C for BaTeO3, and epsilonr = 17, Qx f = 49600 GHz, TCf = -124 ppm/°C for Ba 2TeO5

  18. Myxoma virus M130R is a novel virulence factor required for lethal myxomatosis in rabbits.

    Science.gov (United States)

    Barrett, John W; Werden, Steven J; Wang, Fuan; McKillop, William M; Jimenez, June; Villeneuve, Danielle; McFadden, Grant; Dekaban, Gregory A

    2009-09-01

    Myxoma virus (MV) is a highly lethal, rabbit-specific poxvirus that induces a disease called myxomatosis in European rabbits. In an effort to understand the function of predicted immunomodulatory genes we have deleted various viral genes from MV and tested the ability of these knockout viruses to induce lethal myxomatosis. MV encodes a unique 15 kD cytoplasmic protein (M130R) that is expressed late (12h post infection) during infection. M130R is a non-essential gene for MV replication in rabbit, monkey or human cell lines. Construction of a targeted gene knockout virus (vMyx130KO) and infection of susceptible rabbits demonstrate that the M130R knockout virus is attenuated and that loss of M130R expression allows the rabbit host immune system to effectively respond to and control the lethal effects of MV. M130R expression is a bona fide poxviral virulence factor necessary for full and lethal development of myxomatosis. PMID:19477207

  19. Flexoelectricity in barium strontium titanate thin film

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Seol Ryung; Huang, Wenbin; Yuan, Fuh-Gwo; Jiang, Xiaoning, E-mail: xjiang5@ncsu.edu [Department of Mechanical and Aerospace Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States); Shu, Longlong [Department of Mechanical and Aerospace Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States); Electronic Materials Research Laboratory, International Center for Dielectric Research, Xi' an Jiao Tong University, Xi' an, Shaanxi 710049 (China); Maria, Jon-Paul [Department of Material Science and Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States)

    2014-10-06

    Flexoelectricity, the linear coupling between the strain gradient and the induced electric polarization, has been intensively studied as an alternative to piezoelectricity. Especially, it is of interest to develop flexoelectric devices on micro/nano scales due to the inherent scaling effect of flexoelectric effect. Ba{sub 0.7}Sr{sub 0.3}TiO{sub 3} thin film with a thickness of 130 nm was fabricated on a silicon wafer using a RF magnetron sputtering process. The flexoelectric coefficients of the prepared thin films were determined experimentally. It was revealed that the thin films possessed a transverse flexoelectric coefficient of 24.5 μC/m at Curie temperature (∼28 °C) and 17.44 μC/m at 41 °C. The measured flexoelectric coefficients are comparable to that of bulk BST ceramics, which are reported to be 10–100 μC/m. This result suggests that the flexoelectric thin film structures can be effectively used for micro/nano-sensing devices.

  20. History of Larix decidua Mill. (European larch) since 130 ka

    Science.gov (United States)

    Wagner, Stefanie; Litt, Thomas; Sánchez-Goñi, Maria-Fernanda; Petit, Rémy J.

    2015-09-01

    Retrospective studies focussing on forest dynamics using fossil and genetic data can provide important keys to prepare forests for the future. In this study we analyse the impact of past climate and anthropogenic changes on Larix decidua Mill. (European larch) populations based on a new range-wide fossil compilation encompassing the last 130 ka and on recently produced genetic data (nuclear, mitochondrial). Results demonstrate that during the last 130 ka L. decidua persisted close to its current distribution range and colonized vast areas outside this range during the first two early Weichselian interstadials (c. 87-109 ka and c. 83-78 ka), reaching a distributional maxima in the north-central European lowlands. Some fossil sites point to notably rapid responses to some abrupt climate events (Dansgaard-Oeschger cycles and Heinrich Events). Combined fossil and genetic data identify at least six MIS 2 refuges and postglacial recolonization pathways. The establishment of extant L. decidua forests dates back to the first two millennia of the Holocene (c. 11.5-9.5 ka) and the onset of anthropogenic impact was inferred since the late Neolithic (c. 6 ka), with major changes occurring since the Bronze Age (c. 4 ka). During the last 300 years human-induced translocations resulted in recent admixture of populations originating from separate refuges. Altogether, the results of this study provide valuable clues for developing sustainable conservation and management strategies targeting ancient genetic lineages and for studying evolutionary issues.

  1. Dicty_cDB: AFM130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value (Q4QQW4) RecName: Full=Histone deacetylase...ton... 278 3e-73 ( Q13547 ) RecName: Full=Histone deacetylase 1; Short=HD1... 278 3e-73 AY893466...00 100.0 %: >> prediction for AFM130 is 5' end seq. ID AFM130F 5' end seq. >AFM130F.Seq ATTTATTTTGTAAATATACA...sukuba.ac.jp/CSM/AF/AFM1-B/AFM130Q.Seq.d/ Representative seq. ID AFM130P (Link to Original site) Represe...ntative DNA sequence >AFM130 (AFM130Q) /CSM/AF/AFM1-B/AFM130Q.Seq.d/ ATTTATTTTGTAAATA

  2. Surface studies of barium and barium oxide on tungsten and its application to understanding the mechanism of operation of an impregnated tungsten cathode

    Science.gov (United States)

    Forman, R.

    1976-01-01

    Surface studies have been made of multilayer and monolayer films of barium and barium oxide on a tungsten substrate. The purpose of the investigation was to synthesize the surface conditions that exist on an activated impregnated tungsten cathode and obtain a better understanding of the mechanism of operation of such cathodes. The techniques employed in these measurements were Auger spectroscopy and work-function measurements. The results of this study show that the surface of an impregnated cathode is identical to that observed for a synthesized monolayer or partial monolayer of barium on oxidized tungsten by evaluating Auger spectra and work-function measurements. Data obtained from desorption studies of barium monolayers on a tungsten substrate in conjunction with Auger and work-function results have been interpreted to show that throughout most of its life an impreganated cathode has a partial monolayer, rather than a monolayer, of barium on its surface.

  3. Design, testing, fabrication and launch support of a liquid chemical barium release payload (utilizing the liquid fluorine-barium salt/hydrazine system)

    Science.gov (United States)

    Stokes, C. S.; Smith, E. W.; Murphy, W. J.

    1972-01-01

    A payload was designed which included a cryogenic oxidizer tank, a fuel tank, and burner section. Release of 30 lb of chemicals was planned to occur in 2 seconds at the optimum oxidizer to fuel ratio. The chemicals consisted of 17 lb of liquid fluorine oxidizer and 13 lb of hydrazine-barium salt fuel mixture. The fuel mixture was 17% barium chloride, 16% barium nitrate, and 67% hydrazine, and contained 2.6 lb of available barium. Two significant problem areas were resolved during the program: explosive valve development and burner operation. The release payload was flight tested, from Wallops Island, Virginia. The release took place at an altitude of approximately 260 km. The release produced a luminous cloud which expanded very rapidly, disappearing to the human eye in about 20 seconds. Barium ion concentration slowly increased over a wide area of sky until measurements were discontinued at sunrise (about 30 minutes).

  4. Electromagnetic properties of photodefinable barium ferrite polymer composites

    Directory of Open Access Journals (Sweden)

    Olusegun Sholiyi

    2014-07-01

    Full Text Available This article reports the magnetic and microwave properties of a Barium ferrite powder suspended in a polymer matrix. The sizes for Barium hexaferrite powder are 3–6 μm for coarse and 0.8–1.0 μm for the fine powder. Ratios 1:1 and 3:1 (by mass of ferrite to SU8 samples were characterized and analyzed for predicting the necessary combinations of these powders with SU8 2000 Negative photoresist. The magnetization properties of these materials were equally determined and were analyzed using Vibrating Sample Magnetometer (VSM. The Thru, Reflect, Line (TRL calibration technique was employed in determining complex relative permittivity and permeability of the powders and composites with SU8 between 26.5 and 40 GHz.

  5. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine

    Science.gov (United States)

    Graziana Genchi, Giada; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni

    2016-06-01

    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these ‘smart’ nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation.

  6. HYBRID AND CHARACTERISTIC OF POLYANILINE- BARIUM TITANATE NANOCOMPOSITE PARTICLES

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Polyaniline-barium titanate (PAn-BaTiO3) ultrafine composite particles were prepared by the oxidative polymerization of aniline with H2O2 while barium titanate nanoparticles were synthesized with a sol-gel method. The infrared spectrogram shows that the polymerization of PAn in the hybrid process of PAn-BaTiO3 is similar with the polymeric process of pure aniline, and there is interaction of PAn and BaTiO3 in the PAn-BaTiO3. SEM and TEM results show that the average diameter of the composite particles is 1.50 μm and the diameters of BaTiO3 nanoparticles are 5-15 nm in the composite particle. The electrical conductivity of the ultrafine composite particles is transformable from 100 to 10-11S/cm by equilibrium doping or dedoping method using various concentration of HCl or NaOH solutions.

  7. Thermophysical properties of americium-containing barium plutonate

    International Nuclear Information System (INIS)

    Polycrystalline specimens of americium-containing barium plutonate have been prepared by mixing the appropriate amounts of (Pu0.91Am0.09)O2 and BaCO3 powders followed by reacting and sintering at 1600 K under the flowing gas atmosphere of dry-air. The sintered specimens had a single phase of orthorhombic perovskite structure and were crack-free. Elastic moduli were determined from longitudinal and shear sound velocities. Debye temperature was also determined from sound velocities and lattice parameter measurements. Thermal conductivity was calculated from measured density at room temperature, literature values of heat capacity and thermal diffusivity measured by laser flash method in vacuum. Thermal conductivity of americium-containing barium plutonate was roughly independent of temperature and registered almost the same magnitude as that of BaPuO3 and BaUO3. (author)

  8. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine.

    Science.gov (United States)

    Genchi, Giada Graziana; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni

    2016-06-10

    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these 'smart' nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation. PMID:27145888

  9. 46 CFR 130.460 - Placement of machinery alarms.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Placement of machinery alarms. 130.460 Section 130.460..., AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Automation of Unattended Machinery Spaces § 130.460 Placement of machinery alarms. (a) Visible and audible alarms must be installed at the pilothouse to...

  10. 27 CFR 21.130 - Spike lavender oil, natural.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Spike lavender oil, natural. 21.130 Section 21.130 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Denaturants § 21.130 Spike lavender oil, natural. (a) Alcohol content (as borneol). Not less than 30...

  11. 41 CFR 105-8.130 - General prohibitions against discrimination.

    Science.gov (United States)

    2010-07-01

    ... against discrimination. 105-8.130 Section 105-8.130 Public Contracts and Property Management Federal... § 105-8.130 General prohibitions against discrimination. (a) No qualified individual with handicaps... otherwise be subjected to discrimination under any program or activity conducted by the agency. (1)...

  12. 38 CFR 23.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-07-01

    ... FINANCIAL ASSISTANCE Introduction § 23.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any... opportunities. 23.130 Section 23.130 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS...

  13. 29 CFR 36.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Effect of employment opportunities. 36.130 Section 36.130... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 36.130 Effect of employment opportunities... employment opportunities in any occupation or profession are or may be more limited for members of one...

  14. 36 CFR 1211.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-07-01

    ... FEDERAL FINANCIAL ASSISTANCE Introduction § 1211.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in... opportunities. 1211.130 Section 1211.130 Parks, Forests, and Public Property NATIONAL ARCHIVES AND...

  15. 44 CFR 19.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-10-01

    ... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.130 Effect of employment opportunities... employment opportunities in any occupation or profession are or may be more limited for members of one sex... opportunities. 19.130 Section 19.130 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT...

  16. 18 CFR 1317.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-04-01

    ... Introduction § 1317.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession are... opportunities. 1317.130 Section 1317.130 Conservation of Power and Water Resources TENNESSEE VALLEY...

  17. 41 CFR 105-53.130 - Office of the Administrator.

    Science.gov (United States)

    2010-07-01

    ... Administrator. 105-53.130 Section 105-53.130 Public Contracts and Property Management Federal Property... FUNCTIONS Central Offices § 105-53.130 Office of the Administrator. The Administrator of General Services... assigned to the General Services Administration. The Deputy Administrator, who is appointed by...

  18. 7 CFR 1955.130 - Real estate brokers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Real estate brokers. 1955.130 Section 1955.130... Dispose of Inventory Property § 1955.130 Real estate brokers. Contracting authority for the use of real... provide for any licensed real estate broker to provide sales services for any property listed under...

  19. 20 CFR 401.130 - Freedom of Information Act.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Freedom of Information Act. 401.130 Section 401.130 Employees' Benefits SOCIAL SECURITY ADMINISTRATION PRIVACY AND DISCLOSURE OF OFFICIAL RECORDS AND INFORMATION Disclosure of Official Records and Information § 401.130 Freedom of Information Act. The FOIA requires us to disclose any...

  20. Ion feedback afterpulses in FEU-130 and XP2020 photomultipliers

    International Nuclear Information System (INIS)

    Intensities and time distributions of ion feedback afterpulses are studied as a function of the difference of potentials between the photocathode and the first dynodes in FEU-130. The intensities and amplitudes of afterpulses in FEU-130 are found to be appreciably larger than in XP2020, which may limit the use of FEU-130 in some experiments with autocorrelation delayed-coincidence spectrometers

  1. 13 CFR 130.600 - Cooperative agreement. [Reserved

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Cooperative agreement. 130.600 Section 130.600 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS § 130.600 Cooperative agreement....

  2. 13 CFR 130.400 - Application procedure. [Reserved

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Application procedure. 130.400 Section 130.400 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT CENTERS § 130.400 Application procedure....

  3. 10 CFR 5.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Effect of employment opportunities. 5.130 Section 5.130 Energy NUCLEAR REGULATORY COMMISSION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 5.130 Effect of employment...

  4. 50 CFR 600.130 - Protection of confidentiality of statistics.

    Science.gov (United States)

    2010-10-01

    ... statistics. 600.130 Section 600.130 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... Fishery Management Councils § 600.130 Protection of confidentiality of statistics. Each Council must establish appropriate procedures for ensuring the confidentiality of the statistics that may be submitted...

  5. Barium ferrite powders prepared by milling and annealing

    Directory of Open Access Journals (Sweden)

    R. Nowosielski

    2007-05-01

    Full Text Available Purpose: Microstructure and magnetic properties analysis of barium ferrite powder obtained by milling and heat treatment.Design/methodology/approach: The milling process was carried out in a vibratory mill, which generated vibrations of the balls and milled material inside the container during which their collisions occur. After milling process the powders were annealed in electric chamber furnace. The X-ray diffraction methods were used for qualitative phase analysis of studied powder samples. The distribution of powder particles was determined by a laser particle analyzer. The magnetic hysteresis loops of examined powder material were measured by resonance vibrating sample magnetometer (R-VSM.Findings: The milling process of iron oxide and barium carbonate mixture causes decrease of the crystallite size of involved phases. The X-ray investigations of tested mixture milled for 30 hours and annealed at 950 °C enabled the identification of hard magnetic BaFe12O19 phase and also the presence of Fe2O3 phase in examined material. The Fe2O3 phase is a rest of BaCO3 dissociation in the presence of Fe2O3, which forms a compound of BaFe12O19. The best coercive force (HC for mixture of powders annealed at 950 °C for 10, 20 and 30 hours is 349 kA/m, 366 kA/m and 364 kA/m, respectively. The arithmetic mean of diameter of Fe2O3 and BaCO3 mixture powders after 30 hours of milling is about 6.0 μm.Practical implications: The barium ferrite powder obtained by milling and annealing can be suitable components to produce sintered and elastic magnets with polymer matrix.Originality/value: The results of tested barium ferrite investigations by different methods confirm their utility in the microstructure and magnetic properties analysis of powder materials.

  6. Barium borohydride chlorides: synthesis, crystal structures and thermal properties.

    Science.gov (United States)

    Grube, Elisabeth; Olesen, Cathrine H; Ravnsbæk, Dorthe B; Jensen, Torben R

    2016-05-10

    Here we report the synthesis, mechanism of formation, characterization and thermal decomposition of new barium borohydride chlorides prepared by mechanochemistry and thermal treatment of MBH4-BaCl2, M = Li, Na or K in ratios 1 : 1 and 1 : 2. Initially, orthorhombic barium chloride, o-BaCl2 transforms into o-Ba(BH4)xCl2-x, x ∼ 0.15. Excess LiBH4 leads to continued anion substitution and a phase transformation into hexagonal barium borohydride chloride h-Ba(BH4)xCl2-x, which accommodates higher amounts of borohydride, possibly x ∼ 0.85 and resembles h-BaCl2. Thus, two solid solutions are in equilibrium during mechano-chemical treatment of LiBH4-BaCl2 (1 : 1) whereas LiBH4-BaCl2 (2 : 1) converts to h-Ba(BH4)0.85Cl1.15. Upon thermal treatment at T > ∼200 °C, h-Ba(BH4)0.85Cl1.15 transforms into another orthorhombic barium borohydride chloride compound, o-Ba(BH4)0.85Cl1.15, which is structurally similar to o-BaBr2. The samples with M = Na and K have lower reactivity and form o-Ba(BH4)xCl2-x, x ∼ 0.1 and a solid solution of sodium chloride dissolved in solid sodium borohydride, Na(BH4)1-xClx, x = 0.07. The new compounds and reaction mechanisms are investigated by in situ synchrotron radiation powder X-ray diffraction (SR-PXD), Fourier transform infrared spectroscopy (FT-IR) and simultaneous thermogravimetric analysis (TGA), differential scanning calorimetry (DSC), mass spectroscopy (MS) and temperature programmed photographic analysis (TPPA). PMID:27109871

  7. Thermoelectric power of barium up to 8 GPa

    Energy Technology Data Exchange (ETDEWEB)

    Ramani, G.; Divakar, C.; Singh, A.K.

    1987-01-15

    The present measurements indicate that the thermoelectric power (TEP) of barium at room temperature and pressure is 15 ..mu..V K/sup -1/, and decreases with increasing pressure, reaching about 4 ..mu..V K/sup -1/ just before the bcc..-->..hcp transition. The TEP shows a discontinuous increase at the bcc..-->..hcp transition beyond which it continues to decrease with increasing pressure.

  8. Effect of Silver Coating on Barium Titanium Oxide Nanoparticle Toxicity

    OpenAIRE

    Obregon, Isidro D.; Betts-Obregon, Brandi S.; Yust, Brian; Pedraza, Francisco; Ortiz, Alexandra; Sardar, Dhiraj; Tsin, Andrew T.

    2013-01-01

    Nanoparticles are presently being studied for optical and biomedical applications such as medical imaging and drug delivery. Nanoparticles impact the cellular environment due to many variables such as size, shape, and composition. How these factors affect cell viability is not fully understood. The purpose of this study is to test the toxicity effects of silver coating (Ag@) Barium Titanium Oxide (BaTiO3) nanoparticles on Rhesus Monkey Retinal Endothelial cells (RhREC’s) in culture. The addit...

  9. Microstructure and magnetic properties of commercial barium ferrite powders

    Directory of Open Access Journals (Sweden)

    R. Nowosielski

    2007-01-01

    Full Text Available Purpose: Microstructural and magnetic properties analysis of commercial barium ferrite powder BaFe12O19.Design/methodology/approach: The X-ray diffraction methods were utilized not only for qualitative andquantitative phase analysis of studied powder sample, but also for the determination of lattice parameters, crystallitesize and the lattice distortion. The Rietveld method was used in the verification of the qualitative phase compositionand in the determination of phase abundance. Hill and Howard procedure was applied for quantitative phaseanalysis. The parameters of the individual diffraction line profiles were determined by PRO-FIT Toraya procedure.The morphology of barium ferrite powders was analyzed using the scanning electron miroscopy (SEM method.The distribution of powder particles was determined by a laser particle analyzer. Moreover, the magnetic hysteresisloop of examined powder material were measured by resonance vibrating sample magnetometer (R-VSM.Findings: The X-ray diffraction analysis revealed the presence of hexagonal BaFe12O19 and rhombohedralFe2O3 phases in examined powder samples. The barium ferrite phase appeared to be the main component of thesamples (97.8 wt.%. The crystallite size of BaFe12O19 phase is above 100 nm. The size of studied powders isin the range from 0.2 μm to 40.5 μm. The arithmetic mean diameter of BaFe12O19 powders population is 10.335μm. The SEM images showed irregular shape and size of powder particles. The coercive force (HC obtainedfrom hysteresis loop has a value about 159 kA/m.Practical implications: Structure analysis of commercial barium ferrite powder is helpful to prepare thismaterial by laboratory methods.Originality/value: The obtained results of investigations by different methods of structure characterizationconfirm their utility in the microstructure analysis of powder materials.

  10. Dielectric Properties of Barium Titanate Prepared by Spark Plasma Sintering

    Czech Academy of Sciences Publication Activity Database

    Ctibor, Pavel; Sedláček, J.; Dopita, M.; Pala, Zdeněk

    Bratislava: Slovak Expert Group of Solid State Chemistry and Physics , 2011 - (Koman, M.; Mikloš, D.), s. 68-69 ISBN 978-80-8134-002-4. [Joint Seminar – Development of materials science in research and education (DMRSE)/21.th./. Kežmarské Žlaby (SK), 29.08.2011-02.09.2011] Institutional research plan: CEZ:AV0Z20430508 Keywords : spark plasma sintering * barium titanate * dielectric properties Subject RIV: JK - Corrosion ; Surface Treatment of Materials

  11. Preparation and Characterization of Nano-particle Substituted Barium Hexaferrite

    OpenAIRE

    Atassi, Yomen; Darwich, Iyad Seyd; Tally, Mohammad

    2014-01-01

    High density magnetic recording requires high coercivity magnetic media and small particle size. Barium hexaferrite has been considered as a leading candidate material because of its chemical stability, fairly large crystal anisotropy and suitable magnetic characteristics. In this work, we present the preparation of the hexagonal ferrite BaFe12O19 and one of its derivative; the Zn-Sn substituted hexaferrite by the chemical co-precipitation method. The main advantage of this method on the conv...

  12. FUN3D Manual: 13.0

    Science.gov (United States)

    Biedron, Robert T.; Carlson, Jan-Renee; Derlaga, Joseph M.; Gnoffo, Peter A.; Hammond, Dana P.; Jones, William T.; Kleb, Bill; Lee-Rausch, Elizabeth M.; Nielsen, Eric J.; Park, Michael A.; Rumsey, Christopher L.; Thomas, James L.; Wood, William A.

    2016-01-01

    This manual describes the installation and execution of FUN3D version 13.0, including optional dependent packages. FUN3D is a suite of computational fluid dynamics simulation and design tools that uses mixed-element unstructured grids in a large number of formats, including structured multiblock and overset grid systems. A discretely-exact adjoint solver enables efficient gradient-based design and grid adaptation to reduce estimated discretization error. FUN3D is available with and without a reacting, real-gas capability. This generic gas option is available only for those persons that qualify for its beta release status.

  13. Preparation of Nanoparticles of Barium Ferrite from Precipitation in Microemulsions

    International Nuclear Information System (INIS)

    Magnetic nanoparticles of barium ferrite (BaFe12O19) have been synthesized using a microemulsion mediated process. The aqueous cores of water-in-oil microemulsions were used as constrained microreactors for the precipitation of precursor carbonate and hydroxide particles. These precursors were then calcined at 925 deg. C for 12 h, during which time they were transformed to the hexagonal ferrite. The pH of reaction was varied between 5 and 12, and it was found that the fraction of non-magnetic hematite (α-Fe2O3) in the particles varied with the pH of reaction, thus affecting the magnetic properties of the particles. The same precursor particles were also prepared by bulk co-precipitation reaction for comparison. It was found that the microemulsion derived nanoparticles of barium ferrite had both higher intrinsic coercivity (Hc) and saturation magnetization (σs) than the particles derived from bulk co-precipitation. Particles were analyzed by electron microscopy, X-ray diffraction, differential thermal analysis (DTA), thermogravimetric analysis (TGA) and vibrating sample magnetometry (VSM). The best barium ferrite particles produced by the microemulsion synthesis method yielded an intrinsic coercivity of 4310 Oe and a saturation magnetization of 60.48 emu/g

  14. Role of hexadecapole interaction in proton rich barium isotopes

    International Nuclear Information System (INIS)

    From the systematic analysis of the experimental data on proton rich barium isotopes, it is observed that nuclei in the region z ≥ 50 and N≤82 are the transitional nuclei as they show a shape transition from spherical to deformed shape. An interesting feature of the observed yrast spectra in barium isotopic mass chain is the systematic variation of E2+, E4+ and E6+ excitation energy states from 120Ba to 136Ba. It is observed that these states follow a systematic decreasing trend as move away from 136Ba towards 120Ba. The isotopes 120-128Ba can be taken to be quasi-deformed nuclei having E4+/E2+ ratio larger than 2.7. Based on the systematics of low-lying states and the experimental data of quadrupole moments and B(E2) transition probabilities, the stable barium isotopes range from the approximately spherical 138Ba to l30Ba which is close to the deformed 120-128Ba isotopes. The purpose of the paper is to determine the importance of octupole-octupole and hexadecapole- hexadecapole parts of the two body interaction in reproducing the observed nuclear structure properties of 120-136Ba isotopes

  15. CT and barium features of gastrointestinal and peritoneal tuberculosis

    Directory of Open Access Journals (Sweden)

    Makanjuola Dorothy

    1997-01-01

    Full Text Available The radiological features in barium gastrointestinal studies and computed tomographic (CT examinations of 22 consecutive cases of proven peritoneal and/or intestinal tuberculosis were analyzed in order to highlight the radiological features which could provide ready identification of the disease. There were 15 cases of intestinal tuberculosis and 7 cases of peritoneal tuberculosis and 3 patients had both. The commonest location of intestinal tuberculosis was the ileocecal region (N=10 which occurred in association with colonic or ilea] disease. Bowel wall thickening in CT was largely asymmetrical but minimal and symmetrical wall thickening occurred with peritonitis. Luminal narrowing with or without mucosal tethering were seen in both CT and Barium studies. Peritoneal TB had either high density ascites with smudge or nodular omental surface with a thickened omental lining. Also detected was fibrinous dry peritonitis with thickened mesenteric tissue. Lymphadenopathy in the peripancreatic, mesenteric or paracaval were common to both intestinal or peritoneal tuberculosis (21 out of 22. Fifty percent of the patients showed some lymph nodes with necrotic centers. The differential diagnosis included malignant peritonitis and intestinal or mesenteric carcinoid. The study shows that a combination of barium gastrointestinal study and computed tomography can provide distinct features which could strongly suggest the diagnosis of intestinal or peritoneal tuberculosis.

  16. Scanning electron and tunneling microscopy of palladium-barium emitters

    International Nuclear Information System (INIS)

    The results of study of metal-alloyed palladium-barium emitters' of modern very high frequency high-powered electronic vacuum tubes by scanning electron microscopy (SEM) and scanning tunneling microscopy/spectroscopy (STM/STS) are presented. Since the Pd/Ba foil surface is fairly smooth and is not oxidized in air STM/STS investigations are carried out in air in normal laboratory environment. SEM and STM images show that the emitter surface has a complex porous structure. The cathode surface study by STS in tunneling gap modulation mode allowed to take a map of phase distribution with various work function values and high lateral resolution. Obtained images demonstrate the presence of three phases on the Pd/Ba emitter surface, viz. barium-oxygen compounds, intermetallic, and palladium. As it is seen from presented STS image the phase with a low work function value (barium oxides) is concentrated along boundaries of the substance inclusions with work function corresponding to the intemetallic compound Pd5Ba. This supports the model of low work function areas obtained via Ba segregation from the intermetallic compound and oxidation. The presented methods may be used in the Pd/Ba cathode manufacturing process for increasing the yield of electronic devices in microwave tube production and optimize the emitters' characteristics

  17. Early colon cancer : findings on double contrast barium enema

    International Nuclear Information System (INIS)

    The purpose of this study is to describe the radiologic findings of early colon cancer on double-contrast barium enema. We retrospectively reviewed the double-contrast barium enemas of eight patients (M:F = 6:2; mean age : 67 yrs; range : 48-77 yrs) who were pathologically proven to be early colon cancer. The location, size and gross morphology of lesions was evaluated using double-contrast barium enema, while depth of invasion, degree of differentiation, precancerous lesions and lymph node metastasis were evaluated histopathologically. Early colon cancer was found in the rectum (n=4), sigmoid colon (n=3) and ascending colon (n=1). The size of mass ranged from 2.3 ∼ 8.3 (mean, 4.6) cm. And the polypoid type was most common (n=7); this was subdivided into sessile (Is, n=5), semipedunculated (Isp, n=1) and pedunculated type (Ip, n=1). Another mass was a sessile polypoid combined with a flat depressed lesion. In eight cases, four cancers were confined to the mucosa, while the remaining four had infiltrated the submucosa. Most cancers arose from villous and villotubular adenoma. All cases were well-differentiated adenocarcinoma and no metastasis to lymph nodes had occurred. In early colon cancer, lesions were mainly polypoid and large. Most arose from villous and villotubular adenoma. (author). 19 refs., 1 tab., 3 figs

  18. Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium

    International Nuclear Information System (INIS)

    Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation

  19. Barium and Tc-poor S stars: Binary masqueraders among carbon stars

    OpenAIRE

    Jorissen, A; Van Eck, S.

    1997-01-01

    The current understanding of the origin of barium and S stars is reviewed, based on new orbital elements and binary frequencies. The following questions are addressed: (i) Is binarity a necessary condition to produce a barium star? (ii) What is the mass transfer mode (wind accretion or RLOF?) responsible for their formation? (iii) Do barium stars form as dwarfs or as giants? (iv) Do barium stars evolve into Tc-poor S stars? (v) What is the relative frequency of Tc-rich and Tc-poor S stars?

  20. Mechanism of action of barium ion on rat aortic smooth muscle.

    Science.gov (United States)

    Hansen, T R; Dineen, D X; Petrak, R

    1984-03-01

    The mechanism of action of barium ion on the aortic smooth muscle of the normal rat was investigated using in vitro calcium-depleted aortic strips. Aortic strips were depleted of calcium by repeated exposure to norepinephrine in a calcium-free bathing solution. Although calcium depletion abrogated the response of strips to catecholamines and depolarizing agents, the response to barium chloride remained quantitatively intact. The calcium influx blocker D 600 prevented the contractile response to barium but not to catecholamines, whereas phentolamine prevented the response to catecholamines but not barium. The strip response to barium was depressed by a twofold increase in extracellular magnesium concentration whether the strip was intact or calcium depleted. Although increased concentrations of calcium in the extracellular medium inhibited the contractile response to potassium ion, increases in barium merely potentiated the potassium contracture. These findings indicate that barium produces its contractile effect on vascular smooth muscle by a direct intracellular interaction with the contractile or regulatory proteins. Barium enters these cells via calcium influx channels and is probably not sequestered in a physiologically releasable pool. Unlike calcium, barium does not stabilize the smooth muscle sarcolemma when present in high concentration. PMID:6703038

  1. Barium can replace calcium in calmodulin-dependent contractions of skinned renal arteries of the rabbit.

    Science.gov (United States)

    Kreye, V A; Hofmann, F; Mühleisen, M

    1986-03-01

    Renal arteries of the rabbit were chemically skinned using Triton X-100. In EGTA-buffered solutions containing calmodulin and ATP, small strips of the skinned preparations were found to develop contractile force which was dependent on the concentrations of either free calcium or of free barium. However, a 220 times greater concentration of barium than of calcium was necessary for comparable effects. Quantitatively, the response to barium was dependent on the concentration of calmodulin added to the test solutions. The contractile effect of barium was partly antagonized by the calmodulin antagonist, trifluoperazine. PMID:3960707

  2. High Resolution Computed Tomography Appearences of late sequelae of Barium Aspiration in an asymptomatic young child

    International Nuclear Information System (INIS)

    Barium aspiration is a well-known complication of upper gastro-intestinal studies. Consequences of aspiration are generally insignificant and leave no permanent changes in the lung parenchyma. However, large quantities of high density barium, if aspirated, lead to silent interstitial changes and fibrosis. High-resolution computed tomography HRCT appearances of lung changes have been demonstrated in adults; few such reports are available in the pediatric literature. We report a case of a child who aspirated barium 3 months before this presentation. The HRCT appearances of barium aspiration are presented with a review of the literature. (author)

  3. Solubility and stability of barium arsenate and barium hydrogen arsenate at 25oC

    International Nuclear Information System (INIS)

    The inconsistency among current thermodynamic data of Ba3(AsO4)2(c) and BaHAsO4.H2O(c) led the authors to obtain independent solubility data of barium arsenate by both precipitation and dissolution experiments. Low and neutral pH (3.63-7.43) favored the formation of BaHAsO4.H2O(c). Both BaHAsO4.H2O(c) and Ba3(AsO4)2(c) formed at the neutral pH conditions (7.47, 7.66), whereas Ba3(AsO4)2(c) was the only solid phase precipitated at high pH (13.03, 13.10). The Ba3(AsO4)2(c) precipitate acquired at 50oC appeared as small leafy crystal, while the Ba3(AsO4)2(c) solid precipitated at 25oC comprised granular aggregate with some smaller crystal clusters. XRD and SEM analyses of Ba3(AsO4)2(c) and BaHAsO4.H2O(c) indicated that the solids were indistinguishable before and after the dissolution experiments. In the present work, the solubility products (Ksp) for Ba3(AsO4)2(c) and BaHAsO4.H2O(c) were determined to be 10-23.53(10-23.01 to 10-24.00) and 10-5.60(10-5.23 to 10-5.89), respectively. ΔGfo for Ba3(AsO4)2(c) and BaHAsO4.H2O(c) were calculated to be -3113.40 and -1544.47kJ/mol, respectively. There was no difference between the solubility products of the leafy and the granular Ba3(AsO4)2(c) solids

  4. Obesidad, inflamación e insulino-resistencia: papel de los ligandos del receptor gp 130 Obesity, inflammation and insulin resistance: role of gp 130 receptor ligands

    Directory of Open Access Journals (Sweden)

    B. Marcos-Gómez

    2008-08-01

    like C-reactive protein. In this context, some cytokines of the interleukin-6 (IL-6 family have been involved in the inflammatory processes associated to obesity. In addition to IL-6, the IL-6 cytokine family includes IL-11, ciliary neurotrophic factor (cntf, cardiotrophin-1 (CT-1, cardiotrophin-like cytokine (CLC, leukemia inhibitory factor (LIF y Oncostatin M (OsM. These proteins are also known as gp130 cytokines because all of them exert their action via the glycoprotein 130 (gp130 as a common transducer protein within their functional receptor complexes. However, their role in obesity and related disorders is controversial; thus, whereas some studies have described the involvement of gp130 cytokines in the development of obesity and its related cluster of pathophysiologic conditions like insulin-resistance, fatty liver and cardiovascular diseases, other trials have proposed the gp130 receptor ligands as therapeutic targets in the treatment of obesity and its related disorders. In fact, CNTF treatment has demonstrated to be effective in the reduction of body weight, by promoting the inhibition of food intake and the activation of the energy expenditure, together with an improvement of insulin sensitivity. This review analyzes the potential therapeutic role of some of the gp130 ligands in obesity and related diseases.

  5. Tungsten and barium transport in the internal plasma of hollow cathodes

    Science.gov (United States)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.

    2009-06-01

    The effect of tungsten erosion, transport, and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from 8200 h and 30 352 h ion engine wear tests. Erosion and subsequent redeposition of tungsten in the electron emission zone at the downstream end of the insert reduce the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  6. Functional studies of miR-130a on the inhibitory pathways of apoptosis in patients with chronic myeloid leukemia.

    Science.gov (United States)

    Zhu, X; Zhao, H; Lin, Z; Zhang, G

    2015-12-01

    The p53 mutation in chronic myeloid leukemia (CML) led to decreased overall survival and therapy resistance which was also closely correlated with the downstream proto-oncogenes BCL-2, TCL-1 and MCL-1. We in this study aimed to investigate the function of miR130a in p53 tumor suppressor signaling pathway. We performed microRNA (miRNA) expression profile analysis in CML cancer stem cells of 38 cases and extracted total RNA from peripheral blood of 143 cases. Standard curves of U6 and miRNA were made from 10-fold serial dilutions of the cDNA, which were quantified using real-time quantitative PCR with SYBR Green by ABI 7300. The p53 mutations and BCR/ABL mutation status analysis in CML patients were detected by PCR and direct sequencing. Candidate targets of miR130a of putative relevance in CML pathogenesis were analyzed by bioinformatics approach. We then used dual-luciferase activity assay to verify the target genes of miR130a and used western blot analysis to elucidate the mechanism of miR130a on modulating drug resistance. The levels of miR-130a expression in CML were significantly lower in poor prognostic subgroups, defined by prognostic factors including mutated BCR/ABL status, p53 and ATM deletions and p53 mutations. Furthermore, underexpression of miR-130a was significantly associated with shorter overall survival and treatment-free survival in CML patients. We demonstrated that miR130a function as tumor suppressors by inhibiting multiple anti-apoptosis proteins, including BCL-2, MCL-1 and XIAP. This was a direct effect because miR130a negatively regulated expression of a BCL-2/MCL-1/XIAP 3'untranslated region-based reporter construct. Transfection of miR130a mimics into CML cells from 30 patients without p53 aberrations led to significant increases in apoptosis compared with transfection with the miRNA control. Besides, enforced expression of miR130a had no significant drug-sensitization effect in CML cells from p53-attenuated patients. MiR-130a may have an

  7. Anion and cation diffusion in barium titanate and strontium titanate

    International Nuclear Information System (INIS)

    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO3 single crystals has been studied by means of 18O2/16O2 isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial pressure and temperature. The data

  8. Microstructure of polymer composite with barium ferrite powder

    Directory of Open Access Journals (Sweden)

    R. Nowosielski

    2008-12-01

    Full Text Available Purpose: The aim of the paper is the microstructure characterization of commercial BaFe12O19 powder and its composite material in polymer matrix; XRD (X-Ray Diffraction and SEM (Scanning Electron Microscopy methods were applied.Design/methodology/approach: The Rietveld method appeared to be very useful in the verification of the qualitative phase composition and in the determination of phase abundance. Hill and Howard procedure was applied for quantitative phase analysis. The parameters of the individual diffraction line profiles were determined by PRO-FIT Toraya procedure. The morphology of barium ferrite powders and a fracture surface of the examined composite material was analyzed using the scanning electron microscope.Findings: The X-ray diffraction analysis enabled the identification of BaFe12O19 and Fe2O3 phases in examined material. Basing on Rietveld and Toraya methods the determination of lattice parameters, crystallite size and the lattice distortion was performed. Distribution of powders of barium ferrite in polymer matrix is irregular and powder particles are of irregular shapes and different sizes.Research limitations/implications: Maked researches are limited only to characterization the microstructure of commercial material, because obtained results will be helpful to prepare barium ferrite powders by mechanical alloying and subsequent annealing in the future. As prepared BaFe12O19 powders will be used as the starting material for magnets bonded with polymer material.Originality/value: The obtained results of investigations by different methods of structure analysis confirm their useful in the microstructure analysis of powder materials.

  9. Influence of magnetic field on laser-produced barium plasmas: Spectral and dynamic behaviour of neutral and ionic species

    International Nuclear Information System (INIS)

    The expansion dynamics and spectral behaviour of plasma produced by a Nd:YAG laser (λ = 1.064 μm, pulse width: 8 ns) from barium target and expanding in 0.45 T transverse magnetic field in vacuum (10−5 Torr pressure) are investigated using time-of-flight optical emission spectroscopy. The experiments are carried out at various laser fluences from 12 to 31 J/cm2. The temporal profiles of neutral (Ba I 553.5 and 577.7 nm) lines are temporally broadened, while that of ionic (Ba II 413.0 and 455.4 nm) lines show strong confinement in the presence of a magnetic field. In the absence of magnetic field, the temporal profile of Ba I 553.5 nm is exactly reproduced by fitting with two Shifted Maxwell Boltzmann (SMB) Distribution components, while in the presence of a magnetic field the profile could only be fitted with three components. The field enhanced and field induced SMB components of neutral profile are correlated with populations of ground state, metastable states, and long-lived Rydberg states present in the barium plasma, while SMB components of ionic lines are explained on the basis of the presence of super-elastic collisions among the excited species in the plasma. The spatial variation of electron temperature and temporal variation of electron density are deduced and correlated to the different collisional processes in the barium plasma. The ionic profiles show efficient confinement in the presence of a magnetic field at higher fluences.

  10. 75 FR 36629 - Barium Chloride From the People's Republic of China: Continuation of Antidumping Duty Order

    Science.gov (United States)

    2010-06-28

    ... Barium Chloride From China, 75 FR 33824 (June 15, 2010), and Barium Chloride from China (Inv. No. 731-TA... Five-year (``Sunset'') Review, 74 FR 31412 (July 1, 2009). As a result of its review, the Department... China: Final Results of Expedited Third Sunset Review of Antidumping Duty Order, 74 FR 55814 (October...

  11. New efficient catalyst for ammonia synthesis: barium-promoted cobalt on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus; Jacobsen, Claus J.H.; Teunissen, Herman T; Ståhl, Kenny; Chorkendorff, Ib

    2002-01-01

    Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia......Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia...

  12. LACK OF EFFECT OF DRINKING WATER BARIUM ON CARDIOVASCULAR RISK FACTORS

    Science.gov (United States)

    Higher cardiovascular mortality has been associated in a single epidemiological study with higher levels of barium in drinking water. he purpose of this study was to determine whether drinking water barium at levels found in some U.S. communities alters the known risk factors for...

  13. Acute respiratory failure caused by aspiration of high density barium: A case report

    International Nuclear Information System (INIS)

    Accidental aspiration of barium contrast medium during the upper gastrointestinal study can occur in patients with swallowing disorder, especially in the elderly patients. We experienced a case of respiratory failure followed by death within a few hours in 85 year-old patient after barium aspiration

  14. Medical radiation shielding effect by composition of barium compounds

    International Nuclear Information System (INIS)

    Highlight: ► Radiation shielding sheet was manufactured using BaSO4 and a combination of tourmaline, tungsten, silicon and rubber polymer. ► The particle packing of barium tends to be related to the tensile strength. ► The tensile strength was most excellent in the sheets containing rubber. ► The shielding ability of the tungsten and silicon combination with BaSO4 was the same as that of a 0.3 mm lead equivalent. - Abstract: Shielding aprons were manufactured from barium sulfate as a potential substitute for the lead aprons used most commonly for medical radiation shielding. Six types of radiation shielding sheets made from a combination of tungsten, molybdenum, rubber and silicon with a barium sulfate base were manufactured, and their transmission doses were compared with those of a lead standard. In the process of producing the radiation shielding sheets, the particle packing and porosity of the materials, appropriate weight-average molecular weight to number-average molecular weight ratio and tensile strength were investigated to determine the optimal mixing process. The transmission dose was measured by applying a lead equivalent test method () of X-ray protective supplies in the Korea Industrial Standard. The transmission doses of the lead standard with a thickness of 0.05, 0.1, 0.15, 0.2, 0.25, 0.3 and 0.35 mm, as well as the six types of radiation shielding sheet were obtained at a tube voltage of 50, 80, 100, 120 and 150 kVp. According to the results, the combination of barium, tungsten, molybdenum and silicon recorded a dose of a 0.3 mm lead equivalent and its particle packing and porosity were 28–36% and 12–22%, respectively. Nevertheless, satisfactory shielding ability could be obtained with a porosity >20% and particle packing of 30%. Therefore, it is a potential replacement for lead sheet and can be considered a proper medical radiation shielding sheet with good economic feasibility.

  15. Enhanced flexoelectricity through residual ferroelectricity in barium strontium titanate

    International Nuclear Information System (INIS)

    Residual ferroelectricity is observed in barium strontium titanate ceramics over 30 °C above the global phase transition temperature, in the same temperature range in which anomalously large flexoelectric coefficients are reported. The application of a strain gradient leads to strain gradient-induced poling or flexoelectric poling. This was observed by the development of a remanent polarization in flexoelectric measurements, an induced d33 piezoelectric response even after the strain gradient was removed, and the production of an internal bias of 9 kV m−1. It is concluded that residual ferroelectric response considerably enhances the observed flexoelectric response

  16. Strain engineered barium strontium titanate for tunable thin film resonators

    Energy Technology Data Exchange (ETDEWEB)

    Khassaf, H.; Khakpash, N. [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Sun, F. [Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States); Sbrockey, N. M.; Tompa, G. S. [Structured Materials Industries, Inc., Piscataway, New Jersey 08854 (United States); Kalkur, T. S. [Department of Electrical and Computer Engineering, University of Colorado at Colorado Springs, Colorado Springs, Colorado 80918 (United States); Alpay, S. P., E-mail: p.alpay@ims.uconn.edu [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States)

    2014-05-19

    Piezoelectric properties of epitaxial (001) barium strontium titanate (BST) films are computed as functions of composition, misfit strain, and temperature using a non-linear thermodynamic model. Results show that through adjusting in-plane strains, a highly adaptive rhombohedral ferroelectric phase can be stabilized at room temperature with outstanding piezoelectric response exceeding those of lead based piezoceramics. Furthermore, by adjusting the composition and the in-plane misfit, an electrically tunable piezoelectric response can be obtained in the paraelectric state. These findings indicate that strain engineered BST films can be utilized in the development of electrically tunable and switchable surface and bulk acoustic wave resonators.

  17. Heterometallic β-diketonates containing barium and rare earth elements

    International Nuclear Information System (INIS)

    Potentiality of formation of heterobimetallic complexes of the composition Ba[LnLn] (Ln = La, Er; L - hexafluoroacetylacetonate, pivaloyltrifluoroacetonate-(Pta), dipivaloylmethanate-anion, is studied by mass spectrometry (MALDI-MS) method. The compounds prepared are characterized by the methods of element analysis. IR spectroscopy of gaseous phase, thermal analysis in vacuum. Compound Ba[La(Pta)5] features increased thermal stability compared with Ba(Pta)2 and La(Pta)3 and it can be offered for practical use as barium and lanthanum source in preparation of oxide films

  18. Barium strontium titanate powders prepared by spray pyrolysis

    International Nuclear Information System (INIS)

    Ultasonic spray pyrolysis (SP) has been investigated for the production of the barium strontium titanate (BST) powders from the polymeric precursors. The processing parameters, such as flux of aerosol and temperature profile inside the furnace, were optimized to obtain single phase BST. The powders were characterized by the methods of X-ray diffraction analysis, SEM, EDS and TEM. The obtained powders were submicronic, consisting of spherical, polycrystalline particles, with internal nanocrystalline structure. Crystallite size of 10 nm, calculated using Rietveld refinement, is in a good agreement with results of HRTEM

  19. Mechanism of thermoluminescence in europium-doped barium fluorochloride

    International Nuclear Information System (INIS)

    The paper concerns the optical properties of europium-doped barium fluorochloride. Thermoluminescence (TL) and emission studies have been carried out with this material and the results are reported. The irradiation was by γ-rays from a 60Co source, the dose rate being 5000rad min-1. Glow curves of γ-irradiated BaFCl:Eu2+ are presented, along with the glow curves resolved into component peaks. TL emission spectra of BaFCl:Eu2+ at room temperature, 345K, 395K and 500K are also described. (U.K.)

  20. The Kerr nonlinearity of the beta-barium borate crystal

    OpenAIRE

    Bache, Morten; Guo, Hairun; Zhou, Binbin; Zeng, Xianglong

    2013-01-01

    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e...

  1. K-shell fluorescence yields of barium and lanthanum

    International Nuclear Information System (INIS)

    K-shell fluorescence yields for barium and lanthanum have been measured adopting simple 2π geometrical configuration and employing a weak 57Co radioactive source. A scintillation spectrometer with an NaI(Tl) detector of dimensions 44.5 mm diameterx50 mm thickness was employed for the detection and measurement of radiation. The results obtained are in good agreement with the best-fitted values of and also with the other experimental values, indicating that our simple method can be extended to determine fluorescence parameters of high Z materials.

  2. Colloidal stability of aqueous suspensions of barium zirconate

    OpenAIRE

    Boschini, Frédéric; Rulmont, André; Cloots, Rudi; Moreno, R.

    2005-01-01

    In this article, the colloidal behaviour of aqueous suspensions of barium zirconate is investigated. The variation of zeta-potential as a consequence of changing the pH and the concentration of an anionic polyelectrolyte is studied, the isoelectric point occurring at pH 5.3. The IEP shifts down on calcining the powder and also when anionic polyelectrolytes are added. Rheological studies have been made on suspensions prepared to a solids loading of 27 vol.% (72 wt.%). Optimum dispersing condit...

  3. Experiences with Cascara-Salax preparating children for barium enema

    International Nuclear Information System (INIS)

    30 children prepared for barium enema using Cascara-Salax are reported on. The results are: 1. A satisfactory preparation is possible in out-patient children older than ten years. 2. For children aged 6 to 10 years only the half dose early in the afternoon before the X-ray examination is necessary. 3. In most cases the colon is completely clear, if not, the X-ray study is generally not influenced by rests of stool. 4. It should be considered that other - and often unreliable - cleaning manoevers aren't necessary, the Cascara-Salax - method ist time - saving and side-effects are not of value. (orig.)

  4. Bis(chlorido)(dimethyl­sulfoxide-κO)barium(II)

    OpenAIRE

    Gschwind, Fabienne; Jansen, Martin

    2012-01-01

    The title compound, [BaCl2(C2H6SO)], forms a Ba6Cl9 cluster in which the BaCl2 units are connected via dimethyl­sulfoxide (DMSO) and chloride bridges. The central Cl atom of the Ba6Cl9 cluster is located on a threefold inversion axis and is coordinated octa­hedrally to six barium cations. In the crystal, the clusters are arranged in rows, which are inter­connected by the DMSO mol­ecules, forming a three-dimensional network.

  5. Magnetic and structural investigations on barium hexaferrite ferrofluids

    Science.gov (United States)

    Müller, R.; Hiergeist, R.; Gawalek, W.; Hoell, A.; Wiedenmann, A.

    2002-11-01

    Barium hexaferrite BaFe 12-2 xTi xCo xO 19 ferrofluids have been prepared using oleic acid as surfactant and Isopar M ® or dodecane as carrier liquid. The ferrite particles were prepared by glass crystallization. Hysteresis parameters, the initial susceptibility versus temperature and the magnetic particle size were obtained by VSM. Ferrofluids with a partly deuterated carrier liquid were investigated by small angle neutron scattering (SANS). SANS curves lead to a bimodal size distribution consisting of single magnetic particles with an organic shell and aggregated particles with an incomplete organic layer.

  6. Radium and barium in the Amazon River system

    International Nuclear Information System (INIS)

    Data for 226Ra and 228Ra in the Amazon River system show that the activity of each radium isotope is strongly correlated with barium concentrations. Two trends are apparent, one for rivers which drain shield areas and another for all other rivers. These data suggest that there has been extensive fractionation of U, Th, and Ba during weathering in the Amazon basin. The 226Ra data fit a flux model for the major ions indicating that 226Ra behaves conservatively along the main channel of the Amazon River

  7. Evidence for a Possible E(5) Symmetry in 130Xe

    Institute of Scientific and Technical Information of China (English)

    张大立; 刘玉鑫

    2003-01-01

    By analysing the energy spectrum and E2 transition branching ratios, we show that the E(5) symmetry predictions agree well with the experimental data of nucleus 130Xe. Compared the calculated results with those within the framework of the interacting boson model, it is found that the nucleus 130Xe is definitely a nucleus in the transitional region from U(5) to O(6) symmetry. 130Xe is then another empirical evidence of the nucleus with E(5) symmetry.

  8. A comparison study between diagnostic value of sonography and Barium swallow in gasteroesophageal reflux in pediatrics

    Directory of Open Access Journals (Sweden)

    Fallahi G

    2001-10-01

    Full Text Available One of the common problems in children and specially in infants is gasteroesophageal reflux (G.E.R. Present study was performed to compare diagnostic value of lower esophageal sonography with barium swallow. This study was conducted on 50 patients 1 month to 15 years age in center of pediatric clinic of Tehran, during the years 1999-2000. Patients suspected to have G.E.R studied with lower esophageal sonography and barium swallow and at the end, their results were compared with esophageal PH monitoring as a standard test. In this study sensevity of sonography was 90 percent against 50 percent for barium swallow but specifity of two test was the same 35 percent. We can concluded that sonography is a non invasive, low cost, with less side effects than barium swallow. We recommend sonography in place of barium swallow in diagnosis of G.E.R.

  9. A Comparison between the Diagnostic Value of Sonography vs. Barium Swallow In Gastroesdophageal Reflux in Children

    Directory of Open Access Journals (Sweden)

    F. Zandie

    2003-06-01

    Full Text Available Background: One of the common problems in children, especially infants, is gastroesophageal reflux (GER. Objectives:This study was performed to compare the diagnostic value of lower esophageal sonography with that of barium swallow. Patients and method: Our trial was a triple-blind, performed on 50 patients of 1 month to 15 years of age. The patients suspicious of having GER were evaluated by sonography and barium swallow. Esophageal pH monitoring was the standard test, and both the ultrasound and barium swallow were compared to it. Results: The results showed that sonography was 90% sensitive, vs. 50% for barium swallow. Both tests had the same specificity equal to 35%. Conclusion: We concluded that sonography was a better test than barium swallows, for evaluation of suspected patients with GER, and screening of the infants.

  10. Barium sulfate suspension as a negative oral contrast agent for MR imaging

    International Nuclear Information System (INIS)

    Proton spectroscopy with linewidth measurements and MR imaging were performed on various commercially available barium sulfate suspensions as well as inorganic sulfates and barium salts. Approximately 500 mL of 20%, 40%, 60%, and 70% wt/wt single-contrast oral barium sulfate suspensions were administered to four normal volunteers, and MR imaging was performed with both a 1.5-T and a 0.15-T MR imager. As much as 80% of the small bowel and the entire colon were well visualized with the 60% or 70% wt/wt single-contrast barium sulfate suspensions. The authors conclude that barium sulfate suspensions are useful as oral MR contrast agents

  11. Anion and cation diffusion in barium titanate and strontium titanate; Anionen- und Kationendiffusion in Barium- und Strontiumtitanat

    Energy Technology Data Exchange (ETDEWEB)

    Kessel, Markus Franz

    2012-12-19

    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO{sub 3} single crystals has been studied by means of {sup 18}O{sub 2}/{sup 16}O{sub 2} isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial

  12. Tungsten and Barium Transport in the Internal Plasma of Hollow Cathodes

    Science.gov (United States)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.

    2008-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushedback to the emitter surface by the electric field and drag from the xenon ion flow. Thisbarium ion flux is sufficient to maintain a barium surface coverage at the downstream endgreater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length,so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollowcathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  13. MicroRNA-130b improves renal tubulointerstitial fibrosis via repression of Snail-induced epithelial-mesenchymal transition in diabetic nephropathy

    Science.gov (United States)

    Bai, Xiaoyan; Geng, Jian; Zhou, Zhanmei; Tian, Jianwei; Li, Xiao

    2016-01-01

    MicroRNA-130b (miR-130b) downregulation has been identified in diabetes, but the role and mechanisms for miR-130b in mediating renal tubulointerstitial fibrosis in diabetic nephropathy (DN) remain unknown. We demonstrated that plasma miR-130b downregulation exhibited clinical and biological relevance as it was linked to increased serum creatinine, β2-microglobulin and proteinuria, increased Snail expression and tubulointerstitial fibrosis in renal biopsies of DN patients. MiR-130b inhibitor caused Snail upregulation and enhanced molecular features of epithelial-to-mesenchymal transition (EMT) in high glucose (30 mM) cultured NRK-52E cells. In contrast, miR-130b mimic downregulated Snail expression and increased epithelial hallmarks. Notably, Snail was identified as an miR-130b direct target and inversely correlated with E-CADHERIN expression. Furthermore, the miR-130b-dependent effects were due to Snail suppression that in turn deregulated E-CADHERIN, VIMENTIN, COLLAGEN IV and α-smooth muscle actin (α-SMA), key mediators of EMT. These effects were reproduced in streptozotocin-induced diabetic rats. Thus, we propose a novel role of the miR-130b-SNAIL axis in fostering EMT and progression toward increased tubulointerstitial fibrosis in DN. Detection of plasma miR-130b and its association with SNAIL can be extrapolated to quantifying the severity of renal tubulointerstitial fibrosis. Targeting miR-130b could be evaluated as a potential therapeutic approach for DN. PMID:26837280

  14. Ruthenium and hafnium abundances in giant and dwarf barium stars

    CERN Document Server

    Allen, D M

    2007-01-01

    We present abundances for Ru and Hf, compare them to abundances of other heavy elements, and discuss the problems found in determining Ru and Hf abundances with laboratory gf-values in the spectra of barium stars. We determined Ru and Hf abundances in a sample of giant and dwarf barium stars, by the spectral synthesis of two RuI (4080.574A and 4757.856A) and two HfII (4080.437A and 4093.155A) transitions. The stellar spectra were observed with FEROS/ESO, and the stellar atmospheric parameters lie in the range 4300 < Teff/K < 6500, -1.2 < [Fe/H] <= 0 and 1.4 <= log g < 4.6. The HfII 4080A and the RuI 4758A observed transitions result in a unreasonably high solar abundance, given certain known uncertainties, when fitted with laboratory gf-values. For these two transitions we determined empirical gf-values by fitting the observed line profiles of the spectra of the Sun and Arcturus. For the sample stars, this procedure resulted in a good agreement of Ru and Hf abundances given by the two availa...

  15. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.

    2009-01-01

    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  16. Materials Synthesis Of Barium Hexa ferrite Used Local Natural Resources

    International Nuclear Information System (INIS)

    The magnetic materials of barium hexa ferrites, Ba O.6Fe2O3 successfully synthesized by powder metallurgy method used local natural resources from materials waste of steel fabrication (HSM, CRM), waste of polymer fabrication (LK) as well as iron sands (PBA). These waste as well as iron sands were the main resources of iron oxide, Fe2O3. The barium oxide used in this experiments are from BaCO3 product of Merck, and BaCO4 which is commercially available in the market as barite. Phase identification by x-ray diffraction technique show the synthesized magnetic materials are agreed with the available commercial product, (SUMI). The energy product maximum (BH)max measured by vibrating sample magnetometer (VSM) for the samples used HSM-, CRM- and BaCO3 as basic materials are 1.141 MGOe and 1.136 MGOe while SUMI is 1.142 MGOe. However for the samples made from LK-, PBA- used of BaCO3 or CRM- with barite, the energy product maximum (BH)max are relatively lower than commercial product

  17. Brillouin function characteristics for La-Co substituted barium hexaferrites

    International Nuclear Information System (INIS)

    La-Co substituted barium hexaferrites with the chemical formula of Ba1−xLaxFe12−xCoxO19 (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f1, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ωbf2, ωkf1, ωaf1, ωkf2, and ωbk of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f1, 4f2, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ωbf2 and ωaf1 decrease constantly, while the molecular-field coefficients ωkf1, ωkf2, and ωbk show a slight change

  18. Thermal expansion behaviour of barium and strontium zirconium phosphates

    Indian Academy of Sciences (India)

    P Srikari Tantri; K Geetha; A M Umarji; Sheela K Ramasesha

    2000-12-01

    Ba1.5–SrZr4P5SiO24 compounds with = 0, 0.25, 0.5, 0.75, 1.0, 1.25 and 1.5, belonging to the low thermal expansion NZP family were synthesized by the solid state reaction method. The XRD pattern could be completely indexed with respect to R$\\bar{3}$ space group indicating the ordering of vacancy at the divalent cation octahedral sites. The microstructure and bulk thermal expansion coefficient from room temperature to 800°C of the sintered samples have been studied. All the samples show very low coefficient of thermal expansion (CTE), with = 0 samples showing negative expansion. A small substitution of strontium in the pure barium compound changes the sign of CTE. Similarly, = 1.5 sample (pure strontium) shows a positive CTE and a small substitution of barium changes its sign. = 1.0 and 1.25 samples have almost constant CTE over the entire temperature range. The low thermal expansion of these samples can be attributed to the ordering of the ions in the crystal structure of these materials.

  19. Microstructure of composite material with powders of barium ferrite

    Directory of Open Access Journals (Sweden)

    R. Nowosielski

    2006-04-01

    Full Text Available Purpose: The aim of the present work is the microstructure characterization of commercial powder BaFe12O19 (as-prepared and composite material with BaFe12O19 powders and polymer matrix, using XRD (X-Ray Diffraction and SEM (Scanning Electron Microscopy methods.Design/methodology/approach: The morphology of barium ferrite powders and a fracture surface of the examined composite material was realized by using the scanning electron microscope. The methods of X-ray diffraction were used for the qualitative phase analysis. The parameters of diffraction line profiles were determined by PRO-FIT Toraya procedure.Findings: The X-ray diffraction analysis permitted on identification the BaFe12O19 and Fe2O3 phases in an examined material. Basing on Toraya method is determination of: lattice parameters, crystallite size (D and the lattice distortion (. Distribution of powders of barium ferrite in polymer matrix is irregular and powder particles have irregular shapes and dimensions.Research limitations/implications: For future research the X-ray analysis should be performed by the Rietveld method, which allows to characterization the microstructure of tested material and verification of its qualitative phase composition.Originality/value: The applied Toraya method of structure analysis appeared to be very useful in the microstructure analysis.

  20. Redox processes in highly yttrium-doped barium titanate

    International Nuclear Information System (INIS)

    The changes of microstructure occurring during oxidation of the reduced form of yttrium-doped barium titanate (Ba1-xYx?Ti1-x4+Tix3+O3) have been studied. Samples were sintered under reduction conditions at PO2=10-4Pa and oxidized by annealing at high temperatures (1150 and 1350 deg. C) in air. Depending on yttrium concentration, the oxidation of the reduced form of the yttrium-doped BaTiO3 caused precipitation of the phase Ba6Ti17O40 or the phases Ba6Ti17O40 and Y2Ti2O7. The precipitates had well-defined orientational relationships with the perovskite matrix. Oxidation of the reduced form of doped barium titanate results in formation of the phase Ba1-xYx?Ti1-x/44+(VTi-bar )x/4O3 responsible for increase in the resistance of outer grain layers, which lie between grain boundaries and grain

  1. The Kerr nonlinearity of the beta-barium borate crystal

    DEFF Research Database (Denmark)

    Bache, Morten; Guo, Hairun; Zhou, Binbin;

    2013-01-01

    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond experime......A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond...... experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e. generate a self-defocusing Kerr-like nonlinearity. However, the material Kerr nonlinearity nI 2......, Kerr is self-focusing and competes with the cascading nonlinearity. Therefore, precise knowledge of its strength is crucial. We perform an experiment measuring the main c ü tensor component, and together with literature experimental data [1], we propose a cu value composed of 14 different data points...

  2. Real-time tracking and targeting computations and rocket-vehicle aeroballistics for the PLACES ionospheric-plasma test series

    International Nuclear Information System (INIS)

    The PLACES (Position Location and Communication Effects Simulations) test program, conducted in December 1980 at Eglin Gulf Test Range, involved a series of ionospheric releases of barium/barium-nitrate vapor. The Defense Nuclear Agency sponsored program investigated effects of a structured ionospheric plasma (similar to that produced by a high-altitude nuclear explosion) on satellite navigation systems and provided in situ measurement of plasma structure. Terrier-Tomahawk rocket systems boosted the barium payloads, beacon payloads (plasma occultation experiment), and probe payloads (plasma in situ measurement). Drifting plasma tracking procedures, beacon-and probe-vehicle targeting procedures, and vehicle flight test results are presented

  3. 40 CFR 792.130 - Conduct of a study.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 31 2010-07-01 2010-07-01 true Conduct of a study. 792.130 Section 792... (CONTINUED) GOOD LABORATORY PRACTICE STANDARDS Protocol for and Conduct of A Study § 792.130 Conduct of a study. (a) The study shall be conducted in accordance with the protocol. (b) The test systems shall...

  4. 40 CFR 160.130 - Conduct of a study.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Conduct of a study. 160.130 Section... LABORATORY PRACTICE STANDARDS Protocol for and Conduct of a Study § 160.130 Conduct of a study. (a) The study... conformity with the protocol. (c) Specimens shall be identified by test system, study, nature, and date...

  5. 45 CFR 205.130 - State financial participation.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false State financial participation. 205.130 Section 205... ADMINISTRATION-PUBLIC ASSISTANCE PROGRAMS § 205.130 State financial participation. State plan requirements: (a) A State plan for financial assistance under title I, IV-A, X, XIV, or XVI (AABD) of the Social...

  6. 40 CFR 130.6 - Water quality management plans.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Water quality management plans. 130.6... QUALITY PLANNING AND MANAGEMENT § 130.6 Water quality management plans. (a) Water quality management (WQM... purposes of this rule and the Clean Water Act assistance programs under 40 CFR part 35, subparts A and H...

  7. 49 CFR 28.130 - General prohibition against discrimination.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false General prohibition against discrimination. 28.130....130 General prohibition against discrimination. (a) No qualified individual with handicaps shall, on... subjected to discrimination under any program or activity conducted by the Department. (b)(1) The...

  8. 45 CFR 618.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Effect of employment opportunities. 618.130... FINANCIAL ASSISTANCE Introduction § 618.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in...

  9. 41 CFR 101-4.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-07-01

    ... employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession are or may be more limited for... opportunities. 101-4.130 Section 101-4.130 Public Contracts and Property Management Federal Property...

  10. 45 CFR 2555.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Effect of employment opportunities. 2555.130... RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 2555.130 Effect of employment opportunities. The... opportunities in any occupation or profession are or may be more limited for members of one sex than for...

  11. 43 CFR 41.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Effect of employment opportunities. 41.130... § 41.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession are...

  12. 6 CFR 17.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Effect of employment opportunities. 17.130... Introduction § 17.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession...

  13. 32 CFR 196.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Effect of employment opportunities. 196.130... FEDERAL FINANCIAL ASSISTANCE Introduction § 196.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities...

  14. 40 CFR 130.3 - Water quality standards.

    Science.gov (United States)

    2010-07-01

    ... QUALITY PLANNING AND MANAGEMENT § 130.3 Water quality standards. A water quality standard (WQS) defines... Management (WQM) plans to reflect such revisions. Specific WQS requirements are found in 40 CFR part 131. ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Water quality standards. 130.3...

  15. 13 CFR 120.130 - Restrictions on uses of proceeds.

    Science.gov (United States)

    2010-01-01

    ... Business Investment Company (“SBIC”); (c) Floor plan financing or other revolving line credit, except under... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Restrictions on uses of proceeds. 120.130 Section 120.130 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS...

  16. 21 CFR 130.9 - Sulfites in standardized food.

    Science.gov (United States)

    2010-04-01

    ... incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part 51, and the refinements of the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sulfites in standardized food. 130.9 Section 130.9 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED)...

  17. 21 CFR 173.130 - Carbohydrase derived from Rhizopus oryzae.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Carbohydrase derived from Rhizopus oryzae. 173.130 Section 173.130 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES..., Phycomycetes; order, Mucorales; family, Mucoraceae; genus, Rhizopus; species, Rhizopus oryzae. (b) The...

  18. 13 CFR 130.800 - Oversight of the SBDC program.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Oversight of the SBDC program. 130.800 Section 130.800 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS... funds for the benefit of the small business community....

  19. 13 CFR 130.360 - SBDC advisory boards.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false SBDC advisory boards. 130.360 Section 130.360 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT... include small business owners and other representatives from the entire Area of Service. (4) New...

  20. 30 CFR 62.130 - Permissible exposure level.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Permissible exposure level. 62.130 Section 62... REGULATIONS OCCUPATIONAL NOISE EXPOSURE § 62.130 Permissible exposure level. (a) The mine operator must assure that no miner is exposed during any work shift to noise that exceeds the permissible exposure level....

  1. 12 CFR 410.130 - General prohibitions against discrimination.

    Science.gov (United States)

    2010-01-01

    .... 410.130 Section 410.130 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED... opportunity to participate in or benefit from the aid, benefit, or service; (ii) Afford a qualfied...

  2. 9 CFR 590.130 - Basis of billing plants.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Basis of billing plants. 590.130... of Service § 590.130 Basis of billing plants. Overtime and/or holiday services shall be billed to the official plant on the basis of each 15 minutes of overtime and/or holiday service performed by...

  3. 40 CFR 130.8 - Water quality report.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Water quality report. 130.8 Section... QUALITY PLANNING AND MANAGEMENT § 130.8 Water quality report. (a) Each State shall prepare and submit biennially to the Regional Administrator a water quality report in accordance with section 305(b) of the...

  4. 13 CFR 130.830 - Audits and investigations.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Audits and investigations. 130.830 Section 130.830 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL BUSINESS DEVELOPMENT... network audits. All audits will be conducted according to Government Auditing Standards, promulgated...

  5. 21 CFR 136.130 - Milk bread, rolls, and buns.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk bread, rolls, and buns. 136.130 Section 136....130 Milk bread, rolls, and buns. (a) Each of the foods milk bread, milk rolls, and milk buns conforms... ingredients prescribed for bread, rolls or buns by § 136.110 except that: (1) The only moistening...

  6. 21 CFR 211.130 - Packaging and labeling operations.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Packaging and labeling operations. 211.130 Section... (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Packaging and Labeling Control § 211.130 Packaging and labeling operations. There shall be written procedures designed...

  7. Research on fabricating technique of Ba-Al-S:Eu sputtering target

    Institute of Scientific and Technical Information of China (English)

    DING Zhao; YU Zhinong; ZHANG Dongpu; XUE Wei; WANG Wuyu

    2009-01-01

    Ba-Al-S-Eu sputtering target for blue emitting phosphors was prepared by powder sintering method. XRD patterns showed that the main components of the target were barium tetra aluminum sulfide (BaAl4S7), bariutm sulfide (BaS), and europium sulfide (EuS). In the samples, part of the barium and aluminum are formed into barium aluminum oxide (BaAl2O4) with the impurity element of oxygen. The PL characteristic spectra of the target showed the 470 nm blue emission obviously, and the Ba-Al-S thin films also transmitted a purple-blue emission at the position of 440 nm.The results indicated that this method was suitable for the fabrication of the Ba-Al-S:Eu sputtering target.

  8. Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease

    Science.gov (United States)

    Sharifi, Reza; Morra, Rosa; Denise Appel, C; Tallis, Michael; Chioza, Barry; Jankevicius, Gytis; Simpson, Michael A; Matic, Ivan; Ozkan, Ege; Golia, Barbara; Schellenberg, Matthew J; Weston, Ria; Williams, Jason G; Rossi, Marianna N; Galehdari, Hamid; Krahn, Juno; Wan, Alexander; Trembath, Richard C; Crosby, Andrew H; Ahel, Dragana; Hay, Ron; Ladurner, Andreas G; Timinszky, Gyula; Williams, R Scott; Ahel, Ivan

    2013-01-01

    Adenosine diphosphate (ADP)-ribosylation is a post-translational protein modification implicated in the regulation of a range of cellular processes. A family of proteins that catalyse ADP-ribosylation reactions are the poly(ADP-ribose) (PAR) polymerases (PARPs). PARPs covalently attach an ADP-ribose nucleotide to target proteins and some PARP family members can subsequently add additional ADP-ribose units to generate a PAR chain. The hydrolysis of PAR chains is catalysed by PAR glycohydrolase (PARG). PARG is unable to cleave the mono(ADP-ribose) unit directly linked to the protein and although the enzymatic activity that catalyses this reaction has been detected in mammalian cell extracts, the protein(s) responsible remain unknown. Here, we report the homozygous mutation of the c6orf130 gene in patients with severe neurodegeneration, and identify C6orf130 as a PARP-interacting protein that removes mono(ADP-ribosyl)ation on glutamate amino acid residues in PARP-modified proteins. X-ray structures and biochemical analysis of C6orf130 suggest a mechanism of catalytic reversal involving a transient C6orf130 lysyl-(ADP-ribose) intermediate. Furthermore, depletion of C6orf130 protein in cells leads to proliferation and DNA repair defects. Collectively, our data suggest that C6orf130 enzymatic activity has a role in the turnover and recycling of protein ADP-ribosylation, and we have implicated the importance of this protein in supporting normal cellular function in humans. PMID:23481255

  9. Preparation and properties of yttria doped tetragonal zirconia polycrystal/Sr-doped barium hexaferrite ceramic composites

    International Nuclear Information System (INIS)

    Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m1/2. - Abstract: The effects of substitution of Ba2+ by Sr2+ on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba1−xSrxFe12O19, x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m1/2 for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase

  10. Bio-based barium alginate film: Preparation, flame retardancy and thermal degradation behavior.

    Science.gov (United States)

    Liu, Yun; Zhang, Chuan-Jie; Zhao, Jin-Chao; Guo, Yi; Zhu, Ping; Wang, De-Yi

    2016-03-30

    A bio-based barium alginate film was prepared via a facile ionic exchange and casting approach. Its flammability, thermal degradation and pyrolysis behaviors, thermal degradation mechanism were studied systemically by limiting oxygen index (LOI), vertical burning (UL-94), microscale combustion calorimetry (MCC), thermogravimetric analysis (TGA) coupled with Fourier transform infrared analysis (FTIR) and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS). It showed that barium alginate film had much higher LOI value (52.0%) than that of sodium alginate film (24.5%). Moreover, barium alginate film passed the UL-94 V-0 rating, while the sodium alginate film showed no classification. Importantly, peak of heat release rate (PHRR) of barium alginate film in MCC test was much lower than that of sodium alginate film, suggested that introduction of barium ion into alginate film significantly decreased release of combustible gases. TG-FTIR and Py-GC-MS results indicated that barium alginate produced much less flammable products than that of sodium alginate in whole thermal degradation procedure. Finally, a possible degradation mechanism of barium alginate had been proposed. PMID:26794953

  11. Barium titanate core – gold shell nanoparticles for hyperthermia treatments

    Directory of Open Access Journals (Sweden)

    FarrokhTakin E

    2013-06-01

    Full Text Available Elmira FarrokhTakin,1,2 Gianni Ciofani,1 Gian Luigi Puleo,1 Giuseppe de Vito,3,4 Carlo Filippeschi,1 Barbara Mazzolai,1 Vincenzo Piazza,3 Virgilio Mattoli1 1Center for Micro-BioRobotics @SSSA, Fondazione Istituto Italiano di Tecnologia, Pontedera, Pisa, Italy; 2The Biorobotics Institute, Scuola Superiore Sant'Anna, Pontedera, Pisa, Italy; 3Center for Nanotechnology Innovation @NEST, Fondazione Istituto Italiano di Tecnologia, Pisa, Italy; 4NEST, Scuola Normale Superiore, Pisa, Italy Abstract: The development of new tools and devices to aid in treating cancer is a hot topic in biomedical research. The practice of using heat (hyperthermia to treat cancerous lesions has a long history dating back to ancient Greece. With deeper knowledge of the factors that cause cancer and the transmissive window of cells and tissues in the near-infrared region of the electromagnetic spectrum, hyperthermia applications have been able to incorporate the use of lasers. Photothermal therapy has been introduced as a selective and noninvasive treatment for cancer, in which exogenous photothermal agents are exploited to achieve the selective destruction of cancer cells. In this manuscript, we propose applications of barium titanate core–gold shell nanoparticles for hyperthermia treatment against cancer cells. We explored the effect of increasing concentrations of these nanoshells (0–100 µg/mL on human neuroblastoma SH-SY5Y cells, testing the internalization and intrinsic toxicity and validating the hyperthermic functionality of the particles through near infrared (NIR laser-induced thermoablation experiments. No significant changes were observed in cell viability up to nanoparticle concentrations of 50 µg/mL. Experiments upon stimulation with an NIR laser revealed the ability of the nanoshells to destroy human neuroblastoma cells. On the basis of these findings, barium titanate core–gold shell nanoparticles resulted in being suitable for hyperthermia treatment

  12. Wideband and enhanced microwave absorption performance of doped barium ferrite

    International Nuclear Information System (INIS)

    To achieve stronger microwave attenuation and larger bandwidth in electromagnetic absorber, the nickel ions (Ni2+) and manganese ions (Mn2+) were employed to partially replace the cobalt ions (Co2+) in BaCoTiFe10O19, and the doped barium hexaferrite (Ba(MnNi)0.2Co0.6TiFe10O19 and Ba(MnNi)0.25Co0.5TiFe10O19) powders were synthesized via the sol–gel combustion method. Subsequently, the microwave absorbing composites were prepared by mixing the ferrite powders with the paraffin. The X-ray diffraction (XRD) patterns of the doped ferrites confirmed the formation of the M-type barium ferrite, and no other types of barium ferrite could be found. Based on the electromagnetic parameters measured by the vector net-analyzer, it was found that the composite (Ba(MnNi)0.2Co0.6TiFe10O19) possessed a minimum reflection loss of −52.8 dB at 13.4 GHz with a matching thickness of 1.8 mm and the bandwidth below −15 dB was 5.8 GHz. Moreover, the maximum attenuation of Ba(MnNi)0.25Co0.5TiFe10O19 could reach −69 dB when its thickness was 1.8 mm, and also the bandwidth less than −20 dB was ranging from 13.2 GHz to 18 GHz. Thus, Ba(MnNi)0.2Co0.6TiFe10O19 and Ba(MnNi)0.25Co0.5TiFe10O19 could be the good microwave absorbers, which have great potentials to be applied in the high frequency fields of the microwave absorbing materials. - Highlights: • The Co was first time substituted by Mn–Ni in ferrites. • The substituted ferrites had good microwave absorption. • The doped ferrites had broad bandwidth and low reflection loss

  13. Wideband and enhanced microwave absorption performance of doped barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Pingyuan; Xiong, Kun [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Ju, Kui [Guizhou Institute of Metallurgy and Chemical Engineering, Guiyang 550002 (China); Li, Shengnan [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Xu, Guangliang, E-mail: xuguangliang@swust.edu.cn [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China)

    2015-07-01

    To achieve stronger microwave attenuation and larger bandwidth in electromagnetic absorber, the nickel ions (Ni{sup 2+}) and manganese ions (Mn{sup 2+}) were employed to partially replace the cobalt ions (Co{sup 2+}) in BaCoTiFe{sub 10}O{sub 19}, and the doped barium hexaferrite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19}) powders were synthesized via the sol–gel combustion method. Subsequently, the microwave absorbing composites were prepared by mixing the ferrite powders with the paraffin. The X-ray diffraction (XRD) patterns of the doped ferrites confirmed the formation of the M-type barium ferrite, and no other types of barium ferrite could be found. Based on the electromagnetic parameters measured by the vector net-analyzer, it was found that the composite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19}) possessed a minimum reflection loss of −52.8 dB at 13.4 GHz with a matching thickness of 1.8 mm and the bandwidth below −15 dB was 5.8 GHz. Moreover, the maximum attenuation of Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could reach −69 dB when its thickness was 1.8 mm, and also the bandwidth less than −20 dB was ranging from 13.2 GHz to 18 GHz. Thus, Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could be the good microwave absorbers, which have great potentials to be applied in the high frequency fields of the microwave absorbing materials. - Highlights: • The Co was first time substituted by Mn–Ni in ferrites. • The substituted ferrites had good microwave absorption. • The doped ferrites had broad bandwidth and low reflection loss.

  14. Synthesis and Characterization of Barium-Vanadium Oxide Nanocomposite Using a Facile thermolysis Approach

    OpenAIRE

    Niloufar Akbarzadeh-T; Leila Amiri-O

    2015-01-01

    In this investigation, we report synthesis of new cationic-anionic Barium-Vanadium complex with 2, 6- pyridinedicarboxylic acid ligand. This compound [Ba(H2O)8][VO2(dipic)]2(1) has been characterized using elemental analyses, FT-IR, UV–Vis and Cyclic voltammetry (CV) techniques. Also in this study we report facile synthesis of Barium-Vanadium Oxide nanoparticle under thermal decomposition, using precursor complex (1). Characterization of Barium-Vanadium Oxide nanocomposites was carried out by...

  15. Barium ferrite nanoparticles prepared by self-propagating low-temperature combustion method and its characterization

    Indian Academy of Sciences (India)

    P M Prithviraj Swamy; S Basavaraja; Vijayanand Havanoor; N V Srinivas Rao; R Nijagunappa; A Venkataraman

    2011-12-01

    The barium ferrite particles were prepared using a self-propagating low-temperature combustion method using polyethylene glycol (PEG) as a fuel. The process was investigated with simultaneous thermogravimetric-differential thermal analysis (TG–DTA). The crystalline structure, morphology and the magnetic properties of the barium ferrite particles were studied by means of X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM) and SQUID susceptometer. The results show that the ignition temperature of PEG is lower compared with other combustion methods and gives nanocrystalline barium ferrite.

  16. A Comparative Study on Magnetostructural Properties of Barium Hexaferrite Powders Prepared by Polyethylene Glycol

    Directory of Open Access Journals (Sweden)

    Zehra Durmus

    2014-01-01

    Full Text Available Nanocrystalline particles of barium hexaferrite were synthesized by a sol-gel combustion route using nitrate-citrate gels prepared from metal nitrates and citric acid solutions with Fe/Ba molar ratio 12. The present paper aims to study the effect of addition of polyethylene glycol (PEG solutions with different molecular weights (MW: 400, 2000, and 10.000 g/mol on magnetostructural properties of barium hexaferrite. The formation of the barium hexaferrite was inspected using X-ray diffraction (XRD analysis, Fourier transform infrared (FT-IR analysis, thermogravimetric (TGA analysis, scanning electron microscopy (SEM analysis and vibrating sample magnetometer (VSM analysis for magnetic measurements.

  17. Microscopic insight into nuclear structure properties of proton-rich barium isotopes

    International Nuclear Information System (INIS)

    Variation after projection (VAP) calculations with Hartree-Bogoliubov (HB) Ansatz have been carried out for A=120-136 barium isotopes. In this framework, the yrast spectra with Jmaxπ=10+, B(E2) transition probabilities, quadrupole (β2) and hexadecapole (β4) deformation parameters for even-even barium isotopes have been obtained. The results of the calculation give an indication that it is important to include the hexadecapole-hexadecapole component of the two-body interaction for obtaining various nuclear structure quantities in these barium isotopes. (author)

  18. Orbital elements of barium stars formed through a wind accretion scenario

    CERN Document Server

    Liu, J H; Liang, Y C; Peng, Q H

    2000-01-01

    Taking the total angular momentum conservation in place of the tangential momentum conservation, and considering the square and higher power terms of orbital eccentricity e, the changes of orbital elements of binaries are calculated for wind accretion scenario. These new equations are used to quantitatively explain the observed (e,logP) properties of normal G, K giants and barium stars. Our results reflect the evolution from G, K giant binaries to barium binaries, moreover, the barium stars with longer orbital periods P>1600 days may be formed by accreting part of the ejecta from the intrinsic AGB stars through wind accretion scenario.

  19. The high-temperature sulphation behavior of barium-based sorbents during coal combustion

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, J.; Li, N.; Zhou, J.; Cao, X.; Liu, J.; Zhao, X.; Cen, K.

    2000-07-01

    In order to promote the sulfur removal efficiency during coal combustion, the high-temperature sulfation behavior of barium-based sorbents was studied. The sulfation product BaSO{sub 4} which did not decompose until 1,580 C had much better thermal stability than CaSO{sub 4} which rapidly decomposed at about 1,300 C. The desulfurization effect of barium salt Ba{sup 2+} was much better than calcium salt Ca{sup 2+} during coal combustion at about 1,200{approximately}1,300 C. The sulfur removal efficiency of barium-based sorbents could achieve 35.5% in industrial grate furnace.

  20. Application of barium fluoride for sulfur selective extraction at X-ray spectroscopic analysis of steel

    International Nuclear Information System (INIS)

    In order to increase the sensitivity of X-ray spectroscopic identification of sulphur in steels the application of barium fluoride for selective extraction of sulphate ions was proposed by authors of present work. The influence of concentration of sulphate ions, iron, nickel, chromium and titanium cations as well as acidity of solutions on the coefficient of distribution of sulphate ions in the system barium fluoride-water was studied. The distribution coefficients were calculated, the completeness of extraction was calculated as well. It is defined that sulphate ions from solutions containing cations of heavy metals and other anions can be extracted by means of barium fluoride.

  1. Solvothermal synthesis and Curie temperature of monodispersed barium titanate nanoparticles

    International Nuclear Information System (INIS)

    Barium titanate (BaTiO3) nanoparticles with various particle sizes were prepared by a solvothermal method. X-ray powder diffraction (XRPD) patterns show that the as-prepared powders are of pure perovskite BaTiO3. Scanning electron microscopy (SEM) reveals that all the particles of BaTiO3 with different sizes are dispersed homogenously and have uniform size. The room temperature and in situ high temperature XRD analyses indicate that both the proportion of the tetragonal phase and the Curie temperature of BaTiO3 increase with increasing particles size. The effects of the reaction parameters, such as the concentration of reactants, the polarity of solvent, the reaction temperature and the amount of surfactant, on the size, morphology and uniformity of BaTiO3 nanoparticles are studied in detail.

  2. Infrared Spectroscopic Characterization of Calcium and Barium Hydrazone Complexes

    Directory of Open Access Journals (Sweden)

    *A. Adeniyi

    2013-06-01

    Full Text Available Hydrazones have attracted considerable interest on account of their biological activities. Introduction of calcium and barium metal ions into m- and p-nitrobenzoic hydrazones is expected to modify these biological properties for enhanced activity and versatility. The ligands were synthesized from the parent acids. The complexes have been characterized using C, H and N microanalyses and IR spectrometry. The IR spectral data of the ligands and complexes revealed bonding via the C=O and C=N groups. The suggested metal to ligand stoichiometries are: [M (m-NBHx]Cl2.yH2O, x, y = 1 and 4 for M = Ca; x, y = 2 and 3 for M = Ba respectively. [M(p-NBHx]Cl2.yH2O, x, y = 1 and 12 for M = Ca; x, y = 1 and 3 for M = Ba respectively. The structural deductions are tentative pending future X-ray structural studies.

  3. Preparation and Characterization of Nano-particle Substituted Barium Hexaferrite

    CERN Document Server

    Atassi, Yomen; Tally, Mohammad

    2014-01-01

    High density magnetic recording requires high coercivity magnetic media and small particle size. Barium hexaferrite has been considered as a leading candidate material because of its chemical stability, fairly large crystal anisotropy and suitable magnetic characteristics. In this work, we present the preparation of the hexagonal ferrite BaFe12O19 and one of its derivative; the Zn-Sn substituted hexaferrite by the chemical co-precipitation method. The main advantage of this method on the conventional glass-ceramic one, resides in providing a small enough particle size for magnetic recording. We demonstrate using the X-ray diffraction patterns that the particle size decreases when substituting the hexaferrite by the Zn-Sn combination. This may improve the magnetic properties of the hexaferrite as a medium for HD magnetic recording

  4. Synthesis and optical study of barium magnesium aluminate blue phosphors

    International Nuclear Information System (INIS)

    Europium doped barium magnesium aluminate (BaMgAl10O17:Eu2+) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl10O17(JCPDS 26-0163) along with an additional phase BaAl2O4(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f6 5d → 4f7 transition of Eu2+ which lies in the blue region of the visible spectrum

  5. Conoscopic study of strontium-barium niobate single crystals

    International Nuclear Information System (INIS)

    Optically transparent single crystals of strontium-barium niobate, SrxBa1-xNb2O6, of different compositions (x = 0.26...0.7) were examined with the aid of conoscopic light interference figures. A regular change of the isochrome concentric ring number and diameters consistent with the temperature variation of the value of birefringence is demonstrated by direct observations of polar cuts of optically uniaxial samples. Anomalous violations of the conventional (uniaxial) interference patterns occur occasionaly in some samples being indicative of the existence of biaxial trait in their behaviour even though no voltage is applied. These features may depend on annealing treatments at elevated temperatures. The results of the study show that conoscopic images may serve as a sensitive indicator of the structural state of SBN crystals related to the effects of stress–induced change of optical anisotropy and temperature dependent birefringence parameters

  6. Pulsating aurora induced by upper atmospheric barium releases

    Science.gov (United States)

    Deehr, C.; Romick, G.

    1977-01-01

    The paper reports the apparent generation of pulsating aurora by explosive releases of barium vapor near 250 km altitude. This effect occurred only when the explosions were in the path of precipitating electrons associated with the visible aurora. Each explosive charge was a standard 1.5 kg thermite mixture of Ba and CuO with an excess of Ba metal which was vaporized and dispersed by the thermite explosion. Traces of Sr, Na, and Li were added to some of the charges, and monitoring was achieved by ground-based spectrophotometric observations. On March 28, 1976, an increase in emission at 5577 A and at 4278 A was observed in association with the first two bursts, these emissions pulsating with roughly a 10 sec period for approximately 60 to 100 sec after the burst.

  7. Behaviour of barium and strontium oxides in liquid nitrogen tetroxide

    International Nuclear Information System (INIS)

    Chemical transformations of barium and strontium oxides (MeO, MeO2) in liquid nitrogen tetroxide are considered in the temperature range of 290-493 K. The data on IR and Raman spectra of the reaction products in the region of 2500-600 cm-1 are presented. No formation of nitrosonium complexes of the type NO[Me(NOsub(3))sub(n)]sub(m) and adducts of the type Me(NO3)2xmN2O4 is detected. It has been established that MeO2 possess a higher reactivity in liquid nitrogen tetroxide than MeO. Using the methods of vibrational spectroscopy the bands, characteristic of MeO2 are signled out in MeO samples being in contact with nitrogen tetroxide

  8. Stark effect in Rydberg states of helium and barium

    International Nuclear Information System (INIS)

    This thesis, which deals with the effect of an electric field up to moderate field strengths on atoms with two valence electrons outside closed shells, in casu helium and barium, contains chapter in which the linear Stark effect in the 1 snp 1,3p Rydberg states of helium (n around 40) has been studied in a CW laser-atomic beam experiment. The evolution of the angular momentum manifolds into the n-mixing regime was followed and avoided level crossings were observed. Stark manifolds were also calculated by diagonalization of the complete energy matrix in the presence of an electric field. It turned out to be necessary to include up to five n-values in the calculations already at moderate values of the field to reproduce the data within the experimental accuracy (a few MHz), especially in the regime of the avoided crossings. (author). 147 refs.; 30 figs.; 8 tabs

  9. Small polarons and point defects in barium cerate

    Science.gov (United States)

    Swift, Michael; Janotti, Anderson; Van de Walle, Chris G.

    2015-12-01

    Barium cerate (BaCeO3) is a well-known ionic conductor of both hydrogen and oxygen. In applications, it is frequently doped (for instance with Y) to increase stability and promote diffusion. However, the effects of doping and native defects are not fully understood. Computational studies have been stymied by the nature of the conduction band, which is made up of cerium 4 f states. These states present a challenge to ab initio techniques based on density functional theory within the standard approximations for exchange and correlation. Using a hybrid functional, we investigate the effects of hydrogen impurities and native defects on the electrical and optical properties of BaCeO3. We discuss the tendency of excess electrons or holes to localize in the form of small polarons. We also explore the interactions of polarons with hydrogen impurities and oxygen vacancies, and their impact on luminescence properties.

  10. Nonlinear optical properties of calcium barium niobate epitaxial thin films.

    Science.gov (United States)

    Bancelin, Stéphane; Vigne, Sébastien; Hossain, Nadir; Chaker, Mohammed; Légaré, François

    2016-07-25

    We investigate the potential of epitaxial calcium barium niobate (CBN) thin film grown by pulsed laser deposition for optical frequency conversion. Using second harmonic generation (SHG), we analyze the polarization response of the generated signal to determine the ratios d15 / d32 and d33 / d32 of the three independent components of the second-order nonlinear susceptibility tensor in CBN thin film. In addition, a detailed comparison to the signal intensity obtained in a y-cut quartz allows us to measure the absolute value of these components in CBN thin film: d15 = 5 ± 2 pm / V, d32 = 3.1 ± 0.6 pm / V and d33 = 9 ± 2 pm / V. PMID:27464195

  11. Barium titanate nanocomposite capacitor FY09 year end report.

    Energy Technology Data Exchange (ETDEWEB)

    Stevens, Tyler E.; DiAntonio, Christopher Brian; Yang, Pin; Chavez, Tom P.; Winter, Michael R.; Monson, Todd C.; Roesler, Alexander William; Fellows, Benjamin D.

    2009-11-01

    This late start RTBF project started the development of barium titanate (BTO)/glass nanocomposite capacitors for future and emerging energy storage applications. The long term goal of this work is to decrease the size, weight, and cost of ceramic capacitors while increasing their reliability. Ceramic-based nanocomposites have the potential to yield materials with enhanced permittivity, breakdown strength (BDS), and reduced strain, which can increase the energy density of capacitors and increase their shot life. Composites of BTO in glass will limit grain growth during device fabrication (preserving nanoparticle grain size and enhanced properties), resulting in devices with improved density, permittivity, BDS, and shot life. BTO will eliminate the issues associated with Pb toxicity and volatility as well as the variation in energy storage vs. temperature of PZT based devices. During the last six months of FY09 this work focused on developing syntheses for BTO nanoparticles and firing profiles for sintering BTO/glass composite capacitors.

  12. Ultrasonic de-agglomeration of barium titanate powder.

    Science.gov (United States)

    Marković, S; Mitrić, M; Starcević, G; Uskoković, D

    2008-01-01

    BaTiO3 (BT) powder, with average particle size of 1.4 microm, was synthesized by solid-state reaction. A high-intensity ultrasound irradiation (ultrasonication) was used to de-agglomerate micro-sized powder to nano-sized one. The crystal structure, crystallite size, morphology, particle size, particle size distribution, and specific surface area of the BT powder de-agglomerated for different ultrasonication times (0, 10, 60, and 180 min) were determined. It was found that the particles size of the BT powder was influenced by ultrasonic treatment, while its tetragonal structure was maintained. Therefore, ultrasonic irradiation can be proposed as an environmental-friendly, economical, and effective tool for the de-agglomeration of barium titanate powders. PMID:17845864

  13. Synthesis and optical study of barium magnesium aluminate blue phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Jeet, Suninder, E-mail: suninder.jeet@thapar.edu; Pandey, O. P., E-mail: oppandey@thapar.edu [School of Physics and Materials Science, Thapar University, Patiala (147003), Punjab (India); Sharma, Manoj, E-mail: manojnarad@sggswu.org [Department of Nanotechnology, Sri Guru Granth Sahib World University, Fatehgarh Sahib(146406), Punjab (India)

    2015-05-15

    Europium doped barium magnesium aluminate (BaMgAl{sub 10}O{sub 17}:Eu{sup 2+}) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl{sub 10}O{sub 17}(JCPDS 26-0163) along with an additional phase BaAl{sub 2}O{sub 4}(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f{sup 6} 5d → 4f{sup 7} transition of Eu{sup 2+} which lies in the blue region of the visible spectrum.

  14. Bronchography in dogs. Comparative study with two barium sulphate solutions

    International Nuclear Information System (INIS)

    Two solutions of barium sulphate, 60 and 30% w/v, were compared with the ''overflow'' Bronchographic method. Two groups of eight healthy adult does of both sexes, weighing 7 to 18 kg were used for the study. The dogs were anaesthetised with thiopentone sodium 2% (20 mg/kg iv). After intubation, each dog received contrast medium by a catheter connected to a syringe, in a 9 mi dose. Two series of two x-rays plates were taken in left lateral recumbent, 3 and 6 min after administering the contrast medium and in ventrodorsal projection, 30 sec. later. The x-ray plates obtained were analysed and compared intra and inter group considering the advance speed of the contrast medium, the radiographic density and outlines. Adverse reactions were controlled

  15. Barium depletion study on impregnated cathodes and lifetime prediction

    Science.gov (United States)

    Roquais, J. M.; Poret, F.; le Doze, R.; Ricaud, J. L.; Monterrin, A.; Steinbrunn, A.

    2003-06-01

    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK).

  16. Barium depletion study on impregnated cathodes and lifetime prediction

    International Nuclear Information System (INIS)

    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK)

  17. Structural and functional characterization of barium zirconium titanate / epoxy composites

    Directory of Open Access Journals (Sweden)

    Filiberto González Garcia

    2011-12-01

    Full Text Available The dielectric behavior of composite materials (barium zirconium titanate / epoxy system was analyzed as a function of ceramic concentration. Structure and morphologic behavior of the composites was investigated by X-ray Diffraction (XRD, Fourier transformed infrared spectroscopy (FT-IR, Raman spectroscopy, field emission scanning electron microscopy (FE-SEM and transmission electron microscopy (TEM analyses. Composites were prepared by mixing the components and pouring them into suitable moulds. It was demonstrated that the amount of inorganic phase affects the morphology of the presented composites. XRD revealed the presence of a single phase while Raman scattering confirmed structural transitions as a function of ceramic concentration. Changes in the ceramic concentration affected Raman modes and the distribution of particles along into in epoxy matrix. Dielectric permittivity and dielectric losses were influenced by filler concentration.

  18. Gamma radiation induced darkening in barium gallo-germanate glass.

    Science.gov (United States)

    Chen, Xiaodong; Heng, Xiaobo; Tang, Guowu; Zhu, Tingting; Sun, Min; Shan, Xiujie; Wen, Xin; Guo, Jingyuan; Qian, Qi; Yang, Zhongmin

    2016-05-01

    Barium gallo-germanate (BGG) glass is an important glass matrix material used for mid-infrared transmission and mid-infrared fiber laser. In this study, we investigated the γ-ray irradiation induced darkening effect of BGG glass. Optical transmittance spectra, electron paramagnetic resonance (EPR) and thermoluminescence (TL) spectra were employed to investigate the γ-ray irradiation induced defects. Two kinds of Ge-related defects in the irradiated BGG glass, named Ge-related non-bridging oxygen hole center (Ge-NBOHC) and Ge-related electron centers (GEC), were verified. In addition, the absorption bands of the two defects have been separated and the peak absorptivity of Ge-NBOHC and GEC defects is at 375 nm and 315 nm, respectively. PMID:27137531

  19. Effect of Nb on barium titanate prepared from citrate solutions

    Directory of Open Access Journals (Sweden)

    Stojanović Biljana D.

    2002-01-01

    Full Text Available The influence of the addition of dopants on the microstructure development and electrical properties of BaTiO3 doped with 0.2, 0.4, 0.6, 0.8 mol% of Nb and 0.01 mol% of Mn based compounds was studied. Doped barium titanate was prepared using the polymeric precursor method from citrate solutions. The powders calcined at 700°C for 4 hours were analysed by infrared (IR spectroscopy to verify the presence of carbonates, and by X-ray diffraction (XRD for phase formation. The phase composition, microstructure and dielectric properties show a strong dependence on the amount of added niobium.

  20. Ionoluminescence of trivalent rare-earth-doped strontium barium niobate

    Energy Technology Data Exchange (ETDEWEB)

    Calvo del Castillo, H. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain); Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Ruvalcaba, J.L. [Universidad Nacional Automoma de Mexico, Instituto de Fisica, 04510 Ciudad Universitaria, Mexico D.F. (Mexico); Bettinelli, M.; Speghini, A. [Dipartimento Scientifico e Tecnologico, Universita di Verona and INSTM, UdR Verona, Ca Vignal, Strada Le Grazie 15, I-37134 Verona (Italy); Barboza Flores, M. [Centro de Investigacion en Fisica, Universidad de Sonora, Hermosillo, Sonora (Mexico); Calderon, T. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid, Modulo C-VI, Campus de Cantoblanco, 28049 Cantoblanco, Madrid (Spain)], E-mail: tomas.calderon@uam.es; Jaque, D.; Garcia Sole, J. [Departamento de Fisica de Materiales, Universidad Autonoma de Madrid, 28049 Cantoblanco, Madrid (Spain)

    2008-05-15

    Ionoluminescence spectra for different rare-earth ion (Pr{sup 3+} and Eu{sup 3+})-activated Sr{sub x}Ba{sub 1-x}Nb{sub 2}O{sub 6} strontium barium niobate crystals (x=0.33 and 0.60) have been induced with a 3 MeV proton beam for a variety of beam current intensities (45, 40 and 20 nA). The proton-beam induced luminescent spectra have shown features associated with the presence of the rare-earth ion and some spectral features mostly related to the host crystal, which appear only for high beam current intensities. We have compared the ionoluminescence results to those obtained under UV light excitation (photoluminescence technique) where a direct excitation of the band gap would occur.

  1. Microwave absorption properties of barium titanate/epoxide resin composites

    International Nuclear Information System (INIS)

    Nano-barium titanate (BT) was prepared by a sol-gel method. The prepared powders were characterized by x-ray powder diffraction and transmission electron microscopy. The complex relative dielectric permittivity (ε = ε' - jε-prime) and magnetic permeability (μ = μ' - jμ-prime) of the BT powders were measured in the frequency range 8 ∼ 18 GHz. The BT/epoxide resin (EP) composite with different volume contents was investigated. The effects of thickness on the BT/EP composite were studied. It was found that an optimum thickness and contents of the absorber can yield the maximum reflection loss which could be obtained over a broad frequency region in the X and Ku bands. Our results indicate that BT could be a promising microwave absorption material

  2. Study on a flexoelectric microphone using barium strontium titanate

    Science.gov (United States)

    Kwon, S. R.; Huang, W. B.; Zhang, S. J.; Yuan, F. G.; Jiang, X. N.

    2016-04-01

    In this study, a flexoelectric microphone was, for the first time, designed and fabricated in a bridge structure using barium strontium titanate (Ba0.65Sr0.35TiO3) ceramic and tested afterwards. The prototyped flexoelectric microphone consists of a 1.5 mm  ×  768 μm  ×  50 μm BST bridge structure and a silicon substrate with a cavity. The sensitivity and resonance frequency were designed to be 0.92 pC/Pa and 98.67 kHz, respectively. The signal to noise ratio was measured to be 74 dB. The results demonstrate that the flexoelectric microphone possesses high sensitivity and a wide working frequency range simultaneously, suggesting that flexoelectricity could be an excellent alternative sensing mechanism for microphone applications.

  3. Usefulness of CA 130 kit based on IRMA

    Energy Technology Data Exchange (ETDEWEB)

    Fujii, Takashi; Kimura, Yoshiko; Ata, Mariko; Miyagawa, Naoko; Iio, Atsushi; Hamamoto, Ken

    1988-11-01

    Immunoradiometric assay for CA 130 was fundamentally and clinically evaluated using a commercially available D-7111 kit. Incubation time was 4 hr with the present CA 133 kit as compared with 16 - 24 hr with conventional CA 125 kit. Laboratory performance of CA 130 kit was satisfactory for standard curve, reproducibility, and recovery test. There was well correlation between the present CA 130 kit and CA 125 kit (r = 0.931). The concentration of CA 130 in the serum was significantly higher in healthy women than men (17.3 +- 10.5 U/ml vs 9.6 +- 5.1 U/ml). Serum CA 130 levels tended to decrease with aging, regardless of sex. These levels were changeable with menstrual cycle ; i.e., these were significantly higher during menstrual phase (24.2 +- 9.0 U/ml) and significantly lower during ovulatory phase (10.9 +- 2.4 U/ml) and during menopause (12.1 +- 3.4 U/ml). Cut off serum CA 130 levels were defined as 20 U/ml for men and 38 U/ml for women. Positive rate for CA 130 was the highest in cases of ovarian cancer (80 %), followed by endometrial cancer (50 %), pancreatic cancer (47 %), benign ovarian tumor (44 %), and lung cancer (39 %). (Namekawa, K.).

  4. Enthalpy of formation of (In, Gd)-doped barium cerate

    International Nuclear Information System (INIS)

    Highlights: • BaCe0.7Gd0.2In0.1O2.85 was prepared by solid-state reaction. • The standard formation enthalpy was determined. • The stabilization energy (ΔstH°) was calculated. • ΔstH° of BaCe0.7Gd0.2In0.1O2.85 is higher than BaCe0.7Nd0.2In0.1O2.85 and BaCeO3. - Abstract: Solution enthalpies of barium cerate doped by gadolinium and indium and a mixture of BaCl2 + 0.7CeCl3 + 2GdCl3 + 0.1InCl3 have been measured in 1 mol dm−3 HCl with 0.1 mol dm−3 KI. For the first time the standard molar formation enthalpy of BaCe0.7Gd0.2In0.1O2.85 has been determined by solution calorimetry as follows: ΔfH° (298.15 K) = −1615.84 ± 9.01 kJ mol−1. The stabilization energy for above-mentioned compound has been calculated as well. It has been shown that barium cerate doped gadolinium and indium has higher stabilization energy than BaCe0.7Nd0.2In0.1O2.85 and BaCeO3. The reaction enthalpy with CO2 interaction has been calculated for BaCe0.7Gd0.2In0.1O2.85

  5. Brillouin function characteristics for La-Co substituted barium hexaferrites

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Chuanjian, E-mail: wcjuestc2005@gmail.com, E-mail: ksun@uestc.edu.cn; Yu, Zhong; Sun, Ke, E-mail: wcjuestc2005@gmail.com, E-mail: ksun@uestc.edu.cn; Guo, Rongdi; Jiang, Xiaona; Lan, Zhongwen [State Key Laboratory of Electronic Thin Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Yang, Yan [Department of Communication and Engineering, Chengdu Technological University, Chengdu 611730 (China)

    2015-09-14

    La-Co substituted barium hexaferrites with the chemical formula of Ba{sub 1−x}La{sub x}Fe{sub 12−x}Co{sub x}O{sub 19} (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f{sub 1}, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ω{sub bf2}, ω{sub kf1}, ω{sub af1}, ω{sub kf2}, and ω{sub bk} of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f{sub 1}, 4f{sub 2}, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ω{sub bf2} and ω{sub af1} decrease constantly, while the molecular-field coefficients ω{sub kf1}, ω{sub kf2}, and ω{sub bk} show a slight change.

  6. Is hydroxyethyl starch 130/0.4 safe?

    DEFF Research Database (Denmark)

    Haase, Nicolai; Perner, Anders

    2012-01-01

    ABSTRACT: It is heavily debated whether or not treatment with hydroxyethyl starch 130/0.4 contributes to the development of acute kidney failure in patients with severe sepsis. In the previous issue of Critical Care, Muller and colleagues report no association between initial resuscitation with...... hydroxyethyl starch 130/0.4 and renal impairment in a cohort of septic patients. Can we then consider hydroxyethyl starch 130/0.4 a safe intervention? The answer is no - observational data should be interpreted with caution and should mainly be used to identify risks, while safety must be assessed in...

  7. X-ray emission from a 650-fs laser-produced barium plasma

    International Nuclear Information System (INIS)

    We have used x rays in the 9--15-A band emitted from a solid target of BaF2 irradiated by ∼120 mJ of 248-nm radiation in a 650-fs full width at half maximum Gaussian laser pulse to characterize spectroscopically the resulting ultrashort-pulse laser-produced plasma. The emission was spectrally resolved but space and time integrated. By comparing the spectrum with unresolved-transition-array calculations and measurements of plasma emission from longer-pulse experiments, it is clear that ions as highly stripped as titaniumlike barium are present. We have successfully modeled the observed spectrum by assuming an optically thin source in local thermodynamic equilibrium (LTE) and using the super-transition-array theory [A. Bar-Shalom et al., Phys. Rev. A 40, 3183 (1989)] for emission from a hot, dense plasma. The model indicates that the emitting region is at comparatively low temperature (200--300 eV) and high electron density (1023--1024 cm-3). The degree of agreement between the model and the measured spectrum also suggests that the emitting plasma is near LTE. We conclude that the emission in this band arises from a solid-density plasma formed early in time, and is thus localized in both space and time. This interpretation is reinforced by LASNEX [G. B. Zimmerman and W. L. Kruer, Comments Plasma Phys. Controlled Fusion 11, 51 (1975)] simulations that indicate that emission in this band closely tracks the laser pulse

  8. Screening of plant species for phytoremediation of uranium, thorium, barium, nickel, strontium and lead contaminated soils from a uranium mill tailings repository in South China.

    Science.gov (United States)

    Li, Guang-yue; Hu, Nan; Ding, De-xin; Zheng, Ji-fang; Liu, Yu-long; Wang, Yong-dong; Nie, Xiao-qin

    2011-06-01

    The concentrations of uranium, thorium, barium, nickel, strontium and lead in the samples of the tailings and plant species collected from a uranium mill tailings repository in South China were analyzed. Then, the removal capability of a plant for a target element was assessed. It was found that Phragmites australis had the greatest removal capabilities for uranium (820 μg), thorium (103 μg) and lead (1,870 μg). Miscanthus floridulus had the greatest removal capabilities for barium (3,730 μg) and nickel (667 μg), and Parthenocissus quinquefolia had the greatest removal capability for strontium (3,920 μg). In this study, a novel coefficient, termed as phytoremediation factor (PF), was proposed, for the first time, to assess the potential of a plant to be used in phytoremediation of a target element contaminated soil. Phragmites australis has the highest PFs for uranium (16.6), thorium (8.68), barium (10.0) and lead (10.5). Miscanthus floridulus has the highest PF for Ni (25.0). Broussonetia papyrifera and Parthenocissus quinquefolia have the relatively high PFs for strontium (28.1 and 25.4, respectively). On the basis of the definition for a hyperaccumulator, only Cyperus iria and Parthenocissus quinquefolia satisfied the criteria for hyperaccumulator of uranium (36.4 μg/g) and strontium (190 μg/g), and could be the candidates for phytoremediation of uranium and strontium contaminated soils. The results show that the PF has advantage over the hyperaccumulator in reflecting the removal capabilities of a plant for a target element, and is more adequate for assessing the potential of a plant to be used in phytoremediation than conventional method. PMID:21523506

  9. Sensitivity of single contrast barium enema with regard to colorectal disease as diagnosed by colonoscopy

    International Nuclear Information System (INIS)

    The results of single contrast barium enema were retrospectively correlated with colonoscopically diagnosed colorectal disease in 54 patients (75 lesions). Altogether 66 lesions (88%) were correctly diagnosed. The sensitivity of barium enema for polyps was 81% (26/32). There were three perceptive errors and three polyps 5 mm or less in size were not demonstrated by barium enema. Twenty-nine cases of inflammatory disorders were all correctly diagnosed. One of 12 malignancies was missed by perceptive error. In two cases with vascular malformations the barium enema was normal. 4/9 (44%) of missed lesions were perceptive errors and could have been probably avoided by a second independent reading of films. (orig.)

  10. How changes in a radiologist's technique can reduce patient dose in barium enema studies

    International Nuclear Information System (INIS)

    Changes in a radiologist's technique, especially utilising digital technology, can lead to substantial dose savings in barium enema examinations. Data will be provided showing a 20% saving with only minimal change in technique. (author)

  11. Calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid

    International Nuclear Information System (INIS)

    Present article is devoted to calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid. The calorimetric study of interaction of barium hydroxide with diluted solutions of hydrofluoric acid was carried out in order to determine the thermal effects of reactions. The results of interaction of Ba(OH)4·8H2O with 5, 10, and 20% solution of hydrofluoric acid were considered.

  12. Comparison of barium swallow and ultrasound in diagnosis of gastro-oesophageal reflux in children.

    OpenAIRE

    Naik, D R; Bolia, A; Moore, D. J.

    1985-01-01

    Fifty one infants and older children with suspected gastro-oesophageal reflux entered a study comparing the diagnostic accuracy of a standard barium swallow examination with that of ultrasound scanning. All children were examined by both techniques. In 40 cases there was unequivocal agreement between the examinations. Of the remaining patients, four had definite reflux by ultrasonic criteria but showed no evidence of reflux on barium swallow examination, four had positive findings on ultrasou...

  13. Whipple's disease demonstrated by double contrast small bowel enema with barium and methylcellulose

    International Nuclear Information System (INIS)

    The radiologic findings on small bowel enema examination using barium and methylcellulose (SBE+Ba+MC) in a patient with Whipple's disease before and after treatment are described. The changes on SBE+Ba+MC corresponded well to the clinical and morphologic picture. The advantages of this double contrast technique compared to the enteroclysis with barium alone are demonstrated. The SBE+Ba+MC is a good method to demonstrate the manifestations of Whipple's disease involving the small bowel and the mesentery. (orig.)

  14. Impact of Biofield Treatment on Atomic and Structural Characteristics of Barium Titanate Powder

    OpenAIRE

    Trivedi, Mahendra; Nayak, Gopal

    2015-01-01

    Barium titanate, perovskite structure is known for its high dielectric constant and piezoelectric properties, which makes it interesting material for fabricating capacitors, transducer, actuator, and sensors. The perovskite crystal structure and lattice vibrations play a crucial role in its piezoelectric and ferroelectric behavior. In the present study, the barium titanate powder was subjected to biofield treatment. Further, the control and treated samples were characterized using X-ray diffr...

  15. Kinetics of barium sulphate reaction crystallization in crystallizers with internal circulation

    OpenAIRE

    Koralewska, J.; Piotrowski, K; B. Wierzbowska; A. Matynia

    2008-01-01

    Kinetic calculation results describing the observed nucleation and growth rates of barium sulphate crystals precipitated in an integrated reaction-crystallization process in a barium sulphate-ammonium chloride-water system are presented and analyzed. The scope of experiments included two continuous model DTM-type crystallizers (Draft Tube Magma) with internal circulation of the suspension forced by a liquid jet-pump device responsible for stable and intensive enough ascending/descending flow ...

  16. High spin structure in 130,131Ba

    International Nuclear Information System (INIS)

    High spin states of 130,131Ba have been investigated via fusion evaporation reactions 122Sn(13C,4n)131Ba and 122Sn(13C, 5n)130Ba at Ebeam=65 MeV. The level schemes of 130,131Ba have been extended by placing several new γ transitions. A few interband transitions connecting two negative-parity bands, which are the experimental fingerprints of signature partners, have been established in 130Ba. Spin and parity of a side band have been assigned in 131Ba and this dipole band is proposed to have a three-quasiparticle configuration, νh11/2 x πh11/2 x πg7/2. The observed band structures and nuclear shape evolution as a function of the angular momentum have been discussed in the light of Total-Routhian-Surface calculations. (orig.)

  17. 13 CFR 108.130 - Identified Low Income Geographic Areas.

    Science.gov (United States)

    2010-01-01

    ... VENTURE CAPITAL (âNMVCâ) PROGRAM Qualifications for the NMVC Program Organizing A Nmvc Company § 108.130... intends to make Developmental Venture Capital investments and provide Operational Assistance under...

  18. Nucleocytoplasmic Shuttling of p130/RBL2: Novel Regulatory Mechanism

    OpenAIRE

    Chestukhin, Anton; Litovchick, Larisa; Rudich, Katherine; DeCaprio, James A.

    2002-01-01

    The retinoblastoma-related pocket proteins pRb, p107, and p130 are implicated in the control of cell proliferation, differentiation, and transformation. The function of pocket proteins is in part mediated by their ability to inhibit specific E2F transcription factors. The transcriptional activity of E2Fs is controlled by alteration of their nucleocytoplasmic localization during the cell cycle. p130 was observed to shuttle between the nucleus and cytoplasm in a heterokaryon fusion assay, sugge...

  19. 9 CFR 130.10 - User fees for pet birds.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false User fees for pet birds. 130.10... AGRICULTURE USER FEES USER FEES § 130.10 User fees for pet birds. (a) User fees for pet birds of U.S. origin returning to the United States, except pet birds of U.S. origin returning from Canada, are as...

  20. Dicty_cDB: SLG130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLG130 (Link to dictyBase) - - - Contig-U16419-1 SLG130Z (Link to Original ... plihy*mvvmvlfk Frame C: ---tttrslfikmptkt*m*i**sw*kmlc kdsl**sl*frlw*rf*m*n*t*wfkmlc p frkttpttt*km**emptrp ... *m*s*stwkrmlrccp*tttkmlfkmstkt*m*sqplw*r mlc *sspr*mfiemstrp*m*s*stwkrmlrccp*tttkmlikmstkt*m*nqs ... lw*rml c *k*k*lfnl*rpkl*kkrftlchenctn**rkll*ksssmlfh*siirww ...

  1. The impact of digital imaging on patient doses during barium studies

    International Nuclear Information System (INIS)

    Barium studies performed on 10 digital and four non-digital fluoroscopic systems were monitored with dose-area product meters as part of a Regional Patient Dosimetry Audit programme. The data have been collected using a computer to read and reset the dose-area product meter and also to collect patient and examination details. A comparison of dose-area product measurements from digital and non-digital fluoroscopy units on over 10 000 barium studies is presented. The data have been corrected according to patient size. The mean size corrected dose-area product for a barium meal examination was found to be 7.62 Gy cm-2 for a digital set compared with 15.45 Gy cm-2 for a non-digital set with 2462 and 1308 patients included in each measurement series, respectively. Dose-area products were also a factor of approximately two lower for barium enema, barium swallow and barium follow-through examinations performed on digital systems. (author)

  2. Preparation of porous nano barium ferrite and its adsorption properties on uranium

    International Nuclear Information System (INIS)

    The porous nano barium ferrite was made of Fe(NO3)3 and Ba(NO3)2 as raw materials, CTAB as surfactant by method of sol-gel and self-propagating combustion. The composition, morphology and magnetic properties of nano-rod barium ferrite were characterized by XRD, SEM and vibrating sample magnetometer. The adsorption properties of porous nano barium ferrite on uranium were studied with static adsorption and the effects of pH, adsorption temperature and oscillation time on adsorption properties were discussed. The results indicate that the average particle size of porous nano barium ferrite is 45-65 nm, the saturation magnetization and coercivity are 62.83 emu/g and 5481.0 Oe, respectively. Under the condition of the porous nano barium ferrite amount of 0.02 g, pH of 6, adsorption temperature of 25℃ and oscillation time of 30 min, the adsorption capacity of uranium on the porous nano barium ferrite reaches 921 μg/g. (authors)

  3. Comparison of Calcium and Barium Microcapsules as Scaffolds in the Development of Artificial Dermal Papillae.

    Science.gov (United States)

    Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu

    2016-01-01

    This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and calcium microcapsules maintained xenogenic dermal papilla cells in an immunoisolated environment and induced the formation of hair follicle structures. Calcium microcapsules showed better biocompatibility, permeability, and cell viability in comparison with barium microcapsules. Before 18 weeks, calcium microcapsules gathered together, with no substantial immune response. After 32 weeks, some microcapsules were near inflammatory cells and wrapped with fiber. A few large hair follicles were found. Control samples showed no marked changes at the implantation site. Barium microcapsules were superior to calcium microcapsules in structural and mechanical stability. The cells encapsulated in hydrogel barium microcapsules exhibited higher short-term viability. This study established a model to culture DPCs in 3D culture conditions. Barium microcapsules may be useful in short-term transplantation study. Calcium microcapsules may provide an effective scaffold for the development of artificial dermal papilla. PMID:27123456

  4. Virtual colonoscopy with electron beam CT: correlation with barium enema, colonoscopy and pathology

    International Nuclear Information System (INIS)

    To perform virtual colonoscopy using electron beam tomography(EBT) in patients in whom a colonic mass was present, and to compare the results with those obtained using barium enema, colonoscopy and gross pathologic specimens. Materials and Methods : Ten patients in whom colonic masses were diagnosed by either barium enema or colonoscopy were involved in this study. There were nine cases of adenocarcinoma and one of tubulovillous adenoma. Using EBT preoperative abdominopelvic CT scans were performed. Axial scans were then three-dimensionally reconstructed to produce virtual colonoscopic images and were compared with barium enema, colonoscopy and gross pathologic specimens. Virtual colonoscopic images of the masses were classified as either 1)polyploid, 2)sessile,3)fungating, or 4)annular constrictive. We also determined whether ulcers were present within the lesions and whether there was obstruction. Results : After virtual colonoscopy, two lesions were classified as polyploid, one as sessile, five as fungating and two as annular constrictive. Virtual colonoscopic images showed good correlation with the findings of barium enema, colonoscopy and gross pathologic specimens. Three of six ulcerative lesions were observed on colonoscopy; in seven adenocarcinomas with partial or total luminal obstruction, virtual colonoscopy visualized the colon beyond the obstructed sites. In one case, barium contrast failed to pass through the obstructed portion and in six cases, the colonoscope similarly failed. Conclusion : Virtual colonoscopies correlated well with barium enema, colonoscopy and gross pathologic specimens. They provide three dimensional images of colonic masses and are helpful for the evaluation of obstructive lesions

  5. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough

    Directory of Open Access Journals (Sweden)

    Carlos Shuler Nin

    2013-12-01

    Full Text Available OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons.RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6% of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6% of the patients, whereas the treatment was ineffective in 1 (8.4%. We observed no complications related to barium swallow, such as contrast aspiration.CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.

  6. Excess Barium as a Paleoproductivity Proxy: A Reevaluation

    Science.gov (United States)

    Eagle, M.; Paytan, A.

    2001-12-01

    Marine barite may serve as a proxy to reconstruct past export production (Dymond, 1992). In most studies sedimentary barite accumulation is not measured directly, instead a parameter termed excess barium (Baexs), also referred to as biogenic barium, is used to estimate the barite content. Baexs is defined as the total Ba concentration in the sediment minus the Ba associated with terrigenous material. Baexs is calculated by normalization to a constant Ba/Al ratio, typically the average shale ratio. This application assumes that (1) all the Ba besides the fraction associated with terrigenous Al is in the form of barite (the phase related to productivity) (2) the Ba/Alshale is constant in space and time (3) all of the Al is associated with terrigenous matter. If these assumptions are invalidated however, this approach lead to significant errors in calculating export production rates. To test the validity of the use of Baexs as a proxy for barite we compared the Baexs in a wide range of core top sediments from different oceanic settings to the barite content in the same cores. We found that Baexs frequently overestimated the Ba fraction associated with barite and in several cases significant Baexs was measured in the cores where no barite was observed. We have also used a sequential leaching protocol (Collier and Edmond 1984) to determine Ba association with organic matter, carbonates, Fe-Mn hydroxides and silicates. While terrigenous Ba remains an important fraction, in our samples 25-95% of non-barite Ba was derived from other fractions, with Fe-Mn oxides contributing the most Ba. In addition we found that the Ba/Al ratio in the silicate fraction of our samples varied considerably from site to site. The above results suggest that at least two of the underlying assumptions for employing Baexs to reconstruct paleoproductivity are not always valid and previously published data from (Murray and Leinen 1993) indicate that the third assumption may also not hold in every

  7. Intravenous injection of microvesicle-delivery miR-130b alleviates high-fat diet-induced obesity in C57BL/6 mice through translational repression of PPAR-γ

    OpenAIRE

    Pan, Shifeng; Yang, Xiaojing; Jia, Yimin; Li, Yue; Chen, Rirong; Wang, Min; Cai, Demin; Zhao, Ruqian

    2015-01-01

    Background We have shown previously that microvesicle (MV)-delivered miR-130b (miR-130b-MV) is able to target PPAR-γ and subsequently reduce the lipid accumulation in vitro. However, the in vivo effect of miR-130b on fat deposition and glucose homeostasis remains unknown. Results Three-week-old C57BL/6 mice were fed a high-fat diet for 8 weeks and then intravenously injected with MV-packaged scrambled control microRNA (miRNA) or miR-130b every other day for 10 days. Glucose tolerance test was...

  8. 38 CFR 17.130 - Payment for treatment dependent upon preference prohibited.

    Science.gov (United States)

    2010-07-01

    ... dependent upon preference prohibited. 17.130 Section 17.130 Pensions, Bonuses, and Veterans' Relief... Previously Authorized § 17.130 Payment for treatment dependent upon preference prohibited. No reimbursement... through private sources in preference to available Government facilities....

  9. Monte Carlo estimation for pediatric barium meal procedures

    International Nuclear Information System (INIS)

    Fluoroscopic barium meal (BM) series involve an X-ray examination of the esophagus, stomach, and duodenum, by the use of a contrast media – the barium sulfate (BaSO4). They are widely used to observe digestive functions or to diagnose abnormalities such as ulcers; tumors; inflammation of the esophagus, stomach, and duodenum; malrotations; vascular rings; and gastroesophageal reflux disease (a common ailment in children). However, this procedure uses long fluoroscopy times and multiple radiographies, resulting in high effective doses to pediatric patients, whose radiosensitivity and life expectancy are higher than in adults. Based on those data, the aims of the current study are to: determine the PK,A (kerma-area product) values, on the patient chest area, and the effective doses to 5 and 10 years old children. Thirty-seven different pediatric patients were studied and stratified into two group sizes: 5 and 10 years old. For each procedure, the following data was recorded: sex, age and upper chest thickness, from the patients; technical parameters of the procedure (kV, fluoroscopy time and number of radiographies); distances (focus-detector and focus-table) and field size on the examination table. Three pairs of LiF:Mg,Ti thermoluminescent dosimeters were positioned at the center of the child´s sternum. After that, upper chest thickness was subtracted from focus-table distance, so focus-patient distance was obtained. Using the field size on the table and applying similar triangles concepts, the field size on the patient was measured, which was multiplied by the mean kerma (from the dosimeters), so that PK,A could be determined. To estimate the effective dose, PK,A and technical parameters of the procedure (kV, total filtration, focus-detector distance and field size on the patient) were written in a Monte Carlo software simulation. The results of PK,A and effective doses were higher than studies used for comparison, which shows the importance of an optimization

  10. (EC+β+) decay study of 130Ce and it's radiochemical separation

    International Nuclear Information System (INIS)

    The nuclide 130Ce was produced by a (16O, 4n) reaction carried out at the SFC accelerator of IMP on an enriched 118Sn target. Reaction products were moved to a shielded location by a He-jet tape-transport system, then using a radiochemical separation procedure in which a solvent extraction and precipitation with oxalic acid method was applied, Ce was separated, purified and made into thin sample rapidly, and then a single spectrum as well as X-γ, γ-γ coincidence measurements was performed. A 22.9 min activity in chemical separated sample was identified as 130Ce. The decay scheme was proposed for the first time. The scheme included 108 lines of γ rays, among which 107 being new. Total separation time of this new chemical procedure was about 10 min, and the chemical yield was about 70%. More than 98% La produced in nuclear reaction was removed, decontamination of other impurities also satisfied the requirement of study of 130Ce (EC + β+) decay scheme

  11. “No-spin” states and low-lying structures in 130Xe and 136Xe

    Directory of Open Access Journals (Sweden)

    Ross T.J.

    2015-01-01

    Full Text Available Inelastic neutron scattering on solid 130XeF2 and 136XeF2 targets was utilized to populate excited levels in 130Xe and 136Xe. When calculating nuclear matrix elements vital to the understanding of double-beta decay, it is important to have a clear understanding of the low-lying level structure of both the parent and daughter nucleus. Of particular relevance to double-beta decay searches are the assignments of 0+ states. We show here that in the case of 130Xe there are several discrepancies in the adopted level structure. We found that one previous 0+ candidate level (1590 keV can be ruled out and assigned two additional candidates (2223 and 2242 keV. In 136Xe we question the previous assignment of a 0+ level at 2582 keV. Excitation function and angular distribution measurements were utilized to make spin and parity assignments of levels and place new transitions.

  12. Barium oxide, calcium oxide, magnesia, and alkali oxide free glass

    Science.gov (United States)

    Lu, Peizhen Kathy; Mahapatra, Manoj Kumar

    2013-09-24

    A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.

  13. Abundance analysis of s-process enhanced barium stars

    Science.gov (United States)

    Mahanta, Upakul; Karinkuzhi, Drisya; Goswami, Aruna; Duorah, Kalpana

    2016-08-01

    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ˜42000) of these objects spanning a wavelength range from 4000 to 6800 Å, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature Teff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] ≥ 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars with [Ba/Fe] ˜ 0.4. The derived abundances of the elements are interpreted on the basis of existing theories for understanding their origin and evolution.

  14. Structural and magnetic properties of barium-gadolinium hexaferrites

    Energy Technology Data Exchange (ETDEWEB)

    Litsardakis, G. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)]. E-mail: Lits@eng.auth.gr; Manolakis, I. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Serletis, C. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Efthimiadis, K.G. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)

    2007-03-15

    A series of Gd-substituted M-type barium hexaferrites has been prepared by the ceramic route, according to the formula (Ba{sub 1-x}Gd{sub x})O.5.25Fe{sub 2}O{sub 3} (x=0-0.30). XRD analysis revealed that all the samples present primarily an M-type structure. Samples x=0 and x=0.05 are single-phase. Hematite (Fe{sub 2}O{sub 3}) and GdFeO{sub 3} were detected in the remaining samples. Coercivity (H{sub c}) shows remarkably high values, {approx}293kA/m for x=0.20 and 0.30 with a maximum of 322kA/m for x=0.25. Specific saturation magnetization ({sigma}{sub sat}) of the samples presents a small increase up to x=0.10. The microstructure examination indicates that Gd may act as a grain growth inhibitor.

  15. Barium from a mini r-process in supernovae

    Science.gov (United States)

    Heymann, D.

    1983-01-01

    McCulloch and Wasserburg (1978) have reported nonlinear isotopic anomalies in barium for two Ca-Al-rich inclusions of the Allende carbonaceous chondrite, known as EK-1-4-1 and C-1. In an attempt to account for these anomalies, it has been proposed that Ba from an r-process of nucleosynthesis, containing Ba-135 and Ba-137, was injected into the primeval color system but was not totally homogenized. Questions arise in connection with the relations of Xe isotopes in carbonaceous chondrites. This has prompted Heymann and Dziczkaniec (1979, 1980, 1981) to study the formation of r-Xe, r-Kr, and r-Te by the mini r-process which is thought to occur in the O, Ne-rich shells of Type II supernovae. Lee et al. (1979) have studied the formation of r-Ba, r-Nd, and r-Sm by the same process. Certain differences regarding the approaches used by Lee et al. and by Heymann and Dziczkaniec make it necessary to restudy the work of Lee et al. Attention is given to the survival probabilities of nuclear species of interest, taking into accounts the elements Cs, Ba, I, and Xe.

  16. On-line ultrasonic characterisation of barium doped lanthanum perovskites

    International Nuclear Information System (INIS)

    Perovskite manganite samples La1−xBaxMnO3 with the composition of x=0.30, 0.33 and 0.36 were prepared by employing solid state reaction technique. The X-ray diffraction (XRD) patterns confirmed the rhombhedral structure with R3c space group of the samples. The obtained energy dispersive analysis X-rays (EDX) spectra of the samples have confirmed the elemental composition of the samples. The scanning electron microscope (SEM) images of the samples were used to find out the size of the particles. In-situ ultrasonic measurements were carried out on the samples by through transmission method. The temperature dependence of the ultrasonic parameters revealed interesting features of the samples. The observed ultrasonic velocities and attenuation both in longitudinal and shear mode are related to the paramagnetic (PM) to ferromagnetic (FM) phase transition in the prepared samples. The results confirmed that an increase in the barium content in the sample leads to an increase in the phase transition temperature TC

  17. Properties of barium strontium titanate at millimeter wave frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Osman, Nurul [Department of Physics, Universiti Putra Malaysia (Malaysia); Free, Charles [Department of Engineering and Design, University of Sussex (United Kingdom)

    2015-04-24

    The trend towards using higher millimetre-wave frequencies for communication systems has created a need for accurate characterization of materials to be used at these frequencies. Barium Strontium Titanate (BST) is a ferroelectric material whose permittivity is known to change as a function of applied electric field and have found varieties of application in electronic and communication field. In this work, new data on the properties of BST characterize using the free space technique at frequencies between 145 GHz and 155 GHz for both thick film and bulk samples are presented. The measurement data provided useful information on effective permittivity and loss tangent for all the BST samples. Data on the material transmission, reflection properties as well as loss will also be presented. The outcome of the work shows through practical measurement, that BST has a high permittivity with moderate losses and the results also shows that BST has suitable properties to be used as RAM for high frequency application.

  18. Properties of barium strontium titanate at millimeter wave frequencies

    International Nuclear Information System (INIS)

    The trend towards using higher millimetre-wave frequencies for communication systems has created a need for accurate characterization of materials to be used at these frequencies. Barium Strontium Titanate (BST) is a ferroelectric material whose permittivity is known to change as a function of applied electric field and have found varieties of application in electronic and communication field. In this work, new data on the properties of BST characterize using the free space technique at frequencies between 145 GHz and 155 GHz for both thick film and bulk samples are presented. The measurement data provided useful information on effective permittivity and loss tangent for all the BST samples. Data on the material transmission, reflection properties as well as loss will also be presented. The outcome of the work shows through practical measurement, that BST has a high permittivity with moderate losses and the results also shows that BST has suitable properties to be used as RAM for high frequency application

  19. Radiochemical studies of the sorption behavior of strontium and barium

    International Nuclear Information System (INIS)

    The sorption behavior strontium and barium on kaolinite, bentonite and chlorite-illite mixed clay was studied by radioanalytical techniques using the batch method. 90Sr(29.1 y) and 133Ba(10.5y) were used as radiotracers. Characterization of the solid matrices was done by FTIR and XRD spectrometers and specific surface area measurements. Synthetic groundwater was used as the aqueous phase. The variation of the distribution ratio Rd, as a function of metal ion loading was examined. The sorption isotherms were fitted to various iso term models. The sorption energies were calculated to be in the range of 8-10kJ/mol suggesting an ion exchange type of sorption mechanism. In detailed experiments, chlorite-illite mixed clay was first presatured with K+, Sr2+, Ca2+ and Al 3= ions, respectively, prior to sorption studies with Ba2+ ions. The results of Ca2+ pretreated chlorite-illite were very similar to those of natural chlorite-illite, suggesting that the Ba2+ ion exchanges primarily with the Ca2+ ion on the clay minerals. (author). 15 refs., 3 figs., 5 tabs

  20. Removal of uranyl ions from aqueous solutions using barium titanate

    International Nuclear Information System (INIS)

    Remediation of water sources contaminated with radioactive waste products is a major environmental issue that demands new and more efficient technologies. For this purpose, we report a highly efficient ion-exchange material for the removal of radioactive nuclides from aqueous solutions. The kinetic characteristics of adsorption of uranyl ions on the surface of barium titanate were investigated using a spectrophotometric method under a wide range of conditions. By controlling the pH it was possible to exert fine control over the speciation of uranium, and by optimizing the temperature and grain size of the exchanger, almost total removal was achieved in a matter of just hours. The highest efficiency (>90 % removal) was realized at high temperature (80 deg C). Moreover, the effect of competitive ion adsorption from a range of different cations and anions was quantified. Adsorption was found to follow first-order kinetics and both Freundlich and Langmuir isotherms could be applied to this system. The results of a mathematical treatment of the kinetic data combined with the observation that adsorption was independent of stirring speed and dependent on the ion-exchanger grain size, indicate that the dominant mechanism influencing adsorption is particle spreading. The adsorption behavior was not influenced by exposure to high-intensity gamma radiation, indicating potential for use of this ion-exchanger in systems containing radioactive material. These results will be of use in the development of uranium extraction systems for contaminated water sources. (author)

  1. Colonic diverticulosis: evaluation with double contrast barium enema

    International Nuclear Information System (INIS)

    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west

  2. Colonic diverticulosis: evaluation with double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja [Korea Veterans Hospital, Seoul (Korea, Republic of)

    1997-02-01

    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west.

  3. Barium in landscape components of the western Transbaikal region

    Science.gov (United States)

    Kashin, V. K.

    2015-10-01

    Barium concentrations in parent materials, soils, and plants of the forest-steppe, steppe, and dry steppe landscapes of the Transbaikal region have been studied. The average concentration of this element in rocks and soils of this region exceeds its clarke by 1.8-2.1 times. A positive correlation between the contents of Ba in soils, soil-forming rocks, and plants has been found. The concentration of Ba in soils does not correlate with the soil pH and humus content. Distribution patterns of Ba in the soil profiles have been characterized. With respect to the coefficient of the biological uptake by plants, Ba is assigned to the group of low accumulation (0.55-0.65) for mineral soils and of strong accumulation (6.0) for alluvial bog soils. Average concentrations of Ba in the steppe, meadow, and cultivated vegetation of the region are 1.9-2.3 times higher in comparison with the average concentration of this element in plants of the continents. The biological migration of Ba is most active in meadow landscapes, whereas steppe landscapes are characterized by the least active biological migration of this element.

  4. Abundance analysis of s-process enhanced barium stars

    CERN Document Server

    Mahanta, Upakul; Goswami, Aruna; Duorah, Kalpana

    2016-01-01

    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ~ 42000) of these objects spanning a wavelength range from 4000 to 6800 A, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature T_eff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] > 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars wit...

  5. On-line ultrasonic characterisation of barium doped lanthanum perovskites

    Energy Technology Data Exchange (ETDEWEB)

    Thamilmaran, P.; Arunachalam, M. [Department of Physics, Sri SRNM College, Sattur 626203, Tamil Nadu (India); Research scholars in Physics, Manonmanium Sundaranar University, Tirunelveli 627012 Tamil Nadu (India); Sankarrajan, S. [Department of Physics, Unnamalai Institute of Technology, Kovilpatti 628503, Tamil Nadu (India); Sakthipandi, K., E-mail: sakthipandi@gmail.com [Department of Physics, Sethu Institute of Technology, Kariapatti 626115, Tamil Nadu (India)

    2015-06-15

    Perovskite manganite samples La{sub 1−x}Ba{sub x}MnO{sub 3} with the composition of x=0.30, 0.33 and 0.36 were prepared by employing solid state reaction technique. The X-ray diffraction (XRD) patterns confirmed the rhombhedral structure with R3c space group of the samples. The obtained energy dispersive analysis X-rays (EDX) spectra of the samples have confirmed the elemental composition of the samples. The scanning electron microscope (SEM) images of the samples were used to find out the size of the particles. In-situ ultrasonic measurements were carried out on the samples by through transmission method. The temperature dependence of the ultrasonic parameters revealed interesting features of the samples. The observed ultrasonic velocities and attenuation both in longitudinal and shear mode are related to the paramagnetic (PM) to ferromagnetic (FM) phase transition in the prepared samples. The results confirmed that an increase in the barium content in the sample leads to an increase in the phase transition temperature T{sub C}.

  6. The thermophysical properties of calcium and barium zirconium phosphate

    Energy Technology Data Exchange (ETDEWEB)

    Gregg, Daniel J., E-mail: daniel.gregg@ansto.gov.au; Karatchevtseva, Inna; Triani, Gerry; Lumpkin, Gregory R.; Vance, Eric R.

    2013-10-15

    The thermophysical and structural properties of calcium and barium zirconium phosphate ceramics (CZP and BZP) have been investigated for their potential candidacy as actinide hosts for inert matrix fuels (IMF) in nuclear reactors. These phosphate ceramics, which can accommodate minor actinides as well as the resulting fission products, are found to be thermally stable to 1600 °C in air, however they begin to decompose in an inert atmosphere above approximately 1400 °C. The heat capacity, thermal conductivity and bulk thermal-expansion were measured from room temperature up to 1200 °C. Structural changes in this temperature region as well as the anisotropic thermal-expansion behaviour were studied using high-temperature X-ray diffraction. A phase change from R-3 to R-3c was identified for Ba{sub 0.5}Zr{sub 2}(PO{sub 4}){sub 3} near 880 °C. The thermal conductivity for these ceramics at 1000 °C was found to be 1.0 W m{sup −1} K{sup −1}, a relatively low thermal conductivity that was increased to 5.0 W m{sup −1} K{sup −1} at 1000 °C for BZP:Ni (25:75 mass ratio) cermet composites.

  7. Preparation and properties of yttria doped tetragonal zirconia polycrystal/Sr-doped barium hexaferrite ceramic composites

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Shanshan; Zhang, Chao; Guo, Ruisong, E-mail: rsguo@tju.edu.cn; Liu, Lan; Yang, Yuexia; Li, Kehang

    2015-03-15

    Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m{sup 1/2}. - Abstract: The effects of substitution of Ba{sup 2+} by Sr{sup 2+} on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba{sub 1−x}Sr{sub x}Fe{sub 12}O{sub 19}, x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m{sup 1/2} for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase.

  8. Skylab-barium alpha and beta L = 6 field-line tracing experiments

    International Nuclear Information System (INIS)

    Events SKYLAB-BARIUM ALPHA (27 November 1973) and BETA (4 December 1973) were shaped-charge barium field-line tracing experiments near L approximately equal to 6, conducted jointly by the Los Alamos Scientific Laboratory and the University of Alaska Geophysical Institute. Image-orthicon and pulsed intensified auroral cameras provided data for triangulating the fast ion streaks. Using the POGO 10-68, epoch 1965.0, field-line model with Mead-Fairfield corrections for the outer field, the triangulated positions of the fast ion streak were projected down to the 100 km altitude northern conjugate surface. The projected positions moved toward magnetic east with a velocity of 725 m/sec for both SKYLAB-BARIUM ALPHA and BETA. Assuming only an E x B/B2 force, this drift velocity is consistent with an electric field toward magnetic south of 39 mV/m. Radiometric analysis of the filtered, intensified auroral camera records gave observed peak radiance values of about 2 x 10-11 watts/cm2-Sr in the 455.4 nm line of Ba+. The barium in the portion of the ion streak for which radiometric data were obtained had initial injection velocities of 9.5 to 13.5 km/sec in both events. This portion of the ion streak for both SKYLAB-BARIUM ALPHA and BETA contained approximately 4 x 1023 ions compared to the 6.4 x 1024 atoms contained in the barium liner. Ion inventory estimates are based on a solution of the statistical equilibrium equations. Corrections have been made in the ion inventory calculations for Doppler shifts of the solar spectrum as received in the rest frame of the high-velocity barium ions

  9. An 8-year review of barium studies in the diagnosis of gastroparesis

    International Nuclear Information System (INIS)

    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings

  10. Obtaining of a barium compound by combustion chemistry and their evaluation as Co adsorbent

    International Nuclear Information System (INIS)

    In this work, barium carbonate synthesized by chemical combustion method using a chemical precursor prepared by the combination of barium nitrate and urea as a fuel, with a 1:1 molar ratio in aqueous solution, the chemical precursor was heated to evaporate excess water, producing a homogeneous viscous liquid, that when heated to 900 centi grades for 5 minutes an exothermic reaction was produced very quickly and abruptly, forming a white powder final product, fine porous, little spongy, dry and crystalline ready to be used as material adsorbent. Additionally, the effect of water on the synthesis by chemical combustion was studied. Simultaneously, and with the purpose of comparing the advantages and disadvantages of the method by chemical combustion, barium carbonate was synthesized by precipitation method using barium nitrate salts and sodium carbonate. Synthesized barium carbonate, was characterized by X-ray diffraction, thermal gravimetric analysis, infrared spectrometry and scanning electron microscopy. We studied the adsorption capacity of Co present in aqueous solution by static tests on materials synthesized at room temperature using the neutron activation analysis. It was found that the synthesis by chemical combustion provides an interesting alternative compared to the synthesis by precipitation because it offers simplicity of synthesis and speed to have a good adsorbent material. It was found that the barium carbonate synthesized by the chemical combustion method using in their synthesis 1.0 ml of water, was the one who achieved the maximum adsorption capacity of 95.6% compared with the barium carbonate prepared by precipitation, which reached a capacity adsorption of 51.48%. (Author)

  11. Accelerating the transit time of barium sulphate suspensions in small bowel examinations

    International Nuclear Information System (INIS)

    Purpose: To determine whether hyperosmolar and effervescent agents proven individually to accelerate transit time in the barium small bowel examination have an additive effect when combined, surpassing that of either agent alone. Materials and methods: One hundred and forty-nine patients were randomised to four groups. Three hundred milliliters of barium sulphate alone was given to the first group. Fifteen milliliters of iodinated hyperosmolar contrast agent (Gastrografin, meglumine/sodium diatrizoate, Schering) was given in addition to barium sulphate to the second group while six packets of effervescent granules (Carbex, Ferring) were added for the third group. The final group was given a combination of both additives and barium sulphate. The time taken following ingestion for the contrast column to reach the caecum, as assessed by frequent interval fluoroscopy, was recorded. A subgroup of 32 patients were selected randomly from the four groups, 8 from each and assessed for quality of examination. Statistical assessments were made using Kruskal-Wallis and Mann-Whitney tests. Results: One hundred and nineteen patients were analysed after exclusions. The addition of accelerant to barium sulphate, both individually and in combination significantly reduced the small bowel transit time (p < 0.001). No significant difference existed between the additives when used with barium alone. The combined group had significantly faster transit times compared to the hyperosmolar group (p = 0.02). Differences between combined and effervescent groups tended towards significance (p = 0.09). No significant difference existed between groups when examination quality was assessed. Conclusion: These results suggest that the addition of combined effervescent and hyperosmolar agents to the barium suspension may significantly shorten the small bowel transit time without adversely affecting examination quality. This has implications for patient acceptability of the examination as well as

  12. An 8-year review of barium studies in the diagnosis of gastroparesis

    Energy Technology Data Exchange (ETDEWEB)

    Levin, A.A. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States); Levine, M.S. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)], E-mail: marc.levine@uphs.upenn.edu; Rubesin, S.E.; Laufer, I. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)

    2008-04-15

    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings.

  13. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, N.G. [University of Otago, Department of Radiology, Christchurch (New Zealand); Butler, A.P. [University of Otago, Department of Radiology, Christchurch (New Zealand); University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Scott, N.J.A. [University of Otago, Department of Medicine, Christchurch (New Zealand); Cook, N.J. [Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Butzer, J.S. [Karlsruhe Institute of Technology, Physics Department, Karlsruhe (Germany); Schleich, N. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Firsching, M. [Friedrich Alexander University, Physics Department, Erlangen (Germany); Grasset, R.; Ruiter, N. de [University of Canterbury, Hitlab NZ, Christchurch (New Zealand); Campbell, M. [European Organisation for Nuclear Research, Physics Section, Geneva (Switzerland); Butler, P.H. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand)

    2010-09-15

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 {mu}A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 {mu}m isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)

  14. High pressure–low temperature phase diagram of barium: Simplicity versus complexity

    International Nuclear Information System (INIS)

    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations

  15. Radiologic diagnosis of gastro-oesophageal reflux. Comparison of barium and low-density contrast medium

    Energy Technology Data Exchange (ETDEWEB)

    Fransson, S.G.; Soekjer, H.; Johansson, K.E.; Tibbling, L.

    It has been proposed that the high density of ordinary barium suspension may complicate the radiologic diagnosis of gastro-oesophageal reflux. For this reason P-contrast was developed (Ferring AB); a contrast medium with the same density as water (1 g/cm/sup 3/). A comparison of P-contrast and barium (Mixobar Ventrikel 400 mg/ml) was performed in 82 patients. All patients were examined with both contrast media and the findings were compared with those at reflux test at manometry, endoscopy and 24-hour pH monitoring. Another 40 patients and 15 symptom-free controls were examined with two different amounts of barium, 100 ml and 200 ml, to study if the radiologic diagnosis of reflux varied with the volume of contrast medium administered. P-contrast was found to have no advantages over barium for the diagnosis of gastro-oesophageal reflux. The outcome of the radiologic examination was not influenced by the different volumes of barium used.

  16. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    International Nuclear Information System (INIS)

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 μA). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 μm isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)

  17. High pressure–low temperature phase diagram of barium: Simplicity versus complexity

    Energy Technology Data Exchange (ETDEWEB)

    Desgreniers, Serge [Laboratoire de Physique des Solides Denses, Université d' Ottawa, Ottawa, Ontario K1N 6N5 (Canada); Tse, John S., E-mail: John.Tse@usask.ca [Department of Physics and Engineering Physics, University of Saskatchewan, Saskatoon, Saskatchewan S7N 5B2 (Canada); State Key Laboratory of Superhard Materials, Jilin University, 130012 Changchun (China); Matsuoka, Takahiro [SPring-8/JASRI, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); Department of Electrical, Electronic and Computer Engineering, Gifu University, 1-1 Yanagido, Gifu 501-1193 (Japan); Ohishi, Yasuo [SPring-8/JASRI, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); Li, Quan; Ma, Yanming [State Key Laboratory of Superhard Materials, Jilin University, 130012 Changchun (China)

    2015-11-30

    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations.

  18. High pressure-low temperature phase diagram of barium: Simplicity versus complexity

    Science.gov (United States)

    Desgreniers, Serge; Tse, John S.; Matsuoka, Takahiro; Ohishi, Yasuo; Li, Quan; Ma, Yanming

    2015-11-01

    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations.

  19. Benefits of Barium Enema in Patients with Incomplete Colonoscopy. Prospective Study of 45 Cases

    International Nuclear Information System (INIS)

    To evaluate the usefulness of barium enema in patients with incomplete colonoscopy. There was carried out a prospective 10-month study of 45 patients with incomplete colonoscopy (27 men and 18 women), who were later examined by means of barium enema (33 conventional, 12 double-contrast) in order to check for additional pathology in portions of the colon not visualized by colonoscopy. Barium enema diagnosed six possible additional lesions (13.3%) in portions of the colon not visualized by incomplete colonoscopy (four neoplasia and two non-neoplasia). Regarding the neoplasia two were true positives and two false positives. Both true positives were adenocarcinomas (one synchronous caecum, and another in splenic angle). The two false positives corresponded to fecal matter stuck to the intestinal wall. Regarding the non-neoplasia, multiple stenosis was detected in a patient with Crohn's disease and an enterocolic fistula was found in a patient with sigmoid colon neoplasia. The diagnostic yield of barium enema in the detection of additional pathology in colon portions not visualized by colonoscopy was of 9%. Barium enema following incomplete colonoscopy permits a complete colon evaluation in most cases, and it offers additional diagnostic information. (Author) 21 refs

  20. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    International Nuclear Information System (INIS)

    Barium can be found in waters up to 1 mg L-1 and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L-1 and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  1. Hydro-MRI with fast sequences in Crohn's disease: Comparison with barium studies

    International Nuclear Information System (INIS)

    Purpose: To compare the value of hydro-MRI with that of barium studies in patients with Crohn's disease. Materials and methods: After an oral bowel opacification using 1000 ml of a 2.5% mannitol solution, axial and coronal breathhold sequences (T2W HASTE±FS, contrast-enhanced T1W FLASH FS) were acquired in 46 patients with Crohn's disease at 1,0 T. The findings of hydro-MRI were compared with those of barium studies. Results: In the stomach and the small bowel, hydro-MRI and barium studies demonstrated similar numbers of Crohn's involvements (39 vs. 36); in the colon, hydro-MRI showed clearly more affections (23 vs. 10). Hydro-MRI showed 12.7 cm of inflamed bowel per patient, on average (barium studies: 10,4 cm; p=0,004). There was a good agreement between the two methods regarding the assessment of the extent of Crohn's disease and the severity of bowel stenoses (r=0.89 and 0.88, respectively). Conclusions: For the assessment of Crohn's disease, hydro-MRI is preferable to the barium study because of the superior imaging quality and the lack of radiation exposure. (orig.)

  2. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    Energy Technology Data Exchange (ETDEWEB)

    Matoso, Erika, E-mail: ematoso@hotmail.com [Centro Tecnologico da Marinha em Sao Paulo (CEA/CTMS), Ipero, SP (Brazil). Centro Experimental Aramar; Cadore, Solange, E-mail: cadore@iqm.unicamp.br [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Quimica. Departamento de Quimica Analica

    2015-07-01

    Barium can be found in waters up to 1 mg L{sup -1} and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L{sup -1} and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  3. Dicty_cDB: SHA130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hnqrnsfqnkeinqe*qlilivy*lcqfnvvqdmny y*gkf*ntlkrimlnlkilkvlmnqskilisilmieremliieqny*sykkklkmhqn*l nlidilleshnvis...yyn*ynqc*ylwl**f*ntftntikysi cny*flgl*stttttttttisi**siiinhkynlq*sinnnnniitnkykhnl**siish kykl***kfmgi*sinl**lii...613_1( AF402613 |pid:none) Mus musculus actin-binding protein... 110 1e-22 AB173388_1( AB173388 |pid:none) Macaca fascicularis...SH (Link to library) SHA130 (Link to dictyBase) - - - Contig-U11515-1 SHA130P (Link to Original si... ikgnfkthsrgsc*i*ky*kcl*inqry**vy***kekc***skiirvtkrn*kctrin* is*

  4. Decay pattern of the Pygmy dipole resonance in 130Te

    International Nuclear Information System (INIS)

    The electric dipole strength distribution in 130Te has been investigated using the method of Nuclear Resonance Fluorescence. The experiments were performed at the Darmstadt High Intensity Photon Setup using Bremsstrahlung as photon source and at the High Intensity γ-Ray Source, where quasi-monochromatic and polarized photon beams are provided. Average decay properties of 130Te below the neutron separation energy are determined. Comparing the experimental data to the predictions of the statistical model indicate, that nuclear structure effects play an important role even at sufficiently high excitation energies. Preliminary results will be presented. (authors)

  5. Experiences of the First 130 Patients in Gangnam Severance Hospital

    International Nuclear Information System (INIS)

    We are trying to analyze 130 patients' conditions by using our Helical Tomotherapy, which was installed in our center in Oct. 2007. We will be statistically approach this examination and analyze so that we will be able to figure out adaptive plans according to the change in place of the tumor, GTV (gross tumor volume), total amount of time it took, vector (υ=√x2+y2+z2) and the change in size of the tumor. Objectives were the patients who were medicated with Tomotherapy in our medical center since Oct. 2007 August 2008. The Average age of the patients were 53 years old (Minimum 25 years old, Maximum 83 years old). The parts of the body we operated were could be categorized as Head and neck (n=22), Chest (n=47), Abdomen (n=25), Pelvis (n=11), Bone (n=25). MVCT had acted on 2702 times, and also had acted on our adaptive plan toward patients who showed big difference in the size of tumor. Also, after equalizing our gained MVCT and kv-CT we checked up on the range of possible mistake, using x, y, z, roll and vector. We've also investigated on Set-up, MVCT, average time of operation and target volume. Mean time on table was 22.8 minutes. Mean treatment time was 13.26 minutes. Mean correction (mm) was X=-0.7, Y=-1.4, Z=5.77, roll=0.29, vector=8.66 Head and neck patients had 2.96 mm less vector value in movement than patients of Chest, Abdomen, Bone. In increasing order, Head and neck, Bone, Abdomen, Chest, Pelvis showed the vector value in movement. Also, there were 27 patients for adaptive plan, 39 patients, who had long or multiple tumor. We could know that When medical treatment is one cure plan, it takes 32 minutes, and when medical treatment is two cure plan, it takes 40 minutes that one medical treatment takes 21 minutes, and the other medical treatment takes 19 minutes. With our basic tools, we could bring more accurate IMRT with MVCT. Also, through our daily image, we checked up on the change in tumor so that adaptive plan could work. It was made it possible to

  6. Down-regulation of miR-130a Expression in Medulloblastoma and Its Function Prediction%miR-130a在髓母细胞瘤中的表达下调及其功能预测

    Institute of Scientific and Technical Information of China (English)

    胡官霞; 夏之柏; 朱斌

    2011-01-01

    目的 初步筛选髓母细胞瘤中差异表达显著的微RNA(miRNA)并探求其生物学功能.方法 应用基因芯片获得差异表达的miRNAs,对其中差异显著的目的miRNA行实时定量PCR验证,再利用生物信息学方法预测其潜在靶基因以及靶基因所富集的生物学通路.结果 miR-130a在髓母细胞瘤中显著下调,生物信息学分析表明,血小板衍生的生长因子受体α(PDGFRA)为其靶基因,且该基因与Ras/MAPK通路有关.结论 Ras/MAPK通路在髓母细胞瘤中上调,可能是miR-130a下调引起PDGFRA上调所致.%Objective To find the significant differentially expressed microRNAs in medulloblastoma and investigate their biological function. Methods Differentially expressed microRNAs were found by gene chips, and miR-130a was selected and verified using real-time quantitative PCR, then its potential target genes and their enriched biological pathways were predicted by bioinformatics softwares. Results miR-130a was down-regulated obviously in medulloblastoma. Bioinformatics analysis indicated that its target gene PDGFRA was involved in Ras/MAPK signaling pathway. Conclusion Down-regulation of miR-130a induced the up-regulation of PDGFRA, which might be the reason for up-regulation of Ras/MAPK signaling pathway in medulloblastoma.

  7. FIRST DIRECT EVIDENCE THAT BARIUM DWARFS HAVE WHITE DWARF COMPANIONS

    International Nuclear Information System (INIS)

    Barium II (Ba) stars are chemically peculiar F-, G-, and K-type objects that show enhanced abundances of s-process elements. Since s-process nucleosynthesis is unlikely to take place in stars prior to the advanced asymptotic giant branch (AGB) stage, the prevailing hypothesis is that each present Ba star was contaminated by an AGB companion which is now a white dwarf (WD). Unless the initial mass ratio of such a binary was fairly close to unity, the receiving star is thus at least as likely to be a dwarf as a giant. So although most known Ba stars appear to be giants, the hypothesis requires that Ba dwarfs be comparably plentiful and moreover that they should all have WD companions. However, despite dedicated searches with the IUE satellite, no WD companions have been directly detected to date among the classical Ba dwarfs, even though some 90% of those stars are spectroscopic binaries, so the contamination hypothesis is therefore presently in some jeopardy. In this paper, we analyze recent deep, near-UV and far-UV Galaxy Evolution Explorer (GALEX) exposures of four of the brightest of the class (HD 2454, 15360, 26367, and 221531), together with archived GALEX data for two newly recognized Ba dwarfs: HD 34654 and HD 114520 (which also prove to be spectroscopic binaries). The GALEX observations of the Ba dwarfs as a group show a significant far-UV excess compared to a control sample of normal F-type dwarfs. We suggest that this ensemble far-UV excess constitutes the first direct evidence that Ba dwarfs have WD companions.

  8. Electrical properties of niobium doped barium bismuth-titanate ceramics

    International Nuclear Information System (INIS)

    Highlights: ► Pure and doped BaBi4Ti4O15 were prepared via the solid-state reaction method. ► The grain size was suppressed in Nb-doped samples. ► The diffuseness of the dielectric peak increased with dopant concentration. ► Niobium affected on relaxor behavior of barium bismuth titanate ceramics. ► The conductivity change was noticed in doped samples. -- Abstract: BaBi4Ti4–5/4xNbxO15 (BBNTx, x = 0, 0.05, 0.15, 0.30) ceramics have been prepared by solid state method. XRD data indicate the formation of single-phase-layered perovskites for all compositions. SEM micrographs suggest that the grain size decreases with Nb doping. The effect of niobium doping on the dielectric and relaxor behavior of BaBi4Ti4O15 ceramics was investigated in a wide range of temperatures (20–777 °C) and frequencies (1.21 kHz to 1 MHz). Nb doping influences Tc decrease as well as the decrease of dielectric permittivity at Curie temperature. At room temperature, undoped BaBi4Ti4O15 exhibits dielectric constant of ∼204 at 100 kHz, that slightly increases with Nb doping. The conductivity of BBNT5 ceramics is found to be lower than that of other investigated compositions. The value of activation energy of σDC was found to be 0.89 eV, 1.01 eV, 0.93 eV and 0.71 eV for BBT, BBNT5, BBNT15 and BBNT30, respectively.

  9. Electrical properties of niobium doped barium bismuth-titanate ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Bobić, J.D., E-mail: jelenabobic@yahoo.com [Institute for Multidisciplinary Researches, Belgrade University, Kneza Viseslava 1, Belgrade (Serbia); Vijatović Petrović, M.M. [Institute for Multidisciplinary Researches, Belgrade University, Kneza Viseslava 1, Belgrade (Serbia); Banys, J. [Faculty of Physics, Vilnius University, 9 Sauletekio Str., Vilnius (Lithuania); Stojanović, B.D. [Institute for Multidisciplinary Researches, Belgrade University, Kneza Viseslava 1, Belgrade (Serbia)

    2012-08-15

    Highlights: ► Pure and doped BaBi{sub 4}Ti{sub 4}O{sub 15} were prepared via the solid-state reaction method. ► The grain size was suppressed in Nb-doped samples. ► The diffuseness of the dielectric peak increased with dopant concentration. ► Niobium affected on relaxor behavior of barium bismuth titanate ceramics. ► The conductivity change was noticed in doped samples. -- Abstract: BaBi{sub 4}Ti{sub 4–5/4x}Nb{sub x}O{sub 15} (BBNTx, x = 0, 0.05, 0.15, 0.30) ceramics have been prepared by solid state method. XRD data indicate the formation of single-phase-layered perovskites for all compositions. SEM micrographs suggest that the grain size decreases with Nb doping. The effect of niobium doping on the dielectric and relaxor behavior of BaBi{sub 4}Ti{sub 4}O{sub 15} ceramics was investigated in a wide range of temperatures (20–777 °C) and frequencies (1.21 kHz to 1 MHz). Nb doping influences T{sub c} decrease as well as the decrease of dielectric permittivity at Curie temperature. At room temperature, undoped BaBi{sub 4}Ti{sub 4}O{sub 15} exhibits dielectric constant of ∼204 at 100 kHz, that slightly increases with Nb doping. The conductivity of BBNT5 ceramics is found to be lower than that of other investigated compositions. The value of activation energy of σ{sub DC} was found to be 0.89 eV, 1.01 eV, 0.93 eV and 0.71 eV for BBT, BBNT5, BBNT15 and BBNT30, respectively.

  10. EPR dosimetric properties of nano-barium sulfate

    International Nuclear Information System (INIS)

    Nano/micro BaSO4 were prepared through the co-precipitation method to measure ionizing radiation doses using electron paramagnetic resonance (EPR). The nano-BaSO4 sample was characterized using X-ray diffraction (XRD), and transmission electron microscopy (TEM) techniques. The dose response and fading properties of nano- and micro-phase BaSO4 were compared in EPR spectra. The prepared nano- and micro-BaSO4 samples have the same hole and electron centers, which may be attributed to SO4− and SO3−, respectively. The dosimetric signals for prepared nano- and micro-BaSO4 have spectroscopic splitting factor (g) with values 2.0025±0.0006 and 2.0027±0.0006, respectively. The nanocrystalline sample has a linear γ-ray dose response over the range 0.4 Gy–1 kGy. The performance parameters which including detection limit and critical level calculated from weighted and unweighted least-squares fitting. The sensitivity of nano-BaSO4 to γ-ray is one and a half times more than alanine. The lifetime and activation energy for nano-BaSO4 were estimated by conducting a thermal stability study, and were 5.7±1.1×104 years and 0.73±0.14 eV, respectively. The combined and expanded uncertainties accompanying measurements were ±3.89% and ±7.78%, respectively. - Highlights: • Preparation of nano-BaSO4 using the co-precipitation method. • Study of the dosimetric properties of nano-barium sulfate using the EPR technique. • Comparison between a new EPR dosimeter using nano-materials and standard alanine. • Calculation of the uncertainty budget for nano-BaSO4

  11. Radiation doses to children during modified barium swallow studies

    Energy Technology Data Exchange (ETDEWEB)

    Weir, Kelly A. [University of Queensland, Discipline of Paediatrics and Child Health, School of Medicine, Herston, Queensland (Australia); McMahon, Sandra M. [SpeechNet Speech Pathology Services, Brisbane (Australia); Long, Gillian; Bunch, Judith A. [Royal Children' s Hospital, Department of Medical Imaging, Herston (Australia); Pandeya, Nirmala [Queensland Institute of Medical Research, Herston (Australia); Coakley, Kerry S. [Biomedical Technology Services, Royal Brisbane and Women' s Hospital, Herston (Australia); Chang, Anne B. [Royal Children' s Hospital, Department of Respiratory Medicine, Herston (Australia)

    2007-03-15

    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 {+-} 0.0544 mSv, screening time 2.48 {+-} 0.81 min, and DAP 28.79 {+-} 41.72 cGy cm{sup 2}. Significant differences were found across three age groups ({<=}1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P = 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)

  12. Radiation doses to children during modified barium swallow studies

    International Nuclear Information System (INIS)

    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 ± 0.0544 mSv, screening time 2.48 ± 0.81 min, and DAP 28.79 ± 41.72 cGy cm2. Significant differences were found across three age groups (≤1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)

  13. TWO BARIUM STARS IN THE OPEN CLUSTER NGC 5822

    International Nuclear Information System (INIS)

    Open clusters are very useful examples to explain the constraint of the nucleosynthesis process with the luminosities of stars because the distances of the clusters are better known than those of field stars. We carried out a detailed spectroscopic analysis to derive the chemical composition of two red giants in the young open cluster NGC 5822, NGC 5822-2, and NGC 5822-201. We obtained abundances of C, N, O, Na, Mg, Al, Ca, Si, Ti, Ni, Cr, Y, Zr, La, Ce, and Nd. The atmospheric parameters of the studied stars and their chemical abundances were determined using high-resolution optical spectroscopy. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. The abundances of the light elements were derived using the spectral synthesis technique. We found that NGC 5822-2 and -201 have, respectively, a mean overabundance of the elements created by the s-process, ''s'', with the notation [s/Fe] of 0.77 ± 0.12 and 0.83 ± 0.05. These values are higher than those for field giants of similar metallicity. We also found that NGC 5822-2 and -201 have, respectively, luminosities of 140 L☉ and 76 L☉, which are much lower than the luminosity of an asymptotic giant branch star. We conclude that NGC 5822-2 and NGC 5822-201 are two new barium stars first identified in the open cluster NGC 5822. The mass transfer hypothesis is the best scenario to explain the observed overabundances

  14. Synthesis and thermionic properties of tungsten–barium titanate composites

    International Nuclear Information System (INIS)

    Highlights: • W–BaTiO3 composites were readily synthesized using standard sintering methods. • Compositions in the range 20–80% by mass were studied. • The microstructure of the composites comprises W, BaTiO3, Ba4Ti12O27 and BaW04. • The Richardson work function was reduced from 4.5 eV for W to as little as 2.67 eV. • Post-emission surfaces were coated in a thin layer of Ba4Ti12O27 and BaW04. - Abstract: The potential of novel tungsten–barium titanate composites as thermionic emitters is explored. Composites ranging from 20% to 80% tungsten by mass were prepared by sintering in an Ar–H2 atmosphere. XRD and SEM studies indicate four major micro-constituents; W, BaTiO3, Ba4(Ti,Fe)12O27 and BaWO4. Richardson work functions (φR) and Richardson constants (AR) were determined using a Schottky diode arrangement at temperatures ranging from 1223 to 1473 K. Work functions ranged from 2.67 eV to 3.32 eV with a shallow minimum at 40% by mass W and were relatively constant (∼2.7–2.8 eV) in the range 30–70% by mass W. The decrease in work function was accompanied by a strong decrease in AR from 39.3 A cm−2 K−2 to 0.02 A cm−2 K−2 over the range 20–70% by mass W. The reduction in both φR and AR was associated with the major conversion of the surface to BaWO4 and Ba4Ti12O27 during the activation treatment before emission testing

  15. TWO BARIUM STARS IN THE OPEN CLUSTER NGC 5822

    Energy Technology Data Exchange (ETDEWEB)

    Katime Santrich, O. J.; Pereira, C. B.; De Castro, D. B., E-mail: osantrich@on.br, E-mail: claudio@on.br, E-mail: denise@on.br [Observatorio Nacional/MCT, Rua Gen. Jose Cristino, 77, 20921-400 Rio de Janeiro (Brazil)

    2013-08-01

    Open clusters are very useful examples to explain the constraint of the nucleosynthesis process with the luminosities of stars because the distances of the clusters are better known than those of field stars. We carried out a detailed spectroscopic analysis to derive the chemical composition of two red giants in the young open cluster NGC 5822, NGC 5822-2, and NGC 5822-201. We obtained abundances of C, N, O, Na, Mg, Al, Ca, Si, Ti, Ni, Cr, Y, Zr, La, Ce, and Nd. The atmospheric parameters of the studied stars and their chemical abundances were determined using high-resolution optical spectroscopy. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. The abundances of the light elements were derived using the spectral synthesis technique. We found that NGC 5822-2 and -201 have, respectively, a mean overabundance of the elements created by the s-process, ''s'', with the notation [s/Fe] of 0.77 {+-} 0.12 and 0.83 {+-} 0.05. These values are higher than those for field giants of similar metallicity. We also found that NGC 5822-2 and -201 have, respectively, luminosities of 140 L{sub Sun} and 76 L{sub Sun }, which are much lower than the luminosity of an asymptotic giant branch star. We conclude that NGC 5822-2 and NGC 5822-201 are two new barium stars first identified in the open cluster NGC 5822. The mass transfer hypothesis is the best scenario to explain the observed overabundances.

  16. Study of precipitation processes of strontium and barium nitrates in mixtures of water-with dimethylformamide and dimethylsulfoxide

    International Nuclear Information System (INIS)

    The investigation into phase equilibriums diagrams in the barium (strontium) nitrate-water-dimethylsulfoxide and barium nitrate-water dimethylformamide systems has been pursued at 298, 15 K for the estimation of outlook for use of mixed aqua-organic solvents during the production of mixture form high temperature superconductors by means of coprecipitation or crystallization. 4 refs., 3 figs., 2 tabs

  17. Chlorides retention of barium and chromium in two mangrove species Avicennia germinans and Rhizophora mangrove, developed in waters of the oil industry production, by means of the technique of hydroponics cultivation

    International Nuclear Information System (INIS)

    The objective of the present study was to determine the phytoremediation mechanism (phytoextraction y/o rhizofiltration) given by the mangroves Rhizophora mangle and Avicennia germinans, when exposed to waters from an oil production field applying the hidroponia technique like system for growing the species. Determination of chlorides, barium and chromium bioaccumulation in tissues of mangrove species under study was compared with content of these elements in an inert substrate without mangroves. Bioaccumulation of the targeted elements was measured after 308 days exposure of the mangroves to production waters with initial barium and chromium contents of 1.25 g.m-3 and 0.002 g.m-3 respectively, and salinity in the range of 2,000 to 3,000 mg.kg-1. Bioaccumulation of the studied elements (chlorides, barium and chromium) in tissues of both species was correlated to the increment in biomass of each species, as well as to the general physical condition of the plants. Survival rates higher than 95% of the exposed plants to production water during the time of study, increment in biomass of up to 5.88 g.day-1, and concentrations of chlorides in tissues in the 0 - 170,000 mg.kg-1 during the considered period were observed. No significant difference between the two mangrove species was obtained. Bioaccumulation in tissues does not cause symptoms of deficiency in growing rates in the studied plants compared to natural rate indexes. Similarly, the analyses of inert substrate around the mangrove roots showed chloride and barium concentrations, contrary to the results of the targeted elements in the inert substrate when mangroves are not present. Both phytoremediation mechanisms were observed for the two mangrove species

  18. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    CERN Document Server

    Mong, B; Walton, T; Chambers, C; Craycraft, A; Benitez-Medina, C; Hall, K; Fairbank, W; Albert, J B; Auty, D J; Barbeau, P S; Basque, V; Beck, D; Breidenbach, M; Brunner, T; Cao, G F; Cleveland, B; Coon, M; Daniels, T; Daugherty, S J; DeVoe, R; Didberidze, T; Dilling, J; Dolinski, M J; Dunford, M; Fabris, L; Farine, J; Feldmeier, W; Fierlinger, P; Fudenberg, D; Giroux, G; Gornea, R; Graham, K; Gratta, G; Heffner, M; Hughes, M; Jiang, X S; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krucken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Moore, D; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Retiere, F; Rowson, P C; Rozo, M P; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Twelker, K; Vuilleumier, J -L; Walton, J; Weber, M; Wen, L J; Wichoski, U; Yang, L; Yen, Y -R; Zhao, Y B

    2014-01-01

    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fluorescence quantum efficiency of the principal Ba emission transition are reported. Under current conditions, an image of $\\le10^4$ Ba atoms can be obtained. Prospects for imaging single Ba atoms in solid xenon are discussed.

  19. Synthesis and Characterization of Barium-Vanadium Oxide Nanocomposite Using a Facile thermolysis Approach

    Directory of Open Access Journals (Sweden)

    Niloufar Akbarzadeh-T

    2015-12-01

    Full Text Available In this investigation, we report synthesis of new cationic-anionic Barium-Vanadium complex with 2, 6- pyridinedicarboxylic acid ligand. This compound [Ba(H2O8][VO2(dipic]2(1 has been characterized using elemental analyses, FT-IR, UV–Vis and Cyclic voltammetry (CV techniques. Also in this study we report facile synthesis of Barium-Vanadium Oxide nanoparticle under thermal decomposition, using precursor complex (1. Characterization of Barium-Vanadium Oxide nanocomposites was carried out by scanning electron microscopy (SEM, energy dispersive X-ray analysis (EDX, X-ray powder diffraction (XRD and Fourier transform infrared (FT-IR spectroscopy. The X-ray diffraction pattern at room temperature revealed that, highly pure and crystallized Ba3(VO42 with rhombohedral structure.

  20. CuO and Ag2O effect on electrical properties of barium vanadate glasses

    International Nuclear Information System (INIS)

    Effect of CuO on barium vanadate glass (BVG) conductivity on direct and alternating currents in the frequency range (102-104)Hz has been studied. Effect of Ag2O has been also studied for comparison, as Ag and Cu have idendical structure of external electron shells (d10, S1). CuO introduction to binary barium vanadate glasses as a modificator results in the conductivity improvement on direct and alternating currents conditioned with reducing activation energy of small radius polaron jump, apparently, owing to exchange (ferromagnetic) interaction between V(IV) and Cu(II). Jump activation energy in barium vanadate glasses with Ag2O increases and conductivity drops due to the distance increase between vanadium atoms

  1. The review of various synthesis methods of barium titanate with the enhanced dielectric properties

    Science.gov (United States)

    More, S. P.; Topare, R. J.

    2016-05-01

    The Barium Titanate is a very well known dielectric ceramic belongs to perovskite structure. It has very wide applications in the field of electronic, electro ceramic, electromechanical and electro-optical applications. Barium Titanate has very high dielectric constant as well as low dielectric loss. Substituted dielectrics are one of the most important technological compounds in modern electro ceramics. Its electrical properties can be tuned flexibly by a simple substitution technique. This has encouraged researchers to select a typical cation to be substituted at cationic sites. In the present paper, the review of various synthesis methods of Barium Titanate compound with the effect of different dopants, the grain size on the dielectric properties at various temperatures is discussed.

  2. Plasma irregularities caused by cycloid bunching of the CRRES G-2 barium release

    Science.gov (United States)

    Bernhardt, P. A.; Huba, J. D.; Pongratz, M. B.; Simons, D. J.; Wolcott, J. H.

    1993-01-01

    The Combined Release and Radiation Effects Satellite (CRRES) spacecraft carried a number of barium thermite canisters for release into the upper atmosphere. The barium release labeled G-2 showed evidence of curved irregularities not aligned with the ambient magnetic field B. The newly discovered curved structures can be explained by a process called cycloid bunching. Cycloid bunching occurs when plasma is created by photoionization of a neutral cloud injected at high velocity perpendicular to B. If the injection velocity is much larger than the expansion speed of the cloud, the ion trail will form a cycloid that has irregularities spaced by the product of the perpendicular injection speed and the ion gyroperiod, Images of the solar-illuminated barium ions are compared with the results of a three-dimensional kinetic simulation. Cycloid bunching is shown to be responsible for the rapid generation of both curved and field-aligned irregularities in the CRRES G-2 experiment.

  3. Highly aligned arrays of high aspect ratio barium titanate nanowires via hydrothermal synthesis

    International Nuclear Information System (INIS)

    We report on the development of a hydrothermal synthesis procedure that results in the growth of highly aligned arrays of high aspect ratio barium titanate nanowires. Using a multiple step, scalable hydrothermal reaction, a textured titanium dioxide film is deposited on titanium foil upon which highly aligned nanowires are grown via homoepitaxy and converted to barium titanate. Scanning electron microscope images clearly illustrate the effect the textured film has on the degree of orientation of the nanowires. The alignment of nanowires is quantified by calculating the Herman's Orientation Factor, which reveals a 58% improvement in orientation as compared to growth in the absence of the textured film. The ferroelectric properties of barium titanate combined with the development of this scalable growth procedure provide a powerful route towards increasing the efficiency and performance of nanowire-based devices in future real-world applications such as sensing and power harvesting

  4. TiO2 ceramic varistor modified with tantalum and barium

    International Nuclear Information System (INIS)

    The non-linear current (I)-voltage (V) characteristics of titanium dioxide doped with small quantities of tantalum and barium (99.9 TiO2 + 0.1 Ta and 99.4 TiO2 + 0.1 Ta + 0.5 Ba, all are in at.%) were investigated. These samples have the non-linear coefficient (α) values of (20-30) with high breakdown voltages (E B ∼ 400-700 V mm-1). The pentavalent tantalum acts as donor and increases the electronic conductivity. The higher electrical conductivity and decrease in the breakdown field strength with barium addition is attributed to higher density. The acceptor like surface states formed by barium ions segregate to grain boundaries due size misfit to thereby modifying the electrical barrier characteristics of grain boundaries

  5. Prompt ionization in the CRIT II barium releases. [Critical Ionization Tests

    Science.gov (United States)

    Torbert, R. B.; Kletzing, C. A.; Liou, K.; Rau, D.

    1992-01-01

    Observations of electron and ion distributions inside a fast neutral barium jet in the ionosphere show significant fluxes within 4 km of release, presumably related to beam plasma instability processes involved in the Critical Ionization Velocity (CIV) effect. Electron fluxes exceeding 5 x 10 exp 12/sq cm-str-sec-keV were responsible for ionizing both the streaming barium and ambient oxygen. Resulting ion fluxes seem to be consistent with 1-2 percent ionization of the fast barium, as reported by optical observations, although the extended spatial distribution of the optically observed ions is difficult to reconcile with the in situ observations. When the perpendicular velocity of the neutrals falls below critical values, these processes shut off. Although these observations resemble the earlier Porcupine experimental results (Haerendel, 1982), theoretical understanding of the differences between these data and that of earlier negative experiments is still lacking.

  6. Unexpected finding of barium sulphate on the surface of a microspinal catheter

    International Nuclear Information System (INIS)

    During a study with a scanning electron microscope to evaluate the structure of microspinal catheter after its removal from subarachnoid space, we found an unusual case. The observation with the microscope of the tip of a catheter removed at the end of an operation for hip replacement in a old female showed the presence of grounded particles with a crystal shape covering the outer surface. Further analysis of this material with an Energy-Dispersive Spectrometer (EDS) showed that it was barium. The patient performed a large bowel barium enema 8 months earlier for a painful syndrome to the lower abdomen. Authors rule out the contamination from the skin and suggest two possible mechanisms of passage of barium from blood to cerebrospinal fluid (CSF) and so to the surface of the catheter

  7. Barium sulphate preparations for use in double contrast examination of the upper gastrointestinal tract

    International Nuclear Information System (INIS)

    Physical properties relevant to upper gastrointestinal radiology have been compared for five barium sulphate preparations and related to radiographic results. Evaluation of particles (size and stability) and whole suspension (dispersibility and fluidity) resulted in ranking of the preparations generally in accord with that based on radiological experience in double contrast examinations of the stomach. Experiments with extirpated pig stomach revealed a tendency for large particles in a low viscosity barium sulphate suspension to settle in mucosal grooves. This is believed to contribute to good radiographic definition of both the areae gastricae and small lesions. Particle size is therefore important and susceptibility to flocculation, a possible cause of random change in size during use, was assessed by measuring particle electrophoretic mobility under varying conditions; quantitative differences in suspension flow and dispersibility were also demonstrated. Fluidity and dispersibility together with rapid sedimentation of suitably sized particles resistant to flocculation underlie the successful use of low viscosity high density barium sulphate suspensions. (U.K.)

  8. Barium and strontium sulfate solid solution formation in relation to North Sea scaling problems

    International Nuclear Information System (INIS)

    This paper presents the results of laboratory experiments carried out to investigate barium sulphate and strontium sulphate solid solution formation in multi-pressure tapped cores. Two brines, one barium and strontium rich and the other sulphate rich, were mixed in a core plug. Pressure differentials were measured and the changing permeability distribution along the length of the core calculated. The morphology and chemical analysis of scaling crystals are presented based on Scanning electron Microsocpy (SEM) and Energy Dispersive X-ray Analysis (EDAX). The results show the large extent of permeability damage caused by (Ba, SR) SO/sub 4/ solid solution depositing on the rock pore surface. The rock permeability decline and morphology and size of the scaling crystals indicate the influence of the supersaturations of BaSO/sub 4/ and SrSO/sub 4/ as well as the concentration ratio of barium ions to strontium ions

  9. Use of the barium enema in the diagnosis of necrotizing enterocolitis

    Energy Technology Data Exchange (ETDEWEB)

    Uken, P.; Smith, W.; Franken, E.A.; Frey, E.; Sato, Y.; Ellerbroek, C.

    1988-01-01

    Necrotizing enterocolitis (NEC) is associated with considerable morbidity and mortality in infants. The diagnosis relies heavily upon radiographic and clinical features. Failure to accurately diagnose NEC is associated with a risk of complications and death, however overdiagnosis also causes both morbidity and mortality as well as excessive medical costs. This report documents the use of barium enema to evaluate suspected clinical or radiographic NEC in 31 premature infants with ambiguous clinical and radiographic signs. The enema was normal in 26 infants and no treatment for NEC was given. Only one of these infants developed signs of NEC subsequent to the examination. Five infants had radiographic evidence of colitis including small ulcerations, spasm, intramural extravasation of barium and mucosal irregularity. Two of the five positive cases are pathologically documented. The barium enema can represent a significant improvement in the specificity of the diagnosis of NEC. Its greatest value is in the exclusion of NEC in ambiguous cases.

  10. L130-million cut to grants hits UK physical scientists

    CERN Multimedia

    Cressey, Daniel

    2008-01-01

    "UK physicists, still reeling from massive funding cuts announced earlier this year, have learnt of worse to come. Roughly L130 million (US$260 million)is being slashed from research grants awarded by the Engineering and Physical Scienes Research Council (EPSRC), it announced on 17 March." (2 pages)

  11. 32 CFR 1906.130 - General prohibitions against discrimination.

    Science.gov (United States)

    2010-07-01

    ... INTELLIGENCE AGENCY ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE CENTRAL INTELLIGENCE AGENCY § 1906.130 General prohibitions against discrimination. (a) No... benefit, to reach the same level of achievement as that provided to others; (iii) Provide a...

  12. High spin structure in {sup 130,131}Ba

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Navneet; Kumar, A.; Singh, Amandeep; Kumar, S.; Kaur, Rajbir; Singh, Varinderjit; Behera, B.R.; Singh, K.P.; Singh, G. [Panjab University, Department of Physics, Chandigarh (India); Mukherjee, G. [Variable Energy Cyclotron Centre, Kolkata (India); Sharma, H.P. [Banaras Hindu University, Department of Physics, Varanasi (India); Kumar, Suresh [Delhi University, Department of Physics and Astrophysics, Delhi (India); Kumar Raju, M.; Madhusudhan Rao, P.V. [Andhra University, Department of Nuclear Physics, Vishakapatnam (India); Muralithar, S.; Singh, R.P.; Kumar, Rakesh; Madhvan, N.; Bhowmik, R.K. [Inter University Accelrator Centre, New Delhi (India)

    2014-01-15

    High spin states of {sup 130,131}Ba have been investigated via fusion evaporation reactions {sup 122}Sn({sup 13}C,4n){sup 131}Ba and {sup 122}Sn({sup 13}C, 5n){sup 130}Ba at E{sub beam}=65 MeV. The level schemes of {sup 130,131}Ba have been extended by placing several new {gamma} transitions. A few interband transitions connecting two negative-parity bands, which are the experimental fingerprints of signature partners, have been established in {sup 130}Ba. Spin and parity of a side band have been assigned in {sup 131}Ba and this dipole band is proposed to have a three-quasiparticle configuration, {nu}h{sub 11/2} x {pi}h{sub 11/2} x {pi}g{sub 7/2}. The observed band structures and nuclear shape evolution as a function of the angular momentum have been discussed in the light of Total-Routhian-Surface calculations. (orig.)

  13. 42 CFR 457.130 - Civil rights assurance.

    Science.gov (United States)

    2010-10-01

    ... Act of 1990, section 504 of the Rehabilitation Act of 1973, the Age Discrimination Act of 1975, 45 CFR part 80, part 84, and part 91, and 28 CFR part 35. ... 42 Public Health 4 2010-10-01 2010-10-01 false Civil rights assurance. 457.130 Section...

  14. 24 CFR 3.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Effect of employment opportunities... FEDERAL FINANCIAL ASSISTANCE Introduction § 3.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities...

  15. 22 CFR 229.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Effect of employment opportunities. 229.130... Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession are or may be...

  16. 14 CFR 1253.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Effect of employment opportunities. 1253... Introduction § 1253.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession...

  17. 28 CFR 54.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Effect of employment opportunities. 54... § 54.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession are...

  18. 10 CFR 1042.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Effect of employment opportunities. 1042.130 Section 1042... employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession are or may be more limited...

  19. 22 CFR 146.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Effect of employment opportunities. 146.130... Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession are or may be...

  20. 49 CFR 25.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Effect of employment opportunities. 25.130 Section... Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession are or may be...

  1. 31 CFR 28.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Effect of employment opportunities... Introduction § 28.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession...

  2. 15 CFR 8a.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Effect of employment opportunities. 8a... Introduction § 8a.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession...

  3. 13 CFR 113.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Effect of employment opportunities... Financial Assistance Introduction § 113.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in...

  4. 40 CFR 5.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Effect of employment opportunities. 5... Introduction § 5.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in any occupation or profession...

  5. 16 CFR 1500.130 - Self-pressurized containers: labeling.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Self-pressurized containers: labeling. 1500... § 1500.130 Self-pressurized containers: labeling. (a) Self-pressurized containers that fail to bear a...: warning—contents under pressure Do not puncture or incinerate container. Do not expose to heat or store...

  6. 49 CFR 572.130 - Incorporation by reference.

    Science.gov (United States)

    2010-10-01

    ... incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies of the materials may be inspected at NHTSA's Technical Reference Library, 400 Seventh Street SW., room 5109, Washington, DC, or at... 49 Transportation 7 2010-10-01 2010-10-01 false Incorporation by reference. 572.130 Section...

  7. 40 CFR 180.130 - Hydrogen Cyanide; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Hydrogen Cyanide; tolerances for... § 180.130 Hydrogen Cyanide; tolerances for residues. (a) General. A tolerance for residues of the insecticide hydrogen cyanide from postharvest fumigation as a result of application of sodium cyanide...

  8. 40 CFR 130.12 - Coordination with other programs.

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS WATER QUALITY PLANNING AND MANAGEMENT § 130.12 Coordination with other programs. (a) Relationship... Management (WQM) plan. Where a State has assumed responsibility for the administration of the permit program... planning functions, shall review each facility plan in its area for consistency with the approved WQM...

  9. 40 CFR 130.5 - Continuing planning process.

    Science.gov (United States)

    2010-07-01

    ... QUALITY PLANNING AND MANAGEMENT § 130.5 Continuing planning process. (a) General. Each State shall... Management (WQM) plans, including schedules for revision. (5) The process for assuring adequate authority for... the priority of permit issuance. (c) Regional Administrator review. The Regional Administrator...

  10. 24 CFR 964.130 - Election procedures and standards.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Election procedures and standards... § 964.130 Election procedures and standards. At a minimum, a resident council may use local election boards/commissions. The resident council shall use an independent third-party to oversee elections...

  11. Individual-specific transgenerational marking of fish populations based on a barium dual-isotope procedure.

    Science.gov (United States)

    Huelga-Suarez, Gonzalo; Moldovan, Mariella; Garcia-Valiente, America; Garcia-Vazquez, Eva; Alonso, J Ignacio Garcia

    2012-01-01

    The present study focuses on the development and evaluation of an individual-specific transgenerational marking procedure using two enriched barium isotopes, (135)Ba and (137)Ba, mixed at a given and selectable molar ratio. The method is based on the deconvolution of the isotope patterns found in the sample into four molar contribution factors: natural xenon (Xe nat), natural barium (Ba nat), Ba135, and Ba137. The ratio of molar contributions between Ba137 and Ba135 is constant and independent of the contribution of natural barium in the sample. This procedure was tested in brown trout ( Salmo trutta ) kept in captivity. Trout were injected with three different Ba137/Ba135 isotopic signatures ca. 7 months and 7 days before spawning to compare the efficiency of the marking procedure at long and short term, respectively. The barium isotopic profiles were measured in the offspring by means of inductively coupled plasma mass spectrometry. Each of the three different isotopic signatures was unequivocally identified in the offspring in both whole eggs and larvae. For 9 month old offspring, the characteristic barium isotope signatures could also be detected in the otoliths even in the presence of a high and variable amount of barium of natural isotope abundance. In conclusion, it can be stated that the proposed dual-isotope marking is inheritable and can be detected after both long-term and short-term marking. Furthermore, the dual-isotope marking can be made individual-specific, so that it allows identification of offspring from a single individual or a group of individuals within a given fish group. PMID:22103693

  12. Preparation and characterization of ZnSn-substituted barium ferrite thin films

    International Nuclear Information System (INIS)

    The preparation of ZnSn-substituted barium ferrite films by sputtering deposition was studied. The as-sputtered films were amorphous, and annealing at a minimum of 750 oC was required to crystallize the films, based on the X-ray diffraction analysis and the magnetic measurements. Scanning electron microscopy combined with energy-dispersive X-ray spectroscopic microanalysis confirmed that the films were single phase with the composition BaZnxSnxFe12-2xO19, x=0.2-0.3, and their thicknesses were 0.4-1.0 μm when annealed at 750-900 oC. Atomic and magnetic force microscopy studies showed no significant grain growth upon annealing and that the films consisted of single-domain grains forming interaction-cluster-type domains. The natural ferromagnetic resonance frequency was determined at around 4 GHz, together with substantial magnetic losses that make these films promising candidates for microwave absorbers. - Research highlights: → ZnSn-substituted barium ferrite films can be prepared with a sputtering-deposition followed by annealing at 750-900 oC. → The ZnSn-substituted barium ferrite films consist from magnetically coupled single-domain grains. → The ZnSn-substitution in barium ferrite films reduces the ferromagnetic resonance from 48 to 4 GHz. → The ZnSn-substituted barium ferrite films show large magnetic losses at 7-15 GHz. → The ZnSn-substituted barium ferrite films are suitable for microwave absorbers.

  13. Barium hydrogen phosphate/gelatin composites versus gelatin-free barium hydrogen phosphate: synthesis and characterization of properties.

    Science.gov (United States)

    Gashti, Mazeyar Parvinzadeh; Burgener, Matthias; Stir, Manuela; Hulliger, Jürg

    2014-10-01

    Recently, attention has been spent on crystal growth of phosphate compounds in gels for studying the mechanism of in vitro crystallization processes. Here, we present a gel-based approach for the synthesis of barium hydrogen phosphate (BHP) crystals using single and double diffusion techniques in gelatin. The composite crystals were compared with analytical grade BHP powder, single and polycrystalline BHP materials using Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), scanning pyroelectric microscopy (SPEM), optical microscopy (OM), thermal gravimetric analysis (TGA) and X-ray diffraction (XRD). FTIR spectra showed surface adsorption of gelatin molecules by using BHP stacked sheets due to CH2 stretching, CH2 bending and amide I vibrations are found in a gelatin content of about 2% determined by dissolution. SEM shows various crystal morphologies of the BHP/gelatin composites forming bundled micro-flakes to irregular bundled needles and spheres different from gel-free crystals. The variety in morphology depends on the ion concentration, pH of gel as well as the method of crystal growth. SPEM investigation of BHP/gelatin aggregates revealed polar domains showing alteration of the polarization. Moreover, BHP/gelatin composite crystals showed a higher thermal stability in comparison with analytical grade BHP or/and BHP single crystals due to strong interactions between gelatin and BHP. The XRD diffraction analysis demonstrated that the single and double diffusion techniques in gelatin led to the formation of orthorhombic BHP. This study demonstrates that gelatin is a useful high molecular weight biomacromolecule for controlling the crystallization of a composite material by producing a variety of morphological forms. PMID:24996024

  14. Magnetic properties of barium ferrite dispersed within polystyrene-butadiene-styrene block copolymers.

    Science.gov (United States)

    Chipara, M; Skomski, R; Ali, N; Hui, D; Sellmyer, D J

    2009-06-01

    Magnetic properties of nanocomposite materials obtained by dispersing barium ferrite nanoparticles within polystyrene-butadiene-styrene block copolymer, in the temperature range, 300 to 500 K are reported. The temperature dependence of the magnetization at saturation, averaged uniaxial magnetocrystalline anisotropy, and coercive field of thick films are analyzed. A "matrix effect" was noticed within the glass transition range of the hard component (polystyrene) of the polymeric matrix. The reported modifications of the magnetic properties were assigned to the competition between the magnetic and mechanical reorientation of nanoparticles within the polymeric matrix. Such modifications were not observed in barium ferrite dispersed in cement. PMID:19504902

  15. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate

    Indian Academy of Sciences (India)

    P Sarah; S V Suryanarayana

    2003-12-01

    Piezoelectric 3–0 composite ceramics are prepared from a mixture of barium titanate and lithium ferrite phase constituents. Dielectric properties of composites are affected by a number of parameters that include electrical properties, size, shape and amount of constituent phases. The frequency dependent measurements can provide additional insight into mechanisms controlling electrical response. Frequency dependence of dielectric constant plots of lithium ferrite/barium titanate composites will be given and the relevance of trends seen in them will be discussed. Connectivity in composites developed is studied.

  16. The structural properties of barium cobalt hexaferrite powder prepared by a simple heat treatment method

    Science.gov (United States)

    Chauhan, Chetna; Jotania, Rajshree

    2016-05-01

    The W-type barium hexaferrite was prepared using a simple heat treatment method. The precursor was calcinated at 650°C for 3 hours and then slowly cooled to room temperature in order to obtain barium cobalt hexaferrite powder. The prepared powder was characterised by different experimental techniques like XRD, FTIR and SEM. The X-ray diffractogram of the sample shows W-and M phases. The particle size calculated by Debye Scherrer formula. The FTIR spectra of the sample was taken at room temperature by using KBr pallet method which confirms the formation of hexaferrite phase. The morphological study on the hexaferrite powder was carried out by SEM analysis.

  17. Growth conditions effect on growth strips in barium-strontium niobate crystals

    International Nuclear Information System (INIS)

    The growth bands appeared due to a change of the instantaneous growth rate are studied in the crystals of solid solution of barium and strontium niobates obtained by the method of Chokhral'skii. Instability of thermal conditions in the crystallization front leading to a change of the instantaneous growth rate is caused by several factors: insufficient accuracy in keeping the operating temperature, the presence of convection, displacement of crystallization front in an inhomogeneous thermal field, for instance when crystal rotates. Considered are the ways of diminiching the temperature vibrations in a melt and found are the conditions for obtaining optically homogeneous monocrystals of barium-strontium niobate

  18. Barium meal examination of infants under four months of age presenting with vomiting

    International Nuclear Information System (INIS)

    One hundred barium meal examinations performed on infants of less than 4 months of age are reviewed. All the infants presented with vomiting as a major symptom and the diagnosis remained in doubt following the initial clinical assessment. Fifty seven per cent of the examinations showed an abnormality of which 45% were throught to be significant. Hypertrophic pyloric stenosis was demonstrated in 23 infants. Other abnormalities included hiatus hernia, gastrooesophageal reflux, and duodenal abnormalities. The value of barium meal examinations in this group of infants is emphasised. (orig.)

  19. Barium meal examination of infants under four months of age presenting with vomiting

    Energy Technology Data Exchange (ETDEWEB)

    Arthur, R.J.; Ziervogel, M.A.; Azmy, A.F.

    1984-02-01

    One hundred barium meal examinations performed on infants of less than 4 months of age are reviewed. All the infants presented with vomiting as a major symptom and the diagnosis remained in doubt following the initial clinical assessment. Fifty seven per cent of the examinations showed an abnormality of which 45% were throught to be significant. Hypertrophic pyloric stenosis was demonstrated in 23 infants. Other abnormalities included hiatus hernia, gastrooesophageal reflux, and duodenal abnormalities. The value of barium meal examinations in this group of infants is emphasised.

  20. Temperature-Dependent Raman Spectra and Microstructure of Barium Metaborate Crystals and Its Melts

    Institute of Scientific and Technical Information of China (English)

    尤静林; 蒋国昌; 侯怀宇; 吴永全; 陈辉; 徐匡迪

    2002-01-01

    We have measured the Raman spectra of β- and α-barium metaborate in crystal and liquid states from room temperature to 1873K, with a semiconductor laser as the laser source, coupled with a time-resolved detection system to eliminate the dense thermal emission background when temperature was considerably high.Temperature-dependent Raman spectra can clearly indicate that the phase transformation from β- to α-barium metaborate has been completed during 1273 - 1300 K. Variations of different kinds of microstructure units with temperature are identified and discussed.

  1. Calcium barium niobate as a functional material for broadband optical frequency conversion.

    Science.gov (United States)

    Sheng, Yan; Chen, Xin; Lukasiewicz, Tadeusz; Swirkowicz, Marek; Koynov, Kaloian; Krolikowski, Wieslaw

    2014-03-15

    We demonstrate the application of as-grown calcium barium niobate (CBN) crystal with random-sized ferroelectric domains as a broadband frequency converter. The frequency conversion process is similar to broadband harmonic generation in commonly used strontium barium niobate (SBN) crystal, but results in higher conversion efficiency reflecting a larger effective nonlinear coefficient of the CBN crystal. We also analyzed the polarization properties of the emitted radiation and determined the ratio of d32 and d33 components of the second-order susceptibility tensor of the CBN crystal. PMID:24690779

  2. Chemical composition of nanomodified composite binder with nano- and microsized barium silicate

    Directory of Open Access Journals (Sweden)

    KOROLEV Evgenij Valerjevich

    2014-08-01

    Full Text Available There are several possibilities to improve cement-based binders. In particular, many properties of cement stone can be enhanced by means of micro- and nanoscale modification. In a number of previous works we had shown that application of barium hydrosilicates leads to such improvement. The present article is devoted to the investigation of the chemical composition of the cement stone which is modified by means of addition of barium hydrosilicates. The modification was performed on different scales: micro- and nanoscale; the results of simultaneous multi-scale modification are also presented. The examination was carried out with help of different modern research techniques – FT IR spectroscopy, differential thermal analysis and X-ray phase analysis. Identification of the new phases and comparative quantitative assessment of their content are performed. It is found that the use of nano- and micro-sized barium hydrosilicates as additives leads to reduction of portlandite by 27...28%; by means of multi-scale modification it is possible to reduce the content of portlandite much more (by 83.3%. Due to addition of nano- and micro-sized barium-based modifiers both the amount of calcium hydrosilicates in reaction products is enlarged, and structure of the mentioned hydrosilicates is changed (the formation of a fine-grained structure of hydration products takes place. Micro-sized barium hydrosilicates are chemically active additives and promote the formation of an additional quantity of calcium hydrosilicates of type CSH (I. The use of nanoscale barium hydrosilicates promotes the formation of CSH (I and CSH (II calcium hydrosilicates, and also both riversidite and xonotlite. As a result of simultaneous application of nano- and micro-sized barium hydrosilicates the content of CSH (II increases. This can be confirmed by means of differential thermal and X-ray analysis. The amount of CSH (I, riversidite and various tobermorites is also increases. It is

  3. Effects of oleic acid on the high threshold barium current in seabass Dicentrarchus labrax ventricular myocytes

    OpenAIRE

    Chatelier, Aurelien; Imbert, Nathalie; Zambonino, Jose-luis; McKenzie, David; Bois, P.

    2006-01-01

    The present study employed a patch clamp technique in isolated seabass ventricular myocytes to investigate the hypothesis that oleic acid (OA), a mono-unsaturated fatty acid, can exert direct effects upon whole-cell barium currents. Acute application of free OA caused a dose-dependent depression of the whole-cell barium current that was evoked by a voltage step to 0 mV from a holding potential of -80 mV. The derived 50% inhibitory concentration (IC50) was 12.49 +/- 0.27 mu mol l(-1). At a con...

  4. Synthesis, characterization and thermostability of barium β-diketonate with tetraethylenepentamine ligand

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    The metal-organic chemical vapor deposition (MOCVD) technique is a promising process for high-temperature superconductor YBa2Cu3O7-δ(YBCO) preparation. In this technique, it is a challenge to obtain barium precursors with high volatility. In addition, the purity, evaporation characteristics and thermostability of adopted precursors in the whole process would decide the quality and reproducible results of YBCO film. In the present report, the barium precursor containing 2,2,6,6-tetramethylheptane-3,5-dionate...

  5. The structural and magnetic properties of barium ferrite powders prepared by the sol-gel method

    Institute of Scientific and Technical Information of China (English)

    Li Jie; Zhang Huai-Wu; Li Yuan-Xun; Liu Ying-Li; Ma Yan-Bing

    2012-01-01

    In this paper,M-type hexagonal barium ferrite powders are synthesized using the sol-gel method.A dried precursor heated in air is analyzed in the temperature range from 50 to 1200 ℃ using thermo-gravimetric analysis and differential scanning calorimetry. The effects of the additives and the cacinating temperature on the magnetic properties are investigated,and the results show that single-phase barium ferrite powders can be formed. After heat-treating at 950 ℃ for 4h with 3 wt% additive,the coercivity and saturation magnetization are found to be 440 Oe and 57.9 emu/g,respectively.

  6. Matrix Remodeling Promotes Pulmonary Hypertension through Feedback Mechanoactivation of the YAP/TAZ-miR-130/301 Circuit

    Directory of Open Access Journals (Sweden)

    Thomas Bertero

    2015-11-01

    Full Text Available Pulmonary hypertension (PH is a deadly vascular disease with enigmatic molecular origins. We found that vascular extracellular matrix (ECM remodeling and stiffening are early and pervasive processes that promote PH. In multiple pulmonary vascular cell types, such ECM stiffening induced the microRNA-130/301 family via activation of the co-transcription factors YAP and TAZ. MicroRNA-130/301 controlled a PPARγ-APOE-LRP8 axis, promoting collagen deposition and LOX-dependent remodeling and further upregulating YAP/TAZ via a mechanoactive feedback loop. In turn, ECM remodeling controlled pulmonary vascular cell crosstalk via such mechanotransduction, modulation of secreted vasoactive effectors, and regulation of associated microRNA pathways. In vivo, pharmacologic inhibition of microRNA-130/301, APOE, or LOX activity ameliorated ECM remodeling and PH. Thus, ECM remodeling, as controlled by the YAP/TAZ-miR-130/301 feedback circuit, is an early PH trigger and offers combinatorial therapeutic targets for this devastating disease.

  7. Double-beta decay of $^{130}$Te to the first 0$^{+}$ excited state of $^{130}$Xe with CUORICINO

    CERN Document Server

    Andreotti, E; Avignone, F T; Balata, M; Bandac, I; Barucci, M; Beeman, J W; Bellini, F; Brofferio, C; Bryant, A; Bucci, C; Canonica, L; Capelli, S; Carbone, L; Carrettoni, M; Clemenza, M; Cremonesi, O; Creswick, R J; Di Domizio, S; Dolinski, M J; Ejzak, L; Faccini, R; Farach, H A; Ferri, E; Fiorini, E; Foggetta, L; Giachero, A; Gironi, L; Giuliani, A; Gorla, P; Guardincerri, E; Gutierrez, T D; Haller, E E; Kazkaz, K; Kogler, L; Kraft, S; Maiano, C; Martinez, C; Martinez, M; Maruyama, R H; Newman, S; Nisi, S; Nones, C; Norman, E B; Nucciotti, A; Orio, F; Pallavicini, M; Palmieri, V; Pattavina, L; Pavan, M; Pedretti, M; Pessina, G; Pirro, S; Previtali, E; Risegari, L; Rosenfeld, C; Rusconi, C; Salvioni, C; Sangiorgio, S; Schaeffer, D; Scielzo, N D; Sisti, M; Smith, A R; Tomei, C; Ventura, G; Vignati, M

    2011-01-01

    The CUORICINO experiment was an array of 62 TeO$_{2}$ single-crystal bolometers with a total $^{130}$Te mass of $11.3\\,$kg. The experiment finished in 2008 after more than 3 years of active operating time. Searches for both $0\

  8. Growth rate controlled barium partitioning in calcite and aragonite

    Science.gov (United States)

    Goetschl, Katja Elisabeth; Mavromatis, Vasileios; Baldermann, Andre; Purgstaller, Bettina; Dietzel, Martin

    2016-04-01

    The barium (Ba) content and the Ba/Ca molar ratios in biogenic and abiotic carbonates have been widely used from the scientific community as a geochemical proxy especially in marine and early diagenetic settings. The Ba content of carbonate minerals has been earlier associated to changes in oceanic circulation that may have been caused by upwelling, changes in weathering regimes and river-runoff as well as melt water discharge. The physicochemical controls of Ba ion incorporation in the two most abundant CaCO3 polymorphs found in Earth's surface environments, i.e. calcite and aragonite, have adequately been studied only for calcite. These earlier studies (i.e. [1]) suggest that at increasing growth rate, Ba partitioning in calcite is increasing as well. In contrast, to date the effect of growth rate on the partitioning of Ba in aragonite remains questionable, despite the fact that this mineral phase is the predominant carbonate-forming polymorph in shallow marine environments. To shed light on the mechanisms controlling Ba ion uptake in carbonates in this study we performed steady-state Ba co-precipitation experiments with calcite and aragonite at 25°C. The obtained results for the partitioning of Ba in calcite are in good agreement with those reported earlier by [1], whereas those for aragonite indicate a reduction of Ba partitioning at elevated aragonite growth rates, with the partitioning coefficient value between solid and fluid to be approaching the unity. This finding is good agreement with the formation of a solid solution in the aragonite-witherite system, owing to the isostructural crystallography of the two mineral phases. Moreover, our data set provides new insights that are required for reconstructing the evolution of the Ba content of pristine marine versus diagenetically altered carbonate minerals commonly occurring in marine subfloor settings, as the thermodynamically less stable aragonite will transform to calcite enriched in Ba, whilst affecting

  9. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage.

    Science.gov (United States)

    Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J

    2012-01-01

    Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3). PMID:22233912

  10. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    CERN Document Server

    Anderson, NG; Firsching, M; de Ruiter, N; Schleich, N; Butzer, J S; Cook, N J; Grasset, R; Campbell, M; Scott, N J A; Anderson, N G

    2010-01-01

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 A mu A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct f...

  11. The Precipitation Process of Liquid Wastes Containing Contaminant Am withBarium Sulfate

    International Nuclear Information System (INIS)

    The investigated of the reduction volume liquid wastes containing ofAmericium nuclide contaminant has been done. The reduction volume was done byadding barium sulfate coagulant. The experimental procedure that has beendone by adding regent of barium nitrate and natrium sulfate to the wasteswith its preadjusted pH, then by utilizing the jar test equipment was carriedout the fast stirring speed for 5 minutes and the gentle agitation for 30minutes, therefor its floc and supernatant will be formed. The resultedbarium sulfate floc will trap radionuclide in the wastes. The Variableinvestigated were: the concentration of barium sulfate, pH of the wastes, theflash mixing rate, the gentle agitation rate. The investigated barium sulfateconcentration variable was started from 100 ppm up to 800 ppm. Theinvestigated pH variable was started from pH 7 up to pH 13. The investigatedflash mixing rate were 75, 100, 125, 150, 175, 200, 225, 250 rpm. Theinvestigated gentle agitation variable were 20, 30, 40, 50 rpm. The bestresult which was represented by decontaminating factor (DF) was found frombarium sulfate concentration of 300 ppm and pH 11, and the flash mixing rateof 200 rpm and the gentle agitation rate of 20 rpm, with the separationefficiency = 97.2 %. (author)

  12. Barium enema findings (segmental colitis) in four neonates with bloody diarrhea - possible cow's milk allergy

    International Nuclear Information System (INIS)

    Four neonates with sudden onset of bloody diarrhea and barium enema findings suggestive of segmental colitis are reported. The infants were not very ill and in all four, the condition was self-limiting. An exact etiology for the condition was not determined but in all of the infants a possible association with cow's milk intolerance was suggested. (orig.)

  13. Study of structural, ferromagnetic and ferroelectric properties of nanostructured barium doped Bismuth Ferrite

    International Nuclear Information System (INIS)

    Nanostructured multiferroic Bi(1−x)BaxFeO3x=0.0, 0.1, 0.2 were prepared by hydrothermal technique. All samples belonged to the rhombohedrally distorted perovskite structure. The morphology of the particles changed with the doping of barium. Effect of barium doping on the dielectric constant was studied over a wide frequency range of 1000 Hz–1 MHz. The activation energy due to relaxation and due to conduction was measured from the Cole Cole plot and the AC conductivity versus frequency plot respectively. The activation energy estimated from both the studies was close to each other. The activation energy also enhanced with the increase in the barium content. The magnetization at the highest available field (∼1.6 T) increased from 0.05 emu/g for the sample with x=0.0–12 emu/g for the sample with x=0.2. The magnetic measurements show a significant increase in magnetization around 400 °C. Remnant polarization for x=0.0 was negligible and it increased to 0.06 µC/cm2 for x=0.2. - Highlights: • Bismuth Ferrite nanostructures were synthesized by the hydrothermal technique. • Barium was doped in Bismuth site. • Morphology changed with doping. • Ferromagnetic, Ferroelectric and Dielectric properties enhanced with doping. • An unreported magnetic transition due to spin canting was observed near 550 °C

  14. PROPOSED ORAL REFERENCE DOSE (RFD) FOR BARIUM AND COMPOUNDS (Final Report) 2004

    Science.gov (United States)

    This document is the final report for the 2004 external peer review of the Proposed Oral Reference Dose (RfD) for Barium and Compounds, prepared by the U.S. Environmental Protection Agency (EPA), National Center for Environmental Assessment (NCEA), for the Integrated Risk Informa...

  15. Magnetic studies of cobalt doped barium hexaferrite nanoparticles prepared by modified sol-gel method

    Science.gov (United States)

    Shalini, M. Govindaraj; Sahoo, Subasa C.

    2016-05-01

    M-type barium hexaferrite (BaFe12O19) and cobalt doped barium hexaferrite (BaFe11CoO19) nanopowders were synthesized by modified sol-gel auto-combustion technique and were annealed at 900°C in air for 4 hours. The annealed powders were studied in the present work and X-ray diffraction studies showed pure phase formation after annealing. The average grain size in the nanopowder sample was decreased after doping. Magnetization value of 60 emu/g was observed at 300K for the barium hexaferrite and was reduced to 54 emu/g after doping. The coercivity of 5586 Oe was observed at 300K for the undoped sample and was found to be decreased in the doped sample. As the measurement temperature was decreased from 300K to 60K, magnetization value was increased in both the samples compared to those at 300K. The coercivity of the undoped sample was found to decrease whereas it was increased for the doped sample at 60K. The observed magnetic properties may be understood on the basis of modified exchange interaction and anisotropy in the doped sample compared to that of pure barium hexaferrite.

  16. WEAK-ACID ION EXCHANGE FOR REMOVING BARIUM, RADIUM, AND HARDNESS

    Science.gov (United States)

    Weak-acid resin in the hydrogen form was found to effectively remove barium, radium, and hardness, without increasing the sodium content of the product water. The maximum capacity of the weak-acid resin was about 2.3 times that of strong-acid resin, and much less spent regenerant...

  17. BARIUM BIOAVAILABILITY AS THE CHLORIDE, SULFATE, OR CARBONATE SALT IN THE RAT

    Science.gov (United States)

    This study was conducted to determine how the bioavailability of a low concentration of barium (Ba) in drinking water is affected by anion speciation. Male Sprague Dawley rats weighing 250-300 grams were maintained on a diet of less than 1 mg Ba/kg of food for at least 1 month pr...

  18. Effects of illumination on the dielectric response of barium-strontium niobate ceramics

    International Nuclear Information System (INIS)

    A study of the effects of white light on the low and infra-low frequency relaxation of polarization in the barium-strontium niobate (SBN) ceramics is reported. The light is found considerably decreasing the contribution of space charge at temperatures corresponding to the range of the relaxor phase (it is, around the Tm)

  19. A plasmonic modulator based on metal-insulator-metal waveguide with barium titanate core

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Lavrinenko, Andrei

    2013-01-01

    We design a plasmonic modulator which can be utilized as a compact active device in photonic integrated circuits. The active material, barium titanate (BaTiO3), is sandwiched between metal plates and changes its refractive index under applied voltage. Some degree of switching of ferroelectric...

  20. Barium responsiveness of the rat aorta and femoral artery during pregnancy.

    Science.gov (United States)

    Hart, J L

    1982-01-11

    The barium responses of isolated aortic strips and femoral arteries from non-pregnant and pregnant rats were investigated. Barium caused concentration-related increases in tension of vessels from both pregnant and non-pregnant rats. The concentration-response curves of femoral arteries from non-pregnant and 3 week pregnant rats were not different; however contractility and slopes of concentration-response lines for thoracic aortas from 1, 2 and 3 week pregnant rats were significantly less than those of aortas from non-pregnant rats. In addition, barium caused rhythmic contractions to develop in both femoral arteries and aortas of 3 week pregnant rats more frequently than vessels from non-pregnant rats. Rhythmic contractions did not develop in aortas from 3 week pregnant rats in calcium-free Krebs. Since the effects of barium on the electrical and mechanical activity of various muscles have been postulated to be similar to and/or dependent on calcium, these results may indicate that changes in calcium sensitivity of vascular smooth muscle occur during pregnancy. Such changes may contribute to the blood flow redistribution and other cardiovascular adaptations of pregnancy. PMID:7054642

  1. Adsorption of Pb(II) present in aqueous solution on calcium, strontium and barium hydroxy apatites

    International Nuclear Information System (INIS)

    Calcium, strontium and barium hydroxy apatites were successfully synthesized by chemical precipitation method, the obtained powders were characterized by the techniques of X-ray diffraction (XRD), scanning electron microscopy (Sem), semi-quantitative elemental analysis (EDS), infrared spectroscopy (IR), and N2 physisorption studies, complementary to these analytical techniques, was determined the surface fractal dimension (Df), and the amount of surface active sites of the materials, in order to know application as ceramic for water remediation. The ability of Pb(II) ion adsorption present in aqueous solution on the hydroxy apatites synthesized by batch type experiments was studied as a function of contact time, concentration of the adsorbate and temperature. The maximum lead adsorption efficiencies obtained were 0.31, 0.32 and 0.26 mg/g for calcium, strontium and barium hydroxy apatites respectively, achieved an equilibrium time of 20 minutes in the three solid-liquid systems studied. Experimental data were adequately adjusted at the adsorption kinetic model pseudo-second order, for the three cases. Moreover, experimental data of the strontium and calcium hydroxy apatites were adjusted to the Langmuir adsorption isotherm, indicating that the adsorption was through a monolayer, whereas barium hydroxyapatite was adjusted to the Freundlich adsorption isotherm, indicating a multilayer adsorption. The thermodynamic parameters obtained during adsorption studies as a function of temperature showed physisorption, exothermic and spontaneous processes respectively. The results showed that the calcium hydroxyapatite, strontium and barium are an alternative for the Pb(II) ion adsorption present in wastewaters. (Author)

  2. Barium versus Nonbarium Stimuli: Differences in Taste Intensity, Chemesthesis, and Swallowing Behavior in Healthy Adult Women

    Science.gov (United States)

    Nagy, Ahmed; Steele, Catriona M.; Pelletier, Cathy A.

    2014-01-01

    Purpose: The authors examined the impact of barium on the perceived taste intensity of 7 different liquid tastant stimuli and the modulatory effect that these differences in perceived taste intensity have on swallowing behaviors. Method: Participants were 80 healthy women, stratified by age group (60) and genetic taste status…

  3. A comparison of radiographer and radiologist reports on radiographer conducted barium enemas

    International Nuclear Information System (INIS)

    Purpose: To compare radiographer and radiologist reports on radiographer conducted barium enemas. Method: Two specially trained, experienced radiographers performed barium enemas and prepared provisional reports without consulting radiologists. Later, formal radiologist reports were issued. The reports of each were compared and correlated with clinical findings derived from case note review. Results:Seven hundred and eighty eight patients had barium enemas. Males numbered 295 (37.5%) and females 493 (62.5%). Patients ages ranged from 17 to 95 years (mean 62). The radiologist reported 244 as normal, 432 as diverticular change, 70 with polyps (31 of which had co-existent diverticular disease), 31 with carcinomas and 12 with colitis (three of which had co-existent diverticular disease). Taking the radiologist reports as gold-standard radiographer reports were concordant in 753 (95.5%). There were 35 (4.5%) discordant radiographer reports of these 19 were false-positive diagnoses of polyps and six false positive diagnoses of diverticular change. There were seven false-negative diagnoses of polyps (only one of these was found to have a polyp at follow-up endoscopy). There was one false-negative diagnosis of colitis and two false-negative reports of diverticular change. On follow up there were no false negative diagnoses of carcinoma by either radiographer or radiologist. There was one concordant false-positive diagnosis of carcinoma. Conclusion:Radiographers with specialized training can report barium enemas to a high standard

  4. The precipitation of radioactive radium-226 from acidic chloride leach liquors with barium chloride

    International Nuclear Information System (INIS)

    The conventional barium chloride (BaClsub(2)) precipitation has been effective in the 99+ percent removal of radium-226 as radium-barium sulphate [RaBa(SOsub(4))sub(2)] sludge, from HCl liquors produced by laboratory and pilot leaches of Canadian uranium ores. Radium-226, due to its low-level radiation characteristics, is removed as it has been identified as an environmental and long-term health problem. The formation of the RaBa(SOsub(4))sub(2) sludge was aided due to adequate sulphate (SOsub(4)) concentrations in the HCl pilot liquors produced. Recyclable Rasup(226) concentrations of about 66 pCi/L, in treated effluents, will cost about 1/10 that of effluents below federal environmental guidelines of 10 pCi Rasup(226)/L. Toxic barium (Ba) will potentially build up in effluents as recyclable Rasup(226) concentrations around 66 pCi/L. Barium, in addition to being added to liquors as BaClsub(2) precipitant, is present in the radioactive ore and HCl leach liquors

  5. Synthesis and characterization of barium titanate, doped with europium and neodymium

    International Nuclear Information System (INIS)

    This work aims at synthesize and characterize mixed oxides in Barium Titanium matrix in doping with Neodymium and Europium analyzing thermogravimetric curves, characteristic bands at infrared region of the polymer complex, which are intermediates to mixed oxides, and identify the formation thereof, and the crystallinity using XRD analysis

  6. Periodate salts as pyrotechnic oxidizers: development of barium- and perchlorate-free incendiary formulations.

    Science.gov (United States)

    Moretti, Jared D; Sabatini, Jesse J; Chen, Gary

    2012-07-01

    In a flash: pyrotechnic incendiary formulations with good stabilities toward various ignition stimuli have been developed without the need for barium or perchlorate oxidizers. KIO(4) and NaIO(4) were introduced as pyrotechnic oxidizers and exhibited excellent pyrotechnic performance. The periodate salts may garner widespread use in military and civilian fireworks because of their low hygroscopicities and high chemical reactivities. PMID:22639415

  7. Structure and properties of hard-magnetic barium, strontium and lead ferrites

    International Nuclear Information System (INIS)

    Structure and properties of compact articles of magnetically hard barium, strontium and lead ferrites produced by self-propagating high-temperature synthesis (SHS) are under study. Ferrites of carious structural defect density and internal microstresses are obtained by varying ferritizing (burning) temperature and comminution time. It is states that powder activity has a favourable effect on electromagnetic and mechanical properties of ferrites

  8. Low temperature phase barium borate: A new optical limiter in continuous wave and nano pulsed regime

    Science.gov (United States)

    Babeela, C.; Girisun, T. C. Sabari

    2015-11-01

    Low temperature phase barium borate was synthesized by hydrothermal method. XRD analysis confirms the formation of γ-BBO or hydrated barium polyborate (Ba3B6O9(OH)6) which crystallizes in monoclinic system in the P2/c space group. The molecular structure analysis shows the presence of dominant BO4 unit and the hydrated nature of material. γ-BBO exhibits sharp absorption edge at 202 nm and highly transparency in the UV-Visible-NIR region. The peak at 347 nm in the emission spectrum is due to the presence of self-trapped exciton. The third order nonlinear optical properties and limiting behavior of low temperature barium borate in both pulsed and continuous wave regime were studied. The effective 2PA absorption coefficient of γ-BBO under ns pulse excitation is estimated to be 0.38 × 10-10 m/W. The nonlinear absorption coefficient, refractive index and optical susceptibility of the material in cw regime were found to be in the order of 10-5 m W-1, 10-12 m2 W-1, 10-6 esu respectively. In both regimes, low temperature phase barium borate exhibits better optical limiting properties than high temperature phase β-BBO.

  9. Barium borosilicate glass as a matrix for the uptake of dyes

    International Nuclear Information System (INIS)

    Barium borosilicate (BBS) and sodium borosilicate (SBS) glass samples, prepared by the conventional melt-quench method, were used for the uptake of Rhodamine 6G dye from aqueous solution. The experimental conditions were optimized to get maximum uptake and was found to be 0.4 mg of dye per gram of BBS glass sample. For the same network former to modifier ratio, barium borosilicate glasses are found to have improved extent of uptake for the dye molecules from aqueous solutions compared to sodium borosilicate glasses. Based on 29Si MAS NMR studies on these glasses, it is inferred that significantly higher number of non-bridging oxygen atoms present in barium borosilicate glasses compared to sodium borosilicate glasses is responsible for its improved uptake of Rhodamine 6G dye. 11B MAS NMR studies have confirmed the simultaneous existence of boron in BO3 and BO4 configurations in both barium borosilicate and sodium borosilicate glasses. The luminescence studies have established that the dye molecule is incorporated into the glass matrix through ion exchange mechanism by replacing the exchangeable ions like Na+/Ba2+ attached with the non-bridging oxygen atoms present in the glass.

  10. Esophageal Transit Scintigraphy, Manometry, and Barium Swallow in Assessment of Response to Balloon Dilatation in Achalasia

    Directory of Open Access Journals (Sweden)

    M.J. Ehsani Ardakani

    2006-08-01

    Full Text Available Background/Objective: Achalasia is a motility disorder of unknown etiology, characterized by absent esophageal peristalsis and loss of lower esophageal sphincter relaxation. Balloon dilatation is the most effective non-surgical treatment for patients with achalasia. Manometry, scintigraphy and radiology are three techniques that provide an objective measure of success after balloon dilatation. The objective of this study was to determine the best predictor of success after balloon dilatation in patients with achalasia. Patients and Methods: 17 patients with achalasia of cardia who referred to Taleghani Hospital in 2003, were evaluated, both symptomatically and objectively (esophageal manometry, timed barium esophagogram, and scintigraphic emptying index, before and after treating with pneumatic dilatation of esophagus. The degree of patient symptom improvements after treat-ment was recorded and correlated with improvement in some indices derived by the above-mentioned three methods. Results: 12 (70.6% of 17 patients had score improvements of ≥80%. All the pre-treatment diagnostic indices were significantly (P<0.05 different from those after therapy. There was no significant difference between the two groups in terms of improvement in symptoms according to the indices of barium swallow or scintigraphy. No association between the patient symptom scores and improvement in either the barium height or emptying index was found. Conclusion: In evaluation of efficacy of pneumatic dilatation of esophagus for treatment of achalasia, we should not only rely on transit or barium study.

  11. Physical and biological dosimetry at the barium sulphate-culture medium interface

    International Nuclear Information System (INIS)

    The present study suggests that a thin layer of Barium sulphate suspension forms an interface with tissues which results in high dose regions on both sides of the BSS-tissue interface when irradiated with 250 kVp X rays. The magnitude of dose increase depends on the density of the BSS. (U.K.)

  12. Assessment of barium sulphate formation and inhibition at surfaces with synchrotron X-ray diffraction (SXRD)

    International Nuclear Information System (INIS)

    The precipitation of barium sulphate from aqueous supersaturated solutions is a well-known problem in the oil industry often referred to as 'scaling'. The formation and growth of barite on surfaces during the oil extraction process can result in malfunctions within the oil facilities and serious damage to the equipment. The formation of barium sulphate at surfaces remains an important topic of research with the focus being on understanding the mechanisms of formation and means of control. In situ synchrotron X-ray diffraction (SXRD) was used to investigate the formation of barium sulphate on a stainless steel surface. The effect of Poly-phosphinocarboxylic acid (PPCA) and Diethylenetriamine-penta-methylenephosphonic acid (DETPMP) which are two commercial inhibitors for barium sulphate was examined. The in situ SXRD measurements allowed the identification of the crystal faces of the deposited barite in the absence and presence of the two inhibitors. The preferential effect of the inhibitors on some crystal planes is reported and the practical significance discussed.

  13. 9 CFR 130.50 - Payment of user fees.

    Science.gov (United States)

    2010-01-01

    ..., testing, certification or quarantine of animals, animal products or other commodities. 3 Monday-Saturday... commuted travel time.) 3 See § 97.1(a) of this chapter or 7 CFR 354.3 for details. 4 See § 97.1(a)(3) of... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Payment of user fees. 130.50...

  14. Possible discovery of the r-process characteristics in the abundances of metal-rich barium stars

    CERN Document Server

    Cui, W Y; Shi, J R; Zhao, G; Wang, W J; Niu, P

    2014-01-01

    We study the abundance distributions of a sample of metal-rich barium stars provided by Pereira et al. (2011) to investigate the s- and r-process nucleosynthesis in the metal-rich environment. We compared the theoretical results predicted by a parametric model with the observed abundances of the metal-rich barium stars. We found that six barium stars have a significant r-process characteristic, and we divided the barium stars into two groups: the r-rich barium stars ($C_r>5.0$, [La/Nd]\\,$<0$) and normal barium stars. The behavior of the r-rich barium stars seems more like that of the metal-poor r-rich and CEMP-r/s stars. We suggest that the most possible formation mechanism for these stars is the s-process pollution, although their abundance patterns can be fitted very well when the pre-enrichment hypothesis is included. The fact that we can not explain them well using the s-process nucleosynthesis alone may be due to our incomplete knowledge on the production of Nd, Eu, and other relevant elements by the ...

  15. Fabrication and electrical characterization of 15% yttrium-doped barium zirconate-nitrate freeze drying method combined with vacuum heating

    International Nuclear Information System (INIS)

    Research highlights: → Very fine 15% yttrium-doped barium zirconate powder of particle size about 30 nm was obtained by synthesizing at 500 deg. C in vacuum from powder mixed by the nitrate freeze-drying method. → Large and homogeneous grains of 15% yttrium-doped barium zirconate were easily obtained using the synthesized powder. → Grain boundary resistance was not inversely proportional to the grain size as theoretically expected. → Specific grain boundary conductivity varies with samples because impurities and/or evaporation loss of barium oxide might affect the grain-boundary resistance in 15% yttrium-doped barium zirconate. - Abstract: We applied a nitrate freeze-drying method to obtain a fine synthesized powder of 15% yttrium-doped barium zirconate. Fine 15% yttrium-doped barium zirconate powder of particle size about 30 nm was obtained by synthesizing at 500 deg. C in vacuum from a powder mixed by the nitrate freeze-drying method. However, we could not obtain such fine powder by synthesizing in air. Using the powder synthesized in vacuum, large and homogeneous grains of 15% yttrium-doped barium zirconate were easily obtained after sintering. Then, the bulk and grain boundary resistance were evaluated by AC 2-terminal measurement of sample in the form of bar and pellet and DC 4-terminal measurement of bar-shape sample. The grain boundary resistance was not inversely proportional to the grain size as theoretically expected. We concluded that specific grain boundary conductivity varies with samples. Some impurities, evaporation loss of barium oxide and/or other unexpected reasons might affect the grain boundary resistance in 15% yttrium-doped barium zirconate.

  16. Barium and neodymium isotopic anomalies in the Allende meteorite

    Science.gov (United States)

    Mcculloch, M. T.; Wasserburg, G. J.

    1978-01-01

    The discovery of Ba and Nd isotopic anomalies in two inclusions from the Allende meteorite is reported. The inclusions are Ca-Al-rich objects typical of the type considered as high-temperature condensation products in the solar nebula and contain distinctive Mg and O isotopic anomalies of the FUN (mass Fractionation, Unknown Nuclear processes) type. Mass-spectrometry results are discussed which show that inclusion C1 has anomalies in Ba at masses 134 and 136, while inclusion EK1-4-1 exhibits large marked negative anomalies at 130, 132, 134, and 136, as well as a positive anomaly at 137. It is also found that inclusion EK1-4-1 shows marked negative anomalies in Nd at masses 142, 146, 148, and 150, in addition to a positive anomaly at 145. These isotopic shifts are attributed to addition of r-process nuclei rather than mass fractionation. It is suggested that an onion-shell supernova explosion followed by injection into the solar nebula is the most likely generic model that may explain the observations.

  17. A study of the microchemistry of nanocrystalline barium titanate with tetragonal and pseudocubic room temperature symmetries

    Science.gov (United States)

    Lacey, Robert A.

    The investigation of possible effects of undesired surface species on barium titanate, one of the most utilized ferroelectric ceramics, constitutes the focus of this work. Six commercial barium titanate powders from three manufacturers representing two different synthesis processes, with average particle sizes from 40 nm to 470 nm, were analyzed in this study. Four of the nanopowders exhibited pseudocubic room temperature symmetry. Diffuse Reflectance Infrared Fourier Transform (DRIFT) spectroscopic analysis of the nanopowders was conducted in ambient atmosphere at room temperature. High temperature DRIFT followed incorporating four avenues of analysis: moisture adsorption studies, deuterium oxide exchange studies, carbon dioxide adsorption studies, and high temperature analysis under dry air and UHP nitrogen atmospheres. At the highest temperature used in this study, 1173K, moisture and the accompanying incorporated protonic impurities were still present. The powders readily readsorbed moisture during rapid cooling, 170K/minute, to room temperature. The smallest powder, as received, formed spherical agglomerates up to 10 mum diameter. These sintered as separate units attaining diameters up to 60 mum during intermediate stage sintering. X-ray photoelectron spectroscopy indicated a surface contamination layer of 10 A to 18 A; 50--70% of which was barium carbonate, the balance being atmospheric adsorbed species. Samples cooled at 3K/minute after an 1173K calcine retained cubic symmetry as indicated with high temperature X-ray diffraction. However, spectral evidence was obtained indicating that upon the rapid cooling from the 1173K calcine, a reorientation to the room temperature tetragonal symmetry was observed. Further, SEM and TEM supported this finding with visual evidence of interfacial rearrangement including corroborating electron diffraction analysis. This data, therefore, substantiated the hypothesis that the cause of the room temperature pseudocubic

  18. Influence of barium substitution on bioactivity, thermal and physico-mechanical properties of bioactive glass

    Energy Technology Data Exchange (ETDEWEB)

    Arepalli, Sampath Kumar, E-mail: askumar.rs.cer11@iitbhu.ac.in; Tripathi, Himanshu; Vyas, Vikash Kumar; Jain, Shubham; Suman, Shyam Kumar; Pyare, Ram; Singh, S.P., E-mail: spsinghceram@gmail.com

    2015-04-01

    Barium with low concentration in the glasses acts as a muscle stimulant and is found in human teeth. We have made a primary study by substituting barium in the bioactive glass. The chemical composition containing (46.1 − X) SiO{sub 2−}–24.3 Na{sub 2}O–26.9 CaO–2.6 P{sub 2}O{sub 5}, where X = 0, 0.4, 0.8, 1.2 and 1.6 mol% of BaO was chosen and melted in an electric furnace at 1400 ± 5 °C. The glasses were characterized to determine their use in biomedical applications. The nucleation and crystallization regimes were determined by DTA and the controlled crystallization was carried out by suitable heat treatment. The crystalline phase formed was identified by using XRD technique. Bioactivity of these glasses was assessed by immersion in simulated body fluid (SBF) for various time periods. The formation of hydroxy carbonate apatite (HCA) layer was identified by FTIR spectrometry, scanning electron microscope (SEM) and XRD which showed the presence of HCA as the main phase in all tested bioactive glass samples. Flexural strength and densities of bioactive glasses have been measured and found to increase with increasing the barium content. The human blood compatibility of the samples was evaluated and found to be pertinent. - Highlights: • In vitro bioactivity of soda-lime–baria-phospho-silicate glass was investigated. • HCA formed on surface of glasses was confirmed by XRD, SEM and FTIR spectrometry. • Mechanical properties of glasses were found to increase with barium addition. • Hemolysis showed that 1.2 mol% BaO bioactive glass exhibited better biocompatibility. • Barium substituted bioactive glasses can be used as bone implants.

  19. Influence of barium substitution on bioactivity, thermal and physico-mechanical properties of bioactive glass

    International Nuclear Information System (INIS)

    Barium with low concentration in the glasses acts as a muscle stimulant and is found in human teeth. We have made a primary study by substituting barium in the bioactive glass. The chemical composition containing (46.1 − X) SiO2−–24.3 Na2O–26.9 CaO–2.6 P2O5, where X = 0, 0.4, 0.8, 1.2 and 1.6 mol% of BaO was chosen and melted in an electric furnace at 1400 ± 5 °C. The glasses were characterized to determine their use in biomedical applications. The nucleation and crystallization regimes were determined by DTA and the controlled crystallization was carried out by suitable heat treatment. The crystalline phase formed was identified by using XRD technique. Bioactivity of these glasses was assessed by immersion in simulated body fluid (SBF) for various time periods. The formation of hydroxy carbonate apatite (HCA) layer was identified by FTIR spectrometry, scanning electron microscope (SEM) and XRD which showed the presence of HCA as the main phase in all tested bioactive glass samples. Flexural strength and densities of bioactive glasses have been measured and found to increase with increasing the barium content. The human blood compatibility of the samples was evaluated and found to be pertinent. - Highlights: • In vitro bioactivity of soda-lime–baria-phospho-silicate glass was investigated. • HCA formed on surface of glasses was confirmed by XRD, SEM and FTIR spectrometry. • Mechanical properties of glasses were found to increase with barium addition. • Hemolysis showed that 1.2 mol% BaO bioactive glass exhibited better biocompatibility. • Barium substituted bioactive glasses can be used as bone implants

  20. AFM studies of swift heavy ion and electron irradiated mixed barium strontium borate nonlinear optical crystal

    International Nuclear Information System (INIS)

    Single crystals of novel nonlinear optical material of mixed barium strontium borate is grown in our laboratory by employing the low-temperature solution technique. Equal proportion (1:1 molar ratio) of AR grade barium borate and strontium borate are mixed together in double distilled water to prepare a supersaturated solution. The solution is allowed to evaporate at constant temperature (30 deg. C) in a Petri dish for about a week which resulted in the formation of seed crystals. These seed crystals are used to grow larger crystals by suspending them using fine silk thread in the supersaturated mother solution. The solution is allowed to evaporate at constant temperature. This resulted in the growth of good transparent crystals of dimension 15 mmx10 mmx1 mm after about one month. These crystals show good second harmonic generation (SHG) efficiency. The mixed barium strontium borate crystal is found to be a promising nonlinear optical crystal, which possibly can be used for fabrication of photonic devices. The single crystals of mixed barium strontium borate are irradiated by 120 MeV Ag+13 swift heavy ions (SHI) of fluence 5x1011 ions/cm2 at Nuclear Science Centre, New Delhi and also by electrons of 8 MeV energy with a fluence 5.7x109/cm2 using Microtron accelerator at Mangalore University. Surface morphology studies of these crystals are carried out using atomic force microscope. The AFM topographical images of these SHI/electron irradiated single crystals of mixed barium strontium borate are obtained from different frames of the sample taken at different magnifications using atomic force microscope. An attempt is made to explain the surface damage caused due to SHI/electron irradiation using the observed AFM images